F489105

General Info

Members Datasets Scaffolds Average Seq Length
1052 458 1046 139

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056681323|8056685557
Length 164
Sequence LILRMPWNDDGENEAPPNHKETPMRFMMLMIPLGYETAPPKIDLDPERVAAMMKYNQALKDAGVLIALDGLHPPSAGARVSFATGKPVVTDGPFTESKEVLGGYWMINVASRAEAIEWAKQCPASENEIIEIRQVQEMSDFSEEVQKAAAGFEDMQQGWGKALR

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
4 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
5 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
131 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
132 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
213 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
262 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
263 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
264 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
265 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
266 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
267 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
268 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
269 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
270 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
271 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
355 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
356 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
357 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
358 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
361 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
362 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
363 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
364 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
383 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
384 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
385 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
386 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
387 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
413 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
417 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
418 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
419 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
420 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
421 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
422 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
423 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
424 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
425 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
426 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
427 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
428 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
429 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
430 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
431 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
432 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
433 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
434 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
435 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
436 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
437 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
438 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
439 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
440 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
441 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
442 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
443 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
444 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
445 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
446 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
447 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
448 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
449 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
450 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
451 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
452 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
453 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
456 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
457 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
458 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.1
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.63
Nodule 0.95
Rhizoplane 7.79
Rhizosphere 68.25
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1029154 3300002070 Bacteria 803
2 JGI25165J46597_1048384 3300003214 Bacteria 545
3 JGI25153J46596_10002543 3300003215 Bacteria 10454
4 JGI25153J46596_10010032 3300003215 Bacteria 4323
5 JGI25404J52841_10077133 3300003659 Bacteria 696
6 Ga0055539_1006053 3300003752 Bacteria 1555
7 Ga0055526_1039847 3300003771 Bacteria 1192
8 Ga0055524_1036995 3300003775 Bacteria 1301
9 Ga0055531_10001939 3300003794 Bacteria 14453
10 Ga0055543_1004643 3300004625 Bacteria 3684
11 Ga0055543_1057955 3300004625 Bacteria 625
12 Ga0065165_1001641 3300005262 Bacteria 22770
13 Ga0065165_1003060 3300005262 Bacteria 12519
14 Ga0065165_1006123 3300005262 Bacteria 6438
15 Ga0065165_1060395 3300005262 Bacteria 1040
16 Ga0070658_10012558 3300005327 Bacteria 6793
17 Ga0070658_10023514 3300005327 Bacteria 4944
18 Ga0070658_10102491 3300005327 Bacteria 2367
19 Ga0070676_10179448 3300005328 Bacteria 1375
20 Ga0070683_100650545 3300005329 Bacteria 1009
21 Ga0070683_100983887 3300005329 Bacteria 810
22 Ga0070690_100368152 3300005330 Bacteria 1047
23 Ga0070670_100190496 3300005331 Bacteria 1781
24 Ga0070670_100431462 3300005331 Bacteria 1166
25 Ga0068869_100073753 3300005334 Bacteria 2531
26 Ga0068869_100170574 3300005334 Bacteria 1699
27 Ga0068869_100726511 3300005334 Bacteria 849
28 Ga0068869_101009791 3300005334 Bacteria 725
29 Ga0070666_10242701 3300005335 Bacteria 1274
30 Ga0070682_100036436 3300005337 Bacteria 3007
31 Ga0070682_101668905 3300005337 Bacteria 553
32 Ga0068868_100061212 3300005338 Bacteria 2982
33 Ga0068868_100149026 3300005338 Bacteria 1926
34 Ga0068868_100487663 3300005338 Bacteria 1077
35 Ga0068868_100645846 3300005338 Bacteria 942
36 Ga0070660_100773748 3300005339 Bacteria 807
37 Ga0070660_101235354 3300005339 Bacteria 634
38 Ga0070689_100029472 3300005340 Bacteria 4155
39 Ga0070661_100090117 3300005344 Bacteria 2271
40 Ga0070668_100194020 3300005347 Bacteria 1664
41 Ga0070668_101210569 3300005347 Bacteria 684
42 Ga0070669_100077152 3300005353 Bacteria 2475
43 Ga0070669_100647603 3300005353 Bacteria 889
44 Ga0070675_100256096 3300005354 Bacteria 1533
45 Ga0070675_100444799 3300005354 Bacteria 1162
46 Ga0070675_100494369 3300005354 Bacteria 1102
47 Ga0070675_100671313 3300005354 Bacteria 943
48 Ga0070671_100300849 3300005355 Bacteria 1366
49 Ga0070671_100385853 3300005355 Bacteria 1197
50 Ga0070671_100593258 3300005355 Bacteria 957
51 Ga0070674_100018587 3300005356 Bacteria 4398
52 Ga0070673_100071969 3300005364 Bacteria 2779
53 Ga0070673_100722271 3300005364 Bacteria 916
54 Ga0070673_101609494 3300005364 Bacteria 614
55 Ga0070688_100332304 3300005365 Bacteria 1107
56 Ga0070688_100379429 3300005365 Bacteria 1042
57 Ga0070659_100890205 3300005366 Bacteria 777
58 Ga0070659_101699146 3300005366 Bacteria 564
59 Ga0070667_100171236 3300005367 Bacteria 1917
60 Ga0070667_101488193 3300005367 Bacteria 636
61 Ga0070709_10001487 3300005434 Bacteria 12659
62 Ga0070714_100228898 3300005435 Bacteria 1712
63 Ga0070713_100375492 3300005436 Bacteria 1324
64 Ga0070713_100634323 3300005436 Bacteria 1017
65 Ga0070710_10648292 3300005437 Bacteria 740
66 Ga0070701_10812765 3300005438 Bacteria 639
67 Ga0070711_100004982 3300005439 Bacteria 7886
68 Ga0070711_100009103 3300005439 Bacteria 6103
69 Ga0070711_101810257 3300005439 Bacteria 536
70 Ga0070700_100015418 3300005441 Bacteria 4332
71 Ga0070708_100064842 3300005445 Bacteria 3274
72 Ga0070708_100690600 3300005445 Bacteria 961
73 Ga0070663_100004680 3300005455 Bacteria 8069
74 Ga0070663_100073751 3300005455 Bacteria 2490
75 Ga0070663_100089274 3300005455 Bacteria 2280
76 Ga0070663_100173392 3300005455 Bacteria 1668
77 Ga0070663_100320808 3300005455 Bacteria 1246
78 Ga0070678_100045978 3300005456 Bacteria 3127
79 Ga0070678_100160527 3300005456 Bacteria 1820
80 Ga0070678_100345611 3300005456 Bacteria 1277
81 Ga0070678_100700049 3300005456 Bacteria 913
82 Ga0070662_100100370 3300005457 Bacteria 2189
83 Ga0070662_100145701 3300005457 Bacteria 1839
84 Ga0070662_101016872 3300005457 Bacteria 710
85 Ga0070681_10012465 3300005458 Bacteria 8435
86 Ga0068867_100077329 3300005459 Bacteria 2500
87 Ga0070706_100473639 3300005467 Bacteria 1165
88 Ga0070707_100067780 3300005468 Bacteria 3434
89 Ga0070698_100028998 3300005471 Bacteria 5744
90 Ga0070698_100901362 3300005471 Bacteria 830
91 Ga0070699_100633627 3300005518 Bacteria 976
92 Ga0070679_100018130 3300005530 Bacteria 6824
93 Ga0070697_101292512 3300005536 Bacteria 651
94 Ga0070697_101484915 3300005536 Bacteria 606
95 Ga0068853_100432519 3300005539 Bacteria 1236
96 Ga0068853_101321949 3300005539 Bacteria 697
97 Ga0068853_101927947 3300005539 Bacteria 573
98 Ga0070672_100036650 3300005543 Bacteria 3738
99 Ga0070672_100719582 3300005543 Bacteria 875
100 Ga0070686_100061402 3300005544 Bacteria 2428
101 Ga0070696_101316213 3300005546 Bacteria 614
102 Ga0070665_100013100 3300005548 Bacteria 8350
103 Ga0070665_100030279 3300005548 Bacteria 5447
104 Ga0070665_100062009 3300005548 Bacteria 3749
105 Ga0070665_100142934 3300005548 Bacteria 2396
106 Ga0070665_100154541 3300005548 Bacteria 2296
107 Ga0070665_100176827 3300005548 Bacteria 2135
108 Ga0070665_100475717 3300005548 Bacteria 1260
109 Ga0070665_100602714 3300005548 Bacteria 1111
110 Ga0070665_101278437 3300005548 Bacteria 744
111 Ga0070665_101315473 3300005548 Bacteria 732
112 Ga0068855_100007494 3300005563 Bacteria 13211
113 Ga0068855_100157617 3300005563 Bacteria 2578
114 Ga0068855_100173800 3300005563 Bacteria 2438
115 Ga0070664_100451693 3300005564 Bacteria 1180
116 Ga0070664_101292608 3300005564 Bacteria 689
117 Ga0068854_100081574 3300005578 Bacteria 2389
118 Ga0068854_100515802 3300005578 Bacteria 1009
119 Ga0068854_100557659 3300005578 Bacteria 973
120 Ga0068856_100225909 3300005614 Bacteria 1887
121 Ga0068856_100252283 3300005614 Bacteria 1779
122 Ga0068856_100257385 3300005614 Bacteria 1761
123 Ga0068856_100446153 3300005614 Bacteria 1314
124 Ga0070702_100030788 3300005615 Bacteria 2929
125 Ga0070702_100256668 3300005615 Bacteria 1188
126 Ga0070702_100504825 3300005615 Bacteria 889
127 Ga0068852_100061105 3300005616 Bacteria 3273
128 Ga0068852_100271608 3300005616 Bacteria 1632
129 Ga0068852_100391056 3300005616 Bacteria 1366
130 Ga0068852_102611884 3300005616 Bacteria 525
131 Ga0068859_100029233 3300005617 Bacteria 5530
132 Ga0068859_100157976 3300005617 Bacteria 2346
133 Ga0068864_100031862 3300005618 Bacteria 4475
134 Ga0068864_100189671 3300005618 Bacteria 1884
135 Ga0068864_101871951 3300005618 Bacteria 606
136 Ga0068866_10037646 3300005718 Bacteria 2377
137 Ga0068861_100258607 3300005719 Bacteria 1489
138 Ga0068861_101750191 3300005719 Bacteria 615
139 Ga0068870_10624676 3300005840 Bacteria 735
140 Ga0068863_100276087 3300005841 Bacteria 1627
141 Ga0068863_101101683 3300005841 Bacteria 799
142 Ga0068863_101336523 3300005841 Bacteria 724
143 Ga0068858_100060155 3300005842 Bacteria 3511
144 Ga0068858_100266626 3300005842 Bacteria 1629
145 Ga0068860_100247013 3300005843 Bacteria 1737
146 Ga0068860_100270075 3300005843 Bacteria 1659
147 Ga0068862_100085066 3300005844 Bacteria 2748
148 Ga0068862_100170988 3300005844 Bacteria 1945
149 Ga0068862_100228976 3300005844 Bacteria 1685
150 Ga0068862_100315519 3300005844 Bacteria 1442
151 Ga0081455_10029662 3300005937 Bacteria 4984
152 Ga0081455_10109650 3300005937 Bacteria 2196
153 Ga0081455_10265399 3300005937 Bacteria 1248
154 Ga0081540_1001339 3300005983 Bacteria 21460
155 Ga0081540_1007193 3300005983 Bacteria 7985
156 Ga0081540_1007306 3300005983 Bacteria 7903
157 Ga0081540_1007993 3300005983 Bacteria 7446
158 Ga0081540_1016547 3300005983 Bacteria 4607
159 Ga0081540_1026662 3300005983 Bacteria 3291
160 Ga0081540_1076704 3300005983 Bacteria 1522
161 Ga0081540_1101767 3300005983 Bacteria 1236
162 Ga0081540_1116499 3300005983 Bacteria 1118
163 Ga0081540_1233257 3300005983 Bacteria 649
164 Ga0081539_10000848 3300005985 Bacteria 58499
165 Ga0081539_10012348 3300005985 Bacteria 6599
166 Ga0075365_10016437 3300006038 Bacteria 4501
167 Ga0075365_10032321 3300006038 Bacteria 3362
168 Ga0075365_10041163 3300006038 Bacteria 3017
169 Ga0075365_10075675 3300006038 Bacteria 2272
170 Ga0075365_10082863 3300006038 Bacteria 2175
171 Ga0075365_10504620 3300006038 Bacteria 855
172 Ga0075365_10728030 3300006038 Bacteria 701
173 Ga0075365_10836182 3300006038 Bacteria 650
174 Ga0075368_10003948 3300006042 Bacteria 4995
175 Ga0075363_100014770 3300006048 Bacteria 3825
176 Ga0075363_100122388 3300006048 Bacteria 1454
177 Ga0075363_100155479 3300006048 Bacteria 1293
178 Ga0075363_100418580 3300006048 Bacteria 789
179 Ga0075363_100428285 3300006048 Bacteria 780
180 Ga0075364_10058712 3300006051 Bacteria 2521
181 Ga0075364_10319221 3300006051 Bacteria 1058
182 Ga0075364_10339815 3300006051 Bacteria 1023
183 Ga0070715_10503674 3300006163 Bacteria 694
184 Ga0070716_100034174 3300006173 Bacteria 2786
185 Ga0070716_100154821 3300006173 Bacteria 1478
186 Ga0070716_100367307 3300006173 Bacteria 1024
187 Ga0070712_100073635 3300006175 Bacteria 2451
188 Ga0070712_100217090 3300006175 Bacteria 1512
189 Ga0070712_100377683 3300006175 Bacteria 1166
190 Ga0070712_100413189 3300006175 Bacteria 1117
191 Ga0070712_100685446 3300006175 Bacteria 873
192 Ga0075362_10086410 3300006177 Bacteria 1451
193 Ga0075362_10136051 3300006177 Bacteria 1172
194 Ga0075367_10040157 3300006178 Bacteria 2731
195 Ga0075367_10075171 3300006178 Bacteria 2037
196 Ga0075367_10136379 3300006178 Bacteria 1518
197 Ga0075367_10192724 3300006178 Bacteria 1272
198 Ga0075367_10388212 3300006178 Bacteria 882
199 Ga0075369_10095939 3300006186 Bacteria 1327
200 Ga0075369_10137108 3300006186 Bacteria 1114
201 Ga0075369_10206152 3300006186 Bacteria 908
202 Ga0075369_10239910 3300006186 Bacteria 841
203 Ga0075366_10024888 3300006195 Bacteria 3492
204 Ga0075366_10032034 3300006195 Bacteria 3094
205 Ga0075366_10050422 3300006195 Bacteria 2471
206 Ga0075366_10196605 3300006195 Bacteria 1226
207 Ga0075366_10483993 3300006195 Bacteria 765
208 Ga0075366_10551633 3300006195 Bacteria 714
209 Ga0075366_10637687 3300006195 Bacteria 661
210 Ga0097621_100647048 3300006237 Bacteria 970
211 Ga0097621_100795721 3300006237 Bacteria 876
212 Ga0075370_10005105 3300006353 Bacteria 6470
213 Ga0075370_10020322 3300006353 Bacteria 3627
214 Ga0075370_10094272 3300006353 Bacteria 1728
215 Ga0075370_10138407 3300006353 Bacteria 1423
216 Ga0075370_10201833 3300006353 Bacteria 1173
217 Ga0068871_100031423 3300006358 Bacteria 4188
218 Ga0068871_100104460 3300006358 Bacteria 2376
219 Ga0068871_101681277 3300006358 Bacteria 602
220 Ga0075428_100157112 3300006844 Bacteria 2469
221 Ga0075434_100189929 3300006871 Bacteria 2074
222 Ga0075434_100444533 3300006871 Bacteria 1318
223 Ga0068865_100109505 3300006881 Bacteria 2035
224 Ga0068865_100849440 3300006881 Bacteria 791
225 Ga0068865_101658442 3300006881 Bacteria 576
226 Ga0075436_100624736 3300006914 Bacteria 795
227 Ga0097620_100029232 3300006931 Bacteria 5530
228 Ga0097620_100157985 3300006931 Bacteria 2346
229 Ga0075435_100341705 3300007076 Bacteria 1283
230 Ga0099794_10044583 3300007265 Bacteria 2120
231 Ga0099794_10102428 3300007265 Bacteria 1430
232 Ga0099795_10002812 3300007788 Bacteria 4192
233 Ga0099795_10043944 3300007788 Bacteria 1601
234 Ga0099795_10142251 3300007788 Bacteria 976
235 Ga0099795_10217289 3300007788 Bacteria 812
236 Ga0105240_10309970 3300009093 Bacteria 1803
237 Ga0105240_10502270 3300009093 Bacteria 1348
238 Ga0111539_10071397 3300009094 Bacteria 4097
239 Ga0111539_11000866 3300009094 Bacteria 972
240 Ga0105245_10060551 3300009098 Bacteria 3410
241 Ga0105245_11602772 3300009098 Bacteria 703
242 Ga0105247_10406197 3300009101 Bacteria 972
243 Ga0105243_10501348 3300009148 Bacteria 1150
244 Ga0105243_10638961 3300009148 Bacteria 1030
245 Ga0105243_10702884 3300009148 Bacteria 986
246 Ga0105243_10737151 3300009148 Bacteria 965
247 Ga0105241_10012915 3300009174 Bacteria 6127
248 Ga0105241_10392659 3300009174 Bacteria 1215
249 Ga0105241_10514380 3300009174 Bacteria 1070
250 Ga0105242_10035582 3300009176 Bacteria 3993
251 Ga0105242_10506722 3300009176 Bacteria 1149
252 Ga0105242_11303406 3300009176 Bacteria 750
253 Ga0105248_10172136 3300009177 Bacteria 2441
254 Ga0105248_11181365 3300009177 Bacteria 865
255 Ga0105237_10018023 3300009545 Bacteria 7315
256 Ga0105237_10137184 3300009545 Bacteria 2441
257 Ga0105237_10208119 3300009545 Bacteria 1956
258 Ga0105237_10448755 3300009545 Bacteria 1296
259 Ga0105237_11045357 3300009545 Bacteria 823
260 Ga0105238_10202605 3300009551 Bacteria 1960
261 Ga0105238_10572463 3300009551 Bacteria 1135
262 Ga0105238_10575588 3300009551 Bacteria 1132
263 Ga0105238_11314755 3300009551 Bacteria 749
264 Ga0105249_10311426 3300009553 Bacteria 1583
265 Ga0105249_10513667 3300009553 Bacteria 1245
266 Ga0105249_10910747 3300009553 Bacteria 946
267 Ga0099796_10009289 3300010159 Bacteria 2656
268 Ga0099796_10151157 3300010159 Bacteria 914
269 Ga0099796_10295163 3300010159 Bacteria 685
270 Ga0099796_10520424 3300010159 Bacteria 534
271 Ga0105239_10043909 3300010375 Bacteria 4901
272 Ga0105239_10048229 3300010375 Bacteria 4670
273 Ga0105239_10126823 3300010375 Bacteria 2837
274 Ga0105239_10267474 3300010375 Bacteria 1922
275 Ga0105239_10741915 3300010375 Bacteria 1124
276 Ga0105239_10753928 3300010375 Bacteria 1114
277 Ga0105239_10909995 3300010375 Bacteria 1010
278 Ga0105239_11142778 3300010375 Bacteria 897
279 Ga0105239_13432695 3300010375 Bacteria 515
280 Ga0105246_10085714 3300011119 Bacteria 2256
281 Ga0105246_10089670 3300011119 Bacteria 2213
282 Ga0105246_10199271 3300011119 Bacteria 1555
283 Ga0105246_10233447 3300011119 Bacteria 1450
284 Ga0105246_10783537 3300011119 Bacteria 844
285 Ga0105246_10839555 3300011119 Bacteria 818
286 Ga0105246_11006436 3300011119 Bacteria 755
287 Ga0157323_1011445 3300012495 Bacteria 715
288 Ga0157323_1011788 3300012495 Bacteria 710
289 Ga0157370_10026904 3300013104 Bacteria 5674
290 Ga0157374_10019278 3300013296 Bacteria 6036
291 Ga0157374_10066182 3300013296 Bacteria 3396
292 Ga0157374_10110883 3300013296 Bacteria 2639
293 Ga0157374_10388075 3300013296 Bacteria 1392
294 Ga0157374_12404282 3300013296 Bacteria 554
295 Ga0157378_10031236 3300013297 Bacteria 4704
296 Ga0157378_10547367 3300013297 Bacteria 1162
297 Ga0163162_10044547 3300013306 Bacteria 4444
298 Ga0163162_10129391 3300013306 Bacteria 2633
299 Ga0163162_10235980 3300013306 Bacteria 1959
300 Ga0163162_11179575 3300013306 Bacteria 869
301 Ga0157372_10494544 3300013307 Bacteria 1426
302 Ga0157375_10154583 3300013308 Bacteria 2432
303 Ga0157375_10174025 3300013308 Bacteria 2301
304 Ga0157375_10174992 3300013308 Bacteria 2295
305 Ga0157375_10227133 3300013308 Bacteria 2025
306 Ga0157375_10836715 3300013308 Bacteria 1067
307 Ga0163163_10057665 3300014325 Bacteria 3840
308 Ga0163163_10073225 3300014325 Bacteria 3416
309 Ga0163163_10203034 3300014325 Bacteria 2031
310 Ga0157380_10109465 3300014326 Bacteria 2318
311 Ga0157380_10157219 3300014326 Bacteria 1971
312 Ga0182008_10227787 3300014497 Bacteria 955
313 Ga0182008_10263072 3300014497 Bacteria 893
314 Ga0157377_10149709 3300014745 Bacteria 1442
315 Ga0157377_10686845 3300014745 Bacteria 741
316 Ga0157379_10060147 3300014968 Bacteria 3396
317 Ga0157379_10344996 3300014968 Bacteria 1362
318 Ga0157379_11240093 3300014968 Bacteria 718
319 Ga0157376_10046724 3300014969 Bacteria 3572
320 Ga0157376_10555669 3300014969 Bacteria 1137
321 Ga0157376_12963154 3300014969 Bacteria 514
322 Ga0163161_10088848 3300017792 Bacteria 2284
323 Ga0163161_11063447 3300017792 Bacteria 694
324 Ga0163161_11198956 3300017792 Bacteria 656
325 Ga0206356_10120399 3300020070 Bacteria 749
326 Ga0214542_1000004 3300021321 Bacteria 415597
327 Ga0214542_1037420 3300021321 Bacteria 1384
328 Ga0214545_1000005 3300021324 Bacteria 415590
329 Ga0214545_1035280 3300021324 Bacteria 1666
330 Ga0214543_1000111 3300021327 Bacteria 106517
331 Ga0214543_1033779 3300021327 Bacteria 1803
332 Ga0213876_10295971 3300021384 Bacteria 860
333 Ga0209563_102320 3300025230 Bacteria 4365
334 Ga0209677_101639 3300025253 Bacteria 9408
335 Ga0209677_102591 3300025253 Bacteria 6615
336 Ga0209148_1006467 3300025254 Bacteria 2537
337 Ga0209233_1004340 3300025261 Bacteria 4839
338 Ga0209233_1008872 3300025261 Bacteria 3083
339 Ga0209233_1027348 3300025261 Bacteria 1383
340 Ga0209455_1001472 3300025272 Bacteria 10597
341 Ga0209455_1001710 3300025272 Bacteria 9395
342 Ga0209564_1006563 3300025295 Bacteria 6245
343 Ga0209564_1031518 3300025295 Bacteria 1617
344 Ga0209758_1000102 3300025297 Bacteria 224851
345 Ga0209758_1003592 3300025297 Bacteria 13874
346 Ga0209758_1003725 3300025297 Bacteria 13511
347 Ga0209758_1005478 3300025297 Bacteria 9742
348 Ga0209758_1046037 3300025297 Bacteria 1577
349 Ga0209256_1004953 3300025299 Bacteria 7982
350 Ga0209256_1027989 3300025299 Bacteria 1598
351 Ga0207426_1002013 3300025302 Bacteria 14342
352 Ga0207426_1034873 3300025302 Bacteria 1611
353 Ga0209257_1003378 3300025304 Bacteria 13780
354 Ga0207697_10065223 3300025315 Bacteria 1519
355 Ga0207697_10216603 3300025315 Bacteria 844
356 Ga0207697_10443720 3300025315 Bacteria 575
357 Ga0207692_10407209 3300025898 Bacteria 849
358 Ga0207692_10450057 3300025898 Bacteria 810
359 Ga0207692_10650649 3300025898 Bacteria 681
360 Ga0207642_10020324 3300025899 Bacteria 2589
361 Ga0207642_10396173 3300025899 Bacteria 825
362 Ga0207642_10469724 3300025899 Bacteria 765
363 Ga0207710_10164150 3300025900 Bacteria 1083
364 Ga0207688_10019383 3300025901 Bacteria 3705
365 Ga0207688_10088637 3300025901 Bacteria 1774
366 Ga0207688_10089460 3300025901 Bacteria 1766
367 Ga0207688_10344528 3300025901 Bacteria 917
368 Ga0207680_10163305 3300025903 Bacteria 1495
369 Ga0207680_10169761 3300025903 Bacteria 1468
370 Ga0207647_10011423 3300025904 Bacteria 6230
371 Ga0207685_10233027 3300025905 Bacteria 882
372 Ga0207699_10129981 3300025906 Bacteria 1641
373 Ga0207645_10092170 3300025907 Bacteria 1949
374 Ga0207645_10184660 3300025907 Bacteria 1369
375 Ga0207705_10061486 3300025909 Bacteria 2713
376 Ga0207705_10216616 3300025909 Bacteria 1453
377 Ga0207705_10234508 3300025909 Bacteria 1396
378 Ga0207684_10186080 3300025910 Bacteria 1791
379 Ga0207684_10639812 3300025910 Bacteria 907
380 Ga0207654_10014746 3300025911 Bacteria 4042
381 Ga0207654_10463892 3300025911 Bacteria 890
382 Ga0207707_10011000 3300025912 Bacteria 7874
383 Ga0207707_11354883 3300025912 Bacteria 569
384 Ga0207695_10234230 3300025913 Bacteria 1739
385 Ga0207671_10083323 3300025914 Bacteria 2401
386 Ga0207671_10119378 3300025914 Bacteria 2014
387 Ga0207671_10307417 3300025914 Bacteria 1253
388 Ga0207671_10703069 3300025914 Bacteria 804
389 Ga0207693_10009325 3300025915 Bacteria 8001
390 Ga0207693_10017747 3300025915 Bacteria 5675
391 Ga0207693_10122761 3300025915 Bacteria 2040
392 Ga0207693_10244528 3300025915 Bacteria 1408
393 Ga0207663_10025502 3300025916 Bacteria 3419
394 Ga0207663_10100721 3300025916 Bacteria 1939
395 Ga0207657_10166797 3300025919 Bacteria 1786
396 Ga0207657_10556936 3300025919 Bacteria 896
397 Ga0207657_11061567 3300025919 Bacteria 620
398 Ga0207649_10066665 3300025920 Bacteria 2283
399 Ga0207652_10158337 3300025921 Bacteria 2029
400 Ga0207646_10261644 3300025922 Bacteria 1563
401 Ga0207681_10214086 3300025923 Bacteria 1487
402 Ga0207681_10901979 3300025923 Bacteria 740
403 Ga0207681_11009395 3300025923 Bacteria 698
404 Ga0207694_10122221 3300025924 Bacteria 2079
405 Ga0207694_10572641 3300025924 Bacteria 949
406 Ga0207694_10628845 3300025924 Bacteria 904
407 Ga0207694_11328088 3300025924 Bacteria 608
408 Ga0207650_10562013 3300025925 Bacteria 957
409 Ga0207659_10220386 3300025926 Bacteria 1525
410 Ga0207659_10550945 3300025926 Bacteria 980
411 Ga0207687_10299895 3300025927 Bacteria 1294
412 Ga0207687_10691934 3300025927 Bacteria 865
413 Ga0207700_11115625 3300025928 Bacteria 705
414 Ga0207700_11704156 3300025928 Bacteria 556
415 Ga0207664_11208542 3300025929 Bacteria 674
416 Ga0207644_10178384 3300025931 Bacteria 1663
417 Ga0207644_10273138 3300025931 Bacteria 1355
418 Ga0207644_10516522 3300025931 Bacteria 986
419 Ga0207644_11006653 3300025931 Bacteria 699
420 Ga0207690_10268274 3300025932 Bacteria 1325
421 Ga0207690_11222132 3300025932 Bacteria 628
422 Ga0207706_10020636 3300025933 Bacteria 5921
423 Ga0207706_10218356 3300025933 Bacteria 1670
424 Ga0207706_10465884 3300025933 Bacteria 1092
425 Ga0207686_10170721 3300025934 Bacteria 1533
426 Ga0207686_10256367 3300025934 Bacteria 1280
427 Ga0207686_10445902 3300025934 Bacteria 995
428 Ga0207686_10692655 3300025934 Bacteria 809
429 Ga0207709_10041130 3300025935 Bacteria 2772
430 Ga0207709_11248901 3300025935 Bacteria 613
431 Ga0207709_11616757 3300025935 Bacteria 538
432 Ga0207670_10039211 3300025936 Bacteria 3101
433 Ga0207670_10925765 3300025936 Bacteria 731
434 Ga0207669_10007035 3300025937 Bacteria 5176
435 Ga0207704_10062027 3300025938 Bacteria 2322
436 Ga0207704_10133658 3300025938 Bacteria 1723
437 Ga0207665_10023296 3300025939 Bacteria 4078
438 Ga0207665_10101928 3300025939 Bacteria 2005
439 Ga0207665_10651826 3300025939 Bacteria 825
440 Ga0207665_11424140 3300025939 Bacteria 551
441 Ga0207691_10103322 3300025940 Bacteria 2541
442 Ga0207691_10552016 3300025940 Bacteria 977
443 Ga0207711_10316425 3300025941 Bacteria 1441
444 Ga0207711_10334427 3300025941 Bacteria 1401
445 Ga0207689_10391727 3300025942 Bacteria 1157
446 Ga0207689_10443619 3300025942 Bacteria 1084
447 Ga0207689_10627672 3300025942 Bacteria 905
448 Ga0207689_11080396 3300025942 Bacteria 676
449 Ga0207661_10570559 3300025944 Bacteria 1037
450 Ga0207661_10576659 3300025944 Bacteria 1032
451 Ga0207679_10318278 3300025945 Bacteria 1346
452 Ga0207679_11130151 3300025945 Bacteria 719
453 Ga0207667_10050380 3300025949 Bacteria 4394
454 Ga0207667_12040882 3300025949 Bacteria 533
455 Ga0207651_10064111 3300025960 Bacteria 2570
456 Ga0207668_10008217 3300025972 Bacteria 6216
457 Ga0207668_10173030 3300025972 Bacteria 1695
458 Ga0207668_10262230 3300025972 Bacteria 1409
459 Ga0207668_10683879 3300025972 Bacteria 900
460 Ga0207668_10836322 3300025972 Bacteria 817
461 Ga0207640_10048550 3300025981 Bacteria 2745
462 Ga0207640_10123950 3300025981 Bacteria 1857
463 Ga0207658_10075824 3300025986 Bacteria 2560
464 Ga0207658_10180619 3300025986 Bacteria 1746
465 Ga0207658_10554862 3300025986 Bacteria 1028
466 Ga0207658_10837159 3300025986 Bacteria 836
467 Ga0207658_11253074 3300025986 Bacteria 678
468 Ga0207658_12090848 3300025986 Bacteria 515
469 Ga0207677_10110732 3300026023 Bacteria 2044
470 Ga0207677_10234842 3300026023 Bacteria 1480
471 Ga0207677_10527442 3300026023 Bacteria 1025
472 Ga0207677_10535789 3300026023 Bacteria 1018
473 Ga0207677_11600840 3300026023 Bacteria 603
474 Ga0207703_10193232 3300026035 Bacteria 1804
475 Ga0207639_10098940 3300026041 Bacteria 2352
476 Ga0207639_10164849 3300026041 Bacteria 1871
477 Ga0207639_10167178 3300026041 Bacteria 1859
478 Ga0207639_10249569 3300026041 Bacteria 1547
479 Ga0207639_11186091 3300026041 Bacteria 716
480 Ga0207678_10004216 3300026067 Bacteria 12904
481 Ga0207678_10060134 3300026067 Bacteria 3268
482 Ga0207678_10089469 3300026067 Bacteria 2631
483 Ga0207678_10099974 3300026067 Bacteria 2478
484 Ga0207678_10123758 3300026067 Bacteria 2207
485 Ga0207678_10227790 3300026067 Bacteria 1596
486 Ga0207678_10397726 3300026067 Bacteria 1193
487 Ga0207678_10402078 3300026067 Bacteria 1186
488 Ga0207708_10049842 3300026075 Bacteria 3189
489 Ga0207702_10229418 3300026078 Bacteria 1734
490 Ga0207702_10327935 3300026078 Bacteria 1459
491 Ga0207641_10308005 3300026088 Bacteria 1498
492 Ga0207641_10365347 3300026088 Bacteria 1379
493 Ga0207641_10951971 3300026088 Bacteria 854
494 Ga0207641_11255460 3300026088 Bacteria 741
495 Ga0207648_10097170 3300026089 Bacteria 2578
496 Ga0207648_10293405 3300026089 Bacteria 1456
497 Ga0207676_10162342 3300026095 Bacteria 1937
498 Ga0207676_10669756 3300026095 Bacteria 1003
499 Ga0207676_10894876 3300026095 Bacteria 870
500 Ga0207674_10091381 3300026116 Bacteria 3034
501 Ga0207674_10309414 3300026116 Bacteria 1529
502 Ga0207675_100049241 3300026118 Bacteria 3933
503 Ga0207675_100126297 3300026118 Bacteria 2423
504 Ga0207683_10029544 3300026121 Bacteria 4746
505 Ga0207683_10051305 3300026121 Bacteria 3614
506 Ga0207683_10060366 3300026121 Bacteria 3333
507 Ga0207683_10212381 3300026121 Bacteria 1762
508 Ga0207683_10972293 3300026121 Bacteria 788
509 Ga0207683_11677118 3300026121 Bacteria 585
510 Ga0207683_11865045 3300026121 Bacteria 550
511 Ga0207698_10367021 3300026142 Bacteria 1365
512 Ga0207698_10554453 3300026142 Bacteria 1127
513 Ga0209179_1008779 3300027512 Bacteria 1714
514 Ga0209588_1019784 3300027671 Bacteria 2105
515 Ga0207428_10368040 3300027907 Bacteria 1056
516 Ga0207428_10923875 3300027907 Bacteria 616
517 Ga0268266_10001136 3300028379 Bacteria 33101
518 Ga0268266_10003686 3300028379 Bacteria 15118
519 Ga0268266_10094515 3300028379 Bacteria 2624
520 Ga0268266_10190353 3300028379 Bacteria 1873
521 Ga0268266_10388186 3300028379 Bacteria 1318
522 Ga0268266_10654635 3300028379 Bacteria 1011
523 Ga0268266_10731320 3300028379 Bacteria 954
524 Ga0268266_10742093 3300028379 Bacteria 947
525 Ga0268266_11265124 3300028379 Bacteria 713
526 Ga0268265_10061941 3300028380 Bacteria 2873
527 Ga0268265_10124640 3300028380 Bacteria 2129
528 Ga0268265_10192550 3300028380 Bacteria 1762
529 Ga0268265_10198444 3300028380 Bacteria 1738
530 Ga0268265_10480048 3300028380 Bacteria 1167
531 Ga0268265_10564923 3300028380 Bacteria 1082
532 Ga0268264_10192667 3300028381 Bacteria 1859
533 Ga0265318_10079770 3300028577 Bacteria 1209
534 Ga0265323_10018266 3300028653 Bacteria 2715
535 Ga0265322_10117807 3300028654 Bacteria 756
536 Ga0265336_10000415 3300028666 Bacteria 26412
537 Ga0307517_10000098 3300028786 Bacteria 126044
538 Ga0307517_10111579 3300028786 Bacteria 2077
539 Ga0265338_10010045 3300028800 Bacteria 11184
540 Ga0265324_10017627 3300029957 Bacteria 2597
541 Ga0307513_10418783 3300031456 Bacteria 1070
542 Ga0307509_10128015 3300031507 Bacteria 2501
543 Ga0307408_100232397 3300031548 Bacteria 1511
544 Ga0307508_10127944 3300031616 Bacteria 2143
545 Ga0307516_10046388 3300031730 Bacteria 4287
546 Ga0307516_10053240 3300031730 Bacteria 3958
547 Ga0307405_10315500 3300031731 Bacteria 1192
548 Ga0307405_10505101 3300031731 Bacteria 970
549 Ga0307413_10171007 3300031824 Bacteria 1538
550 Ga0307413_11473637 3300031824 Bacteria 601
551 Ga0307410_11425331 3300031852 Bacteria 609
552 Ga0307407_10761295 3300031903 Bacteria 734
553 Ga0307412_10401698 3300031911 Bacteria 1116
554 Ga0307409_100546889 3300031995 Bacteria 1136
555 Ga0307416_101218302 3300032002 Bacteria 858
556 Ga0307414_11399194 3300032004 Bacteria 650
557 Ga0307411_10076739 3300032005 Bacteria 2285
558 Ga0307411_10843113 3300032005 Bacteria 810
559 Ga0307411_11395977 3300032005 Bacteria 641
560 Ga0307415_100297967 3300032126 Bacteria 1334
561 Ga0307507_10560606 3300033179 Bacteria 600
562 Ga0307510_10007562 3300033180 Bacteria 12946
563 Ga0307510_10327889 3300033180 Bacteria 986
564 Ga0373940_0200791 3300035088 Bacteria 655
565 Ga0373940_0336714 3300035088 Bacteria 527
566 Ga0373952_0095837 3300035092 Bacteria 777
567 Ga0373936_0043384 3300035113 Bacteria 1807
568 Ga0373945_0075784 3300035116 Bacteria 1281
569 Ga0373945_0101051 3300035116 Bacteria 1128
570 Ga0373956_0259800 3300035119 Bacteria 826
571 Ga0373943_0121755 3300035170 Bacteria 1387
572 Ga0373943_0139389 3300035170 Bacteria 1305
573 Ga0373943_0152823 3300035170 Bacteria 1251
574 Ga0373946_0176394 3300035171 Bacteria 1012
575 Ga0373946_0267866 3300035171 Bacteria 837
576 Ga0373955_0071154 3300035172 Bacteria 1945
577 Ga0373924_0048356 3300035410 Bacteria 1757
578 Ga0373931_0020927 3300035691 Bacteria 3277
579 Ga0373935_0000520 3300035692 Bacteria 20054
580 Ga0373927_0000046 3300035695 Bacteria 88401
581 Ga0373927_0009305 3300035695 Bacteria 6590
582 Ga0373927_0039246 3300035695 Bacteria 3073
583 Ga0373947_0001392 3300035725 Bacteria 14902
584 Ga0373947_0038071 3300035725 Bacteria 2855
585 Ga0373947_0165966 3300035725 Bacteria 1430
586 Ga0373937_0048844 3300036401 Bacteria 3874
587 Ga0373925_0009905 3300037068 Bacteria 6924
588 Ga0373925_0013452 3300037068 Bacteria 5923
589 Ga0373925_0023664 3300037068 Bacteria 4482
590 Ga0373925_0390614 3300037068 Bacteria 1134
591 Ga0395899_0154753 3300037312 Bacteria 1623
592 Ga0395900_0016187 3300037418 Bacteria 7597
593 Ga0395898_0475635 3300037466 Bacteria 1189
594 Ga0395905_0081275 3300037471 Bacteria 3037
595 Ga0395905_0147099 3300037471 Bacteria 2217
596 Ga0395905_0344285 3300037471 Bacteria 1382
597 Ga0395905_0860914 3300037471 Bacteria 809
598 Ga0436364_0581979 3300037853 Bacteria 989
599 Ga0395901_0097370 3300038443 Bacteria 3084
600 Ga0395901_0733717 3300038443 Bacteria 982
601 Ga0436365_0808674 3300039437 Bacteria 1431
602 Ga0436365_0939911 3300039437 Bacteria 867
603 Ga0436363_1563002 3300039450 Bacteria 508
604 Ga0436362_1153757 3300039453 Bacteria 603
605 Ga0439466_0205551 3300041411 Bacteria 599
606 Ga0439465_0093118 3300041413 Bacteria 1033
607 Ga0451787_184996 3300041441 Bacteria 635
608 Ga0451787_288168 3300041441 Bacteria 801
609 Ga0451793_0362601 3300041452 Bacteria 827
610 Ga0451797_1560878 3300041453 Bacteria 544
611 Ga0451800_1224866 3300041459 Bacteria 940
612 Ga0451802_1494618 3300041460 Bacteria 619
613 Ga0451833_0138182 3300041491 Bacteria 1056
614 Ga0451841_0540834 3300041498 Bacteria 1072
615 Ga0451849_0041184 3300041505 Bacteria 1084
616 Ga0451849_0883225 3300041505 Bacteria 701
617 Ga0451851_0496392 3300041507 Bacteria 914
618 Ga0451851_0647873 3300041507 Bacteria 516
619 Ga0451851_1102993 3300041507 Bacteria 532
620 Ga0451853_1338784 3300041512 Bacteria 1004
621 Ga0451853_3741495 3300041512 Bacteria 815
622 Ga0439458_0159765 3300042157 Bacteria 606
623 Ga0466972_0013988 3300044658 Bacteria 4024
624 Ga0466965_0127668 3300044683 Bacteria 1317
625 Ga0466964_0264110 3300044706 Bacteria 854
626 Ga0466971_0157021 3300044719 Bacteria 1064
627 Ga0466968_0003372 3300044735 Bacteria 5903
628 Ga0466957_0105153 3300044842 Bacteria 1784
629 Ga0466957_1093303 3300044842 Bacteria 575
630 Ga0466960_0008649 3300044901 Bacteria 4174
631 Ga0466960_0130216 3300044901 Bacteria 1327
632 Ga0466959_0154824 3300045049 Bacteria 1614
633 Ga0495617_231405 3300046452 Bacteria 572
634 Ga0495592_0036407 3300046454 Bacteria 3707
635 Ga0495603_0000051 3300046455 Bacteria 50402
636 Ga0495603_0072096 3300046455 Bacteria 2029
637 Ga0495603_0074766 3300046455 Bacteria 1989
638 Ga0495603_0074854 3300046455 Bacteria 1988
639 Ga0495590_0077288 3300046457 Bacteria 1171
640 Ga0495629_0000182 3300046459 Bacteria 56655
641 Ga0495629_0896585 3300046459 Bacteria 581
642 Ga0495638_0021430 3300046460 Bacteria 4259
643 Ga0495638_0139137 3300046460 Bacteria 1418
644 Ga0495638_0266085 3300046460 Bacteria 938
645 Ga0495638_0526218 3300046460 Bacteria 591
646 Ga0495638_0526497 3300046460 Bacteria 591
647 Ga0495641_0006374 3300046461 Bacteria 7658
648 Ga0495653_0200693 3300046463 Bacteria 1354
649 Ga0495650_0130564 3300046471 Bacteria 917
650 Ga0495580_0004021 3300046472 Bacteria 12411
651 Ga0495580_0291464 3300046472 Bacteria 1112
652 Ga0495582_0000137 3300046473 Bacteria 39425
653 Ga0495582_0229642 3300046473 Bacteria 1062
654 Ga0495582_0482908 3300046473 Bacteria 716
655 Ga0495605_0227921 3300046474 Bacteria 803
656 Ga0495639_0002873 3300046475 Bacteria 7493
657 Ga0495639_0254363 3300046475 Bacteria 869
658 Ga0495639_0620166 3300046475 Bacteria 557
659 Ga0495662_0000583 3300046476 Bacteria 16810
660 Ga0495664_0009075 3300046477 Bacteria 5560
661 Ga0495584_0104087 3300046491 Bacteria 1435
662 Ga0495584_0181275 3300046491 Bacteria 1070
663 Ga0495584_0403064 3300046491 Bacteria 695
664 Ga0495584_0507590 3300046491 Bacteria 614
665 Ga0495585_0029073 3300046492 Bacteria 3148
666 Ga0495585_0275017 3300046492 Bacteria 834
667 Ga0495594_0001833 3300046499 Bacteria 11057
668 Ga0495594_0042613 3300046499 Bacteria 2486
669 Ga0495594_0107854 3300046499 Bacteria 1569
670 Ga0495596_0063639 3300046500 Bacteria 1435
671 Ga0495596_0194477 3300046500 Bacteria 788
672 Ga0495607_0393938 3300046501 Bacteria 631
673 Ga0495583_0025223 3300046506 Bacteria 2974
674 Ga0495606_0119588 3300046507 Bacteria 1578
675 Ga0495606_0122562 3300046507 Bacteria 1554
676 Ga0495606_0157047 3300046507 Bacteria 1330
677 Ga0495606_0444146 3300046507 Bacteria 666
678 Ga0495610_0100069 3300046512 Bacteria 1300
679 Ga0495616_0162322 3300046513 Bacteria 1004
680 Ga0495618_0523518 3300046514 Bacteria 713
681 Ga0495620_0159318 3300046515 Bacteria 877
682 Ga0495620_0169679 3300046515 Bacteria 846
683 Ga0495628_0021321 3300046516 Bacteria 5332
684 Ga0495630_0002625 3300046517 Bacteria 12446
685 Ga0495630_0269329 3300046517 Bacteria 1301
686 Ga0495630_1347834 3300046517 Bacteria 537
687 Ga0495631_0015803 3300046518 Bacteria 3609
688 Ga0495631_0089133 3300046518 Bacteria 1328
689 Ga0495631_0197719 3300046518 Bacteria 860
690 Ga0495631_0511994 3300046518 Bacteria 511
691 Ga0495632_0055923 3300046519 Bacteria 1930
692 Ga0495632_0138876 3300046519 Bacteria 1128
693 Ga0495632_0148961 3300046519 Bacteria 1082
694 Ga0495632_0294698 3300046519 Bacteria 720
695 Ga0495643_0012291 3300046522 Bacteria 5170
696 Ga0495643_0074090 3300046522 Bacteria 1784
697 Ga0495643_0250555 3300046522 Bacteria 827
698 Ga0495644_0091283 3300046523 Bacteria 1150
699 Ga0495644_0220346 3300046523 Bacteria 733
700 Ga0495648_0146427 3300046524 Bacteria 1237
701 Ga0495648_0336875 3300046524 Bacteria 694
702 Ga0495663_0064127 3300046525 Bacteria 1159
703 Ga0495666_0386634 3300046526 Bacteria 629
704 Ga0495666_0391769 3300046526 Bacteria 625
705 Ga0495642_0166942 3300046528 Bacteria 956
706 Ga0495652_0037670 3300046529 Bacteria 4194
707 Ga0495654_0349189 3300046530 Bacteria 595
708 Ga0495665_0001239 3300046531 Bacteria 13612
709 Ga0495640_0004375 3300046533 Bacteria 11274
710 Ga0495598_0046091 3300046537 Bacteria 1294
711 Ga0495621_0018971 3300046539 Bacteria 2240
712 Ga0495597_0033416 3300046542 Bacteria 2329
713 Ga0495597_0051282 3300046542 Bacteria 1820
714 Ga0495597_0344586 3300046542 Bacteria 572
715 Ga0495622_0005490 3300046557 Bacteria 5879
716 Ga0495622_0016785 3300046557 Bacteria 3410
717 Ga0495622_0135417 3300046557 Bacteria 1120
718 Ga0495622_0205157 3300046557 Bacteria 877
719 Ga0495633_0109329 3300046558 Bacteria 1282
720 Ga0495633_0242170 3300046558 Bacteria 824
721 Ga0495667_0011352 3300046559 Bacteria 6031
722 Ga0495656_0016955 3300046615 Bacteria 2772
723 Ga0495656_0200527 3300046615 Bacteria 990
724 Ga0495656_0214078 3300046615 Bacteria 961
725 Ga0495668_0026683 3300046616 Bacteria 3276
726 Ga0495668_0029504 3300046616 Bacteria 3099
727 Ga0495668_0029734 3300046616 Bacteria 3086
728 Ga0495668_0052320 3300046616 Bacteria 2260
729 Ga0495668_0203406 3300046616 Bacteria 1084
730 Ga0495668_0482000 3300046616 Bacteria 683
731 Ga0495634_0002221 3300046642 Bacteria 16276
732 Ga0495611_0126279 3300046648 Bacteria 1193
733 Ga0495625_0058534 3300046660 Bacteria 2738
734 Ga0495625_0094413 3300046660 Bacteria 2064
735 Ga0495625_0140569 3300046660 Bacteria 1629
736 Ga0495625_0185164 3300046660 Bacteria 1382
737 Ga0495625_0391655 3300046660 Bacteria 870
738 Ga0495625_0711609 3300046660 Bacteria 592
739 Ga0495635_0001455 3300046663 Bacteria 15846
740 Ga0495635_0978415 3300046663 Bacteria 539
741 Ga0495659_0061547 3300046664 Bacteria 1387
742 Ga0495661_0247668 3300046665 Bacteria 911
743 Ga0495588_0046469 3300046674 Bacteria 2227
744 Ga0495588_0082492 3300046674 Bacteria 1679
745 Ga0495657_0147798 3300046675 Bacteria 1461
746 Ga0495646_0048867 3300046680 Bacteria 2569
747 Ga0495647_0032438 3300046681 Bacteria 1946
748 Ga0495647_0223727 3300046681 Bacteria 831
749 Ga0495658_0469737 3300046683 Bacteria 804
750 Ga0495669_0007993 3300046684 Bacteria 4439
751 Ga0495669_0255061 3300046684 Bacteria 842
752 Ga0495669_0316823 3300046684 Bacteria 752
753 Ga0495669_0470253 3300046684 Bacteria 611
754 Ga0495613_0047965 3300046689 Bacteria 3154
755 Ga0495624_0000898 3300046690 Bacteria 23624
756 Ga0495624_0145609 3300046690 Bacteria 1450
757 Ga0495624_0564993 3300046690 Bacteria 679
758 Ga0495670_0250616 3300046691 Bacteria 944
759 Ga0495670_0334925 3300046691 Bacteria 813
760 Ga0495671_0084494 3300046692 Bacteria 1555
761 Ga0495671_0089738 3300046692 Bacteria 1505
762 Ga0495671_0101526 3300046692 Bacteria 1406
763 Ga0495671_0165256 3300046692 Bacteria 1076
764 Ga0495649_0097432 3300046694 Bacteria 1565
765 Ga0495649_0157413 3300046694 Bacteria 1192
766 Ga0495649_0193763 3300046694 Bacteria 1057
767 Ga0495589_0103033 3300046794 Bacteria 1380
768 Ga0495589_0111160 3300046794 Bacteria 1322
769 Ga0495589_0129712 3300046794 Bacteria 1211
770 Ga0495600_0113596 3300046809 Bacteria 1763
771 Ga0495581_0007805 3300047315 Bacteria 6197
772 Ga0495581_0081158 3300047315 Bacteria 1878
773 Ga0495581_0425001 3300047315 Bacteria 774
774 Ga0495636_0097970 3300047318 Bacteria 1279
775 Ga0495636_0194356 3300047318 Bacteria 925
776 Ga0495636_0656702 3300047318 Bacteria 515
777 Ga0495674_0010092 3300047319 Bacteria 8948
778 Ga0495672_0025981 3300047320 Bacteria 3742
779 Ga0495672_0239678 3300047320 Bacteria 886
780 Ga0495672_0474812 3300047320 Bacteria 560
781 Ga0495676_0110086 3300047321 Bacteria 2023
782 Ga0495676_0127701 3300047321 Bacteria 1840
783 Ga0495680_0404157 3300047322 Bacteria 942
784 Ga0495683_0064475 3300047323 Bacteria 1809
785 Ga0495683_0478557 3300047323 Bacteria 508
786 Ga0495687_027560 3300047443 Bacteria 2657
787 Ga0495687_047752 3300047443 Bacteria 1841
788 Ga0495677_0067538 3300047445 Bacteria 1330
789 Ga0495677_0172629 3300047445 Bacteria 837
790 Ga0495679_138495 3300047446 Bacteria 658
791 Ga0495685_140734 3300047447 Bacteria 786
792 Ga0495673_0022298 3300047469 Bacteria 3107
793 Ga0495673_0103713 3300047469 Bacteria 1146
794 Ga0495673_0160362 3300047469 Bacteria 864
795 Ga0495673_0256112 3300047469 Bacteria 638
796 Ga0495673_0293941 3300047469 Bacteria 584
797 Ga0495684_0045864 3300047471 Bacteria 3344
798 Ga0495686_0143402 3300047472 Bacteria 1408
799 Ga0495686_0250754 3300047472 Bacteria 995
800 Ga0495593_0000469 3300047673 Bacteria 22695
801 Ga0495602_0385915 3300048088 Bacteria 1002
802 Ga0495614_0001926 3300048089 Bacteria 9106
803 Ga0495614_0409324 3300048089 Bacteria 638
804 Ga0495615_0197116 3300048090 Bacteria 620
805 Ga0495626_0275345 3300048091 Bacteria 670
806 Ga0496100_0001098 3300048903 Bacteria 13078
807 Ga0496100_0137249 3300048903 Bacteria 1729
808 Ga0496100_0223380 3300048903 Bacteria 1383
809 Ga0496101_0011608 3300048904 Bacteria 5851
810 Ga0496101_0232477 3300048904 Bacteria 1433
811 Ga0496101_0541375 3300048904 Bacteria 920
812 Ga0496101_0546160 3300048904 Bacteria 916
813 Ga0496101_0933369 3300048904 Bacteria 683
814 Ga0496102_0008520 3300048905 Bacteria 8791
815 Ga0496102_0153816 3300048905 Bacteria 2162
816 Ga0496102_0199985 3300048905 Bacteria 1883
817 Ga0496102_0380154 3300048905 Bacteria 1329
818 Ga0496102_0381156 3300048905 Bacteria 1327
819 Ga0496102_0410219 3300048905 Bacteria 1273
820 Ga0496102_0438380 3300048905 Bacteria 1226
821 Ga0496102_0476410 3300048905 Bacteria 1169
822 Ga0496102_0861647 3300048905 Bacteria 828
823 Ga0496103_0010717 3300048906 Bacteria 5424
824 Ga0496103_0037555 3300048906 Bacteria 2968
825 Ga0496103_0405205 3300048906 Bacteria 876
826 Ga0496103_0424841 3300048906 Bacteria 853
827 Ga0496103_1061774 3300048906 Bacteria 502
828 Ga0496104_0021810 3300048907 Bacteria 5883
829 Ga0496104_0026734 3300048907 Bacteria 5332
830 Ga0496104_0037264 3300048907 Bacteria 4548
831 Ga0496104_0116018 3300048907 Bacteria 2570
832 Ga0496104_0208151 3300048907 Bacteria 1868
833 Ga0496104_1671737 3300048907 Bacteria 539
834 Ga0496104_1770519 3300048907 Bacteria 520
835 Ga0496105_0030338 3300048908 Bacteria 4430
836 Ga0496105_0120936 3300048908 Bacteria 2159
837 Ga0496105_0207100 3300048908 Bacteria 1600
838 Ga0496105_0286727 3300048908 Bacteria 1326
839 Ga0496105_0345596 3300048908 Bacteria 1189
840 Ga0496106_0026464 3300048909 Bacteria 4320
841 Ga0496106_0123661 3300048909 Bacteria 2024
842 Ga0496106_0396800 3300048909 Bacteria 1109
843 Ga0496106_0500576 3300048909 Bacteria 976
844 Ga0496106_0680497 3300048909 Bacteria 821
845 Ga0496107_0021497 3300048910 Bacteria 4560
846 Ga0496108_0042075 3300048911 Bacteria 3813
847 Ga0496108_0196577 3300048911 Bacteria 1749
848 Ga0496108_0208945 3300048911 Bacteria 1694
849 Ga0496108_0256025 3300048911 Bacteria 1523
850 Ga0496108_0540220 3300048911 Bacteria 1017
851 Ga0496109_0049778 3300048912 Bacteria 3815
852 Ga0496109_0293021 3300048912 Bacteria 1534
853 Ga0496109_0365792 3300048912 Bacteria 1362
854 Ga0496109_0380566 3300048912 Bacteria 1333
855 Ga0496110_0066685 3300048913 Bacteria 3183
856 Ga0496110_0091129 3300048913 Bacteria 2727
857 Ga0496110_0288249 3300048913 Bacteria 1495
858 Ga0496110_0515209 3300048913 Bacteria 1088
859 Ga0496110_1657088 3300048913 Bacteria 550
860 Ga0496111_0040302 3300048914 Bacteria 3350
861 Ga0496111_0599596 3300048914 Bacteria 806
862 Ga0496111_0678287 3300048914 Bacteria 751
863 Ga0496112_0023844 3300048915 Bacteria 5852
864 Ga0496112_0025634 3300048915 Bacteria 5663
865 Ga0496112_0174342 3300048915 Bacteria 2116
866 Ga0496112_0353164 3300048915 Bacteria 1412
867 Ga0496112_0731438 3300048915 Bacteria 916
868 Ga0496113_0015425 3300048916 Bacteria 5250
869 Ga0496113_0054139 3300048916 Bacteria 3002
870 Ga0496113_0716176 3300048916 Bacteria 798
871 Ga0496113_1305035 3300048916 Bacteria 564
872 Ga0496114_0033230 3300048917 Bacteria 4249
873 Ga0496114_0345394 3300048917 Bacteria 1316
874 Ga0496114_0400728 3300048917 Bacteria 1215
875 Ga0496114_0793411 3300048917 Bacteria 825
876 Ga0496114_1533587 3300048917 Bacteria 554
877 Ga0496115_0017046 3300048918 Bacteria 5541
878 Ga0496115_0159969 3300048918 Bacteria 1861
879 Ga0496115_0288059 3300048918 Bacteria 1348
880 Ga0496115_0468347 3300048918 Bacteria 1016
881 Ga0496115_0868630 3300048918 Bacteria 697
882 Ga0496116_0198582 3300048919 Bacteria 1053
883 Ga0496118_0065065 3300048921 Bacteria 2670
884 Ga0496118_0086044 3300048921 Bacteria 2186
885 Ga0496118_0087129 3300048921 Bacteria 2167
886 Ga0496118_0120126 3300048921 Bacteria 1716
887 Ga0496118_0153875 3300048921 Bacteria 1434
888 Ga0496118_0310668 3300048921 Bacteria 860
889 Ga0496119_0043743 3300048922 Bacteria 2827
890 Ga0496119_0044857 3300048922 Bacteria 2778
891 Ga0496119_0046704 3300048922 Bacteria 2701
892 Ga0496119_0189829 3300048922 Bacteria 1071
893 Ga0496120_0012720 3300048923 Bacteria 5708
894 Ga0496120_0220357 3300048923 Bacteria 907
895 Ga0496121_0000265 3300048924 Bacteria 109251
896 Ga0496121_0011669 3300048924 Bacteria 9712
897 Ga0496121_0028222 3300048924 Bacteria 5229
898 Ga0496121_0044559 3300048924 Bacteria 3824
899 Ga0496121_0120593 3300048924 Bacteria 1981
900 Ga0496121_0267964 3300048924 Bacteria 1175
901 Ga0496121_0412556 3300048924 Bacteria 881
902 Ga0496121_0479793 3300048924 Bacteria 794
903 Ga0496121_0481239 3300048924 Bacteria 793
904 Ga0496122_0090249 3300048925 Bacteria 2092
905 Ga0496122_0093188 3300048925 Bacteria 2044
906 Ga0496122_0298659 3300048925 Bacteria 870
907 Ga0496124_0213718 3300048927 Bacteria 1457
908 Ga0496124_0226852 3300048927 Bacteria 1400
909 Ga0496124_0262119 3300048927 Bacteria 1271
910 Ga0496124_0331448 3300048927 Bacteria 1085
911 Ga0496125_0000176 3300048928 Bacteria 140746
912 Ga0496125_0034884 3300048928 Bacteria 4426
913 Ga0496125_0137109 3300048928 Bacteria 1709
914 Ga0496125_0206435 3300048928 Bacteria 1281
915 Ga0496126_0011852 3300048929 Bacteria 8969
916 Ga0496126_0015449 3300048929 Bacteria 7677
917 Ga0496126_0072217 3300048929 Bacteria 3070
918 Ga0496126_0122354 3300048929 Bacteria 2255
919 Ga0496126_0177512 3300048929 Bacteria 1811
920 Ga0496126_0262004 3300048929 Bacteria 1437
921 Ga0496126_0444729 3300048929 Bacteria 1044
922 Ga0496126_1143757 3300048929 Bacteria 576
923 Ga0495682_0018288 3300049460 Bacteria 2641
924 Ga0495682_0053712 3300049460 Bacteria 1463
925 Ga0495682_0066545 3300049460 Bacteria 1299
926 Ga0495682_0213564 3300049460 Bacteria 684
927 Ga0501038_0265551 3300049574 Bacteria 1355
928 Ga0501040_0715101 3300049576 Bacteria 724
929 Ga0501042_0374282 3300049578 Bacteria 1031
930 Ga0501067_0604891 3300049583 Bacteria 615
931 Ga0501074_0394278 3300049590 Bacteria 982
932 nmdc:mga03683_107519_c1 3300050489 Bacteria 1230
933 nmdc:mga03683_489268_c1 3300050489 Bacteria 595
934 nmdc:mga03n38_12993_c1 3300050490 Bacteria 3150
935 nmdc:mga03n38_483662_c1 3300050490 Bacteria 693
936 nmdc:mga00v17_69660_c1 3300050491 Bacteria 2177
937 nmdc:mga00v17_866497_c1 3300050491 Bacteria 573
938 nmdc:mga00v17_86774_c1 3300050491 Bacteria 1961
939 nmdc:mga0yw44_124038_c1 3300050492 Bacteria 1666
940 nmdc:mga0yw44_187882_c1 3300050492 Bacteria 1362
941 nmdc:mga0yw44_19763_c1 3300050492 Bacteria 3722
942 nmdc:mga0yw44_31797_c1 3300050492 Bacteria 3071
943 nmdc:mga0yw44_514125_c1 3300050492 Bacteria 813
944 nmdc:mga0yw44_5454_c2 3300050492 Bacteria 5426
945 nmdc:mga0yw44_638498_c1 3300050492 Bacteria 723
946 nmdc:mga0k408_148173_c1 3300050493 Bacteria 1397
947 nmdc:mga0k408_179196_c1 3300050493 Bacteria 1264
948 nmdc:mga0k408_519503_c1 3300050493 Bacteria 705
949 nmdc:mga0k408_571476_c1 3300050493 Bacteria 668
950 nmdc:mga06z11_199789_c1 3300050494 Bacteria 1161
951 nmdc:mga06z11_217349_c1 3300050494 Bacteria 1116
952 nmdc:mga06z11_224365_c1 3300050494 Bacteria 1099
953 nmdc:mga06z11_298090_c1 3300050494 Bacteria 958
954 nmdc:mga06z11_8466_c1 3300050494 Bacteria 4291
955 nmdc:mga06z11_93967_c1 3300050494 Bacteria 1633
956 nmdc:mga04h51_252344_c1 3300050495 Bacteria 707
957 nmdc:mga07m45_107497_c1 3300050496 Bacteria 1605
958 nmdc:mga07m45_190315_c1 3300050496 Bacteria 1193
959 nmdc:mga07m45_54052_c1 3300050496 Bacteria 2270
960 nmdc:mga07m45_59524_c1 3300050496 Bacteria 2161
961 nmdc:mga07m45_81713_c1 3300050496 Bacteria 1845
962 nmdc:mga09592_265942_c1 3300050508 Bacteria 1487
963 nmdc:mga06r32_893179_c1 3300050510 Bacteria 845
964 nmdc:mga08y16_1146190_c1 3300050511 Bacteria 750
965 nmdc:mga08y16_1285024_c1 3300050511 Bacteria 699
966 nmdc:mga08y16_635192_c1 3300050511 Bacteria 1073
967 nmdc:mga0n895_832353_c1 3300050512 Bacteria 912
968 nmdc:mga0rr50_546422_c1 3300050513 Bacteria 986
969 nmdc:mga0a205_695597_c1 3300050515 Bacteria 866
970 Ga0495601_0301790 3300053077 Bacteria 1043
971 Ga0495612_0157977 3300053078 Bacteria 989
972 Ga0495655_0012324 3300053083 Bacteria 1740
973 Ga0495655_0185941 3300053083 Bacteria 672
974 Ga0495595_0031235 3300053084 Bacteria 2393
975 Ga0495619_0187040 3300053085 Bacteria 1433
976 Ga0500578_0070175 3300053086 Bacteria 2234
977 Ga0500646_0389642 3300053090 Bacteria 513
978 Ga0500647_0073432 3300053091 Bacteria 1642
979 Ga0500647_0193872 3300053091 Bacteria 925
980 Ga0500583_0098116 3300053092 Bacteria 1432
981 Ga0500583_0108192 3300053092 Bacteria 1367
982 Ga0500583_0314451 3300053092 Bacteria 764
983 Ga0500566_0000078 3300053094 Bacteria 47558
984 Ga0500566_0076330 3300053094 Bacteria 1873
985 Ga0500640_000121 3300053095 Bacteria 14580
986 Ga0500640_061554 3300053095 Bacteria 1626
987 Ga0500641_0167005 3300053096 Bacteria 948
988 Ga0500641_0341232 3300053096 Bacteria 604
989 Ga0500554_118757 3300053102 Bacteria 891
990 Ga0500555_031686 3300053103 Bacteria 1497
991 Ga0500555_040212 3300053103 Bacteria 1304
992 Ga0500556_0030267 3300053104 Bacteria 1833
993 Ga0500557_000011 3300053105 Bacteria 117471
994 Ga0500569_018952 3300053109 Bacteria 1785
995 Ga0500569_084458 3300053109 Bacteria 1020
996 Ga0500572_000170 3300053111 Bacteria 22863
997 Ga0500572_110411 3300053111 Bacteria 884
998 Ga0500580_261947 3300053113 Bacteria 503
999 Ga0500591_077793 3300053115 Bacteria 1484
1000 Ga0500592_023529 3300053116 Bacteria 993
1001 Ga0500594_0047298 3300053118 Bacteria 1200
1002 Ga0500595_002442 3300053119 Bacteria 9222
1003 Ga0500595_002477 3300053119 Bacteria 9136
1004 Ga0500595_004672 3300053119 Bacteria 6088
1005 Ga0500595_026908 3300053119 Bacteria 1976
1006 Ga0500597_339561 3300053120 Bacteria 588
1007 Ga0500608_084601 3300053122 Bacteria 1492
1008 Ga0500608_232489 3300053122 Bacteria 734
1009 Ga0500614_004910 3300053123 Bacteria 2813
1010 Ga0500642_0000090 3300053130 Bacteria 46849
1011 Ga0500642_0008061 3300053130 Bacteria 3580
1012 Ga0500642_0199702 3300053130 Bacteria 931
1013 Ga0500658_0072704 3300053134 Bacteria 1455
1014 Ga0500658_0143484 3300053134 Bacteria 1072
1015 Ga0500559_0009508 3300053136 Bacteria 4201
1016 Ga0500559_0016864 3300053136 Bacteria 3085
1017 Ga0500561_0058078 3300053137 Bacteria 1076
1018 Ga0500568_0011274 3300053139 Bacteria 4161
1019 Ga0500568_0037366 3300053139 Bacteria 1970
1020 Ga0500590_085257 3300053148 Bacteria 1543
1021 Ga0500590_096457 3300053148 Bacteria 1427
1022 Ga0500603_000081 3300053150 Bacteria 22182
1023 Ga0500603_001666 3300053150 Bacteria 5003
1024 Ga0500620_100532 3300053155 Bacteria 1011
1025 Ga0500627_0007990 3300053158 Bacteria 3728
1026 Ga0500627_0078704 3300053158 Bacteria 1467
1027 Ga0500627_0293144 3300053158 Bacteria 712
1028 Ga0500627_0441489 3300053158 Bacteria 549
1029 Ga0500630_004509 3300053159 Bacteria 6772
1030 Ga0500634_0113939 3300053161 Bacteria 1328
1031 Ga0500638_021427 3300053162 Bacteria 3054
1032 Ga0500639_000028 3300053163 Bacteria 77951
1033 Ga0500639_131622 3300053163 Bacteria 1184
1034 Ga0500636_0049352 3300053177 Bacteria 2476
1035 Ga0500636_0065953 3300053177 Bacteria 2106
1036 Ga0500636_0200828 3300053177 Bacteria 1055
1037 Ga0500636_0398985 3300053177 Bacteria 639
1038 Ga0500637_0020909 3300053178 Bacteria 3551
1039 Ga0500637_0039902 3300053178 Bacteria 2649
1040 Ga0500637_0125685 3300053178 Bacteria 1487
1041 Ga0500570_131027 3300053724 Bacteria 952
1042 Ga0500625_002925 3300053729 Bacteria 6585
1043 Ga0500645_161204 3300053730 Bacteria 615
1044 Ga0500596_000324 3300053735 Bacteria 8556
1045 Ga0500601_003418 3300053737 Bacteria 1721
1046 Ga0500661_002428 3300055283 Bacteria 3509

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10267474 Ga0105239_102674742 131
2 3300044901 Ga0466960_0008649 Ga0466960_0008649_2044_2442 132
3 3300048914 Ga0496111_0678287 Ga0496111_0678287_174_572 132
4 3300053105 Ga0500557_000011 Ga0500557_000011_42629_43027 132
5 3300053120 Ga0500597_339561 Ga0500597_339561_30_428 132
6 3300053177 Ga0500636_0200828 Ga0500636_0200828_54_452 132
7 3300053729 Ga0500625_002925 Ga0500625_002925_4797_5195 132
8 3300025230 Ga0209563_102320 Ga0209563_1023202 133
9 3300003215 JGI25153J46596_10002543 JGI25153J46596_1000254311 134
10 3300003771 Ga0055526_1039847 Ga0055526_10398471 134
11 3300003775 Ga0055524_1036995 Ga0055524_10369951 134
12 3300003794 Ga0055531_10001939 Ga0055531_100019395 134
13 3300004625 Ga0055543_1004643 Ga0055543_10046436 134
14 3300005262 Ga0065165_1001641 Ga0065165_100164114 134
15 3300005262 Ga0065165_1003060 Ga0065165_100306010 134
16 3300005262 Ga0065165_1006123 Ga0065165_10061233 134
17 3300005327 Ga0070658_10012558 Ga0070658_100125587 134
18 3300005329 Ga0070683_100983887 Ga0070683_1009838872 134
19 3300005331 Ga0070670_100431462 Ga0070670_1004314621 134
20 3300005335 Ga0070666_10242701 Ga0070666_102427012 134
21 3300005339 Ga0070660_100773748 Ga0070660_1007737481 134
22 3300005353 Ga0070669_100077152 Ga0070669_1000771522 134
23 3300005354 Ga0070675_100444799 Ga0070675_1004447991 134
24 3300005355 Ga0070671_100385853 Ga0070671_1003858532 134
25 3300005364 Ga0070673_100722271 Ga0070673_1007222712 134
26 3300005455 Ga0070663_100173392 Ga0070663_1001733921 134
27 3300005457 Ga0070662_101016872 Ga0070662_1010168722 134
28 3300005563 Ga0068855_100157617 Ga0068855_1001576172 134
29 3300005564 Ga0070664_101292608 Ga0070664_1012926082 134
30 3300005578 Ga0068854_100081574 Ga0068854_1000815743 134
31 3300005614 Ga0068856_100225909 Ga0068856_1002259092 134
32 3300005616 Ga0068852_100061105 Ga0068852_1000611053 134
33 3300005616 Ga0068852_100271608 Ga0068852_1002716081 134
34 3300006038 Ga0075365_10032321 Ga0075365_100323213 134
35 3300006048 Ga0075363_100428285 Ga0075363_1004282851 134
36 3300006177 Ga0075362_10136051 Ga0075362_101360512 134
37 3300006186 Ga0075369_10095939 Ga0075369_100959392 134
38 3300006186 Ga0075369_10137108 Ga0075369_101371082 134
39 3300006186 Ga0075369_10206152 Ga0075369_102061522 134
40 3300006195 Ga0075366_10050422 Ga0075366_100504224 134
41 3300006195 Ga0075366_10196605 Ga0075366_101966052 134
42 3300006237 Ga0097621_100795721 Ga0097621_1007957212 134
43 3300006353 Ga0075370_10005105 Ga0075370_100051054 134
44 3300006353 Ga0075370_10094272 Ga0075370_100942722 134
45 3300009093 Ga0105240_10502270 Ga0105240_105022702 134
46 3300009101 Ga0105247_10406197 Ga0105247_104061972 134
47 3300009174 Ga0105241_10392659 Ga0105241_103926591 134
48 3300009177 Ga0105248_10172136 Ga0105248_101721363 134
49 3300009545 Ga0105237_10137184 Ga0105237_101371843 134
50 3300009553 Ga0105249_10311426 Ga0105249_103114261 134
51 3300010375 Ga0105239_10126823 Ga0105239_101268232 134
52 3300010375 Ga0105239_10753928 Ga0105239_107539281 134
53 3300011119 Ga0105246_11006436 Ga0105246_110064361 134
54 3300012495 Ga0157323_1011445 Ga0157323_10114451 134
55 3300013296 Ga0157374_10110883 Ga0157374_101108833 134
56 3300013306 Ga0163162_10235980 Ga0163162_102359804 134
57 3300014325 Ga0163163_10057665 Ga0163163_100576654 134
58 3300014745 Ga0157377_10149709 Ga0157377_101497092 134
59 3300014969 Ga0157376_12963154 Ga0157376_129631542 134
60 3300020070 Ga0206356_10120399 Ga0206356_101203991 134
61 3300021321 Ga0214542_1000004 Ga0214542_100000446 134
62 3300021321 Ga0214542_1037420 Ga0214542_10374202 134
63 3300021324 Ga0214545_1000005 Ga0214545_1000005351 134
64 3300021324 Ga0214545_1035280 Ga0214545_10352802 134
65 3300021327 Ga0214543_1000111 Ga0214543_100011162 134
66 3300021327 Ga0214543_1033779 Ga0214543_10337792 134
67 3300025253 Ga0209677_102591 Ga0209677_1025912 134
68 3300025261 Ga0209233_1004340 Ga0209233_10043406 134
69 3300025261 Ga0209233_1027348 Ga0209233_10273482 134
70 3300025295 Ga0209564_1006563 Ga0209564_10065631 134
71 3300025295 Ga0209564_1031518 Ga0209564_10315182 134
72 3300025297 Ga0209758_1000102 Ga0209758_1000102173 134
73 3300025297 Ga0209758_1003592 Ga0209758_10035928 134
74 3300025297 Ga0209758_1003725 Ga0209758_100372511 134
75 3300025297 Ga0209758_1046037 Ga0209758_10460372 134
76 3300025299 Ga0209256_1004953 Ga0209256_100495310 134
77 3300025299 Ga0209256_1027989 Ga0209256_10279892 134
78 3300025302 Ga0207426_1002013 Ga0207426_100201315 134
79 3300025304 Ga0209257_1003378 Ga0209257_10033784 134
80 3300025315 Ga0207697_10065223 Ga0207697_100652232 134
81 3300025901 Ga0207688_10344528 Ga0207688_103445282 134
82 3300025904 Ga0207647_10011423 Ga0207647_100114239 134
83 3300025909 Ga0207705_10216616 Ga0207705_102166162 134
84 3300025911 Ga0207654_10463892 Ga0207654_104638922 134
85 3300025914 Ga0207671_10703069 Ga0207671_107030691 134
86 3300025919 Ga0207657_11061567 Ga0207657_110615672 134
87 3300025923 Ga0207681_10214086 Ga0207681_102140862 134
88 3300025925 Ga0207650_10562013 Ga0207650_105620132 134
89 3300025926 Ga0207659_10550945 Ga0207659_105509452 134
90 3300025931 Ga0207644_11006653 Ga0207644_110066531 134
91 3300025933 Ga0207706_10218356 Ga0207706_102183563 134
92 3300025941 Ga0207711_10334427 Ga0207711_103344272 134
93 3300025944 Ga0207661_10576659 Ga0207661_105766592 134
94 3300025986 Ga0207658_10837159 Ga0207658_108371592 134
95 3300026041 Ga0207639_10098940 Ga0207639_100989401 134
96 3300026041 Ga0207639_10164849 Ga0207639_101648493 134
97 3300026067 Ga0207678_10099974 Ga0207678_100999742 134
98 3300026067 Ga0207678_10397726 Ga0207678_103977263 134
99 3300026078 Ga0207702_10327935 Ga0207702_103279352 134
100 3300026088 Ga0207641_11255460 Ga0207641_112554601 134
101 3300026095 Ga0207676_10669756 Ga0207676_106697562 134
102 3300026116 Ga0207674_10091381 Ga0207674_100913813 134
103 3300026142 Ga0207698_10367021 Ga0207698_103670212 134
104 3300028379 Ga0268266_10190353 Ga0268266_101903532 134
105 3300028380 Ga0268265_10564923 Ga0268265_105649232 134
106 3300037312 Ga0395899_0154753 Ga0395899_0154753_230_634 134
107 3300037418 Ga0395900_0016187 Ga0395900_0016187_4810_5214 134
108 3300037471 Ga0395905_0344285 Ga0395905_0344285_287_691 134
109 3300038443 Ga0395901_0097370 Ga0395901_0097370_1884_2288 134
110 3300041441 Ga0451787_288168 Ga0451787_288168_40_444 134
111 3300041491 Ga0451833_0138182 Ga0451833_0138182_624_1034 134
112 3300041498 Ga0451841_0540834 Ga0451841_0540834_388_798 134
113 3300041505 Ga0451849_0041184 Ga0451849_0041184_155_559 134
114 3300041507 Ga0451851_0647873 Ga0451851_0647873_18_428 134
115 3300041512 Ga0451853_3741495 Ga0451853_3741495_324_734 134
116 3300044683 Ga0466965_0127668 Ga0466965_0127668_255_659 134
117 3300044901 Ga0466960_0130216 Ga0466960_0130216_823_1227 134
118 3300046471 Ga0495650_0130564 Ga0495650_0130564_32_436 134
119 3300046507 Ga0495606_0157047 Ga0495606_0157047_303_707 134
120 3300046522 Ga0495643_0012291 Ga0495643_0012291_2788_3192 134
121 3300046522 Ga0495643_0250555 Ga0495643_0250555_83_487 134
122 3300046524 Ga0495648_0146427 Ga0495648_0146427_106_510 134
123 3300046542 Ga0495597_0033416 Ga0495597_0033416_1641_2045 134
124 3300046694 Ga0495649_0157413 Ga0495649_0157413_655_1059 134
125 3300046694 Ga0495649_0193763 Ga0495649_0193763_155_559 134
126 3300047320 Ga0495672_0239678 Ga0495672_0239678_205_609 134
127 3300047323 Ga0495683_0064475 Ga0495683_0064475_1092_1496 134
128 3300047443 Ga0495687_027560 Ga0495687_027560_1850_2254 134
129 3300047443 Ga0495687_047752 Ga0495687_047752_728_1132 134
130 3300047469 Ga0495673_0103713 Ga0495673_0103713_54_458 134
131 3300048903 Ga0496100_0223380 Ga0496100_0223380_599_1003 134
132 3300048905 Ga0496102_0476410 Ga0496102_0476410_533_937 134
133 3300048906 Ga0496103_0037555 Ga0496103_0037555_2000_2404 134
134 3300048906 Ga0496103_0424841 Ga0496103_0424841_364_768 134
135 3300048907 Ga0496104_0021810 Ga0496104_0021810_401_805 134
136 3300048908 Ga0496105_0120936 Ga0496105_0120936_233_637 134
137 3300048908 Ga0496105_0207100 Ga0496105_0207100_166_576 134
138 3300048911 Ga0496108_0208945 Ga0496108_0208945_736_1140 134
139 3300048911 Ga0496108_0256025 Ga0496108_0256025_524_928 134
140 3300048912 Ga0496109_0293021 Ga0496109_0293021_698_1102 134
141 3300048912 Ga0496109_0365792 Ga0496109_0365792_944_1348 134
142 3300048913 Ga0496110_0091129 Ga0496110_0091129_1563_1967 134
143 3300048914 Ga0496111_0599596 Ga0496111_0599596_261_665 134
144 3300048915 Ga0496112_0174342 Ga0496112_0174342_1145_1549 134
145 3300048916 Ga0496113_0716176 Ga0496113_0716176_345_749 134
146 3300048917 Ga0496114_0400728 Ga0496114_0400728_167_571 134
147 3300048921 Ga0496118_0120126 Ga0496118_0120126_673_1077 134
148 3300048921 Ga0496118_0153875 Ga0496118_0153875_500_904 134
149 3300048922 Ga0496119_0044857 Ga0496119_0044857_1957_2361 134
150 3300048924 Ga0496121_0412556 Ga0496121_0412556_448_852 134
151 3300048925 Ga0496122_0298659 Ga0496122_0298659_137_541 134
152 3300048927 Ga0496124_0226852 Ga0496124_0226852_213_617 134
153 3300050490 nmdc:mga03n38_483662_c1 nmdc:mga03n38_483662_c1_249_653 134
154 3300050491 nmdc:mga00v17_866497_c1 nmdc:mga00v17_866497_c1_35_445 134
155 3300050492 nmdc:mga0yw44_19763_c1 nmdc:mga0yw44_19763_c1_2098_2508 134
156 3300050492 nmdc:mga0yw44_514125_c1 nmdc:mga0yw44_514125_c1_380_784 134
157 3300050493 nmdc:mga0k408_179196_c1 nmdc:mga0k408_179196_c1_346_750 134
158 3300050494 nmdc:mga06z11_217349_c1 nmdc:mga06z11_217349_c1_374_778 134
159 3300050496 nmdc:mga07m45_59524_c1 nmdc:mga07m45_59524_c1_324_728 134
160 3300053083 Ga0495655_0185941 Ga0495655_0185941_213_617 134
161 3300053086 Ga0500578_0070175 Ga0500578_0070175_838_1242 134
162 3300053094 Ga0500566_0076330 Ga0500566_0076330_558_968 134
163 3300053095 Ga0500640_061554 Ga0500640_061554_1041_1496 134
164 3300053096 Ga0500641_0167005 Ga0500641_0167005_289_693 134
165 3300053102 Ga0500554_118757 Ga0500554_118757_182_586 134
166 3300053103 Ga0500555_031686 Ga0500555_031686_654_1058 134
167 3300053109 Ga0500569_084458 Ga0500569_084458_551_955 134
168 3300053111 Ga0500572_110411 Ga0500572_110411_291_695 134
169 3300053119 Ga0500595_026908 Ga0500595_026908_1505_1909 134
170 3300053122 Ga0500608_084601 Ga0500608_084601_423_827 134
171 3300053130 Ga0500642_0008061 Ga0500642_0008061_995_1399 134
172 3300053136 Ga0500559_0016864 Ga0500559_0016864_1521_1925 134
173 3300053139 Ga0500568_0037366 Ga0500568_0037366_1074_1478 134
174 3300053148 Ga0500590_085257 Ga0500590_085257_227_631 134
175 3300053155 Ga0500620_100532 Ga0500620_100532_444_848 134
176 3300053158 Ga0500627_0007990 Ga0500627_0007990_2126_2530 134
177 3300053178 Ga0500637_0125685 Ga0500637_0125685_373_777 134
178 3300055283 Ga0500661_002428 Ga0500661_002428_54_458 134
179 3300005536 Ga0070697_101484915 Ga0070697_1014849151 135
180 3300007265 Ga0099794_10102428 Ga0099794_101024282 135
181 3300014497 Ga0182008_10227787 Ga0182008_102277872 135
182 3300028380 Ga0268265_10061941 Ga0268265_100619413 135
183 3300039437 Ga0436365_0808674 Ga0436365_0808674_601_1008 135
184 3300044658 Ga0466972_0013988 Ga0466972_0013988_2265_2672 135
185 3300044706 Ga0466964_0264110 Ga0466964_0264110_85_492 135
186 3300044735 Ga0466968_0003372 Ga0466968_0003372_2172_2579 135
187 3300046514 Ga0495618_0523518 Ga0495618_0523518_234_641 135
188 3300046524 Ga0495648_0336875 Ga0495648_0336875_117_524 135
189 3300046526 Ga0495666_0386634 Ga0495666_0386634_74_481 135
190 3300046616 Ga0495668_0482000 Ga0495668_0482000_261_668 135
191 3300047320 Ga0495672_0474812 Ga0495672_0474812_64_471 135
192 3300048921 Ga0496118_0086044 Ga0496118_0086044_1100_1507 135
193 3300048923 Ga0496120_0220357 Ga0496120_0220357_203_610 135
194 3300048924 Ga0496121_0044559 Ga0496121_0044559_792_1199 135
195 3300048928 Ga0496125_0034884 Ga0496125_0034884_2154_2561 135
196 3300049460 Ga0495682_0018288 Ga0495682_0018288_245_652 135
197 3300053091 Ga0500647_0193872 Ga0500647_0193872_17_424 135
198 3300053122 Ga0500608_232489 Ga0500608_232489_313_720 135
199 3300053130 Ga0500642_0000090 Ga0500642_0000090_9151_9558 135
200 3300053177 Ga0500636_0049352 Ga0500636_0049352_1188_1595 135
201 3300053737 Ga0500601_003418 Ga0500601_003418_1077_1484 135
202 iso_pu_bacteria 2513237098 2513673294 135
203 iso_pu_bacteria 2524023210 2524465862 135
204 iso_pu_bacteria 2885383462 2885387305 135
205 iso_pu_bacteria 2903768456 2903774357 135
206 3300007788 Ga0099795_10217289 Ga0099795_102172892 136
207 3300010159 Ga0099796_10151157 Ga0099796_101511572 136
208 3300035088 Ga0373940_0200791 Ga0373940_0200791_221_631 136
209 3300035116 Ga0373945_0101051 Ga0373945_0101051_681_1091 136
210 3300035691 Ga0373931_0020927 Ga0373931_0020927_875_1285 136
211 3300037471 Ga0395905_0147099 Ga0395905_0147099_1158_1568 136
212 3300041460 Ga0451802_1494618 Ga0451802_1494618_169_579 136
213 3300046459 Ga0495629_0896585 Ga0495629_0896585_15_425 136
214 3300046475 Ga0495639_0254363 Ga0495639_0254363_82_492 136
215 3300046517 Ga0495630_0269329 Ga0495630_0269329_420_830 136
216 3300046518 Ga0495631_0197719 Ga0495631_0197719_266_676 136
217 3300046530 Ga0495654_0349189 Ga0495654_0349189_143_553 136
218 3300046615 Ga0495656_0200527 Ga0495656_0200527_174_584 136
219 3300046660 Ga0495625_0391655 Ga0495625_0391655_86_496 136
220 3300047446 Ga0495679_138495 Ga0495679_138495_74_484 136
221 3300047469 Ga0495673_0160362 Ga0495673_0160362_264_674 136
222 3300047472 Ga0495686_0250754 Ga0495686_0250754_170_580 136
223 3300048907 Ga0496104_0026734 Ga0496104_0026734_480_890 136
224 3300048908 Ga0496105_0345596 Ga0496105_0345596_85_495 136
225 3300048913 Ga0496110_0515209 Ga0496110_0515209_538_948 136
226 3300048914 Ga0496111_0040302 Ga0496111_0040302_522_932 136
227 3300048915 Ga0496112_0025634 Ga0496112_0025634_4843_5253 136
228 3300048918 Ga0496115_0159969 Ga0496115_0159969_983_1393 136
229 3300048918 Ga0496115_0868630 Ga0496115_0868630_194_604 136
230 3300048924 Ga0496121_0011669 Ga0496121_0011669_1684_2094 136
231 3300048925 Ga0496122_0090249 Ga0496122_0090249_1389_1799 136
232 3300048928 Ga0496125_0000176 Ga0496125_0000176_28791_29201 136
233 3300050494 nmdc:mga06z11_224365_c1 nmdc:mga06z11_224365_c1_294_704 136
234 3300053091 Ga0500647_0073432 Ga0500647_0073432_730_1140 136
235 3300053094 Ga0500566_0000078 Ga0500566_0000078_32722_33132 136
236 3300053095 Ga0500640_000121 Ga0500640_000121_10312_10722 136
237 3300053111 Ga0500572_000170 Ga0500572_000170_9147_9557 136
238 3300053113 Ga0500580_261947 Ga0500580_261947_82_492 136
239 3300053115 Ga0500591_077793 Ga0500591_077793_681_1091 136
240 3300053116 Ga0500592_023529 Ga0500592_023529_36_446 136
241 3300053123 Ga0500614_004910 Ga0500614_004910_745_1155 136
242 3300053136 Ga0500559_0009508 Ga0500559_0009508_2828_3238 136
243 3300053150 Ga0500603_000081 Ga0500603_000081_9147_9557 136
244 3300053159 Ga0500630_004509 Ga0500630_004509_4049_4459 136
245 3300053162 Ga0500638_021427 Ga0500638_021427_334_744 136
246 3300053163 Ga0500639_000028 Ga0500639_000028_68854_69264 136
247 3300053177 Ga0500636_0065953 Ga0500636_0065953_889_1302 136
248 3300053724 Ga0500570_131027 Ga0500570_131027_278_688 136
249 3300053735 Ga0500596_000324 Ga0500596_000324_7589_7999 136
250 3300004625 Ga0055543_1057955 Ga0055543_10579552 137
251 3300005262 Ga0065165_1060395 Ga0065165_10603952 137
252 3300005841 Ga0068863_101101683 Ga0068863_1011016832 137
253 3300005937 Ga0081455_10265399 Ga0081455_102653992 137
254 3300005983 Ga0081540_1007306 Ga0081540_10073068 137
255 3300005983 Ga0081540_1233257 Ga0081540_12332571 137
256 3300006871 Ga0075434_100189929 Ga0075434_1001899292 137
257 3300007788 Ga0099795_10142251 Ga0099795_101422512 137
258 3300009176 Ga0105242_11303406 Ga0105242_113034061 137
259 3300025302 Ga0207426_1034873 Ga0207426_10348732 137
260 3300025936 Ga0207670_10925765 Ga0207670_109257651 137
261 3300037471 Ga0395905_0081275 Ga0395905_0081275_794_1207 137
262 3300038443 Ga0395901_0733717 Ga0395901_0733717_180_593 137
263 3300041505 Ga0451849_0883225 Ga0451849_0883225_59_472 137
264 3300047472 Ga0495686_0143402 Ga0495686_0143402_766_1179 137
265 3300048904 Ga0496101_0232477 Ga0496101_0232477_711_1124 137
266 3300048905 Ga0496102_0381156 Ga0496102_0381156_873_1286 137
267 3300048917 Ga0496114_0793411 Ga0496114_0793411_127_540 137
268 3300048918 Ga0496115_0468347 Ga0496115_0468347_238_651 137
269 3300048924 Ga0496121_0000265 Ga0496121_0000265_50358_50798 137
270 3300048924 Ga0496121_0120593 Ga0496121_0120593_946_1359 137
271 3300048927 Ga0496124_0213718 Ga0496124_0213718_513_926 137
272 3300053104 Ga0500556_0030267 Ga0500556_0030267_1304_1717 137
273 3300053119 Ga0500595_002442 Ga0500595_002442_7298_7711 137
274 3300053119 Ga0500595_002477 Ga0500595_002477_2782_3195 137
275 3300053139 Ga0500568_0011274 Ga0500568_0011274_2353_2766 137
276 3300003214 JGI25165J46597_1048384 JGI25165J46597_10483841 138
277 3300003752 Ga0055539_1006053 Ga0055539_10060532 138
278 3300005434 Ga0070709_10001487 Ga0070709_1000148713 138
279 3300005436 Ga0070713_100375492 Ga0070713_1003754922 138
280 3300005436 Ga0070713_100634323 Ga0070713_1006343231 138
281 3300005439 Ga0070711_100009103 Ga0070711_1000091036 138
282 3300005445 Ga0070708_100064842 Ga0070708_1000648425 138
283 3300005468 Ga0070707_100067780 Ga0070707_1000677802 138
284 3300005471 Ga0070698_100901362 Ga0070698_1009013622 138
285 3300005546 Ga0070696_101316213 Ga0070696_1013162131 138
286 3300005548 Ga0070665_101278437 Ga0070665_1012784371 138
287 3300005983 Ga0081540_1026662 Ga0081540_10266624 138
288 3300006038 Ga0075365_10504620 Ga0075365_105046202 138
289 3300006038 Ga0075365_10836182 Ga0075365_108361822 138
290 3300006051 Ga0075364_10339815 Ga0075364_103398153 138
291 3300006175 Ga0070712_100377683 Ga0070712_1003776832 138
292 3300006175 Ga0070712_100685446 Ga0070712_1006854462 138
293 3300007265 Ga0099794_10044583 Ga0099794_100445834 138
294 3300007788 Ga0099795_10002812 Ga0099795_100028121 138
295 3300007788 Ga0099795_10043944 Ga0099795_100439443 138
296 3300009094 Ga0111539_10071397 Ga0111539_100713975 138
297 3300009551 Ga0105238_11314755 Ga0105238_113147552 138
298 3300010159 Ga0099796_10009289 Ga0099796_100092892 138
299 3300010159 Ga0099796_10295163 Ga0099796_102951632 138
300 3300010375 Ga0105239_10043909 Ga0105239_100439096 138
301 3300010375 Ga0105239_10909995 Ga0105239_109099952 138
302 3300010375 Ga0105239_13432695 Ga0105239_134326951 138
303 3300012495 Ga0157323_1011788 Ga0157323_10117881 138
304 3300013297 Ga0157378_10031236 Ga0157378_100312366 138
305 3300013308 Ga0157375_10836715 Ga0157375_108367151 138
306 3300021384 Ga0213876_10295971 Ga0213876_102959712 138
307 3300025253 Ga0209677_101639 Ga0209677_1016399 138
308 3300025254 Ga0209148_1006467 Ga0209148_10064674 138
309 3300025261 Ga0209233_1008872 Ga0209233_10088721 138
310 3300025272 Ga0209455_1001472 Ga0209455_100147213 138
311 3300025272 Ga0209455_1001710 Ga0209455_10017106 138
312 3300025898 Ga0207692_10450057 Ga0207692_104500572 138
313 3300025898 Ga0207692_10650649 Ga0207692_106506491 138
314 3300025906 Ga0207699_10129981 Ga0207699_101299811 138
315 3300025910 Ga0207684_10639812 Ga0207684_106398122 138
316 3300025915 Ga0207693_10017747 Ga0207693_100177472 138
317 3300025916 Ga0207663_10100721 Ga0207663_101007213 138
318 3300025922 Ga0207646_10261644 Ga0207646_102616442 138
319 3300025924 Ga0207694_10628845 Ga0207694_106288452 138
320 3300025928 Ga0207700_11115625 Ga0207700_111156251 138
321 3300025939 Ga0207665_10101928 Ga0207665_101019283 138
322 3300025972 Ga0207668_10262230 Ga0207668_102622303 138
323 3300027512 Ga0209179_1008779 Ga0209179_10087793 138
324 3300027671 Ga0209588_1019784 Ga0209588_10197842 138
325 3300028379 Ga0268266_11265124 Ga0268266_112651242 138
326 3300028577 Ga0265318_10079770 Ga0265318_100797702 138
327 3300028653 Ga0265323_10018266 Ga0265323_100182664 138
328 3300028654 Ga0265322_10117807 Ga0265322_101178072 138
329 3300028666 Ga0265336_10000415 Ga0265336_1000041525 138
330 3300028800 Ga0265338_10010045 Ga0265338_1001004515 138
331 3300029957 Ga0265324_10017627 Ga0265324_100176272 138
332 3300035088 Ga0373940_0336714 Ga0373940_0336714_43_459 138
333 3300035092 Ga0373952_0095837 Ga0373952_0095837_332_748 138
334 3300035170 Ga0373943_0139389 Ga0373943_0139389_566_982 138
335 3300035171 Ga0373946_0267866 Ga0373946_0267866_181_597 138
336 3300035695 Ga0373927_0009305 Ga0373927_0009305_5368_5784 138
337 3300035725 Ga0373947_0038071 Ga0373947_0038071_322_738 138
338 3300037068 Ga0373925_0023664 Ga0373925_0023664_3912_4328 138
339 3300037068 Ga0373925_0390614 Ga0373925_0390614_365_781 138
340 3300037466 Ga0395898_0475635 Ga0395898_0475635_747_1163 138
341 3300037853 Ga0436364_0581979 Ga0436364_0581979_523_939 138
342 3300039450 Ga0436363_1563002 Ga0436363_1563002_82_498 138
343 3300042157 Ga0439458_0159765 Ga0439458_0159765_44_460 138
344 3300044719 Ga0466971_0157021 Ga0466971_0157021_76_492 138
345 3300044842 Ga0466957_0105153 Ga0466957_0105153_229_645 138
346 3300044842 Ga0466957_1093303 Ga0466957_1093303_39_455 138
347 3300045049 Ga0466959_0154824 Ga0466959_0154824_119_535 138
348 3300046455 Ga0495603_0072096 Ga0495603_0072096_776_1192 138
349 3300046455 Ga0495603_0074766 Ga0495603_0074766_853_1269 138
350 3300046457 Ga0495590_0077288 Ga0495590_0077288_336_752 138
351 3300046460 Ga0495638_0266085 Ga0495638_0266085_133_549 138
352 3300046472 Ga0495580_0291464 Ga0495580_0291464_671_1087 138
353 3300046473 Ga0495582_0229642 Ga0495582_0229642_513_929 138
354 3300046491 Ga0495584_0104087 Ga0495584_0104087_825_1241 138
355 3300046491 Ga0495584_0181275 Ga0495584_0181275_11_427 138
356 3300046491 Ga0495584_0403064 Ga0495584_0403064_253_669 138
357 3300046491 Ga0495584_0507590 Ga0495584_0507590_10_426 138
358 3300046492 Ga0495585_0275017 Ga0495585_0275017_65_481 138
359 3300046499 Ga0495594_0107854 Ga0495594_0107854_369_785 138
360 3300046500 Ga0495596_0194477 Ga0495596_0194477_362_778 138
361 3300046501 Ga0495607_0393938 Ga0495607_0393938_148_564 138
362 3300046507 Ga0495606_0122562 Ga0495606_0122562_764_1180 138
363 3300046517 Ga0495630_1347834 Ga0495630_1347834_28_444 138
364 3300046518 Ga0495631_0089133 Ga0495631_0089133_458_874 138
365 3300046518 Ga0495631_0511994 Ga0495631_0511994_72_488 138
366 3300046523 Ga0495644_0220346 Ga0495644_0220346_29_445 138
367 3300046528 Ga0495642_0166942 Ga0495642_0166942_120_536 138
368 3300046537 Ga0495598_0046091 Ga0495598_0046091_581_997 138
369 3300046539 Ga0495621_0018971 Ga0495621_0018971_1345_1761 138
370 3300046542 Ga0495597_0344586 Ga0495597_0344586_140_556 138
371 3300046557 Ga0495622_0005490 Ga0495622_0005490_2549_2965 138
372 3300046557 Ga0495622_0135417 Ga0495622_0135417_654_1070 138
373 3300046557 Ga0495622_0205157 Ga0495622_0205157_392_808 138
374 3300046616 Ga0495668_0203406 Ga0495668_0203406_314_730 138
375 3300046648 Ga0495611_0126279 Ga0495611_0126279_321_737 138
376 3300046660 Ga0495625_0140569 Ga0495625_0140569_764_1180 138
377 3300046660 Ga0495625_0185164 Ga0495625_0185164_393_809 138
378 3300046674 Ga0495588_0082492 Ga0495588_0082492_912_1328 138
379 3300046681 Ga0495647_0223727 Ga0495647_0223727_349_765 138
380 3300046684 Ga0495669_0007993 Ga0495669_0007993_1090_1506 138
381 3300046684 Ga0495669_0255061 Ga0495669_0255061_389_805 138
382 3300046690 Ga0495624_0145609 Ga0495624_0145609_916_1332 138
383 3300046690 Ga0495624_0564993 Ga0495624_0564993_227_643 138
384 3300046692 Ga0495671_0101526 Ga0495671_0101526_261_677 138
385 3300046794 Ga0495589_0111160 Ga0495589_0111160_574_990 138
386 3300046794 Ga0495589_0129712 Ga0495589_0129712_779_1195 138
387 3300047315 Ga0495581_0081158 Ga0495581_0081158_1376_1792 138
388 3300047321 Ga0495676_0110086 Ga0495676_0110086_78_494 138
389 3300047469 Ga0495673_0293941 Ga0495673_0293941_110_526 138
390 3300048091 Ga0495626_0275345 Ga0495626_0275345_34_450 138
391 3300048904 Ga0496101_0546160 Ga0496101_0546160_137_553 138
392 3300048905 Ga0496102_0410219 Ga0496102_0410219_838_1254 138
393 3300048905 Ga0496102_0861647 Ga0496102_0861647_173_589 138
394 3300048906 Ga0496103_1061774 Ga0496103_1061774_69_485 138
395 3300048907 Ga0496104_1770519 Ga0496104_1770519_54_470 138
396 3300048917 Ga0496114_0345394 Ga0496114_0345394_645_1061 138
397 3300048919 Ga0496116_0198582 Ga0496116_0198582_214_630 138
398 3300048921 Ga0496118_0065065 Ga0496118_0065065_1295_1711 138
399 3300048922 Ga0496119_0189829 Ga0496119_0189829_155_571 138
400 3300048924 Ga0496121_0028222 Ga0496121_0028222_1083_1499 138
401 3300048924 Ga0496121_0479793 Ga0496121_0479793_68_484 138
402 3300048927 Ga0496124_0262119 Ga0496124_0262119_281_697 138
403 3300048927 Ga0496124_0331448 Ga0496124_0331448_60_476 138
404 3300048928 Ga0496125_0137109 Ga0496125_0137109_256_672 138
405 3300048928 Ga0496125_0206435 Ga0496125_0206435_126_542 138
406 3300048929 Ga0496126_0015449 Ga0496126_0015449_4362_4778 138
407 3300048929 Ga0496126_0072217 Ga0496126_0072217_786_1202 138
408 3300048929 Ga0496126_0122354 Ga0496126_0122354_696_1112 138
409 3300048929 Ga0496126_0177512 Ga0496126_0177512_1322_1738 138
410 3300049460 Ga0495682_0066545 Ga0495682_0066545_863_1279 138
411 3300049574 Ga0501038_0265551 Ga0501038_0265551_569_985 138
412 3300049590 Ga0501074_0394278 Ga0501074_0394278_521_937 138
413 3300050489 nmdc:mga03683_489268_c1 nmdc:mga03683_489268_c1_168_584 138
414 3300050492 nmdc:mga0yw44_187882_c1 nmdc:mga0yw44_187882_c1_469_912 138
415 3300050492 nmdc:mga0yw44_638498_c1 nmdc:mga0yw44_638498_c1_138_554 138
416 3300050495 nmdc:mga04h51_252344_c1 nmdc:mga04h51_252344_c1_180_596 138
417 3300050496 nmdc:mga07m45_107497_c1 nmdc:mga07m45_107497_c1_968_1384 138
418 3300053092 Ga0500583_0098116 Ga0500583_0098116_923_1339 138
419 3300053103 Ga0500555_040212 Ga0500555_040212_736_1152 138
420 3300053119 Ga0500595_004672 Ga0500595_004672_3809_4225 138
421 3300053130 Ga0500642_0199702 Ga0500642_0199702_71_487 138
422 3300053134 Ga0500658_0072704 Ga0500658_0072704_748_1164 138
423 3300053150 Ga0500603_001666 Ga0500603_001666_450_866 138
424 3300053158 Ga0500627_0441489 Ga0500627_0441489_112_528 138
425 3300053163 Ga0500639_131622 Ga0500639_131622_310_726 138
426 3300053177 Ga0500636_0398985 Ga0500636_0398985_100_516 138
427 3300053178 Ga0500637_0020909 Ga0500637_0020909_2795_3211 138
428 3300053178 Ga0500637_0039902 Ga0500637_0039902_817_1233 138
429 3300005327 Ga0070658_10023514 Ga0070658_100235144 139
430 3300005327 Ga0070658_10102491 Ga0070658_101024913 139
431 3300005329 Ga0070683_100650545 Ga0070683_1006505452 139
432 3300005331 Ga0070670_100190496 Ga0070670_1001904963 139
433 3300005337 Ga0070682_100036436 Ga0070682_1000364363 139
434 3300005338 Ga0068868_100061212 Ga0068868_1000612121 139
435 3300005338 Ga0068868_100487663 Ga0068868_1004876632 139
436 3300005339 Ga0070660_101235354 Ga0070660_1012353541 139
437 3300005344 Ga0070661_100090117 Ga0070661_1000901173 139
438 3300005354 Ga0070675_100256096 Ga0070675_1002560962 139
439 3300005355 Ga0070671_100300849 Ga0070671_1003008492 139
440 3300005355 Ga0070671_100593258 Ga0070671_1005932582 139
441 3300005364 Ga0070673_100071969 Ga0070673_1000719694 139
442 3300005366 Ga0070659_101699146 Ga0070659_1016991461 139
443 3300005367 Ga0070667_101488193 Ga0070667_1014881931 139
444 3300005435 Ga0070714_100228898 Ga0070714_1002288982 139
445 3300005437 Ga0070710_10648292 Ga0070710_106482921 139
446 3300005439 Ga0070711_101810257 Ga0070711_1018102571 139
447 3300005445 Ga0070708_100690600 Ga0070708_1006906002 139
448 3300005455 Ga0070663_100004680 Ga0070663_1000046805 139
449 3300005455 Ga0070663_100320808 Ga0070663_1003208083 139
450 3300005456 Ga0070678_100045978 Ga0070678_1000459784 139
451 3300005456 Ga0070678_100345611 Ga0070678_1003456112 139
452 3300005458 Ga0070681_10012465 Ga0070681_100124658 139
453 3300005467 Ga0070706_100473639 Ga0070706_1004736391 139
454 3300005530 Ga0070679_100018130 Ga0070679_1000181302 139
455 3300005539 Ga0068853_101321949 Ga0068853_1013219491 139
456 3300005539 Ga0068853_101927947 Ga0068853_1019279471 139
457 3300005543 Ga0070672_100719582 Ga0070672_1007195822 139
458 3300005548 Ga0070665_100013100 Ga0070665_1000131003 139
459 3300005548 Ga0070665_100142934 Ga0070665_1001429343 139
460 3300005563 Ga0068855_100007494 Ga0068855_1000074948 139
461 3300005564 Ga0070664_100451693 Ga0070664_1004516931 139
462 3300005614 Ga0068856_100257385 Ga0068856_1002573853 139
463 3300005615 Ga0070702_100504825 Ga0070702_1005048252 139
464 3300005616 Ga0068852_100391056 Ga0068852_1003910561 139
465 3300005616 Ga0068852_102611884 Ga0068852_1026118841 139
466 3300005618 Ga0068864_100189671 Ga0068864_1001896713 139
467 3300005841 Ga0068863_101336523 Ga0068863_1013365231 139
468 3300005983 Ga0081540_1001339 Ga0081540_100133910 139
469 3300005983 Ga0081540_1076704 Ga0081540_10767043 139
470 3300005983 Ga0081540_1101767 Ga0081540_11017672 139
471 3300006038 Ga0075365_10016437 Ga0075365_100164375 139
472 3300006038 Ga0075365_10075675 Ga0075365_100756754 139
473 3300006048 Ga0075363_100014770 Ga0075363_1000147707 139
474 3300006048 Ga0075363_100122388 Ga0075363_1001223883 139
475 3300006051 Ga0075364_10319221 Ga0075364_103192212 139
476 3300006173 Ga0070716_100154821 Ga0070716_1001548213 139
477 3300006173 Ga0070716_100367307 Ga0070716_1003673072 139
478 3300006175 Ga0070712_100217090 Ga0070712_1002170902 139
479 3300006175 Ga0070712_100413189 Ga0070712_1004131893 139
480 3300006178 Ga0075367_10040157 Ga0075367_100401574 139
481 3300006178 Ga0075367_10192724 Ga0075367_101927242 139
482 3300006178 Ga0075367_10388212 Ga0075367_103882121 139
483 3300006353 Ga0075370_10020322 Ga0075370_100203226 139
484 3300006353 Ga0075370_10201833 Ga0075370_102018332 139
485 3300006358 Ga0068871_100031423 Ga0068871_1000314236 139
486 3300009093 Ga0105240_10309970 Ga0105240_103099703 139
487 3300009098 Ga0105245_11602772 Ga0105245_116027721 139
488 3300009148 Ga0105243_10501348 Ga0105243_105013482 139
489 3300009148 Ga0105243_10638961 Ga0105243_106389612 139
490 3300009174 Ga0105241_10514380 Ga0105241_105143801 139
491 3300009176 Ga0105242_10506722 Ga0105242_105067222 139
492 3300009177 Ga0105248_11181365 Ga0105248_111813651 139
493 3300009545 Ga0105237_10208119 Ga0105237_102081192 139
494 3300009545 Ga0105237_11045357 Ga0105237_110453572 139
495 3300009551 Ga0105238_10202605 Ga0105238_102026053 139
496 3300009551 Ga0105238_10572463 Ga0105238_105724631 139
497 3300009551 Ga0105238_10575588 Ga0105238_105755882 139
498 3300010159 Ga0099796_10520424 Ga0099796_105204241 139
499 3300010375 Ga0105239_10048229 Ga0105239_100482295 139
500 3300011119 Ga0105246_10089670 Ga0105246_100896702 139
501 3300013104 Ga0157370_10026904 Ga0157370_100269044 139
502 3300013296 Ga0157374_10019278 Ga0157374_100192785 139
503 3300013306 Ga0163162_10044547 Ga0163162_100445473 139
504 3300013308 Ga0157375_10174025 Ga0157375_101740254 139
505 3300014325 Ga0163163_10073225 Ga0163163_100732252 139
506 3300014325 Ga0163163_10203034 Ga0163163_102030343 139
507 3300014497 Ga0182008_10263072 Ga0182008_102630722 139
508 3300014968 Ga0157379_10060147 Ga0157379_100601475 139
509 3300014968 Ga0157379_11240093 Ga0157379_112400932 139
510 3300014969 Ga0157376_10046724 Ga0157376_100467243 139
511 3300017792 Ga0163161_11063447 Ga0163161_110634471 139
512 3300025898 Ga0207692_10407209 Ga0207692_104072092 139
513 3300025900 Ga0207710_10164150 Ga0207710_101641501 139
514 3300025901 Ga0207688_10088637 Ga0207688_100886373 139
515 3300025909 Ga0207705_10061486 Ga0207705_100614865 139
516 3300025909 Ga0207705_10234508 Ga0207705_102345082 139
517 3300025910 Ga0207684_10186080 Ga0207684_101860802 139
518 3300025912 Ga0207707_10011000 Ga0207707_100110006 139
519 3300025913 Ga0207695_10234230 Ga0207695_102342303 139
520 3300025914 Ga0207671_10307417 Ga0207671_103074172 139
521 3300025915 Ga0207693_10122761 Ga0207693_101227612 139
522 3300025915 Ga0207693_10244528 Ga0207693_102445281 139
523 3300025919 Ga0207657_10556936 Ga0207657_105569362 139
524 3300025920 Ga0207649_10066665 Ga0207649_100666653 139
525 3300025921 Ga0207652_10158337 Ga0207652_101583372 139
526 3300025924 Ga0207694_10572641 Ga0207694_105726411 139
527 3300025924 Ga0207694_11328088 Ga0207694_113280881 139
528 3300025928 Ga0207700_11704156 Ga0207700_117041561 139
529 3300025929 Ga0207664_11208542 Ga0207664_112085422 139
530 3300025931 Ga0207644_10178384 Ga0207644_101783842 139
531 3300025931 Ga0207644_10273138 Ga0207644_102731382 139
532 3300025934 Ga0207686_10445902 Ga0207686_104459022 139
533 3300025935 Ga0207709_11248901 Ga0207709_112489011 139
534 3300025938 Ga0207704_10133658 Ga0207704_101336582 139
535 3300025939 Ga0207665_10651826 Ga0207665_106518262 139
536 3300025944 Ga0207661_10570559 Ga0207661_105705591 139
537 3300025945 Ga0207679_11130151 Ga0207679_111301512 139
538 3300025949 Ga0207667_10050380 Ga0207667_100503803 139
539 3300025960 Ga0207651_10064111 Ga0207651_100641113 139
540 3300025972 Ga0207668_10836322 Ga0207668_108363221 139
541 3300025986 Ga0207658_12090848 Ga0207658_120908481 139
542 3300026023 Ga0207677_10110732 Ga0207677_101107324 139
543 3300026023 Ga0207677_11600840 Ga0207677_116008401 139
544 3300026041 Ga0207639_10249569 Ga0207639_102495691 139
545 3300026041 Ga0207639_11186091 Ga0207639_111860911 139
546 3300026067 Ga0207678_10004216 Ga0207678_1000421615 139
547 3300026067 Ga0207678_10402078 Ga0207678_104020781 139
548 3300026078 Ga0207702_10229418 Ga0207702_102294181 139
549 3300026088 Ga0207641_10308005 Ga0207641_103080053 139
550 3300026095 Ga0207676_10162342 Ga0207676_101623423 139
551 3300026121 Ga0207683_10029544 Ga0207683_100295445 139
552 3300026121 Ga0207683_11677118 Ga0207683_116771181 139
553 3300026142 Ga0207698_10554453 Ga0207698_105544531 139
554 3300028379 Ga0268266_10001136 Ga0268266_1000113620 139
555 3300028379 Ga0268266_10094515 Ga0268266_100945153 139
556 3300028379 Ga0268266_10654635 Ga0268266_106546352 139
557 3300031456 Ga0307513_10418783 Ga0307513_104187833 139
558 3300031616 Ga0307508_10127944 Ga0307508_101279444 139
559 3300031730 Ga0307516_10046388 Ga0307516_100463882 139
560 3300031730 Ga0307516_10053240 Ga0307516_100532404 139
561 3300031731 Ga0307405_10315500 Ga0307405_103155003 139
562 3300032005 Ga0307411_11395977 Ga0307411_113959771 139
563 3300033180 Ga0307510_10327889 Ga0307510_103278892 139
564 3300035113 Ga0373936_0043384 Ga0373936_0043384_492_911 139
565 3300035119 Ga0373956_0259800 Ga0373956_0259800_218_637 139
566 3300035170 Ga0373943_0121755 Ga0373943_0121755_14_433 139
567 3300035170 Ga0373943_0152823 Ga0373943_0152823_46_465 139
568 3300035172 Ga0373955_0071154 Ga0373955_0071154_214_633 139
569 3300035410 Ga0373924_0048356 Ga0373924_0048356_22_441 139
570 3300035692 Ga0373935_0000520 Ga0373935_0000520_8350_8769 139
571 3300035695 Ga0373927_0000046 Ga0373927_0000046_53650_54069 139
572 3300035725 Ga0373947_0001392 Ga0373947_0001392_3309_3728 139
573 3300036401 Ga0373937_0048844 Ga0373937_0048844_993_1412 139
574 3300037068 Ga0373925_0009905 Ga0373925_0009905_979_1398 139
575 3300037471 Ga0395905_0860914 Ga0395905_0860914_372_791 139
576 3300039437 Ga0436365_0939911 Ga0436365_0939911_361_786 139
577 3300039453 Ga0436362_1153757 Ga0436362_1153757_67_489 139
578 3300041453 Ga0451797_1560878 Ga0451797_1560878_13_432 139
579 3300041459 Ga0451800_1224866 Ga0451800_1224866_195_614 139
580 3300041507 Ga0451851_0496392 Ga0451851_0496392_222_641 139
581 3300041512 Ga0451853_1338784 Ga0451853_1338784_83_502 139
582 3300046454 Ga0495592_0036407 Ga0495592_0036407_336_755 139
583 3300046455 Ga0495603_0000051 Ga0495603_0000051_16811_17230 139
584 3300046459 Ga0495629_0000182 Ga0495629_0000182_44703_45122 139
585 3300046461 Ga0495641_0006374 Ga0495641_0006374_1407_1826 139
586 3300046463 Ga0495653_0200693 Ga0495653_0200693_747_1166 139
587 3300046472 Ga0495580_0004021 Ga0495580_0004021_905_1324 139
588 3300046473 Ga0495582_0000137 Ga0495582_0000137_33363_33782 139
589 3300046473 Ga0495582_0482908 Ga0495582_0482908_179_598 139
590 3300046475 Ga0495639_0002873 Ga0495639_0002873_5772_6191 139
591 3300046475 Ga0495639_0620166 Ga0495639_0620166_58_477 139
592 3300046476 Ga0495662_0000583 Ga0495662_0000583_1176_1595 139
593 3300046477 Ga0495664_0009075 Ga0495664_0009075_2584_3003 139
594 3300046499 Ga0495594_0001833 Ga0495594_0001833_9615_10034 139
595 3300046516 Ga0495628_0021321 Ga0495628_0021321_2311_2730 139
596 3300046517 Ga0495630_0002625 Ga0495630_0002625_11171_11590 139
597 3300046523 Ga0495644_0091283 Ga0495644_0091283_639_1058 139
598 3300046526 Ga0495666_0391769 Ga0495666_0391769_108_527 139
599 3300046529 Ga0495652_0037670 Ga0495652_0037670_1422_1841 139
600 3300046531 Ga0495665_0001239 Ga0495665_0001239_9450_9869 139
601 3300046533 Ga0495640_0004375 Ga0495640_0004375_281_700 139
602 3300046557 Ga0495622_0016785 Ga0495622_0016785_1121_1540 139
603 3300046559 Ga0495667_0011352 Ga0495667_0011352_527_946 139
604 3300046616 Ga0495668_0029504 Ga0495668_0029504_1806_2225 139
605 3300046642 Ga0495634_0002221 Ga0495634_0002221_2604_3023 139
606 3300046660 Ga0495625_0711609 Ga0495625_0711609_21_440 139
607 3300046663 Ga0495635_0001455 Ga0495635_0001455_11129_11548 139
608 3300046674 Ga0495588_0046469 Ga0495588_0046469_1682_2101 139
609 3300046675 Ga0495657_0147798 Ga0495657_0147798_966_1385 139
610 3300046680 Ga0495646_0048867 Ga0495646_0048867_1335_1754 139
611 3300046681 Ga0495647_0032438 Ga0495647_0032438_250_669 139
612 3300046684 Ga0495669_0470253 Ga0495669_0470253_142_561 139
613 3300046689 Ga0495613_0047965 Ga0495613_0047965_1430_1849 139
614 3300046690 Ga0495624_0000898 Ga0495624_0000898_13136_13555 139
615 3300046692 Ga0495671_0165256 Ga0495671_0165256_268_687 139
616 3300046809 Ga0495600_0113596 Ga0495600_0113596_469_888 139
617 3300047315 Ga0495581_0007805 Ga0495581_0007805_2070_2489 139
618 3300047315 Ga0495581_0425001 Ga0495581_0425001_177_596 139
619 3300047319 Ga0495674_0010092 Ga0495674_0010092_2495_2914 139
620 3300047320 Ga0495672_0025981 Ga0495672_0025981_2949_3368 139
621 3300047321 Ga0495676_0127701 Ga0495676_0127701_720_1139 139
622 3300047322 Ga0495680_0404157 Ga0495680_0404157_349_768 139
623 3300047469 Ga0495673_0022298 Ga0495673_0022298_1024_1443 139
624 3300047471 Ga0495684_0045864 Ga0495684_0045864_2107_2526 139
625 3300047673 Ga0495593_0000469 Ga0495593_0000469_16081_16500 139
626 3300048088 Ga0495602_0385915 Ga0495602_0385915_111_530 139
627 3300048089 Ga0495614_0001926 Ga0495614_0001926_203_622 139
628 3300048089 Ga0495614_0409324 Ga0495614_0409324_83_502 139
629 3300048903 Ga0496100_0001098 Ga0496100_0001098_6537_6956 139
630 3300048904 Ga0496101_0011608 Ga0496101_0011608_2333_2752 139
631 3300048905 Ga0496102_0199985 Ga0496102_0199985_1033_1452 139
632 3300048905 Ga0496102_0380154 Ga0496102_0380154_524_943 139
633 3300048906 Ga0496103_0010717 Ga0496103_0010717_1109_1528 139
634 3300048907 Ga0496104_0037264 Ga0496104_0037264_3128_3547 139
635 3300048907 Ga0496104_0208151 Ga0496104_0208151_1366_1785 139
636 3300048908 Ga0496105_0030338 Ga0496105_0030338_1016_1435 139
637 3300048909 Ga0496106_0026464 Ga0496106_0026464_1268_1687 139
638 3300048910 Ga0496107_0021497 Ga0496107_0021497_1231_1650 139
639 3300048911 Ga0496108_0042075 Ga0496108_0042075_854_1273 139
640 3300048912 Ga0496109_0049778 Ga0496109_0049778_2350_2769 139
641 3300048913 Ga0496110_0066685 Ga0496110_0066685_1280_1699 139
642 3300048915 Ga0496112_0023844 Ga0496112_0023844_2816_3235 139
643 3300048916 Ga0496113_0015425 Ga0496113_0015425_2198_2617 139
644 3300048916 Ga0496113_1305035 Ga0496113_1305035_72_491 139
645 3300048917 Ga0496114_0033230 Ga0496114_0033230_1091_1510 139
646 3300048917 Ga0496114_1533587 Ga0496114_1533587_120_539 139
647 3300048918 Ga0496115_0017046 Ga0496115_0017046_2110_2529 139
648 3300048918 Ga0496115_0288059 Ga0496115_0288059_391_810 139
649 3300048921 Ga0496118_0087129 Ga0496118_0087129_482_901 139
650 3300048922 Ga0496119_0043743 Ga0496119_0043743_986_1405 139
651 3300048923 Ga0496120_0012720 Ga0496120_0012720_3432_3851 139
652 3300048925 Ga0496122_0093188 Ga0496122_0093188_1059_1535 139
653 3300048929 Ga0496126_0011852 Ga0496126_0011852_4951_5427 139
654 3300048929 Ga0496126_0262004 Ga0496126_0262004_786_1205 139
655 3300048929 Ga0496126_1143757 Ga0496126_1143757_73_492 139
656 3300049460 Ga0495682_0213564 Ga0495682_0213564_135_554 139
657 3300050490 nmdc:mga03n38_12993_c1 nmdc:mga03n38_12993_c1_2478_2897 139
658 3300050491 nmdc:mga00v17_86774_c1 nmdc:mga00v17_86774_c1_149_568 139
659 3300050492 nmdc:mga0yw44_31797_c1 nmdc:mga0yw44_31797_c1_1961_2380 139
660 3300050493 nmdc:mga0k408_148173_c1 nmdc:mga0k408_148173_c1_552_971 139
661 3300050494 nmdc:mga06z11_8466_c1 nmdc:mga06z11_8466_c1_2212_2631 139
662 3300050494 nmdc:mga06z11_93967_c1 nmdc:mga06z11_93967_c1_384_821 139
663 3300050496 nmdc:mga07m45_190315_c1 nmdc:mga07m45_190315_c1_474_911 139
664 3300050496 nmdc:mga07m45_54052_c1 nmdc:mga07m45_54052_c1_1804_2223 139
665 3300053077 Ga0495601_0301790 Ga0495601_0301790_222_641 139
666 3300053078 Ga0495612_0157977 Ga0495612_0157977_88_507 139
667 3300053083 Ga0495655_0012324 Ga0495655_0012324_897_1316 139
668 3300053084 Ga0495595_0031235 Ga0495595_0031235_147_566 139
669 3300053085 Ga0495619_0187040 Ga0495619_0187040_754_1173 139
670 3300053090 Ga0500646_0389642 Ga0500646_0389642_38_457 139
671 3300053092 Ga0500583_0314451 Ga0500583_0314451_119_538 139
672 3300053158 Ga0500627_0293144 Ga0500627_0293144_266_685 139
673 iso_pu_bacteria 2728368998 2728751746 139
674 iso_pu_bacteria 8056681323 8056685557 139
675 3300005439 Ga0070711_100004982 Ga0070711_1000049822 140
676 3300005985 Ga0081539_10000848 Ga0081539_1000084825 140
677 3300006163 Ga0070715_10503674 Ga0070715_105036741 140
678 3300006173 Ga0070716_100034174 Ga0070716_1000341743 140
679 3300006175 Ga0070712_100073635 Ga0070712_1000736352 140
680 3300025905 Ga0207685_10233027 Ga0207685_102330271 140
681 3300025915 Ga0207693_10009325 Ga0207693_1000932510 140
682 3300025916 Ga0207663_10025502 Ga0207663_100255026 140
683 3300025934 Ga0207686_10692655 Ga0207686_106926551 140
684 3300025939 Ga0207665_10023296 Ga0207665_100232966 140
685 3300025939 Ga0207665_11424140 Ga0207665_114241401 140
686 3300025940 Ga0207691_10552016 Ga0207691_105520162 140
687 3300026121 Ga0207683_11865045 Ga0207683_118650451 140
688 3300028786 Ga0307517_10000098 Ga0307517_10000098109 140
689 3300035116 Ga0373945_0075784 Ga0373945_0075784_456_878 140
690 3300035171 Ga0373946_0176394 Ga0373946_0176394_39_461 140
691 3300035695 Ga0373927_0039246 Ga0373927_0039246_1251_1673 140
692 3300035725 Ga0373947_0165966 Ga0373947_0165966_792_1214 140
693 3300037068 Ga0373925_0013452 Ga0373925_0013452_4406_4828 140
694 3300046683 Ga0495658_0469737 Ga0495658_0469737_346_768 140
695 3300048903 Ga0496100_0137249 Ga0496100_0137249_990_1412 140
696 3300048909 Ga0496106_0500576 Ga0496106_0500576_100_522 140
697 3300048913 Ga0496110_1657088 Ga0496110_1657088_36_458 140
698 3300002070 JGI24750J21931_1029154 JGI24750J21931_10291541 141
699 3300003215 JGI25153J46596_10010032 JGI25153J46596_100100322 141
700 3300003659 JGI25404J52841_10077133 JGI25404J52841_100771331 141
701 3300005328 Ga0070676_10179448 Ga0070676_101794482 141
702 3300005330 Ga0070690_100368152 Ga0070690_1003681522 141
703 3300005334 Ga0068869_100073753 Ga0068869_1000737534 141
704 3300005334 Ga0068869_100170574 Ga0068869_1001705743 141
705 3300005334 Ga0068869_100726511 Ga0068869_1007265111 141
706 3300005334 Ga0068869_101009791 Ga0068869_1010097911 141
707 3300005337 Ga0070682_101668905 Ga0070682_1016689051 141
708 3300005338 Ga0068868_100149026 Ga0068868_1001490263 141
709 3300005338 Ga0068868_100645846 Ga0068868_1006458462 141
710 3300005340 Ga0070689_100029472 Ga0070689_1000294721 141
711 3300005347 Ga0070668_100194020 Ga0070668_1001940202 141
712 3300005347 Ga0070668_101210569 Ga0070668_1012105691 141
713 3300005353 Ga0070669_100647603 Ga0070669_1006476031 141
714 3300005354 Ga0070675_100494369 Ga0070675_1004943692 141
715 3300005354 Ga0070675_100671313 Ga0070675_1006713132 141
716 3300005356 Ga0070674_100018587 Ga0070674_1000185876 141
717 3300005364 Ga0070673_101609494 Ga0070673_1016094941 141
718 3300005365 Ga0070688_100332304 Ga0070688_1003323041 141
719 3300005365 Ga0070688_100379429 Ga0070688_1003794291 141
720 3300005366 Ga0070659_100890205 Ga0070659_1008902051 141
721 3300005367 Ga0070667_100171236 Ga0070667_1001712363 141
722 3300005438 Ga0070701_10812765 Ga0070701_108127651 141
723 3300005441 Ga0070700_100015418 Ga0070700_1000154185 141
724 3300005455 Ga0070663_100073751 Ga0070663_1000737514 141
725 3300005455 Ga0070663_100089274 Ga0070663_1000892742 141
726 3300005456 Ga0070678_100160527 Ga0070678_1001605272 141
727 3300005456 Ga0070678_100700049 Ga0070678_1007000491 141
728 3300005457 Ga0070662_100100370 Ga0070662_1001003703 141
729 3300005457 Ga0070662_100145701 Ga0070662_1001457012 141
730 3300005459 Ga0068867_100077329 Ga0068867_1000773292 141
731 3300005471 Ga0070698_100028998 Ga0070698_1000289982 141
732 3300005518 Ga0070699_100633627 Ga0070699_1006336271 141
733 3300005536 Ga0070697_101292512 Ga0070697_1012925121 141
734 3300005539 Ga0068853_100432519 Ga0068853_1004325192 141
735 3300005543 Ga0070672_100036650 Ga0070672_1000366507 141
736 3300005544 Ga0070686_100061402 Ga0070686_1000614024 141
737 3300005548 Ga0070665_100030279 Ga0070665_1000302796 141
738 3300005548 Ga0070665_100062009 Ga0070665_1000620094 141
739 3300005548 Ga0070665_100154541 Ga0070665_1001545412 141
740 3300005548 Ga0070665_100176827 Ga0070665_1001768272 141
741 3300005548 Ga0070665_100475717 Ga0070665_1004757172 141
742 3300005548 Ga0070665_100602714 Ga0070665_1006027142 141
743 3300005548 Ga0070665_101315473 Ga0070665_1013154732 141
744 3300005563 Ga0068855_100173800 Ga0068855_1001738002 141
745 3300005578 Ga0068854_100515802 Ga0068854_1005158022 141
746 3300005578 Ga0068854_100557659 Ga0068854_1005576591 141
747 3300005614 Ga0068856_100252283 Ga0068856_1002522833 141
748 3300005614 Ga0068856_100446153 Ga0068856_1004461532 141
749 3300005615 Ga0070702_100030788 Ga0070702_1000307881 141
750 3300005615 Ga0070702_100256668 Ga0070702_1002566683 141
751 3300005617 Ga0068859_100029233 Ga0068859_1000292333 141
752 3300005617 Ga0068859_100157976 Ga0068859_1001579763 141
753 3300005618 Ga0068864_100031862 Ga0068864_1000318627 141
754 3300005618 Ga0068864_101871951 Ga0068864_1018719512 141
755 3300005718 Ga0068866_10037646 Ga0068866_100376462 141
756 3300005719 Ga0068861_100258607 Ga0068861_1002586072 141
757 3300005719 Ga0068861_101750191 Ga0068861_1017501911 141
758 3300005840 Ga0068870_10624676 Ga0068870_106246761 141
759 3300005841 Ga0068863_100276087 Ga0068863_1002760872 141
760 3300005842 Ga0068858_100060155 Ga0068858_1000601552 141
761 3300005842 Ga0068858_100266626 Ga0068858_1002666263 141
762 3300005843 Ga0068860_100247013 Ga0068860_1002470133 141
763 3300005843 Ga0068860_100270075 Ga0068860_1002700752 141
764 3300005844 Ga0068862_100085066 Ga0068862_1000850662 141
765 3300005844 Ga0068862_100170988 Ga0068862_1001709882 141
766 3300005844 Ga0068862_100228976 Ga0068862_1002289762 141
767 3300005844 Ga0068862_100315519 Ga0068862_1003155193 141
768 3300005937 Ga0081455_10029662 Ga0081455_100296625 141
769 3300005937 Ga0081455_10109650 Ga0081455_101096502 141
770 3300005983 Ga0081540_1007193 Ga0081540_10071938 141
771 3300005983 Ga0081540_1007993 Ga0081540_10079936 141
772 3300005983 Ga0081540_1016547 Ga0081540_10165475 141
773 3300005983 Ga0081540_1116499 Ga0081540_11164992 141
774 3300005985 Ga0081539_10012348 Ga0081539_100123489 141
775 3300006038 Ga0075365_10041163 Ga0075365_100411634 141
776 3300006038 Ga0075365_10082863 Ga0075365_100828632 141
777 3300006038 Ga0075365_10728030 Ga0075365_107280301 141
778 3300006042 Ga0075368_10003948 Ga0075368_100039482 141
779 3300006048 Ga0075363_100155479 Ga0075363_1001554792 141
780 3300006048 Ga0075363_100418580 Ga0075363_1004185802 141
781 3300006051 Ga0075364_10058712 Ga0075364_100587123 141
782 3300006177 Ga0075362_10086410 Ga0075362_100864102 141
783 3300006178 Ga0075367_10075171 Ga0075367_100751714 141
784 3300006178 Ga0075367_10136379 Ga0075367_101363793 141
785 3300006186 Ga0075369_10239910 Ga0075369_102399102 141
786 3300006195 Ga0075366_10024888 Ga0075366_100248884 141
787 3300006195 Ga0075366_10032034 Ga0075366_100320343 141
788 3300006195 Ga0075366_10483993 Ga0075366_104839931 141
789 3300006195 Ga0075366_10551633 Ga0075366_105516331 141
790 3300006195 Ga0075366_10637687 Ga0075366_106376871 141
791 3300006237 Ga0097621_100647048 Ga0097621_1006470482 141
792 3300006353 Ga0075370_10138407 Ga0075370_101384071 141
793 3300006358 Ga0068871_100104460 Ga0068871_1001044603 141
794 3300006358 Ga0068871_101681277 Ga0068871_1016812771 141
795 3300006844 Ga0075428_100157112 Ga0075428_1001571126 141
796 3300006871 Ga0075434_100444533 Ga0075434_1004445332 141
797 3300006881 Ga0068865_100109505 Ga0068865_1001095054 141
798 3300006881 Ga0068865_100849440 Ga0068865_1008494402 141
799 3300006881 Ga0068865_101658442 Ga0068865_1016584422 141
800 3300006914 Ga0075436_100624736 Ga0075436_1006247361 141
801 3300006931 Ga0097620_100029232 Ga0097620_1000292323 141
802 3300006931 Ga0097620_100157985 Ga0097620_1001579853 141
803 3300007076 Ga0075435_100341705 Ga0075435_1003417053 141
804 3300009094 Ga0111539_11000866 Ga0111539_110008662 141
805 3300009098 Ga0105245_10060551 Ga0105245_100605514 141
806 3300009148 Ga0105243_10702884 Ga0105243_107028843 141
807 3300009148 Ga0105243_10737151 Ga0105243_107371512 141
808 3300009174 Ga0105241_10012915 Ga0105241_100129157 141
809 3300009176 Ga0105242_10035582 Ga0105242_100355826 141
810 3300009545 Ga0105237_10018023 Ga0105237_1001802310 141
811 3300009545 Ga0105237_10448755 Ga0105237_104487552 141
812 3300009553 Ga0105249_10513667 Ga0105249_105136672 141
813 3300009553 Ga0105249_10910747 Ga0105249_109107472 141
814 3300010375 Ga0105239_10741915 Ga0105239_107419152 141
815 3300010375 Ga0105239_11142778 Ga0105239_111427782 141
816 3300011119 Ga0105246_10085714 Ga0105246_100857142 141
817 3300011119 Ga0105246_10199271 Ga0105246_101992713 141
818 3300011119 Ga0105246_10233447 Ga0105246_102334471 141
819 3300011119 Ga0105246_10783537 Ga0105246_107835371 141
820 3300011119 Ga0105246_10839555 Ga0105246_108395551 141
821 3300013296 Ga0157374_10066182 Ga0157374_100661824 141
822 3300013296 Ga0157374_10388075 Ga0157374_103880751 141
823 3300013296 Ga0157374_12404282 Ga0157374_124042821 141
824 3300013297 Ga0157378_10547367 Ga0157378_105473671 141
825 3300013306 Ga0163162_10129391 Ga0163162_101293912 141
826 3300013306 Ga0163162_11179575 Ga0163162_111795751 141
827 3300013307 Ga0157372_10494544 Ga0157372_104945442 141
828 3300013308 Ga0157375_10154583 Ga0157375_101545832 141
829 3300013308 Ga0157375_10174992 Ga0157375_101749923 141
830 3300013308 Ga0157375_10227133 Ga0157375_102271333 141
831 3300014326 Ga0157380_10109465 Ga0157380_101094652 141
832 3300014326 Ga0157380_10157219 Ga0157380_101572192 141
833 3300014745 Ga0157377_10686845 Ga0157377_106868451 141
834 3300014968 Ga0157379_10344996 Ga0157379_103449962 141
835 3300014969 Ga0157376_10555669 Ga0157376_105556692 141
836 3300017792 Ga0163161_10088848 Ga0163161_100888483 141
837 3300017792 Ga0163161_11198956 Ga0163161_111989561 141
838 3300025297 Ga0209758_1005478 Ga0209758_10054785 141
839 3300025315 Ga0207697_10216603 Ga0207697_102166032 141
840 3300025315 Ga0207697_10443720 Ga0207697_104437201 141
841 3300025899 Ga0207642_10020324 Ga0207642_100203242 141
842 3300025899 Ga0207642_10396173 Ga0207642_103961731 141
843 3300025899 Ga0207642_10469724 Ga0207642_104697242 141
844 3300025901 Ga0207688_10019383 Ga0207688_100193832 141
845 3300025901 Ga0207688_10089460 Ga0207688_100894603 141
846 3300025903 Ga0207680_10163305 Ga0207680_101633053 141
847 3300025903 Ga0207680_10169761 Ga0207680_101697611 141
848 3300025907 Ga0207645_10092170 Ga0207645_100921703 141
849 3300025907 Ga0207645_10184660 Ga0207645_101846602 141
850 3300025911 Ga0207654_10014746 Ga0207654_100147463 141
851 3300025912 Ga0207707_11354883 Ga0207707_113548831 141
852 3300025914 Ga0207671_10083323 Ga0207671_100833234 141
853 3300025914 Ga0207671_10119378 Ga0207671_101193784 141
854 3300025919 Ga0207657_10166797 Ga0207657_101667972 141
855 3300025923 Ga0207681_10901979 Ga0207681_109019792 141
856 3300025923 Ga0207681_11009395 Ga0207681_110093951 141
857 3300025924 Ga0207694_10122221 Ga0207694_101222212 141
858 3300025926 Ga0207659_10220386 Ga0207659_102203862 141
859 3300025927 Ga0207687_10299895 Ga0207687_102998952 141
860 3300025927 Ga0207687_10691934 Ga0207687_106919341 141
861 3300025931 Ga0207644_10516522 Ga0207644_105165221 141
862 3300025932 Ga0207690_10268274 Ga0207690_102682741 141
863 3300025932 Ga0207690_11222132 Ga0207690_112221321 141
864 3300025933 Ga0207706_10020636 Ga0207706_100206366 141
865 3300025933 Ga0207706_10465884 Ga0207706_104658842 141
866 3300025934 Ga0207686_10170721 Ga0207686_101707212 141
867 3300025934 Ga0207686_10256367 Ga0207686_102563673 141
868 3300025935 Ga0207709_10041130 Ga0207709_100411303 141
869 3300025935 Ga0207709_11616757 Ga0207709_116167571 141
870 3300025936 Ga0207670_10039211 Ga0207670_100392115 141
871 3300025937 Ga0207669_10007035 Ga0207669_100070354 141
872 3300025938 Ga0207704_10062027 Ga0207704_100620272 141
873 3300025940 Ga0207691_10103322 Ga0207691_101033224 141
874 3300025941 Ga0207711_10316425 Ga0207711_103164252 141
875 3300025942 Ga0207689_10391727 Ga0207689_103917272 141
876 3300025942 Ga0207689_10443619 Ga0207689_104436192 141
877 3300025942 Ga0207689_10627672 Ga0207689_106276722 141
878 3300025942 Ga0207689_11080396 Ga0207689_110803961 141
879 3300025945 Ga0207679_10318278 Ga0207679_103182782 141
880 3300025949 Ga0207667_12040882 Ga0207667_120408821 141
881 3300025972 Ga0207668_10008217 Ga0207668_100082174 141
882 3300025972 Ga0207668_10173030 Ga0207668_101730303 141
883 3300025972 Ga0207668_10683879 Ga0207668_106838792 141
884 3300025981 Ga0207640_10048550 Ga0207640_100485503 141
885 3300025981 Ga0207640_10123950 Ga0207640_101239502 141
886 3300025986 Ga0207658_10075824 Ga0207658_100758245 141
887 3300025986 Ga0207658_10180619 Ga0207658_101806193 141
888 3300025986 Ga0207658_10554862 Ga0207658_105548621 141
889 3300025986 Ga0207658_11253074 Ga0207658_112530741 141
890 3300026023 Ga0207677_10234842 Ga0207677_102348421 141
891 3300026023 Ga0207677_10527442 Ga0207677_105274421 141
892 3300026023 Ga0207677_10535789 Ga0207677_105357892 141
893 3300026035 Ga0207703_10193232 Ga0207703_101932321 141
894 3300026041 Ga0207639_10167178 Ga0207639_101671782 141
895 3300026067 Ga0207678_10060134 Ga0207678_100601343 141
896 3300026067 Ga0207678_10089469 Ga0207678_100894693 141
897 3300026067 Ga0207678_10123758 Ga0207678_101237583 141
898 3300026067 Ga0207678_10227790 Ga0207678_102277902 141
899 3300026075 Ga0207708_10049842 Ga0207708_100498423 141
900 3300026088 Ga0207641_10365347 Ga0207641_103653472 141
901 3300026088 Ga0207641_10951971 Ga0207641_109519712 141
902 3300026089 Ga0207648_10097170 Ga0207648_100971702 141
903 3300026089 Ga0207648_10293405 Ga0207648_102934053 141
904 3300026095 Ga0207676_10894876 Ga0207676_108948762 141
905 3300026116 Ga0207674_10309414 Ga0207674_103094142 141
906 3300026118 Ga0207675_100049241 Ga0207675_1000492413 141
907 3300026118 Ga0207675_100126297 Ga0207675_1001262975 141
908 3300026121 Ga0207683_10051305 Ga0207683_100513055 141
909 3300026121 Ga0207683_10060366 Ga0207683_100603664 141
910 3300026121 Ga0207683_10212381 Ga0207683_102123812 141
911 3300026121 Ga0207683_10972293 Ga0207683_109722931 141
912 3300027907 Ga0207428_10368040 Ga0207428_103680402 141
913 3300027907 Ga0207428_10923875 Ga0207428_109238751 141
914 3300028379 Ga0268266_10003686 Ga0268266_1000368617 141
915 3300028379 Ga0268266_10388186 Ga0268266_103881861 141
916 3300028379 Ga0268266_10731320 Ga0268266_107313201 141
917 3300028379 Ga0268266_10742093 Ga0268266_107420932 141
918 3300028380 Ga0268265_10124640 Ga0268265_101246402 141
919 3300028380 Ga0268265_10192550 Ga0268265_101925503 141
920 3300028380 Ga0268265_10198444 Ga0268265_101984442 141
921 3300028380 Ga0268265_10480048 Ga0268265_104800481 141
922 3300028381 Ga0268264_10192667 Ga0268264_101926672 141
923 3300028786 Ga0307517_10111579 Ga0307517_101115792 141
924 3300031507 Ga0307509_10128015 Ga0307509_101280152 141
925 3300031548 Ga0307408_100232397 Ga0307408_1002323972 141
926 3300031731 Ga0307405_10505101 Ga0307405_105051012 141
927 3300031824 Ga0307413_10171007 Ga0307413_101710072 141
928 3300031824 Ga0307413_11473637 Ga0307413_114736371 141
929 3300031852 Ga0307410_11425331 Ga0307410_114253311 141
930 3300031903 Ga0307407_10761295 Ga0307407_107612951 141
931 3300031911 Ga0307412_10401698 Ga0307412_104016982 141
932 3300031995 Ga0307409_100546889 Ga0307409_1005468892 141
933 3300032002 Ga0307416_101218302 Ga0307416_1012183022 141
934 3300032004 Ga0307414_11399194 Ga0307414_113991941 141
935 3300032005 Ga0307411_10076739 Ga0307411_100767394 141
936 3300032005 Ga0307411_10843113 Ga0307411_108431131 141
937 3300032126 Ga0307415_100297967 Ga0307415_1002979672 141
938 3300033179 Ga0307507_10560606 Ga0307507_105606062 141
939 3300033180 Ga0307510_10007562 Ga0307510_1000756213 141
940 3300041411 Ga0439466_0205551 Ga0439466_0205551_85_510 141
941 3300041413 Ga0439465_0093118 Ga0439465_0093118_16_450 141
942 3300041441 Ga0451787_184996 Ga0451787_184996_58_483 141
943 3300041452 Ga0451793_0362601 Ga0451793_0362601_92_517 141
944 3300041507 Ga0451851_1102993 Ga0451851_1102993_16_447 141
945 3300046452 Ga0495617_231405 Ga0495617_231405_34_459 141
946 3300046455 Ga0495603_0074854 Ga0495603_0074854_700_1125 141
947 3300046460 Ga0495638_0021430 Ga0495638_0021430_2312_2737 141
948 3300046460 Ga0495638_0139137 Ga0495638_0139137_635_1060 141
949 3300046460 Ga0495638_0526218 Ga0495638_0526218_112_537 141
950 3300046460 Ga0495638_0526497 Ga0495638_0526497_108_533 141
951 3300046474 Ga0495605_0227921 Ga0495605_0227921_28_453 141
952 3300046492 Ga0495585_0029073 Ga0495585_0029073_2144_2569 141
953 3300046499 Ga0495594_0042613 Ga0495594_0042613_2042_2467 141
954 3300046500 Ga0495596_0063639 Ga0495596_0063639_624_1049 141
955 3300046506 Ga0495583_0025223 Ga0495583_0025223_1449_1922 141
956 3300046507 Ga0495606_0119588 Ga0495606_0119588_474_947 141
957 3300046507 Ga0495606_0444146 Ga0495606_0444146_194_619 141
958 3300046512 Ga0495610_0100069 Ga0495610_0100069_363_836 141
959 3300046513 Ga0495616_0162322 Ga0495616_0162322_199_624 141
960 3300046515 Ga0495620_0159318 Ga0495620_0159318_179_604 141
961 3300046515 Ga0495620_0169679 Ga0495620_0169679_331_756 141
962 3300046518 Ga0495631_0015803 Ga0495631_0015803_2770_3195 141
963 3300046519 Ga0495632_0055923 Ga0495632_0055923_1246_1671 141
964 3300046519 Ga0495632_0138876 Ga0495632_0138876_360_785 141
965 3300046519 Ga0495632_0148961 Ga0495632_0148961_89_514 141
966 3300046519 Ga0495632_0294698 Ga0495632_0294698_15_440 141
967 3300046522 Ga0495643_0074090 Ga0495643_0074090_896_1321 141
968 3300046525 Ga0495663_0064127 Ga0495663_0064127_335_760 141
969 3300046542 Ga0495597_0051282 Ga0495597_0051282_93_518 141
970 3300046558 Ga0495633_0109329 Ga0495633_0109329_818_1243 141
971 3300046558 Ga0495633_0242170 Ga0495633_0242170_255_680 141
972 3300046615 Ga0495656_0016955 Ga0495656_0016955_68_493 141
973 3300046615 Ga0495656_0214078 Ga0495656_0214078_100_525 141
974 3300046616 Ga0495668_0026683 Ga0495668_0026683_1438_1911 141
975 3300046616 Ga0495668_0029734 Ga0495668_0029734_1376_1801 141
976 3300046616 Ga0495668_0052320 Ga0495668_0052320_1292_1717 141
977 3300046660 Ga0495625_0058534 Ga0495625_0058534_906_1331 141
978 3300046660 Ga0495625_0094413 Ga0495625_0094413_930_1355 141
979 3300046663 Ga0495635_0978415 Ga0495635_0978415_94_519 141
980 3300046664 Ga0495659_0061547 Ga0495659_0061547_333_758 141
981 3300046665 Ga0495661_0247668 Ga0495661_0247668_205_630 141
982 3300046684 Ga0495669_0316823 Ga0495669_0316823_277_702 141
983 3300046691 Ga0495670_0250616 Ga0495670_0250616_48_473 141
984 3300046691 Ga0495670_0334925 Ga0495670_0334925_194_619 141
985 3300046692 Ga0495671_0084494 Ga0495671_0084494_770_1195 141
986 3300046692 Ga0495671_0089738 Ga0495671_0089738_773_1198 141
987 3300046694 Ga0495649_0097432 Ga0495649_0097432_341_766 141
988 3300046794 Ga0495589_0103033 Ga0495589_0103033_48_473 141
989 3300047318 Ga0495636_0097970 Ga0495636_0097970_632_1057 141
990 3300047318 Ga0495636_0194356 Ga0495636_0194356_36_461 141
991 3300047318 Ga0495636_0656702 Ga0495636_0656702_38_463 141
992 3300047323 Ga0495683_0478557 Ga0495683_0478557_41_466 141
993 3300047445 Ga0495677_0067538 Ga0495677_0067538_539_964 141
994 3300047445 Ga0495677_0172629 Ga0495677_0172629_72_497 141
995 3300047447 Ga0495685_140734 Ga0495685_140734_41_466 141
996 3300047469 Ga0495673_0256112 Ga0495673_0256112_56_529 141
997 3300048090 Ga0495615_0197116 Ga0495615_0197116_108_533 141
998 3300048904 Ga0496101_0541375 Ga0496101_0541375_137_610 141
999 3300048904 Ga0496101_0933369 Ga0496101_0933369_52_477 141
1000 3300048905 Ga0496102_0008520 Ga0496102_0008520_6641_7114 141
1001 3300048905 Ga0496102_0153816 Ga0496102_0153816_751_1176 141
1002 3300048905 Ga0496102_0438380 Ga0496102_0438380_745_1170 141
1003 3300048906 Ga0496103_0405205 Ga0496103_0405205_61_486 141
1004 3300048907 Ga0496104_0116018 Ga0496104_0116018_1970_2395 141
1005 3300048907 Ga0496104_1671737 Ga0496104_1671737_92_517 141
1006 3300048908 Ga0496105_0286727 Ga0496105_0286727_798_1271 141
1007 3300048909 Ga0496106_0123661 Ga0496106_0123661_188_613 141
1008 3300048909 Ga0496106_0396800 Ga0496106_0396800_602_1027 141
1009 3300048909 Ga0496106_0680497 Ga0496106_0680497_205_630 141
1010 3300048911 Ga0496108_0196577 Ga0496108_0196577_1111_1536 141
1011 3300048911 Ga0496108_0540220 Ga0496108_0540220_111_536 141
1012 3300048912 Ga0496109_0380566 Ga0496109_0380566_401_826 141
1013 3300048913 Ga0496110_0288249 Ga0496110_0288249_412_837 141
1014 3300048915 Ga0496112_0353164 Ga0496112_0353164_150_575 141
1015 3300048915 Ga0496112_0731438 Ga0496112_0731438_222_695 141
1016 3300048916 Ga0496113_0054139 Ga0496113_0054139_1466_1939 141
1017 3300048921 Ga0496118_0310668 Ga0496118_0310668_160_585 141
1018 3300048922 Ga0496119_0046704 Ga0496119_0046704_1473_1898 141
1019 3300048924 Ga0496121_0267964 Ga0496121_0267964_658_1083 141
1020 3300048924 Ga0496121_0481239 Ga0496121_0481239_212_637 141
1021 3300048929 Ga0496126_0444729 Ga0496126_0444729_251_676 141
1022 3300049460 Ga0495682_0053712 Ga0495682_0053712_632_1105 141
1023 3300049576 Ga0501040_0715101 Ga0501040_0715101_238_663 141
1024 3300049578 Ga0501042_0374282 Ga0501042_0374282_526_951 141
1025 3300049583 Ga0501067_0604891 Ga0501067_0604891_101_526 141
1026 3300050489 nmdc:mga03683_107519_c1 nmdc:mga03683_107519_c1_336_761 141
1027 3300050491 nmdc:mga00v17_69660_c1 nmdc:mga00v17_69660_c1_789_1262 141
1028 3300050492 nmdc:mga0yw44_124038_c1 nmdc:mga0yw44_124038_c1_961_1386 141
1029 3300050492 nmdc:mga0yw44_5454_c2 nmdc:mga0yw44_5454_c2_4851_5276 141
1030 3300050493 nmdc:mga0k408_519503_c1 nmdc:mga0k408_519503_c1_88_513 141
1031 3300050493 nmdc:mga0k408_571476_c1 nmdc:mga0k408_571476_c1_92_517 141
1032 3300050494 nmdc:mga06z11_199789_c1 nmdc:mga06z11_199789_c1_493_918 141
1033 3300050494 nmdc:mga06z11_298090_c1 nmdc:mga06z11_298090_c1_124_549 141
1034 3300050496 nmdc:mga07m45_81713_c1 nmdc:mga07m45_81713_c1_634_1059 141
1035 3300050508 nmdc:mga09592_265942_c1 nmdc:mga09592_265942_c1_219_644 141
1036 3300050510 nmdc:mga06r32_893179_c1 nmdc:mga06r32_893179_c1_98_523 141
1037 3300050511 nmdc:mga08y16_1146190_c1 nmdc:mga08y16_1146190_c1_46_471 141
1038 3300050511 nmdc:mga08y16_1285024_c1 nmdc:mga08y16_1285024_c1_164_589 141
1039 3300050511 nmdc:mga08y16_635192_c1 nmdc:mga08y16_635192_c1_212_637 141
1040 3300050512 nmdc:mga0n895_832353_c1 nmdc:mga0n895_832353_c1_19_444 141
1041 3300050513 nmdc:mga0rr50_546422_c1 nmdc:mga0rr50_546422_c1_128_553 141
1042 3300050515 nmdc:mga0a205_695597_c1 nmdc:mga0a205_695597_c1_65_490 141
1043 3300053092 Ga0500583_0108192 Ga0500583_0108192_548_973 141
1044 3300053096 Ga0500641_0341232 Ga0500641_0341232_139_564 141
1045 3300053109 Ga0500569_018952 Ga0500569_018952_1049_1474 141
1046 3300053118 Ga0500594_0047298 Ga0500594_0047298_201_647 141
1047 3300053134 Ga0500658_0143484 Ga0500658_0143484_176_601 141
1048 3300053137 Ga0500561_0058078 Ga0500561_0058078_534_959 141
1049 3300053148 Ga0500590_096457 Ga0500590_096457_969_1394 141
1050 3300053158 Ga0500627_0078704 Ga0500627_0078704_280_705 141
1051 3300053161 Ga0500634_0113939 Ga0500634_0113939_850_1275 141
1052 3300053730 Ga0500645_161204 Ga0500645_161204_108_533 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

24

139

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zyf-assembly2.cif.gz_C crystal structure of streptococcus pyogenes type ii-a cas2 0.6766 2 117
3exc-assembly1.cif.gz_X-2 structure of the rna'se sso8090 from sulfolobus solfataricus 0.6616 1 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6369 1 114
5zyf-assembly3.cif.gz_F crystal structure of streptococcus pyogenes type ii-a cas2 0.6278 2 117
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6131 1 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6369 1 114 3.30.70.1060
4tnoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6346 1 113 3.30.70.240
4tnoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6277 1 113 3.30.70.240
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.621 1 114 3.30.70.1060
af_Q1LYG6_500_570_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.5972 1 112 3.30.70.870
ID Description Score Start End GO Terms
AF-A0A7W1B6H1-F1-model_v4 YciI family protein 0.7527 1 126
AF-A0A503WCB3-F1-model_v4 YciI family protein 0.7526 1 129
AF-X6EJ73-F1-model_v4 deleted 0.7492 1 132
AF-A0A0F6YML2-F1-model_v4 PhnB protein 0.7471 1 125
AF-A0A4Q1UNU8-F1-model_v4 Transcription initiation protein 0.7456 1 130

Feature Viewer

pLDDT pTM Quality
82.28 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map