F489096

General Info

Members Datasets Scaffolds Average Seq Length
1052 393 2105 338

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10110095|Ga0207648_101100953
Length 410
Sequence MRPEVNSHQTVRRRDCDVEDLRAPGRDLHGLGLEERIDGPVLLTVFDAPPLQSDDEYLDESLKPPVLDVRWRFVSNIYEVAKRAGVSTATVSRVLSQPNVVAPDTRRKVMAAVERLGYTPNAAATNLRTLRTKKLVVTVPDISNPFFSLILQGIEDAAQREGYSVLLGDTQHDEQREERYALMLRRKEADGLIFLGHRLPKEAAALVRSMPGRAPIVNGCEFSPRLGIPSVHIDNATAAADAMDHLYRLGHRRIGIVTGPLVSPLSRDRLRGATARAKKAGAERDFIVMNGDFSIESGAVAAERLLGRKEPPTAIFCFNDEMAIGVIDTARRRKLRIPNDLSLVGFDDIRFARYTDPPLTTVAQPMRQIGEGTVRLLLEILQGQGSPESVTLPHTLVVRSSTAPPGSLIK

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
206 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
222 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
223 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
234 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
250 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
354 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
355 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
356 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
360 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
366 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
367 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
368 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
369 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
370 2643221593 Lysobacter sp. Root690 Isolate Unclassified
371 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
372 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
373 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
374 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
375 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
376 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
377 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
378 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
379 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
380 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
381 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
382 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
383 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
384 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
385 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
386 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
387 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
388 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
389 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
390 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
391 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
392 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
393 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 0
Isolates 2.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 10.93
Nodule 0
Rhizoplane 2.57
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10110095 3300026089 Bacteria 2418
2 SwRhRL2b_contig_1411923 2162886007 Bacteria 8737
3 SwRhRL2b_contig_3539020 2162886007 Bacteria 24060
4 JGI24739J22299_10010725 3300001989 Bacteria 3397
5 JGI24735J21928_10019568 3300002067 Bacteria 2080
6 JGI24738J21930_10000759 3300002075 Bacteria 9234
7 JGI24749J21850_1000053 3300002076 Bacteria 22163
8 JGI25150J39212_1000224 3300002774 Bacteria 30911
9 JGI25150J39212_1000458 3300002774 Bacteria 17923
10 JGI25151J46595_10000016 3300003187 Bacteria 249712
11 JGI25151J46595_10000057 3300003187 Bacteria 151052
12 JGI25406J46586_10005401 3300003203 Bacteria 5929
13 JGI25153J46596_10000041 3300003215 Bacteria 162103
14 JGI25153J46596_10000198 3300003215 Bacteria 56709
15 rootL2_10081122 3300003322 Bacteria 7015
16 rootL2_10145053 3300003322 Bacteria 4911
17 rootH1_10033773 3300003316 Bacteria 2681
18 rootH1_10033773 3300003323 Bacteria 4965
19 Ga0055526_1000006 3300003771 Bacteria 330857
20 Ga0055526_1005312 3300003771 Bacteria 7460
21 Ga0055537_1000003 3300003773 Bacteria 220933
22 Ga0055537_1000018 3300003773 Bacteria 123452
23 Ga0055537_1000442 3300003773 Bacteria 26526
24 Ga0055537_1000746 3300003773 Bacteria 16605
25 Ga0055524_1000009 3300003775 Bacteria 295254
26 Ga0055536_1006687 3300003781 Bacteria 5303
27 Ga0055536_1007631 3300003781 Bacteria 4798
28 Ga0055534_1000004 3300003784 Bacteria 295251
29 Ga0055534_1001119 3300003784 Bacteria 11371
30 Ga0055528_1000003 3300003790 Bacteria 330875
31 Ga0055528_1000990 3300003790 Bacteria 18873
32 Ga0055530_10000301 3300003791 Bacteria 44944
33 Ga0055530_10007254 3300003791 Bacteria 4713
34 Ga0055530_10009834 3300003791 Bacteria 3612
35 Ga0055540_1001135 3300003792 Bacteria 16601
36 Ga0055531_10004329 3300003794 Bacteria 8685
37 Ga0055531_10007930 3300003794 Bacteria 5695
38 Ga0055531_10007945 3300003794 Bacteria 5687
39 Ga0055531_10008703 3300003794 Bacteria 5303
40 Ga0055531_10009940 3300003794 Bacteria 4802
41 Ga0055531_10022649 3300003794 Bacteria 2385
42 Ga0058692_1000015 3300003856 Bacteria 295729
43 Ga0058692_1000022 3300003856 Bacteria 237321
44 Ga0065165_1002680 3300005262 Bacteria 14354
45 Ga0065165_1004694 3300005262 Bacteria 8220
46 Ga0065165_1006492 3300005262 Bacteria 6115
47 Ga0065165_1016066 3300005262 Bacteria 2821
48 Ga0065704_10000363 3300005289 Bacteria 43914
49 Ga0065704_10070190 3300005289 Bacteria 113837
50 Ga0065704_10105639 3300005289 Bacteria 2105
51 Ga0065712_10000333 3300005290 Bacteria 13723
52 Ga0065712_10106997 3300005290 Bacteria 1905
53 Ga0065715_10004188 3300005293 Bacteria 3801
54 Ga0065707_10003170 3300005295 Bacteria 4599
55 Ga0065707_10082125 3300005295 Bacteria 21290
56 Ga0065707_10092877 3300005295 Bacteria 3704
57 Ga0065707_10198382 3300005295 Bacteria 1322
58 Ga0070676_10004330 3300005328 Bacteria 7459
59 Ga0070676_10257570 3300005328 Bacteria 1167
60 Ga0070683_100013418 3300005329 Bacteria 7146
61 Ga0070683_100160851 3300005329 Bacteria 2131
62 Ga0070690_100006381 3300005330 Bacteria 6683
63 Ga0070690_100218758 3300005330 Bacteria 1334
64 Ga0070690_100289245 3300005330 Bacteria 1171
65 Ga0070670_100001701 3300005331 Bacteria 17909
66 Ga0070670_100004309 3300005331 Bacteria 11908
67 Ga0070670_100022221 3300005331 Bacteria 5460
68 Ga0070670_100023356 3300005331 Bacteria 5322
69 Ga0070670_100085994 3300005331 Bacteria 2702
70 Ga0070670_100164515 3300005331 Bacteria 1923
71 Ga0070670_100179812 3300005331 Bacteria 1836
72 Ga0070677_10050298 3300005333 Bacteria 1682
73 Ga0068869_100003496 3300005334 Bacteria 9623
74 Ga0068869_100136230 3300005334 Bacteria 1892
75 Ga0068869_100248095 3300005334 Bacteria 1421
76 Ga0070666_10043508 3300005335 Bacteria 3008
77 Ga0070666_10068495 3300005335 Bacteria 2412
78 Ga0070666_10070344 3300005335 Bacteria 2380
79 Ga0070666_10115508 3300005335 Bacteria 1859
80 Ga0070680_100368814 3300005336 Bacteria 1221
81 Ga0068868_100297023 3300005338 Bacteria 1371
82 Ga0070689_100032021 3300005340 Bacteria 3998
83 Ga0070689_100032944 3300005340 Bacteria 3946
84 Ga0070689_100038392 3300005340 Bacteria 3664
85 Ga0070689_100039411 3300005340 Bacteria 3617
86 Ga0070689_100074258 3300005340 Bacteria 2661
87 Ga0070691_10003000 3300005341 Bacteria 7560
88 Ga0070691_10010618 3300005341 Bacteria 4206
89 Ga0070687_100012617 3300005343 Bacteria 3738
90 Ga0070687_100013142 3300005343 Bacteria 3679
91 Ga0070687_100090533 3300005343 Bacteria 1691
92 Ga0070687_100152432 3300005343 Bacteria 1358
93 Ga0070661_100012157 3300005344 Bacteria 6019
94 Ga0070692_10056824 3300005345 Bacteria 2050
95 Ga0070692_10071957 3300005345 Bacteria 1844
96 Ga0070668_100017093 3300005347 Bacteria 5428
97 Ga0070669_100001414 3300005353 Bacteria 17346
98 Ga0070669_100017191 3300005353 Bacteria 5160
99 Ga0070669_100027408 3300005353 Bacteria 4099
100 Ga0070669_100029241 3300005353 Bacteria 3972
101 Ga0070669_100058591 3300005353 Bacteria 2827
102 Ga0070669_100082992 3300005353 Bacteria 2389
103 Ga0070669_100374442 3300005353 Bacteria 1160
104 Ga0070675_100001217 3300005354 Bacteria 18706
105 Ga0070675_100001225 3300005354 Bacteria 18657
106 Ga0070675_100002905 3300005354 Bacteria 12915
107 Ga0070675_100008687 3300005354 Bacteria 7888
108 Ga0070675_100019988 3300005354 Bacteria 5343
109 Ga0070675_100039757 3300005354 Bacteria 3839
110 Ga0070675_100052358 3300005354 Bacteria 3356
111 Ga0070675_100076372 3300005354 Bacteria 2786
112 Ga0070675_100162562 3300005354 Bacteria 1921
113 Ga0070675_100442358 3300005354 Bacteria 1165
114 Ga0070671_100000844 3300005355 Bacteria 22305
115 Ga0070671_100005852 3300005355 Bacteria 9796
116 Ga0070671_100009229 3300005355 Bacteria 7922
117 Ga0070674_100002174 3300005356 Bacteria 10782
118 Ga0070674_100190459 3300005356 Bacteria 1578
119 Ga0070674_100312467 3300005356 Bacteria 1257
120 Ga0070673_100091993 3300005364 Bacteria 2480
121 Ga0070673_100148350 3300005364 Bacteria 1984
122 Ga0070673_100179045 3300005364 Bacteria 1814
123 Ga0070673_100342702 3300005364 Bacteria 1325
124 Ga0070688_100002411 3300005365 Bacteria 9438
125 Ga0070688_100003784 3300005365 Bacteria 7841
126 Ga0070688_100031288 3300005365 Bacteria 3201
127 Ga0070688_100050052 3300005365 Bacteria 2602
128 Ga0070688_100180537 3300005365 Bacteria 1464
129 Ga0070659_100113743 3300005366 Bacteria 2186
130 Ga0070667_100061524 3300005367 Bacteria 3179
131 Ga0070667_100307461 3300005367 Unclassified 1428
132 Ga0070667_100409899 3300005367 Bacteria 1234
133 Ga0070713_100027448 3300005436 Bacteria 4482
134 Ga0070701_10012165 3300005438 Bacteria 3872
135 Ga0070701_10141666 3300005438 Bacteria 1376
136 Ga0070705_100000116 3300005440 Bacteria 45853
137 Ga0070705_100003965 3300005440 Bacteria 7232
138 Ga0070705_100032260 3300005440 Bacteria 2909
139 Ga0070700_100005845 3300005441 Bacteria 6532
140 Ga0070700_100072300 3300005441 Bacteria 2204
141 Ga0070700_100176452 3300005441 Bacteria 1483
142 Ga0070700_100256781 3300005441 Bacteria 1256
143 Ga0070694_100011107 3300005444 Bacteria 5575
144 Ga0070694_100073074 3300005444 Bacteria 2368
145 Ga0070694_100084248 3300005444 Bacteria 2217
146 Ga0070694_100264000 3300005444 Bacteria 1307
147 Ga0070708_100333050 3300005445 Bacteria 1430
148 Ga0070708_100419736 3300005445 Bacteria 1262
149 Ga0070663_100185106 3300005455 Bacteria 1618
150 Ga0070662_100023078 3300005457 Bacteria 4270
151 Ga0070662_100083848 3300005457 Bacteria 2380
152 Ga0070662_100093816 3300005457 Bacteria 2259
153 Ga0068867_100038337 3300005459 Bacteria 3488
154 Ga0068867_100039559 3300005459 Bacteria 3438
155 Ga0068867_100053738 3300005459 Bacteria 2975
156 Ga0068867_100061470 3300005459 Bacteria 2789
157 Ga0070707_100147585 3300005468 Bacteria 2289
158 Ga0070707_100209972 3300005468 Bacteria 1898
159 Ga0070707_100432239 3300005468 Bacteria 1277
160 Ga0070698_100008611 3300005471 Bacteria 10995
161 Ga0070698_100074877 3300005471 Bacteria 3390
162 Ga0070698_100094926 3300005471 Bacteria 2961
163 Ga0070699_100013945 3300005518 Bacteria 6913
164 Ga0070699_100106092 3300005518 Bacteria 2464
165 Ga0070699_100130553 3300005518 Bacteria 2215
166 Ga0070699_100464075 3300005518 Bacteria 1148
167 Ga0070684_100000131 3300005535 Bacteria 49644
168 Ga0070684_100094446 3300005535 Bacteria 2664
169 Ga0070672_100011456 3300005543 Bacteria 6185
170 Ga0070672_100116012 3300005543 Bacteria 2187
171 Ga0070686_100001409 3300005544 Bacteria 13568
172 Ga0070695_100001466 3300005545 Bacteria 13070
173 Ga0070695_100003657 3300005545 Bacteria 8963
174 Ga0070695_100006552 3300005545 Bacteria 6880
175 Ga0070695_100195534 3300005545 Bacteria 1442
176 Ga0070696_100000141 3300005546 Bacteria 39540
177 Ga0070696_100008448 3300005546 Bacteria 6892
178 Ga0070696_100010528 3300005546 Bacteria 6198
179 Ga0070696_100017939 3300005546 Bacteria 4780
180 Ga0070665_100005360 3300005548 Bacteria 13242
181 Ga0070665_100311681 3300005548 Bacteria 1577
182 Ga0070704_100003072 3300005549 Bacteria 9506
183 Ga0070704_100252371 3300005549 Bacteria 1449
184 Ga0070664_100013166 3300005564 Bacteria 6734
185 Ga0070664_100180015 3300005564 Bacteria 1878
186 Ga0068857_100006456 3300005577 Bacteria 10056
187 Ga0068857_100265947 3300005577 Bacteria 1575
188 Ga0068854_100007820 3300005578 Bacteria 6841
189 Ga0068854_100082043 3300005578 Bacteria 2383
190 Ga0068854_100084220 3300005578 Bacteria 2352
191 Ga0068854_100087694 3300005578 Bacteria 2309
192 Ga0068854_100146030 3300005578 Bacteria 1820
193 Ga0068856_100522646 3300005614 Bacteria 1208
194 Ga0070702_100005096 3300005615 Bacteria 6078
195 Ga0070702_100021415 3300005615 Bacteria 3401
196 Ga0068859_100000441 3300005617 Bacteria 41723
197 Ga0068859_100001084 3300005617 Bacteria 27803
198 Ga0068859_100008641 3300005617 Bacteria 10292
199 Ga0068859_100114953 3300005617 Unclassified 2755
200 Ga0068864_100000583 3300005618 Bacteria 31040
201 Ga0068864_100043296 3300005618 Bacteria 3855
202 Ga0068864_100081212 3300005618 Bacteria 2842
203 Ga0068864_100371295 3300005618 Bacteria 1354
204 Ga0068866_10018596 3300005718 Bacteria 3146
205 Ga0068861_100005269 3300005719 Bacteria 8719
206 Ga0068861_100010517 3300005719 Bacteria 6422
207 Ga0068861_100055469 3300005719 Bacteria 3021
208 Ga0068861_100057934 3300005719 Bacteria 2960
209 Ga0068861_100151935 3300005719 Bacteria 1901
210 Ga0068861_100159632 3300005719 Bacteria 1859
211 Ga0068861_100295342 3300005719 Bacteria 1401
212 Ga0068861_100351496 3300005719 Bacteria 1293
213 Ga0068851_10065657 3300005834 Unclassified 1868
214 Ga0068851_10154222 3300005834 Bacteria 1258
215 Ga0068870_10105645 3300005840 Bacteria 1599
216 Ga0068870_10162645 3300005840 Bacteria 1325
217 Ga0068863_100000019 3300005841 Bacteria 205585
218 Ga0068863_100008426 3300005841 Bacteria 10068
219 Ga0068863_100033097 3300005841 Bacteria 4924
220 Ga0068863_100081690 3300005841 Bacteria 3061
221 Ga0068863_100291459 3300005841 Bacteria 1582
222 Ga0068863_100350008 3300005841 Bacteria 1438
223 Ga0068858_100000700 3300005842 Bacteria 35018
224 Ga0068858_100012279 3300005842 Bacteria 8078
225 Ga0068858_100016289 3300005842 Bacteria 6983
226 Ga0068858_100024743 3300005842 Bacteria 5591
227 Ga0068858_100099111 3300005842 Bacteria 2717
228 Ga0068860_100013412 3300005843 Bacteria 8037
229 Ga0068860_100015157 3300005843 Bacteria 7530
230 Ga0068860_100179866 3300005843 Bacteria 2044
231 Ga0068860_100250185 3300005843 Unclassified 1726
232 Ga0068860_100348768 3300005843 Bacteria 1456
233 Ga0068862_100029633 3300005844 Bacteria 4612
234 Ga0068862_100054848 3300005844 Bacteria 3413
235 Ga0068862_100158428 3300005844 Bacteria 2019
236 Ga0068862_100182058 3300005844 Bacteria 1886
237 Ga0068862_100278351 3300005844 Bacteria 1533
238 Ga0081455_10000127 3300005937 Bacteria 88574
239 Ga0081455_10035042 3300005937 Bacteria 4490
240 Ga0081540_1076471 3300005983 Bacteria 1525
241 Ga0081539_10000334 3300005985 Bacteria 104401
242 Ga0081539_10000548 3300005985 Bacteria 77496
243 Ga0081539_10000753 3300005985 Bacteria 64323
244 Ga0075365_10053109 3300006038 Bacteria 2683
245 Ga0075363_100001428 3300006048 Bacteria 9041
246 Ga0075364_10007623 3300006051 Bacteria 6434
247 Ga0075364_10017498 3300006051 Bacteria 4478
248 Ga0075364_10259181 3300006051 Bacteria 1182
249 Ga0070716_100101601 3300006173 Bacteria 1764
250 Ga0070716_100171168 3300006173 Bacteria 1417
251 Ga0075362_10000270 3300006177 Bacteria 14466
252 Ga0075367_10008801 3300006178 Bacteria 5250
253 Ga0075367_10049686 3300006178 Bacteria 2473
254 Ga0075369_10007151 3300006186 Bacteria 4240
255 Ga0075366_10000070 3300006195 Bacteria 39329
256 Ga0075366_10056627 3300006195 Bacteria 2328
257 Ga0097621_100024815 3300006237 Bacteria 4686
258 Ga0097621_100180315 3300006237 Bacteria 1825
259 Ga0075370_10000009 3300006353 Bacteria 97850
260 Ga0075370_10070789 3300006353 Bacteria 1995
261 Ga0068871_100006884 3300006358 Bacteria 8095
262 Ga0068871_100141796 3300006358 Bacteria 2044
263 Ga0068871_100253650 3300006358 Bacteria 1533
264 Ga0075428_100001819 3300006844 Bacteria 22833
265 Ga0075428_100020409 3300006844 Bacteria 7335
266 Ga0075428_100057101 3300006844 Bacteria 4274
267 Ga0075428_100079670 3300006844 Bacteria 3575
268 Ga0075428_100080881 3300006844 Bacteria 3546
269 Ga0075428_100108460 3300006844 Unclassified 3026
270 Ga0075428_100160340 3300006844 Bacteria 2441
271 Ga0075428_100399462 3300006844 Bacteria 1473
272 Ga0075430_100001773 3300006846 Bacteria 17636
273 Ga0075430_100016744 3300006846 Bacteria 6244
274 Ga0075430_100026431 3300006846 Bacteria 4938
275 Ga0075430_100041131 3300006846 Bacteria 3911
276 Ga0075430_100114973 3300006846 Bacteria 2242
277 Ga0075430_100180286 3300006846 Bacteria 1757
278 Ga0075430_100204161 3300006846 Bacteria 1640
279 Ga0075431_100029382 3300006847 Bacteria 5658
280 Ga0075431_100059805 3300006847 Bacteria 3932
281 Ga0075431_100071732 3300006847 Bacteria 3574
282 Ga0075431_100085607 3300006847 Bacteria 3253
283 Ga0075431_100229698 3300006847 Bacteria 1891
284 Ga0075431_100237528 3300006847 Bacteria 1855
285 Ga0075433_10018342 3300006852 Bacteria 5815
286 Ga0075433_10034494 3300006852 Bacteria 4346
287 Ga0075433_10035109 3300006852 Bacteria 4310
288 Ga0075433_10046558 3300006852 Bacteria 3772
289 Ga0075433_10049165 3300006852 Bacteria 3669
290 Ga0075433_10088056 3300006852 Bacteria 2743
291 Ga0075433_10155746 3300006852 Bacteria 2033
292 Ga0075433_10159709 3300006852 Bacteria 2006
293 Ga0075433_10211999 3300006852 Bacteria 1721
294 Ga0075433_10241311 3300006852 Bacteria 1604
295 Ga0075434_100009173 3300006871 Bacteria 9217
296 Ga0075434_100016423 3300006871 Bacteria 7116
297 Ga0075434_100024027 3300006871 Bacteria 5953
298 Ga0075434_100037189 3300006871 Bacteria 4818
299 Ga0075434_100100580 3300006871 Bacteria 2897
300 Ga0075434_100117300 3300006871 Bacteria 2675
301 Ga0075434_100118947 3300006871 Bacteria 2656
302 Ga0075434_100126099 3300006871 Bacteria 2577
303 Ga0075434_100131168 3300006871 Bacteria 2525
304 Ga0075434_100514235 3300006871 Unclassified 1218
305 Ga0075429_100058037 3300006880 Unclassified 3371
306 Ga0075429_100070422 3300006880 Bacteria 3045
307 Ga0075429_100087006 3300006880 Bacteria 2723
308 Ga0075429_100098756 3300006880 Bacteria 2547
309 Ga0075429_100201739 3300006880 Bacteria 1743
310 Ga0075429_100295260 3300006880 Bacteria 1419
311 Ga0068865_100000942 3300006881 Bacteria 16545
312 Ga0068865_100006865 3300006881 Bacteria 6973
313 Ga0068865_100065977 3300006881 Bacteria 2553
314 Ga0075436_100059382 3300006914 Bacteria 2642
315 Ga0097620_100000074 3300006931 Bacteria 92064
316 Ga0097620_100000441 3300006931 Bacteria 41723
317 Ga0097620_100001083 3300006931 Bacteria 27803
318 Ga0097620_100008641 3300006931 Bacteria 10292
319 Ga0097620_100114953 3300006931 Unclassified 2755
320 Ga0075435_100000928 3300007076 Bacteria 18503
321 Ga0075435_100003002 3300007076 Bacteria 11356
322 Ga0075435_100005829 3300007076 Bacteria 8662
323 Ga0075435_100094384 3300007076 Unclassified 2473
324 Ga0075435_100109768 3300007076 Bacteria 2294
325 Ga0075435_100139830 3300007076 Bacteria 2031
326 Ga0075435_100143497 3300007076 Bacteria 2005
327 Ga0075435_100188600 3300007076 Bacteria 1744
328 Ga0105251_10000013 3300009011 Bacteria 163226
329 Ga0105244_10043643 3300009036 Bacteria 2312
330 Ga0105250_10001875 3300009092 Bacteria 10924
331 Ga0105240_10013459 3300009093 Bacteria 11236
332 Ga0105240_10111093 3300009093 Bacteria 3316
333 Ga0105240_10337221 3300009093 Bacteria 1714
334 Ga0111539_10000049 3300009094 Bacteria 119544
335 Ga0111539_10006856 3300009094 Bacteria 14635
336 Ga0111539_10007298 3300009094 Bacteria 14152
337 Ga0111539_10008943 3300009094 Bacteria 12680
338 Ga0111539_10019390 3300009094 Bacteria 8396
339 Ga0111539_10039504 3300009094 Bacteria 5686
340 Ga0111539_10054280 3300009094 Bacteria 4769
341 Ga0111539_10063121 3300009094 Bacteria 4384
342 Ga0111539_10086698 3300009094 Bacteria 3679
343 Ga0111539_10159766 3300009094 Bacteria 2636
344 Ga0111539_10234904 3300009094 Bacteria 2134
345 Ga0111539_10294161 3300009094 Bacteria 1890
346 Ga0111539_10326706 3300009094 Bacteria 1785
347 Ga0105245_10022300 3300009098 Bacteria 5557
348 Ga0105245_10145452 3300009098 Bacteria 2236
349 Ga0105247_10000923 3300009101 Bacteria 22103
350 Ga0105247_10172018 3300009101 Bacteria 1441
351 Ga0114129_10001463 3300009147 Bacteria 31911
352 Ga0114129_10002077 3300009147 Bacteria 27547
353 Ga0114129_10012069 3300009147 Bacteria 12295
354 Ga0114129_10015078 3300009147 Bacteria 11003
355 Ga0114129_10017374 3300009147 Bacteria 10244
356 Ga0114129_10017991 3300009147 Bacteria 10063
357 Ga0114129_10021206 3300009147 Bacteria 9227
358 Ga0114129_10021598 3300009147 Bacteria 9136
359 Ga0114129_10021805 3300009147 Bacteria 9093
360 Ga0114129_10027614 3300009147 Bacteria 8036
361 Ga0114129_10037003 3300009147 Bacteria 6891
362 Ga0114129_10039981 3300009147 Bacteria 6615
363 Ga0114129_10055881 3300009147 Bacteria 5532
364 Ga0114129_10063964 3300009147 Bacteria 5134
365 Ga0114129_10092853 3300009147 Bacteria 4181
366 Ga0114129_10097270 3300009147 Bacteria 4075
367 Ga0114129_10105548 3300009147 Bacteria 3893
368 Ga0114129_10168886 3300009147 Bacteria 2983
369 Ga0114129_10188468 3300009147 Bacteria 2802
370 Ga0114129_10303605 3300009147 Bacteria 2127
371 Ga0114129_10314310 3300009147 Bacteria 2084
372 Ga0114129_10427377 3300009147 Bacteria 1741
373 Ga0114129_10469870 3300009147 Bacteria 1647
374 Ga0105243_10012897 3300009148 Bacteria 6315
375 Ga0105243_10040969 3300009148 Bacteria 3620
376 Ga0105243_10491266 3300009148 Bacteria 1161
377 Ga0105241_10048546 3300009174 Bacteria 3231
378 Ga0105241_10134353 3300009174 Bacteria 2006
379 Ga0105242_10008281 3300009176 Bacteria 7989
380 Ga0105242_10071701 3300009176 Bacteria 2875
381 Ga0105242_10075697 3300009176 Bacteria 2803
382 Ga0105242_10179844 3300009176 Bacteria 1865
383 Ga0105248_10001761 3300009177 Bacteria 24074
384 Ga0105248_10004937 3300009177 Bacteria 14734
385 Ga0105248_10010781 3300009177 Bacteria 10090
386 Ga0105248_10013157 3300009177 Bacteria 9111
387 Ga0105248_10030345 3300009177 Bacteria 6036
388 Ga0105248_10126609 3300009177 Bacteria 2881
389 Ga0105248_10142693 3300009177 Bacteria 2702
390 Ga0105237_10006300 3300009545 Bacteria 13194
391 Ga0105237_10014363 3300009545 Bacteria 8285
392 Ga0105237_10085870 3300009545 Bacteria 3136
393 Ga0105237_10110467 3300009545 Bacteria 2741
394 Ga0105249_10000654 3300009553 Bacteria 31467
395 Ga0105249_10002700 3300009553 Bacteria 15340
396 Ga0105249_10012954 3300009553 Bacteria 7359
397 Ga0105249_10028928 3300009553 Bacteria 5002
398 Ga0105249_10107619 3300009553 Bacteria 2631
399 Ga0105249_10198420 3300009553 Bacteria 1963
400 Ga0105249_10219105 3300009553 Bacteria 1872
401 Ga0105249_10326727 3300009553 Bacteria 1546
402 Ga0105239_10125251 3300010375 Bacteria 2855
403 Ga0105239_10246529 3300010375 Bacteria 2006
404 Ga0105239_10363989 3300010375 Bacteria 1634
405 Ga0157374_10041093 3300013296 Bacteria 4259
406 Ga0157374_10053818 3300013296 Bacteria 3753
407 Ga0157374_10194629 3300013296 Bacteria 1984
408 Ga0157374_10216424 3300013296 Bacteria 1879
409 Ga0157378_10008708 3300013297 Bacteria 8831
410 Ga0163162_10046655 3300013306 Bacteria 4343
411 Ga0163162_10071234 3300013306 Bacteria 3529
412 Ga0163162_10078015 3300013306 Bacteria 3377
413 Ga0157372_10207269 3300013307 Bacteria 2271
414 Ga0157375_10019096 3300013308 Bacteria 6226
415 Ga0163163_10004894 3300014325 Bacteria 11518
416 Ga0163163_10010247 3300014325 Bacteria 8418
417 Ga0163163_10024873 3300014325 Bacteria 5701
418 Ga0163163_10050639 3300014325 Bacteria 4090
419 Ga0163163_10123269 3300014325 Bacteria 2627
420 Ga0163163_10209284 3300014325 Bacteria 1999
421 Ga0163163_10447815 3300014325 Bacteria 1351
422 Ga0157380_10013953 3300014326 Bacteria 5867
423 Ga0157380_10055011 3300014326 Bacteria 3159
424 Ga0157380_10074853 3300014326 Bacteria 2750
425 Ga0157380_10292640 3300014326 Bacteria 1496
426 Ga0182008_10000187 3300014497 Bacteria 48971
427 Ga0182008_10019950 3300014497 Bacteria 3454
428 Ga0157377_10017156 3300014745 Bacteria 3741
429 Ga0157377_10045165 3300014745 Bacteria 2460
430 Ga0157377_10050727 3300014745 Bacteria 2338
431 Ga0157377_10179063 3300014745 Bacteria 1332
432 Ga0157379_10243492 3300014968 Bacteria 1631
433 Ga0157379_10261773 3300014968 Bacteria 1572
434 Ga0157379_10288227 3300014968 Bacteria 1495
435 Ga0157379_10435620 3300014968 Bacteria 1208
436 Ga0182005_1001455 3300015265 Bacteria 9536
437 Ga0183360_10001 3300015689 Bacteria 3943671
438 Ga0163161_10002965 3300017792 Bacteria 12025
439 Ga0207425_1000016 3300025245 Bacteria 428169
440 Ga0207425_1000044 3300025245 Bacteria 195202
441 Ga0207425_1000388 3300025245 Bacteria 29705
442 Ga0209026_1002380 3300025250 Bacteria 7097
443 Ga0209129_1000044 3300025258 Bacteria 298971
444 Ga0209129_1001083 3300025258 Bacteria 16006
445 Ga0209565_1000001 3300025263 Bacteria 2950419
446 Ga0209565_1000031 3300025263 Bacteria 320341
447 Ga0209565_1000206 3300025263 Bacteria 68867
448 Ga0209673_1000001 3300025273 Bacteria 3176258
449 Ga0209673_1000674 3300025273 Bacteria 49444
450 Ga0209673_1015571 3300025273 Bacteria 2880
451 Ga0209675_1000001 3300025291 Bacteria 2950293
452 Ga0209675_1000015 3300025291 Bacteria 403517
453 Ga0209676_1000570 3300025292 Bacteria 55557
454 Ga0209676_1000998 3300025292 Bacteria 33231
455 Ga0209676_1001784 3300025292 Bacteria 18110
456 Ga0209676_1039475 3300025292 Bacteria 1341
457 Ga0209025_1000006 3300025294 Bacteria 1153444
458 Ga0209025_1000012 3300025294 Bacteria 924362
459 Ga0209025_1000475 3300025294 Bacteria 77876
460 Ga0209564_1000001 3300025295 Bacteria 3176258
461 Ga0209564_1000037 3300025295 Bacteria 414794
462 Ga0209564_1000996 3300025295 Bacteria 35381
463 Ga0209758_1000009 3300025297 Bacteria 1123483
464 Ga0209758_1000018 3300025297 Bacteria 753320
465 Ga0209758_1000736 3300025297 Bacteria 47860
466 Ga0209758_1031300 3300025297 Bacteria 2185
467 Ga0209050_1000005 3300025298 Bacteria 1557793
468 Ga0209050_1000029 3300025298 Bacteria 465801
469 Ga0209050_1000201 3300025298 Bacteria 134028
470 Ga0209050_1000709 3300025298 Bacteria 49201
471 Ga0209050_1005225 3300025298 Bacteria 8289
472 Ga0209050_1016542 3300025298 Bacteria 3009
473 Ga0209050_1030006 3300025298 Bacteria 1724
474 Ga0209256_1000002 3300025299 Bacteria 1906740
475 Ga0209256_1002877 3300025299 Bacteria 13057
476 Ga0209051_1000100 3300025303 Bacteria 165053
477 Ga0209051_1000798 3300025303 Bacteria 33097
478 Ga0209257_1000208 3300025304 Bacteria 141393
479 Ga0209257_1000273 3300025304 Bacteria 117663
480 Ga0209257_1000493 3300025304 Bacteria 71002
481 Ga0209257_1000896 3300025304 Bacteria 41831
482 Ga0209257_1001045 3300025304 Bacteria 36833
483 Ga0209257_1001168 3300025304 Bacteria 33231
484 Ga0209257_1002196 3300025304 Bacteria 20183
485 Ga0207697_10007900 3300025315 Bacteria 4701
486 Ga0207697_10075189 3300025315 Bacteria 1419
487 Ga0207696_1016053 3300025711 Bacteria 2517
488 Ga0207713_1000445 3300025735 Bacteria 43504
489 Ga0207642_10039477 3300025899 Bacteria 2051
490 Ga0207710_10001276 3300025900 Bacteria 12714
491 Ga0207710_10089290 3300025900 Bacteria 1440
492 Ga0207680_10077036 3300025903 Bacteria 2084
493 Ga0207680_10077737 3300025903 Bacteria 2077
494 Ga0207680_10112898 3300025903 Bacteria 1766
495 Ga0207647_10008924 3300025904 Bacteria 7150
496 Ga0207645_10005050 3300025907 Bacteria 9668
497 Ga0207645_10009707 3300025907 Bacteria 6649
498 Ga0207643_10001752 3300025908 Bacteria 12121
499 Ga0207654_10252755 3300025911 Unclassified 1182
500 Ga0207695_10040313 3300025913 Bacteria 5010
501 Ga0207695_10197319 3300025913 Bacteria 1928
502 Ga0207695_10209490 3300025913 Bacteria 1860
503 Ga0207671_10197129 3300025914 Bacteria 1571
504 Ga0207671_10201936 3300025914 Bacteria 1553
505 Ga0207662_10007677 3300025918 Bacteria 5876
506 Ga0207662_10010309 3300025918 Bacteria 5159
507 Ga0207662_10015467 3300025918 Bacteria 4293
508 Ga0207662_10023443 3300025918 Bacteria 3546
509 Ga0207646_10093154 3300025922 Bacteria 2697
510 Ga0207646_10101801 3300025922 Bacteria 2575
511 Ga0207646_10243182 3300025922 Bacteria 1626
512 Ga0207681_10006282 3300025923 Bacteria 7295
513 Ga0207681_10042902 3300025923 Bacteria 3024
514 Ga0207694_10111187 3300025924 Bacteria 2179
515 Ga0207650_10001485 3300025925 Bacteria 16814
516 Ga0207650_10007102 3300025925 Bacteria 7629
517 Ga0207650_10015962 3300025925 Bacteria 5239
518 Ga0207650_10097529 3300025925 Bacteria 2257
519 Ga0207650_10117377 3300025925 Bacteria 2068
520 Ga0207650_10136821 3300025925 Bacteria 1922
521 Ga0207650_10138597 3300025925 Bacteria 1911
522 Ga0207650_10335452 3300025925 Bacteria 1241
523 Ga0207659_10000110 3300025926 Bacteria 48302
524 Ga0207659_10002884 3300025926 Bacteria 10231
525 Ga0207659_10005234 3300025926 Bacteria 7858
526 Ga0207659_10005455 3300025926 Bacteria 7711
527 Ga0207659_10009646 3300025926 Bacteria 6039
528 Ga0207659_10025939 3300025926 Bacteria 3947
529 Ga0207659_10099132 3300025926 Bacteria 2193
530 Ga0207659_10212906 3300025926 Bacteria 1550
531 Ga0207687_10125483 3300025927 Bacteria 1926
532 Ga0207644_10007549 3300025931 Bacteria 7090
533 Ga0207644_10011367 3300025931 Bacteria 5889
534 Ga0207644_10041929 3300025931 Bacteria 3240
535 Ga0207644_10088751 3300025931 Bacteria 2300
536 Ga0207706_10046751 3300025933 Bacteria 3831
537 Ga0207706_10065021 3300025933 Bacteria 3212
538 Ga0207706_10118701 3300025933 Bacteria 2326
539 Ga0207706_10136090 3300025933 Bacteria 2161
540 Ga0207706_10174814 3300025933 Bacteria 1886
541 Ga0207706_10244336 3300025933 Bacteria 1569
542 Ga0207686_10002104 3300025934 Bacteria 10966
543 Ga0207686_10005442 3300025934 Bacteria 6836
544 Ga0207686_10006277 3300025934 Bacteria 6396
545 Ga0207686_10275402 3300025934 Bacteria 1240
546 Ga0207709_10008442 3300025935 Bacteria 5697
547 Ga0207709_10020870 3300025935 Bacteria 3701
548 Ga0207709_10058163 3300025935 Bacteria 2401
549 Ga0207670_10011792 3300025936 Bacteria 5087
550 Ga0207670_10061176 3300025936 Bacteria 2569
551 Ga0207670_10144790 3300025936 Bacteria 1756
552 Ga0207669_10000758 3300025937 Bacteria 13943
553 Ga0207704_10001200 3300025938 Bacteria 11545
554 Ga0207704_10230296 3300025938 Bacteria 1377
555 Ga0207665_10227534 3300025939 Bacteria 1369
556 Ga0207691_10010734 3300025940 Bacteria 8793
557 Ga0207691_10017127 3300025940 Bacteria 6874
558 Ga0207691_10041774 3300025940 Bacteria 4231
559 Ga0207691_10083538 3300025940 Bacteria 2867
560 Ga0207691_10145049 3300025940 Bacteria 2090
561 Ga0207691_10149499 3300025940 Bacteria 2054
562 Ga0207691_10202520 3300025940 Bacteria 1727
563 Ga0207711_10002106 3300025941 Bacteria 17974
564 Ga0207711_10003658 3300025941 Bacteria 13289
565 Ga0207711_10109413 3300025941 Bacteria 2456
566 Ga0207711_10169430 3300025941 Bacteria 1981
567 Ga0207711_10217721 3300025941 Unclassified 1745
568 Ga0207711_10232479 3300025941 Bacteria 1689
569 Ga0207689_10004598 3300025942 Bacteria 12488
570 Ga0207689_10181233 3300025942 Bacteria 1737
571 Ga0207661_10001850 3300025944 Bacteria 14484
572 Ga0207661_10076664 3300025944 Bacteria 2746
573 Ga0207679_10007781 3300025945 Bacteria 6810
574 Ga0207679_10065127 3300025945 Bacteria 2726
575 Ga0207679_10168876 3300025945 Bacteria 1799
576 Ga0207651_10007650 3300025960 Bacteria 5769
577 Ga0207651_10023309 3300025960 Bacteria 3804
578 Ga0207651_10125745 3300025960 Bacteria 1953
579 Ga0207651_10246909 3300025960 Bacteria 1458
580 Ga0207651_10294267 3300025960 Bacteria 1347
581 Ga0207651_10310162 3300025960 Bacteria 1315
582 Ga0207712_10007112 3300025961 Bacteria 7056
583 Ga0207712_10044185 3300025961 Bacteria 3078
584 Ga0207712_10180717 3300025961 Bacteria 1657
585 Ga0207712_10232366 3300025961 Bacteria 1481
586 Ga0207640_10038990 3300025981 Bacteria 3003
587 Ga0207640_10058860 3300025981 Bacteria 2533
588 Ga0207640_10072245 3300025981 Bacteria 2327
589 Ga0207640_10181997 3300025981 Bacteria 1577
590 Ga0207658_10017674 3300025986 Bacteria 4917
591 Ga0207658_10056542 3300025986 Bacteria 2912
592 Ga0207658_10165239 3300025986 Bacteria 1817
593 Ga0207658_10216821 3300025986 Bacteria 1607
594 Ga0207703_10001472 3300026035 Bacteria 21466
595 Ga0207703_10001628 3300026035 Bacteria 20230
596 Ga0207703_10001635 3300026035 Bacteria 20195
597 Ga0207703_10090140 3300026035 Bacteria 2576
598 Ga0207703_10124888 3300026035 Bacteria 2214
599 Ga0207639_10332689 3300026041 Bacteria 1352
600 Ga0207678_10038324 3300026067 Bacteria 4165
601 Ga0207678_10093256 3300026067 Bacteria 2573
602 Ga0207678_10363542 3300026067 Bacteria 1249
603 Ga0207708_10009619 3300026075 Bacteria 7168
604 Ga0207708_10020509 3300026075 Bacteria 4985
605 Ga0207708_10214961 3300026075 Bacteria 1538
606 Ga0207702_10445246 3300026078 Bacteria 1256
607 Ga0207641_10000005 3300026088 Bacteria 470841
608 Ga0207641_10028560 3300026088 Bacteria 4609
609 Ga0207641_10037410 3300026088 Bacteria 4052
610 Ga0207641_10093846 3300026088 Bacteria 2631
611 Ga0207641_10121503 3300026088 Bacteria 2332
612 Ga0207648_10006060 3300026089 Bacteria 12057
613 Ga0207648_10010861 3300026089 Bacteria 8608
614 Ga0207648_10071064 3300026089 Bacteria 3034
615 Ga0207648_10206383 3300026089 Bacteria 1744
616 Ga0207676_10002609 3300026095 Bacteria 12852
617 Ga0207676_10020241 3300026095 Bacteria 4865
618 Ga0207676_10194997 3300026095 Bacteria 1785
619 Ga0207676_10212861 3300026095 Bacteria 1716
620 Ga0207676_10411425 3300026095 Bacteria 1266
621 Ga0207674_10032779 3300026116 Bacteria 5446
622 Ga0207674_10078540 3300026116 Bacteria 3305
623 Ga0207674_10095302 3300026116 Bacteria 2962
624 Ga0207674_10229405 3300026116 Bacteria 1804
625 Ga0207675_100004144 3300026118 Bacteria 14034
626 Ga0207675_100004655 3300026118 Bacteria 13215
627 Ga0207675_100039417 3300026118 Bacteria 4409
628 Ga0207675_100089543 3300026118 Bacteria 2892
629 Ga0207675_100117617 3300026118 Bacteria 2513
630 Ga0207675_100131679 3300026118 Bacteria 2372
631 Ga0207675_100232526 3300026118 Bacteria 1779
632 Ga0207675_100355489 3300026118 Unclassified 1436
633 Ga0207683_10253076 3300026121 Bacteria 1608
634 Ga0207698_10142204 3300026142 Bacteria 2069
635 Ga0209371_1000004 3300027312 Bacteria 1098197
636 Ga0209371_1000011 3300027312 Bacteria 848456
637 Ga0207428_10000331 3300027907 Bacteria 61372
638 Ga0207428_10000814 3300027907 Bacteria 35226
639 Ga0207428_10023480 3300027907 Bacteria 5187
640 Ga0207428_10023677 3300027907 Bacteria 5160
641 Ga0207428_10089873 3300027907 Bacteria 2386
642 Ga0207428_10109115 3300027907 Unclassified 2131
643 Ga0207428_10145544 3300027907 Bacteria 1806
644 Ga0207428_10151620 3300027907 Bacteria 1764
645 Ga0268266_10007235 3300028379 Bacteria 10038
646 Ga0268266_10037406 3300028379 Bacteria 4135
647 Ga0268265_10024226 3300028380 Bacteria 4291
648 Ga0268265_10073703 3300028380 Bacteria 2667
649 Ga0268265_10100210 3300028380 Bacteria 2337
650 Ga0268265_10130797 3300028380 Bacteria 2085
651 Ga0268265_10341374 3300028380 Bacteria 1364
652 Ga0268264_10000100 3300028381 Bacteria 227852
653 Ga0268264_10044990 3300028381 Bacteria 3664
654 Ga0268256_1000005 3300030500 Bacteria 1082342
655 Ga0268256_1000011 3300030500 Bacteria 848625
656 Ga0307511_10000260 3300030521 Bacteria 54540
657 Ga0307511_10017236 3300030521 Bacteria 6936
658 Ga0307511_10018661 3300030521 Bacteria 6618
659 Ga0316176_1017131 3300030732 Bacteria 3060
660 Ga0316183_1083776 3300030742 Bacteria 2371
661 Ga0307513_10055717 3300031456 Bacteria 4228
662 Ga0307508_10251272 3300031616 Bacteria 1364
663 Ga0307516_10000034 3300031730 Bacteria 155251
664 Ga0307413_10010611 3300031824 Bacteria 4482
665 Ga0307410_10024217 3300031852 Bacteria 3790
666 Ga0307406_10129684 3300031901 Bacteria 1768
667 Ga0307412_10001045 3300031911 Bacteria 15821
668 Ga0307412_10003164 3300031911 Bacteria 9146
669 Ga0307409_100013022 3300031995 Bacteria 5330
670 Ga0307409_100018478 3300031995 Bacteria 4689
671 Ga0307409_100293851 3300031995 Bacteria 1508
672 Ga0307416_100086564 3300032002 Bacteria 2671
673 Ga0307414_10276437 3300032004 Bacteria 1409
674 Ga0307411_10121049 3300032005 Bacteria 1893
675 Ga0307415_100104302 3300032126 Bacteria 2088
676 Ga0307510_10000001 3300033180 Bacteria 1172244
677 Ga0307510_10008818 3300033180 Bacteria 12020
678 Ga0373948_0008419 3300034817 Bacteria 1755
679 Ga0373950_0006066 3300034818 Bacteria 1827
680 Ga0373959_0002412 3300034820 Bacteria 2973
681 Ga0373938_0000534 3300034957 Bacteria 6149
682 Ga0373928_0002510 3300035084 Bacteria 3553
683 Ga0373929_0000719 3300035085 Bacteria 6404
684 Ga0373940_0000338 3300035088 Bacteria 6940
685 Ga0373949_0002015 3300035090 Bacteria 5419
686 Ga0373951_0000760 3300035091 Bacteria 8821
687 Ga0373932_0002231 3300035112 Bacteria 4978
688 Ga0373932_0049668 3300035112 Bacteria 1241
689 Ga0373936_0004159 3300035113 Bacteria 5454
690 Ga0373939_0000610 3300035114 Bacteria 8857
691 Ga0373941_0000441 3300035115 Bacteria 8235
692 Ga0373960_0000099 3300035121 Bacteria 13644
693 Ga0373942_0000501 3300035207 Bacteria 11054
694 Ga0373961_0001461 3300035241 Bacteria 6948
695 Ga0373962_0002767 3300035242 Bacteria 4183
696 Ga0373931_0004832 3300035691 Bacteria 6189
697 Ga0373935_0223138 3300035692 Bacteria 1310
698 Ga0373947_0297085 3300035725 Bacteria 1076
699 Ga0373925_0121611 3300037068 Bacteria 2027
700 Ga0395905_0000174 3300037471 Bacteria 104301
701 Ga0395905_0234766 3300037471 Bacteria 1714
702 Ga0237819_00014 3300038705 Bacteria 59581
703 Ga0439436_0000046 3300041404 Bacteria 36987
704 Ga0439447_002290 3300041407 Bacteria 7019
705 Ga0439465_0000157 3300041413 Bacteria 16967
706 Ga0439448_0000557 3300042005 Bacteria 8732
707 Ga0439448_0006523 3300042005 Bacteria 3359
708 Ga0439432_032812 3300042006 Bacteria 1673
709 Ga0439446_0072737 3300042156 Bacteria 1054
710 Ga0439458_0001347 3300042157 Bacteria 6192
711 Ga0439458_0002817 3300042157 Bacteria 4185
712 Ga0450908_000067 3300042184 Bacteria 20606
713 Ga0439434_0021324 3300042435 Bacteria 1947
714 Ga0439434_0037382 3300042435 Bacteria 1487
715 Ga0439464_0053343 3300042439 Unclassified 1173
716 Ga0439460_0014263 3300042461 Bacteria 2088
717 Ga0466969_0005283 3300044656 Bacteria 6873
718 Ga0451576_0038031 3300045051 Bacteria 5095
719 Ga0451576_0055575 3300045051 Bacteria 4141
720 Ga0451576_0559693 3300045051 Bacteria 1201
721 Ga0495603_0204627 3300046455 Bacteria 1141
722 Ga0495638_0000523 3300046460 Bacteria 44816
723 Ga0495638_0000642 3300046460 Bacteria 38350
724 Ga0495594_0144900 3300046499 Bacteria 1348
725 Ga0495607_0002111 3300046501 Bacteria 16600
726 Ga0495607_0027190 3300046501 Bacteria 3541
727 Ga0495583_0092854 3300046506 Unclassified 1297
728 Ga0495606_0014574 3300046507 Bacteria 6119
729 Ga0495610_0000184 3300046512 Bacteria 69871
730 Ga0495643_0000767 3300046522 Bacteria 35872
731 Ga0495648_0079689 3300046524 Bacteria 1868
732 Ga0495663_0011295 3300046525 Bacteria 2486
733 Ga0495609_0143298 3300046538 Bacteria 1019
734 Ga0495621_0045606 3300046539 Bacteria 1553
735 Ga0495633_0005263 3300046558 Bacteria 7968
736 Ga0495668_0000024 3300046616 Bacteria 359469
737 Ga0495668_0005888 3300046616 Bacteria 8163
738 Ga0495625_0000153 3300046660 Bacteria 105123
739 Ga0495625_0020533 3300046660 Bacteria 5097
740 Ga0495659_0009276 3300046664 Bacteria 3138
741 Ga0495659_0012961 3300046664 Bacteria 2709
742 Ga0495659_0067026 3300046664 Bacteria 1338
743 Ga0495659_0085380 3300046664 Bacteria 1204
744 Ga0495647_0026822 3300046681 Bacteria 2114
745 Ga0495658_0198613 3300046683 Bacteria 1249
746 Ga0495669_0007859 3300046684 Bacteria 4475
747 Ga0495669_0053541 3300046684 Bacteria 1815
748 Ga0495613_0255125 3300046689 Bacteria 1223
749 Ga0495670_0000002 3300046691 Bacteria 601814
750 Ga0495670_0005324 3300046691 Bacteria 6332
751 Ga0495671_0065859 3300046692 Bacteria 1783
752 Ga0495671_0074127 3300046692 Bacteria 1670
753 Ga0495636_0020569 3300047318 Unclassified 2660
754 Ga0495672_0000230 3300047320 Bacteria 79829
755 Ga0495686_0012441 3300047472 Bacteria 5950
756 Ga0495686_0034422 3300047472 Bacteria 3263
757 Ga0495686_0057275 3300047472 Bacteria 2433
758 Ga0496100_0102951 3300048903 Bacteria 1971
759 Ga0496102_0015105 3300048905 Bacteria 6722
760 Ga0496102_0015973 3300048905 Bacteria 6551
761 Ga0496102_0123104 3300048905 Bacteria 2423
762 Ga0496102_0287319 3300048905 Bacteria 1550
763 Ga0496104_0003434 3300048907 Bacteria 13662
764 Ga0496104_0056292 3300048907 Bacteria 3718
765 Ga0496105_0023194 3300048908 Bacteria 5031
766 Ga0496106_0019449 3300048909 Bacteria 5037
767 Ga0496106_0082458 3300048909 Bacteria 2472
768 Ga0496106_0304668 3300048909 Bacteria 1278
769 Ga0496108_0002594 3300048911 Bacteria 14473
770 Ga0496108_0004453 3300048911 Bacteria 11277
771 Ga0496109_0003044 3300048912 Bacteria 13976
772 Ga0496109_0181430 3300048912 Bacteria 1977
773 Ga0496109_0246009 3300048912 Bacteria 1684
774 Ga0496109_0678982 3300048912 Unclassified 967
775 Ga0496110_0004462 3300048913 Bacteria 10853
776 Ga0496112_0002100 3300048915 Bacteria 15812
777 Ga0496112_0008114 3300048915 Bacteria 9378
778 Ga0496112_0096532 3300048915 Unclassified 2926
779 Ga0496113_0010492 3300048916 Bacteria 6125
780 Ga0496113_0254245 3300048916 Bacteria 1403
781 Ga0496114_0045076 3300048917 Bacteria 3662
782 Ga0496114_0476538 3300048917 Bacteria 1104
783 Ga0496115_0008535 3300048918 Bacteria 7582
784 Ga0496116_0050858 3300048919 Bacteria 2757
785 Ga0496116_0127826 3300048919 Bacteria 1455
786 Ga0496117_0000035 3300048920 Bacteria 326449
787 Ga0496117_0002617 3300048920 Bacteria 22352
788 Ga0496117_0003560 3300048920 Bacteria 17974
789 Ga0496117_0009832 3300048920 Bacteria 8809
790 Ga0496117_0172962 3300048920 Bacteria 1251
791 Ga0496118_0000038 3300048921 Bacteria 315464
792 Ga0496118_0000944 3300048921 Bacteria 45453
793 Ga0496118_0001666 3300048921 Bacteria 32615
794 Ga0496118_0019847 3300048921 Bacteria 5990
795 Ga0496118_0061323 3300048921 Bacteria 2785
796 Ga0496119_0000596 3300048922 Bacteria 48957
797 Ga0496119_0003923 3300048922 Bacteria 15086
798 Ga0496119_0020625 3300048922 Bacteria 4799
799 Ga0496119_0045327 3300048922 Bacteria 2757
800 Ga0496120_0000591 3300048923 Bacteria 54957
801 Ga0496120_0002725 3300048923 Bacteria 17263
802 Ga0496120_0010224 3300048923 Bacteria 6569
803 Ga0496120_0012981 3300048923 Bacteria 5635
804 Ga0496120_0040421 3300048923 Bacteria 2740
805 Ga0496121_0000036 3300048924 Bacteria 362643
806 Ga0496121_0000332 3300048924 Bacteria 98654
807 Ga0496121_0004638 3300048924 Bacteria 18274
808 Ga0496121_0004643 3300048924 Bacteria 18264
809 Ga0496121_0016951 3300048924 Bacteria 7484
810 Ga0496122_0003813 3300048925 Bacteria 19401
811 Ga0496122_0003919 3300048925 Bacteria 19038
812 Ga0496122_0004805 3300048925 Bacteria 16507
813 Ga0496122_0008759 3300048925 Bacteria 10821
814 Ga0496122_0027450 3300048925 Bacteria 4866
815 Ga0496122_0136023 3300048925 Bacteria 1548
816 Ga0496123_0003419 3300048926 Bacteria 17867
817 Ga0496123_0007270 3300048926 Bacteria 10508
818 Ga0496123_0013647 3300048926 Bacteria 6797
819 Ga0496123_0051832 3300048926 Bacteria 2729
820 Ga0496123_0065000 3300048926 Bacteria 2321
821 Ga0496123_0065191 3300048926 Bacteria 2317
822 Ga0496124_0000071 3300048927 Bacteria 220642
823 Ga0496124_0002463 3300048927 Bacteria 24200
824 Ga0496124_0007392 3300048927 Bacteria 11684
825 Ga0496124_0027703 3300048927 Bacteria 5078
826 Ga0496124_0067845 3300048927 Bacteria 2966
827 Ga0496124_0082468 3300048927 Bacteria 2639
828 Ga0496124_0087772 3300048927 Bacteria 2543
829 Ga0496125_0003007 3300048928 Bacteria 21093
830 Ga0496125_0010198 3300048928 Bacteria 9524
831 Ga0496125_0031098 3300048928 Bacteria 4764
832 Ga0496125_0033625 3300048928 Bacteria 4534
833 Ga0496125_0138338 3300048928 Bacteria 1698
834 Ga0496125_0172989 3300048928 Bacteria 1449
835 Ga0496125_0177087 3300048928 Bacteria 1425
836 Ga0496126_0013261 3300048929 Bacteria 8397
837 Ga0501031_0207395 3300049568 Bacteria 1278
838 Ga0501032_0006519 3300049569 Bacteria 8576
839 Ga0501032_0054984 3300049569 Bacteria 2678
840 Ga0501034_0009602 3300049571 Bacteria 10122
841 Ga0501034_0021706 3300049571 Bacteria 6541
842 Ga0501036_0047615 3300049572 Bacteria 3630
843 Ga0501036_0095789 3300049572 Bacteria 2509
844 Ga0501036_0295012 3300049572 Bacteria 1356
845 Ga0501037_0117345 3300049573 Bacteria 1915
846 Ga0501038_0009816 3300049574 Bacteria 8764
847 Ga0501038_0080664 3300049574 Bacteria 2742
848 Ga0501038_0107195 3300049574 Unclassified 2318
849 Ga0501039_0014224 3300049575 Bacteria 6093
850 Ga0501039_0030770 3300049575 Bacteria 4139
851 Ga0501039_0048953 3300049575 Bacteria 3267
852 Ga0501039_0299277 3300049575 Bacteria 1265
853 Ga0501040_0023710 3300049576 Bacteria 4115
854 Ga0501040_0111501 3300049576 Bacteria 1913
855 Ga0501040_0204608 3300049576 Bacteria 1402
856 Ga0501041_0068088 3300049577 Bacteria 2182
857 Ga0501041_0071871 3300049577 Unclassified 2124
858 Ga0501042_0039490 3300049578 Bacteria 3354
859 Ga0501043_0003083 3300049579 Bacteria 13841
860 Ga0501043_0034044 3300049579 Bacteria 4007
861 Ga0501043_0146341 3300049579 Bacteria 1850
862 Ga0501046_0013245 3300049580 Bacteria 6988
863 Ga0501046_0145509 3300049580 Bacteria 1790
864 Ga0501046_0164993 3300049580 Bacteria 1664
865 Ga0501047_0000090 3300049581 Bacteria 116416
866 Ga0501047_0038513 3300049581 Bacteria 4625
867 Ga0501047_0047353 3300049581 Bacteria 4154
868 Ga0501047_0060947 3300049581 Bacteria 3640
869 Ga0501048_0044212 3300049582 Bacteria 3186
870 Ga0501048_0115898 3300049582 Bacteria 1893
871 Ga0501048_0168900 3300049582 Bacteria 1549
872 Ga0501067_0025768 3300049583 Bacteria 3259
873 Ga0501067_0053450 3300049583 Bacteria 2238
874 Ga0501068_0045583 3300049584 Bacteria 2642
875 Ga0501068_0093923 3300049584 Bacteria 1853
876 Ga0501070_0074157 3300049586 Bacteria 2817
877 Ga0501071_0141297 3300049587 Bacteria 1793
878 Ga0501071_0152577 3300049587 Bacteria 1724
879 Ga0501072_0037550 3300049588 Bacteria 3799
880 Ga0501072_0052135 3300049588 Bacteria 3221
881 Ga0501073_0018115 3300049589 Bacteria 5091
882 Ga0501073_0070581 3300049589 Bacteria 2433
883 Ga0501073_0094712 3300049589 Bacteria 2074
884 Ga0501074_0101980 3300049590 Bacteria 2054
885 Ga0501074_0180195 3300049590 Bacteria 1507
886 Ga0501074_0207311 3300049590 Bacteria 1397
887 Ga0501075_0043745 3300049591 Bacteria 3359
888 Ga0501075_0115351 3300049591 Unclassified 2042
889 Ga0501075_0163329 3300049591 Bacteria 1699
890 Ga0501076_0055252 3300049592 Bacteria 3149
891 Ga0501076_0089822 3300049592 Bacteria 2470
892 Ga0501076_0116632 3300049592 Bacteria 2161
893 Ga0501077_0024880 3300049593 Bacteria 3802
894 Ga0501079_0007223 3300049741 Bacteria 8386
895 Ga0501079_0008840 3300049741 Bacteria 7627
896 Ga0501079_0064166 3300049741 Bacteria 2833
897 Ga0501080_0009143 3300049742 Bacteria 9022
898 Ga0501080_0136327 3300049742 Bacteria 2271
899 Ga0501080_0241661 3300049742 Bacteria 1648
900 Ga0501081_0045427 3300049743 Bacteria 3016
901 Ga0501081_0103222 3300049743 Bacteria 2017
902 Ga0501083_0014694 3300049744 Bacteria 5472
903 Ga0501035_0016181 3300049822 Bacteria 6882
904 Ga0501044_0002228 3300049823 Bacteria 22202
905 Ga0501044_0014647 3300049823 Bacteria 8456
906 Ga0501044_0104326 3300049823 Bacteria 2849
907 Ga0501045_0018516 3300049824 Bacteria 4955
908 Ga0501045_0032318 3300049824 Bacteria 3792
909 nmdc:mga03683_51_c1 3300050489 Bacteria 50013
910 nmdc:mga03683_8724_c1 3300050489 Bacteria 3576
911 nmdc:mga03n38_172_c1 3300050490 Bacteria 14385
912 nmdc:mga00v17_3776_c1 3300050491 Bacteria 7824
913 nmdc:mga00v17_61120_c1 3300050491 Bacteria 2315
914 nmdc:mga00v17_64538_c1 3300050491 Bacteria 2257
915 nmdc:mga0yw44_32028_c1 3300050492 Bacteria 3061
916 nmdc:mga0k408_3210_c2 3300050493 Bacteria 5327
917 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
918 nmdc:mga06z11_6749_c1 3300050494 Bacteria 4690
919 nmdc:mga07m45_63713_c1 3300050496 Bacteria 2091
920 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
921 nmdc:mga05p37_113658_c1 3300050507 Bacteria 3329
922 nmdc:mga05p37_114217_c1 3300050507 Bacteria 3319
923 nmdc:mga05p37_14429_c1 3300050507 Bacteria 9483
924 nmdc:mga05p37_14951_c1 3300050507 Bacteria 9317
925 nmdc:mga05p37_17170_c1 3300050507 Bacteria 8732
926 nmdc:mga05p37_173268_c1 3300050507 Bacteria 2630
927 nmdc:mga05p37_17374_c1 3300050507 Bacteria 8680
928 nmdc:mga05p37_195680_c1 3300050507 Bacteria 2451
929 nmdc:mga05p37_20417_c1 3300050507 Bacteria 8013
930 nmdc:mga05p37_26138_c1 3300050507 Bacteria 7098
931 nmdc:mga05p37_38418_c1 3300050507 Bacteria 5872
932 nmdc:mga05p37_5461_c1 3300050507 Bacteria 14920
933 nmdc:mga05p37_56964_c1 3300050507 Bacteria 4813
934 nmdc:mga05p37_5779_c1 3300050507 Bacteria 14547
935 nmdc:mga05p37_64255_c1 3300050507 Bacteria 4516
936 nmdc:mga05p37_86332_c1 3300050507 Bacteria 3867
937 nmdc:mga09592_235295_c1 3300050508 Bacteria 1587
938 nmdc:mga09592_241463_c1 3300050508 Unclassified 1565
939 nmdc:mga09592_479822_c1 3300050508 Bacteria 1071
940 nmdc:mga09592_74670_c1 3300050508 Bacteria 2881
941 nmdc:mga09592_75144_c1 3300050508 Bacteria 2872
942 nmdc:mga0qj67_107382_c1 3300050509 Bacteria 2252
943 nmdc:mga0qj67_2660_c1 3300050509 Bacteria 12799
944 nmdc:mga0qj67_278522_c1 3300050509 Bacteria 1356
945 nmdc:mga0qj67_66995_c1 3300050509 Bacteria 2860
946 nmdc:mga0qj67_82798_c1 3300050509 Bacteria 2573
947 nmdc:mga06r32_173540_c1 3300050510 Unclassified 2140
948 nmdc:mga06r32_225664_c1 3300050510 Unclassified 1862
949 nmdc:mga06r32_29624_c1 3300050510 Bacteria 5132
950 nmdc:mga06r32_50480_c1 3300050510 Bacteria 3979
951 nmdc:mga06r32_58760_c1 3300050510 Bacteria 3696
952 nmdc:mga06r32_9095_c1 3300050510 Bacteria 8956
953 nmdc:mga06r32_91728_c1 3300050510 Bacteria 2969
954 nmdc:mga08y16_102855_c1 3300050511 Bacteria 2974
955 nmdc:mga08y16_13609_c1 3300050511 Bacteria 8563
956 nmdc:mga08y16_295858_c1 3300050511 Unclassified 1669
957 nmdc:mga08y16_39_c1 3300050511 Bacteria 131064
958 nmdc:mga08y16_416437_c1 3300050511 Bacteria 1374
959 nmdc:mga08y16_6402_c1 3300050511 Bacteria 12343
960 nmdc:mga08y16_6676_c1 3300050511 Bacteria 12101
961 nmdc:mga08y16_70504_c1 3300050511 Bacteria 3643
962 nmdc:mga08y16_88590_c1 3300050511 Bacteria 3225
963 nmdc:mga0n895_10029_c1 3300050512 Bacteria 8336
964 nmdc:mga0n895_104824_c1 3300050512 Bacteria 2840
965 nmdc:mga0n895_125962_c1 3300050512 Unclassified 2585
966 nmdc:mga0n895_16181_c1 3300050512 Bacteria 6838
967 nmdc:mga0n895_16737_c1 3300050512 Bacteria 6737
968 nmdc:mga0n895_168210_c1 3300050512 Bacteria 2224
969 nmdc:mga0n895_19263_c1 3300050512 Bacteria 6338
970 nmdc:mga0n895_240200_c1 3300050512 Bacteria 1838
971 nmdc:mga0n895_412145_c1 3300050512 Bacteria 1366
972 nmdc:mga0n895_4246_c1 3300050512 Bacteria 11718
973 nmdc:mga0n895_4336_c1 3300050512 Bacteria 11626
974 nmdc:mga0n895_44683_c1 3300050512 Bacteria 4320
975 nmdc:mga0n895_57949_c1 3300050512 Bacteria 3819
976 nmdc:mga0n895_81032_c1 3300050512 Bacteria 3234
977 nmdc:mga0n895_84598_c1 3300050512 Bacteria 3165
978 nmdc:mga0rr50_1067_c1 3300050513 Bacteria 14898
979 nmdc:mga0rr50_124699_c1 3300050513 Bacteria 2055
980 nmdc:mga0rr50_127921_c1 3300050513 Bacteria 2030
981 nmdc:mga0rr50_22805_c1 3300050513 Unclassified 4303
982 nmdc:mga0rr50_4416_c1 3300050513 Bacteria 8266
983 nmdc:mga0rr50_46935_c1 3300050513 Bacteria 3182
984 nmdc:mga0rr50_58034_c1 3300050513 Bacteria 2899
985 nmdc:mga0rr50_64007_c1 3300050513 Bacteria 2780
986 nmdc:mga0rr50_73754_c1 3300050513 Bacteria 2610
987 nmdc:mga08x19_169313_c1 3300050514 Bacteria 1487
988 nmdc:mga08x19_23227_c1 3300050514 Bacteria 3846
989 nmdc:mga08x19_53223_c1 3300050514 Bacteria 2604
990 nmdc:mga08x19_56685_c1 3300050514 Bacteria 2530
991 nmdc:mga0a205_103351_c1 3300050515 Bacteria 2748
992 nmdc:mga0a205_112872_c1 3300050515 Bacteria 2616
993 nmdc:mga0a205_178200_c1 3300050515 Bacteria 2020
994 nmdc:mga0a205_28284_c1 3300050515 Bacteria 5359
995 nmdc:mga0a205_286497_c1 3300050515 Bacteria 1522
996 nmdc:mga0a205_43385_c1 3300050515 Bacteria 4336
997 nmdc:mga0a205_6227_c1 3300050515 Bacteria 4229
998 nmdc:mga0a205_64123_c1 3300050515 Bacteria 3549
999 nmdc:mga0a205_8596_c1 3300050515 Bacteria 9291
1000 nmdc:mga0a205_9730_c1 3300050515 Bacteria 8805
1001 nmdc:mga0sz30_329_c1 3300050516 Bacteria 7754
1002 Ga0500583_0067790 3300053092 Unclassified 1700
1003 Ga0500651_0119011 3300053093 Bacteria 1605
1004 Ga0500556_0000578 3300053104 Bacteria 24347
1005 Ga0500594_0002617 3300053118 Bacteria 3909
1006 Ga0500595_009000 3300053119 Bacteria 4055
1007 Ga0500618_003364 3300053125 Bacteria 5522
1008 Ga0500658_0000707 3300053134 Bacteria 13800
1009 Ga0500590_086676 3300053148 Bacteria 1527
1010 Ga0500624_023235 3300053157 Unclassified 1015
1011 Ga0500637_0004718 3300053178 Bacteria 6515
1012 Ga0500645_005168 3300053730 Bacteria 4862
1013 Ga0501084_0004174 3300054114 Bacteria 11784
1014 Ga0501084_0031351 3300054114 Bacteria 4445
1015 Ga0501084_0041677 3300054114 Bacteria 3841
1016 Ga0501084_0057571 3300054114 Unclassified 3252
1017 Ga0501084_0396586 3300054114 Bacteria 1166
1018 Ga0501082_0001523 3300060353 Bacteria 20382
1019 Ga0501082_0007454 3300060353 Bacteria 9440
1020 Ga0501082_0023709 3300060353 Bacteria 5292
1021 Ga0501082_0042059 3300060353 Bacteria 3940
1022 Ga0501082_0073883 3300060353 Unclassified 2936
1023 Ga0501082_0359885 3300060353 Bacteria 1269
1024 Ga0530510_0004917 3300061734 Bacteria 9232
1025 Ga0530510_0051507 3300061734 Bacteria 2975
1026 2547500771 2547132130 Bacteria 4660562
1027 2578459248 2576861471 Bacteria 4648976
1028 2600225387 2599185359 Bacteria 4772316
1029 2643908402 2643221579 Bacteria 4443405
1030 2643973606 2643221593 Bacteria 6296053
1031 2816516134 2816332141 Bacteria 4436036
1032 2819713688 2818991466 Bacteria 4748179
1033 2842921120 2842918807 Bacteria 4289178
1034 2852651579 2852649853 Bacteria 4036942
1035 2852686487 2852684882 Bacteria 5463342
1036 2879163651 2879163058 Bacteria 4223965
1037 2919132765 2919130084 Bacteria 5301837
1038 2919134617 2919134579 Bacteria 4480386
1039 2928528262 2928526807 Bacteria 4760224
1040 2928969852 2928968154 Bacteria 4633371
1041 2929196933 2929195423 Bacteria 5325372
1042 2939592146 2939589442 Bacteria 4214238
1043 2939625156 2939622612 Bacteria 4698046
1044 2941477006 2941475908 Bacteria 4145589
1045 2941490344 2941489479 Bacteria 6313767
1046 2953996396 2953994433 Bacteria 4303959
1047 2974309678 2974307012 Bacteria 4172388
1048 2977250426 2977247770 Bacteria 4160543
1049 2984515109 2984514374 Bacteria 4172479
1050 2995951649 2995948881 Bacteria 6358104
1051 8002872092 8002869464 Bacteria 3588529
1052 8021625261 8021622325 Bacteria 4844743
1053 8021649726 8021648035 Bacteria 4772378
1054 Ga0207648_10110095
1055 SwRhRL2b_contig_1411923
1056 SwRhRL2b_contig_3539020
1057 JGI24739J22299_10010725
1058 JGI24735J21928_10019568
1059 JGI24738J21930_10000759
1060 JGI24749J21850_1000053
1061 JGI25150J39212_1000224
1062 JGI25150J39212_1000458
1063 JGI25151J46595_10000016
1064 JGI25151J46595_10000057
1065 JGI25406J46586_10005401
1066 JGI25153J46596_10000041
1067 JGI25153J46596_10000198
1068 rootL2_10081122
1069 rootL2_10145053
1070 rootH1_10033773
1071 Ga0055526_1000006
1072 Ga0055526_1005312
1073 Ga0055537_1000003
1074 Ga0055537_1000018
1075 Ga0055537_1000442
1076 Ga0055537_1000746
1077 Ga0055524_1000009
1078 Ga0055536_1006687
1079 Ga0055536_1007631
1080 Ga0055534_1000004
1081 Ga0055534_1001119
1082 Ga0055528_1000003
1083 Ga0055528_1000990
1084 Ga0055530_10000301
1085 Ga0055530_10007254
1086 Ga0055530_10009834
1087 Ga0055540_1001135
1088 Ga0055531_10004329
1089 Ga0055531_10007930
1090 Ga0055531_10007945
1091 Ga0055531_10008703
1092 Ga0055531_10009940
1093 Ga0055531_10022649
1094 Ga0058692_1000015
1095 Ga0058692_1000022
1096 Ga0065165_1002680
1097 Ga0065165_1004694
1098 Ga0065165_1006492
1099 Ga0065165_1016066
1100 Ga0065704_10000363
1101 Ga0065704_10070190
1102 Ga0065704_10105639
1103 Ga0065712_10000333
1104 Ga0065712_10106997
1105 Ga0065715_10004188
1106 Ga0065707_10003170
1107 Ga0065707_10082125
1108 Ga0065707_10092877
1109 Ga0065707_10198382
1110 Ga0070676_10004330
1111 Ga0070676_10257570
1112 Ga0070683_100013418
1113 Ga0070683_100160851
1114 Ga0070690_100006381
1115 Ga0070690_100218758
1116 Ga0070690_100289245
1117 Ga0070670_100001701
1118 Ga0070670_100004309
1119 Ga0070670_100022221
1120 Ga0070670_100023356
1121 Ga0070670_100085994
1122 Ga0070670_100164515
1123 Ga0070670_100179812
1124 Ga0070677_10050298
1125 Ga0068869_100003496
1126 Ga0068869_100136230
1127 Ga0068869_100248095
1128 Ga0070666_10043508
1129 Ga0070666_10068495
1130 Ga0070666_10070344
1131 Ga0070666_10115508
1132 Ga0070680_100368814
1133 Ga0068868_100297023
1134 Ga0070689_100032021
1135 Ga0070689_100032944
1136 Ga0070689_100038392
1137 Ga0070689_100039411
1138 Ga0070689_100074258
1139 Ga0070691_10003000
1140 Ga0070691_10010618
1141 Ga0070687_100012617
1142 Ga0070687_100013142
1143 Ga0070687_100090533
1144 Ga0070687_100152432
1145 Ga0070661_100012157
1146 Ga0070692_10056824
1147 Ga0070692_10071957
1148 Ga0070668_100017093
1149 Ga0070669_100001414
1150 Ga0070669_100017191
1151 Ga0070669_100027408
1152 Ga0070669_100029241
1153 Ga0070669_100058591
1154 Ga0070669_100082992
1155 Ga0070669_100374442
1156 Ga0070675_100001217
1157 Ga0070675_100001225
1158 Ga0070675_100002905
1159 Ga0070675_100008687
1160 Ga0070675_100019988
1161 Ga0070675_100039757
1162 Ga0070675_100052358
1163 Ga0070675_100076372
1164 Ga0070675_100162562
1165 Ga0070675_100442358
1166 Ga0070671_100000844
1167 Ga0070671_100005852
1168 Ga0070671_100009229
1169 Ga0070674_100002174
1170 Ga0070674_100190459
1171 Ga0070674_100312467
1172 Ga0070673_100091993
1173 Ga0070673_100148350
1174 Ga0070673_100179045
1175 Ga0070673_100342702
1176 Ga0070688_100002411
1177 Ga0070688_100003784
1178 Ga0070688_100031288
1179 Ga0070688_100050052
1180 Ga0070688_100180537
1181 Ga0070659_100113743
1182 Ga0070667_100061524
1183 Ga0070667_100307461
1184 Ga0070667_100409899
1185 Ga0070713_100027448
1186 Ga0070701_10012165
1187 Ga0070701_10141666
1188 Ga0070705_100000116
1189 Ga0070705_100003965
1190 Ga0070705_100032260
1191 Ga0070700_100005845
1192 Ga0070700_100072300
1193 Ga0070700_100176452
1194 Ga0070700_100256781
1195 Ga0070694_100011107
1196 Ga0070694_100073074
1197 Ga0070694_100084248
1198 Ga0070694_100264000
1199 Ga0070708_100333050
1200 Ga0070708_100419736
1201 Ga0070663_100185106
1202 Ga0070662_100023078
1203 Ga0070662_100083848
1204 Ga0070662_100093816
1205 Ga0068867_100038337
1206 Ga0068867_100039559
1207 Ga0068867_100053738
1208 Ga0068867_100061470
1209 Ga0070707_100147585
1210 Ga0070707_100209972
1211 Ga0070707_100432239
1212 Ga0070698_100008611
1213 Ga0070698_100074877
1214 Ga0070698_100094926
1215 Ga0070699_100013945
1216 Ga0070699_100106092
1217 Ga0070699_100130553
1218 Ga0070699_100464075
1219 Ga0070684_100000131
1220 Ga0070684_100094446
1221 Ga0070672_100011456
1222 Ga0070672_100116012
1223 Ga0070686_100001409
1224 Ga0070695_100001466
1225 Ga0070695_100003657
1226 Ga0070695_100006552
1227 Ga0070695_100195534
1228 Ga0070696_100000141
1229 Ga0070696_100008448
1230 Ga0070696_100010528
1231 Ga0070696_100017939
1232 Ga0070665_100005360
1233 Ga0070665_100311681
1234 Ga0070704_100003072
1235 Ga0070704_100252371
1236 Ga0070664_100013166
1237 Ga0070664_100180015
1238 Ga0068857_100006456
1239 Ga0068857_100265947
1240 Ga0068854_100007820
1241 Ga0068854_100082043
1242 Ga0068854_100084220
1243 Ga0068854_100087694
1244 Ga0068854_100146030
1245 Ga0068856_100522646
1246 Ga0070702_100005096
1247 Ga0070702_100021415
1248 Ga0068859_100000441
1249 Ga0068859_100001084
1250 Ga0068859_100008641
1251 Ga0068859_100114953
1252 Ga0068864_100000583
1253 Ga0068864_100043296
1254 Ga0068864_100081212
1255 Ga0068864_100371295
1256 Ga0068866_10018596
1257 Ga0068861_100005269
1258 Ga0068861_100010517
1259 Ga0068861_100055469
1260 Ga0068861_100057934
1261 Ga0068861_100151935
1262 Ga0068861_100159632
1263 Ga0068861_100295342
1264 Ga0068861_100351496
1265 Ga0068851_10065657
1266 Ga0068851_10154222
1267 Ga0068870_10105645
1268 Ga0068870_10162645
1269 Ga0068863_100000019
1270 Ga0068863_100008426
1271 Ga0068863_100033097
1272 Ga0068863_100081690
1273 Ga0068863_100291459
1274 Ga0068863_100350008
1275 Ga0068858_100000700
1276 Ga0068858_100012279
1277 Ga0068858_100016289
1278 Ga0068858_100024743
1279 Ga0068858_100099111
1280 Ga0068860_100013412
1281 Ga0068860_100015157
1282 Ga0068860_100179866
1283 Ga0068860_100250185
1284 Ga0068860_100348768
1285 Ga0068862_100029633
1286 Ga0068862_100054848
1287 Ga0068862_100158428
1288 Ga0068862_100182058
1289 Ga0068862_100278351
1290 Ga0081455_10000127
1291 Ga0081455_10035042
1292 Ga0081540_1076471
1293 Ga0081539_10000334
1294 Ga0081539_10000548
1295 Ga0081539_10000753
1296 Ga0075365_10053109
1297 Ga0075363_100001428
1298 Ga0075364_10007623
1299 Ga0075364_10017498
1300 Ga0075364_10259181
1301 Ga0070716_100101601
1302 Ga0070716_100171168
1303 Ga0075362_10000270
1304 Ga0075367_10008801
1305 Ga0075367_10049686
1306 Ga0075369_10007151
1307 Ga0075366_10000070
1308 Ga0075366_10056627
1309 Ga0097621_100024815
1310 Ga0097621_100180315
1311 Ga0075370_10000009
1312 Ga0075370_10070789
1313 Ga0068871_100006884
1314 Ga0068871_100141796
1315 Ga0068871_100253650
1316 Ga0075428_100001819
1317 Ga0075428_100020409
1318 Ga0075428_100057101
1319 Ga0075428_100079670
1320 Ga0075428_100080881
1321 Ga0075428_100108460
1322 Ga0075428_100160340
1323 Ga0075428_100399462
1324 Ga0075430_100001773
1325 Ga0075430_100016744
1326 Ga0075430_100026431
1327 Ga0075430_100041131
1328 Ga0075430_100114973
1329 Ga0075430_100180286
1330 Ga0075430_100204161
1331 Ga0075431_100029382
1332 Ga0075431_100059805
1333 Ga0075431_100071732
1334 Ga0075431_100085607
1335 Ga0075431_100229698
1336 Ga0075431_100237528
1337 Ga0075433_10018342
1338 Ga0075433_10034494
1339 Ga0075433_10035109
1340 Ga0075433_10046558
1341 Ga0075433_10049165
1342 Ga0075433_10088056
1343 Ga0075433_10155746
1344 Ga0075433_10159709
1345 Ga0075433_10211999
1346 Ga0075433_10241311
1347 Ga0075434_100009173
1348 Ga0075434_100016423
1349 Ga0075434_100024027
1350 Ga0075434_100037189
1351 Ga0075434_100100580
1352 Ga0075434_100117300
1353 Ga0075434_100118947
1354 Ga0075434_100126099
1355 Ga0075434_100131168
1356 Ga0075434_100514235
1357 Ga0075429_100058037
1358 Ga0075429_100070422
1359 Ga0075429_100087006
1360 Ga0075429_100098756
1361 Ga0075429_100201739
1362 Ga0075429_100295260
1363 Ga0068865_100000942
1364 Ga0068865_100006865
1365 Ga0068865_100065977
1366 Ga0075436_100059382
1367 Ga0097620_100000074
1368 Ga0097620_100000441
1369 Ga0097620_100001083
1370 Ga0097620_100008641
1371 Ga0097620_100114953
1372 Ga0075435_100000928
1373 Ga0075435_100003002
1374 Ga0075435_100005829
1375 Ga0075435_100094384
1376 Ga0075435_100109768
1377 Ga0075435_100139830
1378 Ga0075435_100143497
1379 Ga0075435_100188600
1380 Ga0105251_10000013
1381 Ga0105244_10043643
1382 Ga0105250_10001875
1383 Ga0105240_10013459
1384 Ga0105240_10111093
1385 Ga0105240_10337221
1386 Ga0111539_10000049
1387 Ga0111539_10006856
1388 Ga0111539_10007298
1389 Ga0111539_10008943
1390 Ga0111539_10019390
1391 Ga0111539_10039504
1392 Ga0111539_10054280
1393 Ga0111539_10063121
1394 Ga0111539_10086698
1395 Ga0111539_10159766
1396 Ga0111539_10234904
1397 Ga0111539_10294161
1398 Ga0111539_10326706
1399 Ga0105245_10022300
1400 Ga0105245_10145452
1401 Ga0105247_10000923
1402 Ga0105247_10172018
1403 Ga0114129_10001463
1404 Ga0114129_10002077
1405 Ga0114129_10012069
1406 Ga0114129_10015078
1407 Ga0114129_10017374
1408 Ga0114129_10017991
1409 Ga0114129_10021206
1410 Ga0114129_10021598
1411 Ga0114129_10021805
1412 Ga0114129_10027614
1413 Ga0114129_10037003
1414 Ga0114129_10039981
1415 Ga0114129_10055881
1416 Ga0114129_10063964
1417 Ga0114129_10092853
1418 Ga0114129_10097270
1419 Ga0114129_10105548
1420 Ga0114129_10168886
1421 Ga0114129_10188468
1422 Ga0114129_10303605
1423 Ga0114129_10314310
1424 Ga0114129_10427377
1425 Ga0114129_10469870
1426 Ga0105243_10012897
1427 Ga0105243_10040969
1428 Ga0105243_10491266
1429 Ga0105241_10048546
1430 Ga0105241_10134353
1431 Ga0105242_10008281
1432 Ga0105242_10071701
1433 Ga0105242_10075697
1434 Ga0105242_10179844
1435 Ga0105248_10001761
1436 Ga0105248_10004937
1437 Ga0105248_10010781
1438 Ga0105248_10013157
1439 Ga0105248_10030345
1440 Ga0105248_10126609
1441 Ga0105248_10142693
1442 Ga0105237_10006300
1443 Ga0105237_10014363
1444 Ga0105237_10085870
1445 Ga0105237_10110467
1446 Ga0105249_10000654
1447 Ga0105249_10002700
1448 Ga0105249_10012954
1449 Ga0105249_10028928
1450 Ga0105249_10107619
1451 Ga0105249_10198420
1452 Ga0105249_10219105
1453 Ga0105249_10326727
1454 Ga0105239_10125251
1455 Ga0105239_10246529
1456 Ga0105239_10363989
1457 Ga0157374_10041093
1458 Ga0157374_10053818
1459 Ga0157374_10194629
1460 Ga0157374_10216424
1461 Ga0157378_10008708
1462 Ga0163162_10046655
1463 Ga0163162_10071234
1464 Ga0163162_10078015
1465 Ga0157372_10207269
1466 Ga0157375_10019096
1467 Ga0163163_10004894
1468 Ga0163163_10010247
1469 Ga0163163_10024873
1470 Ga0163163_10050639
1471 Ga0163163_10123269
1472 Ga0163163_10209284
1473 Ga0163163_10447815
1474 Ga0157380_10013953
1475 Ga0157380_10055011
1476 Ga0157380_10074853
1477 Ga0157380_10292640
1478 Ga0182008_10000187
1479 Ga0182008_10019950
1480 Ga0157377_10017156
1481 Ga0157377_10045165
1482 Ga0157377_10050727
1483 Ga0157377_10179063
1484 Ga0157379_10243492
1485 Ga0157379_10261773
1486 Ga0157379_10288227
1487 Ga0157379_10435620
1488 Ga0182005_1001455
1489 Ga0183360_10001
1490 Ga0163161_10002965
1491 Ga0207425_1000016
1492 Ga0207425_1000044
1493 Ga0207425_1000388
1494 Ga0209026_1002380
1495 Ga0209129_1000044
1496 Ga0209129_1001083
1497 Ga0209565_1000001
1498 Ga0209565_1000031
1499 Ga0209565_1000206
1500 Ga0209673_1000001
1501 Ga0209673_1000674
1502 Ga0209673_1015571
1503 Ga0209675_1000001
1504 Ga0209675_1000015
1505 Ga0209676_1000570
1506 Ga0209676_1000998
1507 Ga0209676_1001784
1508 Ga0209676_1039475
1509 Ga0209025_1000006
1510 Ga0209025_1000012
1511 Ga0209025_1000475
1512 Ga0209564_1000001
1513 Ga0209564_1000037
1514 Ga0209564_1000996
1515 Ga0209758_1000009
1516 Ga0209758_1000018
1517 Ga0209758_1000736
1518 Ga0209758_1031300
1519 Ga0209050_1000005
1520 Ga0209050_1000029
1521 Ga0209050_1000201
1522 Ga0209050_1000709
1523 Ga0209050_1005225
1524 Ga0209050_1016542
1525 Ga0209050_1030006
1526 Ga0209256_1000002
1527 Ga0209256_1002877
1528 Ga0209051_1000100
1529 Ga0209051_1000798
1530 Ga0209257_1000208
1531 Ga0209257_1000273
1532 Ga0209257_1000493
1533 Ga0209257_1000896
1534 Ga0209257_1001045
1535 Ga0209257_1001168
1536 Ga0209257_1002196
1537 Ga0207697_10007900
1538 Ga0207697_10075189
1539 Ga0207696_1016053
1540 Ga0207713_1000445
1541 Ga0207642_10039477
1542 Ga0207710_10001276
1543 Ga0207710_10089290
1544 Ga0207680_10077036
1545 Ga0207680_10077737
1546 Ga0207680_10112898
1547 Ga0207647_10008924
1548 Ga0207645_10005050
1549 Ga0207645_10009707
1550 Ga0207643_10001752
1551 Ga0207654_10252755
1552 Ga0207695_10040313
1553 Ga0207695_10197319
1554 Ga0207695_10209490
1555 Ga0207671_10197129
1556 Ga0207671_10201936
1557 Ga0207662_10007677
1558 Ga0207662_10010309
1559 Ga0207662_10015467
1560 Ga0207662_10023443
1561 Ga0207646_10093154
1562 Ga0207646_10101801
1563 Ga0207646_10243182
1564 Ga0207681_10006282
1565 Ga0207681_10042902
1566 Ga0207694_10111187
1567 Ga0207650_10001485
1568 Ga0207650_10007102
1569 Ga0207650_10015962
1570 Ga0207650_10097529
1571 Ga0207650_10117377
1572 Ga0207650_10136821
1573 Ga0207650_10138597
1574 Ga0207650_10335452
1575 Ga0207659_10000110
1576 Ga0207659_10002884
1577 Ga0207659_10005234
1578 Ga0207659_10005455
1579 Ga0207659_10009646
1580 Ga0207659_10025939
1581 Ga0207659_10099132
1582 Ga0207659_10212906
1583 Ga0207687_10125483
1584 Ga0207644_10007549
1585 Ga0207644_10011367
1586 Ga0207644_10041929
1587 Ga0207644_10088751
1588 Ga0207706_10046751
1589 Ga0207706_10065021
1590 Ga0207706_10118701
1591 Ga0207706_10136090
1592 Ga0207706_10174814
1593 Ga0207706_10244336
1594 Ga0207686_10002104
1595 Ga0207686_10005442
1596 Ga0207686_10006277
1597 Ga0207686_10275402
1598 Ga0207709_10008442
1599 Ga0207709_10020870
1600 Ga0207709_10058163
1601 Ga0207670_10011792
1602 Ga0207670_10061176
1603 Ga0207670_10144790
1604 Ga0207669_10000758
1605 Ga0207704_10001200
1606 Ga0207704_10230296
1607 Ga0207665_10227534
1608 Ga0207691_10010734
1609 Ga0207691_10017127
1610 Ga0207691_10041774
1611 Ga0207691_10083538
1612 Ga0207691_10145049
1613 Ga0207691_10149499
1614 Ga0207691_10202520
1615 Ga0207711_10002106
1616 Ga0207711_10003658
1617 Ga0207711_10109413
1618 Ga0207711_10169430
1619 Ga0207711_10217721
1620 Ga0207711_10232479
1621 Ga0207689_10004598
1622 Ga0207689_10181233
1623 Ga0207661_10001850
1624 Ga0207661_10076664
1625 Ga0207679_10007781
1626 Ga0207679_10065127
1627 Ga0207679_10168876
1628 Ga0207651_10007650
1629 Ga0207651_10023309
1630 Ga0207651_10125745
1631 Ga0207651_10246909
1632 Ga0207651_10294267
1633 Ga0207651_10310162
1634 Ga0207712_10007112
1635 Ga0207712_10044185
1636 Ga0207712_10180717
1637 Ga0207712_10232366
1638 Ga0207640_10038990
1639 Ga0207640_10058860
1640 Ga0207640_10072245
1641 Ga0207640_10181997
1642 Ga0207658_10017674
1643 Ga0207658_10056542
1644 Ga0207658_10165239
1645 Ga0207658_10216821
1646 Ga0207703_10001472
1647 Ga0207703_10001628
1648 Ga0207703_10001635
1649 Ga0207703_10090140
1650 Ga0207703_10124888
1651 Ga0207639_10332689
1652 Ga0207678_10038324
1653 Ga0207678_10093256
1654 Ga0207678_10363542
1655 Ga0207708_10009619
1656 Ga0207708_10020509
1657 Ga0207708_10214961
1658 Ga0207702_10445246
1659 Ga0207641_10000005
1660 Ga0207641_10028560
1661 Ga0207641_10037410
1662 Ga0207641_10093846
1663 Ga0207641_10121503
1664 Ga0207648_10006060
1665 Ga0207648_10010861
1666 Ga0207648_10071064
1667 Ga0207648_10206383
1668 Ga0207676_10002609
1669 Ga0207676_10020241
1670 Ga0207676_10194997
1671 Ga0207676_10212861
1672 Ga0207676_10411425
1673 Ga0207674_10032779
1674 Ga0207674_10078540
1675 Ga0207674_10095302
1676 Ga0207674_10229405
1677 Ga0207675_100004144
1678 Ga0207675_100004655
1679 Ga0207675_100039417
1680 Ga0207675_100089543
1681 Ga0207675_100117617
1682 Ga0207675_100131679
1683 Ga0207675_100232526
1684 Ga0207675_100355489
1685 Ga0207683_10253076
1686 Ga0207698_10142204
1687 Ga0209371_1000004
1688 Ga0209371_1000011
1689 Ga0207428_10000331
1690 Ga0207428_10000814
1691 Ga0207428_10023480
1692 Ga0207428_10023677
1693 Ga0207428_10089873
1694 Ga0207428_10109115
1695 Ga0207428_10145544
1696 Ga0207428_10151620
1697 Ga0268266_10007235
1698 Ga0268266_10037406
1699 Ga0268265_10024226
1700 Ga0268265_10073703
1701 Ga0268265_10100210
1702 Ga0268265_10130797
1703 Ga0268265_10341374
1704 Ga0268264_10000100
1705 Ga0268264_10044990
1706 Ga0268256_1000005
1707 Ga0268256_1000011
1708 Ga0307511_10000260
1709 Ga0307511_10017236
1710 Ga0307511_10018661
1711 Ga0316176_1017131
1712 Ga0316183_1083776
1713 Ga0307513_10055717
1714 Ga0307508_10251272
1715 Ga0307516_10000034
1716 Ga0307413_10010611
1717 Ga0307410_10024217
1718 Ga0307406_10129684
1719 Ga0307412_10001045
1720 Ga0307412_10003164
1721 Ga0307409_100013022
1722 Ga0307409_100018478
1723 Ga0307409_100293851
1724 Ga0307416_100086564
1725 Ga0307414_10276437
1726 Ga0307411_10121049
1727 Ga0307415_100104302
1728 Ga0307510_10000001
1729 Ga0307510_10008818
1730 Ga0373948_0008419
1731 Ga0373950_0006066
1732 Ga0373959_0002412
1733 Ga0373938_0000534
1734 Ga0373928_0002510
1735 Ga0373929_0000719
1736 Ga0373940_0000338
1737 Ga0373949_0002015
1738 Ga0373951_0000760
1739 Ga0373932_0002231
1740 Ga0373932_0049668
1741 Ga0373936_0004159
1742 Ga0373939_0000610
1743 Ga0373941_0000441
1744 Ga0373960_0000099
1745 Ga0373942_0000501
1746 Ga0373961_0001461
1747 Ga0373962_0002767
1748 Ga0373931_0004832
1749 Ga0373935_0223138
1750 Ga0373947_0297085
1751 Ga0373925_0121611
1752 Ga0395905_0000174
1753 Ga0395905_0234766
1754 Ga0237819_00014
1755 Ga0439436_0000046
1756 Ga0439447_002290
1757 Ga0439465_0000157
1758 Ga0439448_0000557
1759 Ga0439448_0006523
1760 Ga0439432_032812
1761 Ga0439446_0072737
1762 Ga0439458_0001347
1763 Ga0439458_0002817
1764 Ga0450908_000067
1765 Ga0439434_0021324
1766 Ga0439434_0037382
1767 Ga0439464_0053343
1768 Ga0439460_0014263
1769 Ga0466969_0005283
1770 Ga0451576_0038031
1771 Ga0451576_0055575
1772 Ga0451576_0559693
1773 Ga0495603_0204627
1774 Ga0495638_0000523
1775 Ga0495638_0000642
1776 Ga0495594_0144900
1777 Ga0495607_0002111
1778 Ga0495607_0027190
1779 Ga0495583_0092854
1780 Ga0495606_0014574
1781 Ga0495610_0000184
1782 Ga0495643_0000767
1783 Ga0495648_0079689
1784 Ga0495663_0011295
1785 Ga0495609_0143298
1786 Ga0495621_0045606
1787 Ga0495633_0005263
1788 Ga0495668_0000024
1789 Ga0495668_0005888
1790 Ga0495625_0000153
1791 Ga0495625_0020533
1792 Ga0495659_0009276
1793 Ga0495659_0012961
1794 Ga0495659_0067026
1795 Ga0495659_0085380
1796 Ga0495647_0026822
1797 Ga0495658_0198613
1798 Ga0495669_0007859
1799 Ga0495669_0053541
1800 Ga0495613_0255125
1801 Ga0495670_0000002
1802 Ga0495670_0005324
1803 Ga0495671_0065859
1804 Ga0495671_0074127
1805 Ga0495636_0020569
1806 Ga0495672_0000230
1807 Ga0495686_0012441
1808 Ga0495686_0034422
1809 Ga0495686_0057275
1810 Ga0496100_0102951
1811 Ga0496102_0015105
1812 Ga0496102_0015973
1813 Ga0496102_0123104
1814 Ga0496102_0287319
1815 Ga0496104_0003434
1816 Ga0496104_0056292
1817 Ga0496105_0023194
1818 Ga0496106_0019449
1819 Ga0496106_0082458
1820 Ga0496106_0304668
1821 Ga0496108_0002594
1822 Ga0496108_0004453
1823 Ga0496109_0003044
1824 Ga0496109_0181430
1825 Ga0496109_0246009
1826 Ga0496109_0678982
1827 Ga0496110_0004462
1828 Ga0496112_0002100
1829 Ga0496112_0008114
1830 Ga0496112_0096532
1831 Ga0496113_0010492
1832 Ga0496113_0254245
1833 Ga0496114_0045076
1834 Ga0496114_0476538
1835 Ga0496115_0008535
1836 Ga0496116_0050858
1837 Ga0496116_0127826
1838 Ga0496117_0000035
1839 Ga0496117_0002617
1840 Ga0496117_0003560
1841 Ga0496117_0009832
1842 Ga0496117_0172962
1843 Ga0496118_0000038
1844 Ga0496118_0000944
1845 Ga0496118_0001666
1846 Ga0496118_0019847
1847 Ga0496118_0061323
1848 Ga0496119_0000596
1849 Ga0496119_0003923
1850 Ga0496119_0020625
1851 Ga0496119_0045327
1852 Ga0496120_0000591
1853 Ga0496120_0002725
1854 Ga0496120_0010224
1855 Ga0496120_0012981
1856 Ga0496120_0040421
1857 Ga0496121_0000036
1858 Ga0496121_0000332
1859 Ga0496121_0004638
1860 Ga0496121_0004643
1861 Ga0496121_0016951
1862 Ga0496122_0003813
1863 Ga0496122_0003919
1864 Ga0496122_0004805
1865 Ga0496122_0008759
1866 Ga0496122_0027450
1867 Ga0496122_0136023
1868 Ga0496123_0003419
1869 Ga0496123_0007270
1870 Ga0496123_0013647
1871 Ga0496123_0051832
1872 Ga0496123_0065000
1873 Ga0496123_0065191
1874 Ga0496124_0000071
1875 Ga0496124_0002463
1876 Ga0496124_0007392
1877 Ga0496124_0027703
1878 Ga0496124_0067845
1879 Ga0496124_0082468
1880 Ga0496124_0087772
1881 Ga0496125_0003007
1882 Ga0496125_0010198
1883 Ga0496125_0031098
1884 Ga0496125_0033625
1885 Ga0496125_0138338
1886 Ga0496125_0172989
1887 Ga0496125_0177087
1888 Ga0496126_0013261
1889 Ga0501031_0207395
1890 Ga0501032_0006519
1891 Ga0501032_0054984
1892 Ga0501034_0009602
1893 Ga0501034_0021706
1894 Ga0501036_0047615
1895 Ga0501036_0095789
1896 Ga0501036_0295012
1897 Ga0501037_0117345
1898 Ga0501038_0009816
1899 Ga0501038_0080664
1900 Ga0501038_0107195
1901 Ga0501039_0014224
1902 Ga0501039_0030770
1903 Ga0501039_0048953
1904 Ga0501039_0299277
1905 Ga0501040_0023710
1906 Ga0501040_0111501
1907 Ga0501040_0204608
1908 Ga0501041_0068088
1909 Ga0501041_0071871
1910 Ga0501042_0039490
1911 Ga0501043_0003083
1912 Ga0501043_0034044
1913 Ga0501043_0146341
1914 Ga0501046_0013245
1915 Ga0501046_0145509
1916 Ga0501046_0164993
1917 Ga0501047_0000090
1918 Ga0501047_0038513
1919 Ga0501047_0047353
1920 Ga0501047_0060947
1921 Ga0501048_0044212
1922 Ga0501048_0115898
1923 Ga0501048_0168900
1924 Ga0501067_0025768
1925 Ga0501067_0053450
1926 Ga0501068_0045583
1927 Ga0501068_0093923
1928 Ga0501070_0074157
1929 Ga0501071_0141297
1930 Ga0501071_0152577
1931 Ga0501072_0037550
1932 Ga0501072_0052135
1933 Ga0501073_0018115
1934 Ga0501073_0070581
1935 Ga0501073_0094712
1936 Ga0501074_0101980
1937 Ga0501074_0180195
1938 Ga0501074_0207311
1939 Ga0501075_0043745
1940 Ga0501075_0115351
1941 Ga0501075_0163329
1942 Ga0501076_0055252
1943 Ga0501076_0089822
1944 Ga0501076_0116632
1945 Ga0501077_0024880
1946 Ga0501079_0007223
1947 Ga0501079_0008840
1948 Ga0501079_0064166
1949 Ga0501080_0009143
1950 Ga0501080_0136327
1951 Ga0501080_0241661
1952 Ga0501081_0045427
1953 Ga0501081_0103222
1954 Ga0501083_0014694
1955 Ga0501035_0016181
1956 Ga0501044_0002228
1957 Ga0501044_0014647
1958 Ga0501044_0104326
1959 Ga0501045_0018516
1960 Ga0501045_0032318
1961 nmdc:mga03683_51_c1
1962 nmdc:mga03683_8724_c1
1963 nmdc:mga03n38_172_c1
1964 nmdc:mga00v17_3776_c1
1965 nmdc:mga00v17_61120_c1
1966 nmdc:mga00v17_64538_c1
1967 nmdc:mga0yw44_32028_c1
1968 nmdc:mga0k408_3210_c2
1969 nmdc:mga0k408_3_c1
1970 nmdc:mga06z11_6749_c1
1971 nmdc:mga07m45_63713_c1
1972 nmdc:mga07m45_6_c1
1973 nmdc:mga05p37_113658_c1
1974 nmdc:mga05p37_114217_c1
1975 nmdc:mga05p37_14429_c1
1976 nmdc:mga05p37_14951_c1
1977 nmdc:mga05p37_17170_c1
1978 nmdc:mga05p37_173268_c1
1979 nmdc:mga05p37_17374_c1
1980 nmdc:mga05p37_195680_c1
1981 nmdc:mga05p37_20417_c1
1982 nmdc:mga05p37_26138_c1
1983 nmdc:mga05p37_38418_c1
1984 nmdc:mga05p37_5461_c1
1985 nmdc:mga05p37_56964_c1
1986 nmdc:mga05p37_5779_c1
1987 nmdc:mga05p37_64255_c1
1988 nmdc:mga05p37_86332_c1
1989 nmdc:mga09592_235295_c1
1990 nmdc:mga09592_241463_c1
1991 nmdc:mga09592_479822_c1
1992 nmdc:mga09592_74670_c1
1993 nmdc:mga09592_75144_c1
1994 nmdc:mga0qj67_107382_c1
1995 nmdc:mga0qj67_2660_c1
1996 nmdc:mga0qj67_278522_c1
1997 nmdc:mga0qj67_66995_c1
1998 nmdc:mga0qj67_82798_c1
1999 nmdc:mga06r32_173540_c1
2000 nmdc:mga06r32_225664_c1
2001 nmdc:mga06r32_29624_c1
2002 nmdc:mga06r32_50480_c1
2003 nmdc:mga06r32_58760_c1
2004 nmdc:mga06r32_9095_c1
2005 nmdc:mga06r32_91728_c1
2006 nmdc:mga08y16_102855_c1
2007 nmdc:mga08y16_13609_c1
2008 nmdc:mga08y16_295858_c1
2009 nmdc:mga08y16_39_c1
2010 nmdc:mga08y16_416437_c1
2011 nmdc:mga08y16_6402_c1
2012 nmdc:mga08y16_6676_c1
2013 nmdc:mga08y16_70504_c1
2014 nmdc:mga08y16_88590_c1
2015 nmdc:mga0n895_10029_c1
2016 nmdc:mga0n895_104824_c1
2017 nmdc:mga0n895_125962_c1
2018 nmdc:mga0n895_16181_c1
2019 nmdc:mga0n895_16737_c1
2020 nmdc:mga0n895_168210_c1
2021 nmdc:mga0n895_19263_c1
2022 nmdc:mga0n895_240200_c1
2023 nmdc:mga0n895_412145_c1
2024 nmdc:mga0n895_4246_c1
2025 nmdc:mga0n895_4336_c1
2026 nmdc:mga0n895_44683_c1
2027 nmdc:mga0n895_57949_c1
2028 nmdc:mga0n895_81032_c1
2029 nmdc:mga0n895_84598_c1
2030 nmdc:mga0rr50_1067_c1
2031 nmdc:mga0rr50_124699_c1
2032 nmdc:mga0rr50_127921_c1
2033 nmdc:mga0rr50_22805_c1
2034 nmdc:mga0rr50_4416_c1
2035 nmdc:mga0rr50_46935_c1
2036 nmdc:mga0rr50_58034_c1
2037 nmdc:mga0rr50_64007_c1
2038 nmdc:mga0rr50_73754_c1
2039 nmdc:mga08x19_169313_c1
2040 nmdc:mga08x19_23227_c1
2041 nmdc:mga08x19_53223_c1
2042 nmdc:mga08x19_56685_c1
2043 nmdc:mga0a205_103351_c1
2044 nmdc:mga0a205_112872_c1
2045 nmdc:mga0a205_178200_c1
2046 nmdc:mga0a205_28284_c1
2047 nmdc:mga0a205_286497_c1
2048 nmdc:mga0a205_43385_c1
2049 nmdc:mga0a205_6227_c1
2050 nmdc:mga0a205_64123_c1
2051 nmdc:mga0a205_8596_c1
2052 nmdc:mga0a205_9730_c1
2053 nmdc:mga0sz30_329_c1
2054 Ga0500583_0067790
2055 Ga0500651_0119011
2056 Ga0500556_0000578
2057 Ga0500594_0002617
2058 Ga0500595_009000
2059 Ga0500618_003364
2060 Ga0500658_0000707
2061 Ga0500590_086676
2062 Ga0500624_023235
2063 Ga0500637_0004718
2064 Ga0500645_005168
2065 Ga0501084_0004174
2066 Ga0501084_0031351
2067 Ga0501084_0041677
2068 Ga0501084_0057571
2069 Ga0501084_0396586
2070 Ga0501082_0001523
2071 Ga0501082_0007454
2072 Ga0501082_0023709
2073 Ga0501082_0042059
2074 Ga0501082_0073883
2075 Ga0501082_0359885
2076 Ga0530510_0004917
2077 Ga0530510_0051507
2078 2547500771
2079 2578459248
2080 2600225387
2081 2643908402
2082 2643973606
2083 2816516134
2084 2819713688
2085 2842921120
2086 2852651579
2087 2852686487
2088 2879163651
2089 2919132765
2090 2919134617
2091 2928528262
2092 2928969852
2093 2929196933
2094 2939592146
2095 2939625156
2096 2941477006
2097 2941490344
2098 2953996396
2099 2974309678
2100 2977250426
2101 2984515109
2102 2995951649
2103 8002872092
2104 8021625261
2105 8021649726

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00356

LacI

Bacterial regulatory proteins, lacI family

76

121

0.98

PF13377

Peripla_BP_3

Periplasmic binding protein-like domain

243

402

0.9

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

132

400

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c3k-assembly1.cif.gz_A crystal structure of an uncharacterized protein from actinobacillus succinogenes 0.9229 58 329
1sxg-assembly3.cif.gz_F structural studies on the apo transcription factor form b. megaterium 0.9175 61 329
3c3k-assembly1.cif.gz_A crystal structure of an uncharacterized protein from actinobacillus succinogenes 0.9162 58 329
2fep-assembly1.cif.gz_A-2 structure of truncated ccpa in complex with p-ser-hpr and sulfate ions 0.9154 60 329
4o5a-assembly1.cif.gz_A-2 the crystal structure of a laci family transcriptional regulator from bifidobacterium animalis subsp. lactis dsm 10140 0.9123 58 332
ID Description Score Start End Superfamily
2rgyA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9485 161 288 3.40.50.2300
3kkeB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9439 163 288 3.40.50.2300
3c3kB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.941 163 288 3.40.50.2300
3h5tA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9336 4 45 1.10.260.40
2pafA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.924 162 329 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3DKY9-F1-model_v4 Uncharacterized protein 0.9686 161 267 GO:0000976
GO:0003700
GO:0016798
AF-A0A7I0J546-F1-model_v4 LacI family transcriptional regulator 0.9676 167 269 GO:0000976
GO:0003700
AF-A0A660QII2-F1-model_v4 LacI family transcriptional regulator 0.9611 158 331 GO:0000976
GO:0003700
AF-A0A4Q6DTD8-F1-model_v4 deleted 0.9578 176 331
AF-A0A7H4P3Q3-F1-model_v4 Regulatory protein 0.9524 155 331 GO:0000976
GO:0003700

Map