F489105
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1052 | 458 | 1046 | 139 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8056681323|8056685557 |
| Length | 164 |
| Sequence | LILRMPWNDDGENEAPPNHKETPMRFMMLMIPLGYETAPPKIDLDPERVAAMMKYNQALKDAGVLIALDGLHPPSAGARVSFATGKPVVTDGPFTESKEVLGGYWMINVASRAEAIEWAKQCPASENEIIEIRQVQEMSDFSEEVQKAAAGFEDMQQGWGKALR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 3 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 4 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 5 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 131 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 132 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 267 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 268 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 269 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 270 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 271 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 383 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 384 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 385 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 386 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 387 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 388 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 389 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 390 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 391 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 418 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 420 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 424 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 427 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 428 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 430 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 431 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 432 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 433 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 434 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 435 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 436 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 437 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 438 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 441 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 443 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 445 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 447 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 450 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 452 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 453 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 454 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 456 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 457 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 458 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.63 |
| Nodule | 0.95 |
| Rhizoplane | 7.79 |
| Rhizosphere | 68.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1029154 | 3300002070 | Bacteria | 803 |
| 2 | JGI25165J46597_1048384 | 3300003214 | Bacteria | 545 |
| 3 | JGI25153J46596_10002543 | 3300003215 | Bacteria | 10454 |
| 4 | JGI25153J46596_10010032 | 3300003215 | Bacteria | 4323 |
| 5 | JGI25404J52841_10077133 | 3300003659 | Bacteria | 696 |
| 6 | Ga0055539_1006053 | 3300003752 | Bacteria | 1555 |
| 7 | Ga0055526_1039847 | 3300003771 | Bacteria | 1192 |
| 8 | Ga0055524_1036995 | 3300003775 | Bacteria | 1301 |
| 9 | Ga0055531_10001939 | 3300003794 | Bacteria | 14453 |
| 10 | Ga0055543_1004643 | 3300004625 | Bacteria | 3684 |
| 11 | Ga0055543_1057955 | 3300004625 | Bacteria | 625 |
| 12 | Ga0065165_1001641 | 3300005262 | Bacteria | 22770 |
| 13 | Ga0065165_1003060 | 3300005262 | Bacteria | 12519 |
| 14 | Ga0065165_1006123 | 3300005262 | Bacteria | 6438 |
| 15 | Ga0065165_1060395 | 3300005262 | Bacteria | 1040 |
| 16 | Ga0070658_10012558 | 3300005327 | Bacteria | 6793 |
| 17 | Ga0070658_10023514 | 3300005327 | Bacteria | 4944 |
| 18 | Ga0070658_10102491 | 3300005327 | Bacteria | 2367 |
| 19 | Ga0070676_10179448 | 3300005328 | Bacteria | 1375 |
| 20 | Ga0070683_100650545 | 3300005329 | Bacteria | 1009 |
| 21 | Ga0070683_100983887 | 3300005329 | Bacteria | 810 |
| 22 | Ga0070690_100368152 | 3300005330 | Bacteria | 1047 |
| 23 | Ga0070670_100190496 | 3300005331 | Bacteria | 1781 |
| 24 | Ga0070670_100431462 | 3300005331 | Bacteria | 1166 |
| 25 | Ga0068869_100073753 | 3300005334 | Bacteria | 2531 |
| 26 | Ga0068869_100170574 | 3300005334 | Bacteria | 1699 |
| 27 | Ga0068869_100726511 | 3300005334 | Bacteria | 849 |
| 28 | Ga0068869_101009791 | 3300005334 | Bacteria | 725 |
| 29 | Ga0070666_10242701 | 3300005335 | Bacteria | 1274 |
| 30 | Ga0070682_100036436 | 3300005337 | Bacteria | 3007 |
| 31 | Ga0070682_101668905 | 3300005337 | Bacteria | 553 |
| 32 | Ga0068868_100061212 | 3300005338 | Bacteria | 2982 |
| 33 | Ga0068868_100149026 | 3300005338 | Bacteria | 1926 |
| 34 | Ga0068868_100487663 | 3300005338 | Bacteria | 1077 |
| 35 | Ga0068868_100645846 | 3300005338 | Bacteria | 942 |
| 36 | Ga0070660_100773748 | 3300005339 | Bacteria | 807 |
| 37 | Ga0070660_101235354 | 3300005339 | Bacteria | 634 |
| 38 | Ga0070689_100029472 | 3300005340 | Bacteria | 4155 |
| 39 | Ga0070661_100090117 | 3300005344 | Bacteria | 2271 |
| 40 | Ga0070668_100194020 | 3300005347 | Bacteria | 1664 |
| 41 | Ga0070668_101210569 | 3300005347 | Bacteria | 684 |
| 42 | Ga0070669_100077152 | 3300005353 | Bacteria | 2475 |
| 43 | Ga0070669_100647603 | 3300005353 | Bacteria | 889 |
| 44 | Ga0070675_100256096 | 3300005354 | Bacteria | 1533 |
| 45 | Ga0070675_100444799 | 3300005354 | Bacteria | 1162 |
| 46 | Ga0070675_100494369 | 3300005354 | Bacteria | 1102 |
| 47 | Ga0070675_100671313 | 3300005354 | Bacteria | 943 |
| 48 | Ga0070671_100300849 | 3300005355 | Bacteria | 1366 |
| 49 | Ga0070671_100385853 | 3300005355 | Bacteria | 1197 |
| 50 | Ga0070671_100593258 | 3300005355 | Bacteria | 957 |
| 51 | Ga0070674_100018587 | 3300005356 | Bacteria | 4398 |
| 52 | Ga0070673_100071969 | 3300005364 | Bacteria | 2779 |
| 53 | Ga0070673_100722271 | 3300005364 | Bacteria | 916 |
| 54 | Ga0070673_101609494 | 3300005364 | Bacteria | 614 |
| 55 | Ga0070688_100332304 | 3300005365 | Bacteria | 1107 |
| 56 | Ga0070688_100379429 | 3300005365 | Bacteria | 1042 |
| 57 | Ga0070659_100890205 | 3300005366 | Bacteria | 777 |
| 58 | Ga0070659_101699146 | 3300005366 | Bacteria | 564 |
| 59 | Ga0070667_100171236 | 3300005367 | Bacteria | 1917 |
| 60 | Ga0070667_101488193 | 3300005367 | Bacteria | 636 |
| 61 | Ga0070709_10001487 | 3300005434 | Bacteria | 12659 |
| 62 | Ga0070714_100228898 | 3300005435 | Bacteria | 1712 |
| 63 | Ga0070713_100375492 | 3300005436 | Bacteria | 1324 |
| 64 | Ga0070713_100634323 | 3300005436 | Bacteria | 1017 |
| 65 | Ga0070710_10648292 | 3300005437 | Bacteria | 740 |
| 66 | Ga0070701_10812765 | 3300005438 | Bacteria | 639 |
| 67 | Ga0070711_100004982 | 3300005439 | Bacteria | 7886 |
| 68 | Ga0070711_100009103 | 3300005439 | Bacteria | 6103 |
| 69 | Ga0070711_101810257 | 3300005439 | Bacteria | 536 |
| 70 | Ga0070700_100015418 | 3300005441 | Bacteria | 4332 |
| 71 | Ga0070708_100064842 | 3300005445 | Bacteria | 3274 |
| 72 | Ga0070708_100690600 | 3300005445 | Bacteria | 961 |
| 73 | Ga0070663_100004680 | 3300005455 | Bacteria | 8069 |
| 74 | Ga0070663_100073751 | 3300005455 | Bacteria | 2490 |
| 75 | Ga0070663_100089274 | 3300005455 | Bacteria | 2280 |
| 76 | Ga0070663_100173392 | 3300005455 | Bacteria | 1668 |
| 77 | Ga0070663_100320808 | 3300005455 | Bacteria | 1246 |
| 78 | Ga0070678_100045978 | 3300005456 | Bacteria | 3127 |
| 79 | Ga0070678_100160527 | 3300005456 | Bacteria | 1820 |
| 80 | Ga0070678_100345611 | 3300005456 | Bacteria | 1277 |
| 81 | Ga0070678_100700049 | 3300005456 | Bacteria | 913 |
| 82 | Ga0070662_100100370 | 3300005457 | Bacteria | 2189 |
| 83 | Ga0070662_100145701 | 3300005457 | Bacteria | 1839 |
| 84 | Ga0070662_101016872 | 3300005457 | Bacteria | 710 |
| 85 | Ga0070681_10012465 | 3300005458 | Bacteria | 8435 |
| 86 | Ga0068867_100077329 | 3300005459 | Bacteria | 2500 |
| 87 | Ga0070706_100473639 | 3300005467 | Bacteria | 1165 |
| 88 | Ga0070707_100067780 | 3300005468 | Bacteria | 3434 |
| 89 | Ga0070698_100028998 | 3300005471 | Bacteria | 5744 |
| 90 | Ga0070698_100901362 | 3300005471 | Bacteria | 830 |
| 91 | Ga0070699_100633627 | 3300005518 | Bacteria | 976 |
| 92 | Ga0070679_100018130 | 3300005530 | Bacteria | 6824 |
| 93 | Ga0070697_101292512 | 3300005536 | Bacteria | 651 |
| 94 | Ga0070697_101484915 | 3300005536 | Bacteria | 606 |
| 95 | Ga0068853_100432519 | 3300005539 | Bacteria | 1236 |
| 96 | Ga0068853_101321949 | 3300005539 | Bacteria | 697 |
| 97 | Ga0068853_101927947 | 3300005539 | Bacteria | 573 |
| 98 | Ga0070672_100036650 | 3300005543 | Bacteria | 3738 |
| 99 | Ga0070672_100719582 | 3300005543 | Bacteria | 875 |
| 100 | Ga0070686_100061402 | 3300005544 | Bacteria | 2428 |
| 101 | Ga0070696_101316213 | 3300005546 | Bacteria | 614 |
| 102 | Ga0070665_100013100 | 3300005548 | Bacteria | 8350 |
| 103 | Ga0070665_100030279 | 3300005548 | Bacteria | 5447 |
| 104 | Ga0070665_100062009 | 3300005548 | Bacteria | 3749 |
| 105 | Ga0070665_100142934 | 3300005548 | Bacteria | 2396 |
| 106 | Ga0070665_100154541 | 3300005548 | Bacteria | 2296 |
| 107 | Ga0070665_100176827 | 3300005548 | Bacteria | 2135 |
| 108 | Ga0070665_100475717 | 3300005548 | Bacteria | 1260 |
| 109 | Ga0070665_100602714 | 3300005548 | Bacteria | 1111 |
| 110 | Ga0070665_101278437 | 3300005548 | Bacteria | 744 |
| 111 | Ga0070665_101315473 | 3300005548 | Bacteria | 732 |
| 112 | Ga0068855_100007494 | 3300005563 | Bacteria | 13211 |
| 113 | Ga0068855_100157617 | 3300005563 | Bacteria | 2578 |
| 114 | Ga0068855_100173800 | 3300005563 | Bacteria | 2438 |
| 115 | Ga0070664_100451693 | 3300005564 | Bacteria | 1180 |
| 116 | Ga0070664_101292608 | 3300005564 | Bacteria | 689 |
| 117 | Ga0068854_100081574 | 3300005578 | Bacteria | 2389 |
| 118 | Ga0068854_100515802 | 3300005578 | Bacteria | 1009 |
| 119 | Ga0068854_100557659 | 3300005578 | Bacteria | 973 |
| 120 | Ga0068856_100225909 | 3300005614 | Bacteria | 1887 |
| 121 | Ga0068856_100252283 | 3300005614 | Bacteria | 1779 |
| 122 | Ga0068856_100257385 | 3300005614 | Bacteria | 1761 |
| 123 | Ga0068856_100446153 | 3300005614 | Bacteria | 1314 |
| 124 | Ga0070702_100030788 | 3300005615 | Bacteria | 2929 |
| 125 | Ga0070702_100256668 | 3300005615 | Bacteria | 1188 |
| 126 | Ga0070702_100504825 | 3300005615 | Bacteria | 889 |
| 127 | Ga0068852_100061105 | 3300005616 | Bacteria | 3273 |
| 128 | Ga0068852_100271608 | 3300005616 | Bacteria | 1632 |
| 129 | Ga0068852_100391056 | 3300005616 | Bacteria | 1366 |
| 130 | Ga0068852_102611884 | 3300005616 | Bacteria | 525 |
| 131 | Ga0068859_100029233 | 3300005617 | Bacteria | 5530 |
| 132 | Ga0068859_100157976 | 3300005617 | Bacteria | 2346 |
| 133 | Ga0068864_100031862 | 3300005618 | Bacteria | 4475 |
| 134 | Ga0068864_100189671 | 3300005618 | Bacteria | 1884 |
| 135 | Ga0068864_101871951 | 3300005618 | Bacteria | 606 |
| 136 | Ga0068866_10037646 | 3300005718 | Bacteria | 2377 |
| 137 | Ga0068861_100258607 | 3300005719 | Bacteria | 1489 |
| 138 | Ga0068861_101750191 | 3300005719 | Bacteria | 615 |
| 139 | Ga0068870_10624676 | 3300005840 | Bacteria | 735 |
| 140 | Ga0068863_100276087 | 3300005841 | Bacteria | 1627 |
| 141 | Ga0068863_101101683 | 3300005841 | Bacteria | 799 |
| 142 | Ga0068863_101336523 | 3300005841 | Bacteria | 724 |
| 143 | Ga0068858_100060155 | 3300005842 | Bacteria | 3511 |
| 144 | Ga0068858_100266626 | 3300005842 | Bacteria | 1629 |
| 145 | Ga0068860_100247013 | 3300005843 | Bacteria | 1737 |
| 146 | Ga0068860_100270075 | 3300005843 | Bacteria | 1659 |
| 147 | Ga0068862_100085066 | 3300005844 | Bacteria | 2748 |
| 148 | Ga0068862_100170988 | 3300005844 | Bacteria | 1945 |
| 149 | Ga0068862_100228976 | 3300005844 | Bacteria | 1685 |
| 150 | Ga0068862_100315519 | 3300005844 | Bacteria | 1442 |
| 151 | Ga0081455_10029662 | 3300005937 | Bacteria | 4984 |
| 152 | Ga0081455_10109650 | 3300005937 | Bacteria | 2196 |
| 153 | Ga0081455_10265399 | 3300005937 | Bacteria | 1248 |
| 154 | Ga0081540_1001339 | 3300005983 | Bacteria | 21460 |
| 155 | Ga0081540_1007193 | 3300005983 | Bacteria | 7985 |
| 156 | Ga0081540_1007306 | 3300005983 | Bacteria | 7903 |
| 157 | Ga0081540_1007993 | 3300005983 | Bacteria | 7446 |
| 158 | Ga0081540_1016547 | 3300005983 | Bacteria | 4607 |
| 159 | Ga0081540_1026662 | 3300005983 | Bacteria | 3291 |
| 160 | Ga0081540_1076704 | 3300005983 | Bacteria | 1522 |
| 161 | Ga0081540_1101767 | 3300005983 | Bacteria | 1236 |
| 162 | Ga0081540_1116499 | 3300005983 | Bacteria | 1118 |
| 163 | Ga0081540_1233257 | 3300005983 | Bacteria | 649 |
| 164 | Ga0081539_10000848 | 3300005985 | Bacteria | 58499 |
| 165 | Ga0081539_10012348 | 3300005985 | Bacteria | 6599 |
| 166 | Ga0075365_10016437 | 3300006038 | Bacteria | 4501 |
| 167 | Ga0075365_10032321 | 3300006038 | Bacteria | 3362 |
| 168 | Ga0075365_10041163 | 3300006038 | Bacteria | 3017 |
| 169 | Ga0075365_10075675 | 3300006038 | Bacteria | 2272 |
| 170 | Ga0075365_10082863 | 3300006038 | Bacteria | 2175 |
| 171 | Ga0075365_10504620 | 3300006038 | Bacteria | 855 |
| 172 | Ga0075365_10728030 | 3300006038 | Bacteria | 701 |
| 173 | Ga0075365_10836182 | 3300006038 | Bacteria | 650 |
| 174 | Ga0075368_10003948 | 3300006042 | Bacteria | 4995 |
| 175 | Ga0075363_100014770 | 3300006048 | Bacteria | 3825 |
| 176 | Ga0075363_100122388 | 3300006048 | Bacteria | 1454 |
| 177 | Ga0075363_100155479 | 3300006048 | Bacteria | 1293 |
| 178 | Ga0075363_100418580 | 3300006048 | Bacteria | 789 |
| 179 | Ga0075363_100428285 | 3300006048 | Bacteria | 780 |
| 180 | Ga0075364_10058712 | 3300006051 | Bacteria | 2521 |
| 181 | Ga0075364_10319221 | 3300006051 | Bacteria | 1058 |
| 182 | Ga0075364_10339815 | 3300006051 | Bacteria | 1023 |
| 183 | Ga0070715_10503674 | 3300006163 | Bacteria | 694 |
| 184 | Ga0070716_100034174 | 3300006173 | Bacteria | 2786 |
| 185 | Ga0070716_100154821 | 3300006173 | Bacteria | 1478 |
| 186 | Ga0070716_100367307 | 3300006173 | Bacteria | 1024 |
| 187 | Ga0070712_100073635 | 3300006175 | Bacteria | 2451 |
| 188 | Ga0070712_100217090 | 3300006175 | Bacteria | 1512 |
| 189 | Ga0070712_100377683 | 3300006175 | Bacteria | 1166 |
| 190 | Ga0070712_100413189 | 3300006175 | Bacteria | 1117 |
| 191 | Ga0070712_100685446 | 3300006175 | Bacteria | 873 |
| 192 | Ga0075362_10086410 | 3300006177 | Bacteria | 1451 |
| 193 | Ga0075362_10136051 | 3300006177 | Bacteria | 1172 |
| 194 | Ga0075367_10040157 | 3300006178 | Bacteria | 2731 |
| 195 | Ga0075367_10075171 | 3300006178 | Bacteria | 2037 |
| 196 | Ga0075367_10136379 | 3300006178 | Bacteria | 1518 |
| 197 | Ga0075367_10192724 | 3300006178 | Bacteria | 1272 |
| 198 | Ga0075367_10388212 | 3300006178 | Bacteria | 882 |
| 199 | Ga0075369_10095939 | 3300006186 | Bacteria | 1327 |
| 200 | Ga0075369_10137108 | 3300006186 | Bacteria | 1114 |
| 201 | Ga0075369_10206152 | 3300006186 | Bacteria | 908 |
| 202 | Ga0075369_10239910 | 3300006186 | Bacteria | 841 |
| 203 | Ga0075366_10024888 | 3300006195 | Bacteria | 3492 |
| 204 | Ga0075366_10032034 | 3300006195 | Bacteria | 3094 |
| 205 | Ga0075366_10050422 | 3300006195 | Bacteria | 2471 |
| 206 | Ga0075366_10196605 | 3300006195 | Bacteria | 1226 |
| 207 | Ga0075366_10483993 | 3300006195 | Bacteria | 765 |
| 208 | Ga0075366_10551633 | 3300006195 | Bacteria | 714 |
| 209 | Ga0075366_10637687 | 3300006195 | Bacteria | 661 |
| 210 | Ga0097621_100647048 | 3300006237 | Bacteria | 970 |
| 211 | Ga0097621_100795721 | 3300006237 | Bacteria | 876 |
| 212 | Ga0075370_10005105 | 3300006353 | Bacteria | 6470 |
| 213 | Ga0075370_10020322 | 3300006353 | Bacteria | 3627 |
| 214 | Ga0075370_10094272 | 3300006353 | Bacteria | 1728 |
| 215 | Ga0075370_10138407 | 3300006353 | Bacteria | 1423 |
| 216 | Ga0075370_10201833 | 3300006353 | Bacteria | 1173 |
| 217 | Ga0068871_100031423 | 3300006358 | Bacteria | 4188 |
| 218 | Ga0068871_100104460 | 3300006358 | Bacteria | 2376 |
| 219 | Ga0068871_101681277 | 3300006358 | Bacteria | 602 |
| 220 | Ga0075428_100157112 | 3300006844 | Bacteria | 2469 |
| 221 | Ga0075434_100189929 | 3300006871 | Bacteria | 2074 |
| 222 | Ga0075434_100444533 | 3300006871 | Bacteria | 1318 |
| 223 | Ga0068865_100109505 | 3300006881 | Bacteria | 2035 |
| 224 | Ga0068865_100849440 | 3300006881 | Bacteria | 791 |
| 225 | Ga0068865_101658442 | 3300006881 | Bacteria | 576 |
| 226 | Ga0075436_100624736 | 3300006914 | Bacteria | 795 |
| 227 | Ga0097620_100029232 | 3300006931 | Bacteria | 5530 |
| 228 | Ga0097620_100157985 | 3300006931 | Bacteria | 2346 |
| 229 | Ga0075435_100341705 | 3300007076 | Bacteria | 1283 |
| 230 | Ga0099794_10044583 | 3300007265 | Bacteria | 2120 |
| 231 | Ga0099794_10102428 | 3300007265 | Bacteria | 1430 |
| 232 | Ga0099795_10002812 | 3300007788 | Bacteria | 4192 |
| 233 | Ga0099795_10043944 | 3300007788 | Bacteria | 1601 |
| 234 | Ga0099795_10142251 | 3300007788 | Bacteria | 976 |
| 235 | Ga0099795_10217289 | 3300007788 | Bacteria | 812 |
| 236 | Ga0105240_10309970 | 3300009093 | Bacteria | 1803 |
| 237 | Ga0105240_10502270 | 3300009093 | Bacteria | 1348 |
| 238 | Ga0111539_10071397 | 3300009094 | Bacteria | 4097 |
| 239 | Ga0111539_11000866 | 3300009094 | Bacteria | 972 |
| 240 | Ga0105245_10060551 | 3300009098 | Bacteria | 3410 |
| 241 | Ga0105245_11602772 | 3300009098 | Bacteria | 703 |
| 242 | Ga0105247_10406197 | 3300009101 | Bacteria | 972 |
| 243 | Ga0105243_10501348 | 3300009148 | Bacteria | 1150 |
| 244 | Ga0105243_10638961 | 3300009148 | Bacteria | 1030 |
| 245 | Ga0105243_10702884 | 3300009148 | Bacteria | 986 |
| 246 | Ga0105243_10737151 | 3300009148 | Bacteria | 965 |
| 247 | Ga0105241_10012915 | 3300009174 | Bacteria | 6127 |
| 248 | Ga0105241_10392659 | 3300009174 | Bacteria | 1215 |
| 249 | Ga0105241_10514380 | 3300009174 | Bacteria | 1070 |
| 250 | Ga0105242_10035582 | 3300009176 | Bacteria | 3993 |
| 251 | Ga0105242_10506722 | 3300009176 | Bacteria | 1149 |
| 252 | Ga0105242_11303406 | 3300009176 | Bacteria | 750 |
| 253 | Ga0105248_10172136 | 3300009177 | Bacteria | 2441 |
| 254 | Ga0105248_11181365 | 3300009177 | Bacteria | 865 |
| 255 | Ga0105237_10018023 | 3300009545 | Bacteria | 7315 |
| 256 | Ga0105237_10137184 | 3300009545 | Bacteria | 2441 |
| 257 | Ga0105237_10208119 | 3300009545 | Bacteria | 1956 |
| 258 | Ga0105237_10448755 | 3300009545 | Bacteria | 1296 |
| 259 | Ga0105237_11045357 | 3300009545 | Bacteria | 823 |
| 260 | Ga0105238_10202605 | 3300009551 | Bacteria | 1960 |
| 261 | Ga0105238_10572463 | 3300009551 | Bacteria | 1135 |
| 262 | Ga0105238_10575588 | 3300009551 | Bacteria | 1132 |
| 263 | Ga0105238_11314755 | 3300009551 | Bacteria | 749 |
| 264 | Ga0105249_10311426 | 3300009553 | Bacteria | 1583 |
| 265 | Ga0105249_10513667 | 3300009553 | Bacteria | 1245 |
| 266 | Ga0105249_10910747 | 3300009553 | Bacteria | 946 |
| 267 | Ga0099796_10009289 | 3300010159 | Bacteria | 2656 |
| 268 | Ga0099796_10151157 | 3300010159 | Bacteria | 914 |
| 269 | Ga0099796_10295163 | 3300010159 | Bacteria | 685 |
| 270 | Ga0099796_10520424 | 3300010159 | Bacteria | 534 |
| 271 | Ga0105239_10043909 | 3300010375 | Bacteria | 4901 |
| 272 | Ga0105239_10048229 | 3300010375 | Bacteria | 4670 |
| 273 | Ga0105239_10126823 | 3300010375 | Bacteria | 2837 |
| 274 | Ga0105239_10267474 | 3300010375 | Bacteria | 1922 |
| 275 | Ga0105239_10741915 | 3300010375 | Bacteria | 1124 |
| 276 | Ga0105239_10753928 | 3300010375 | Bacteria | 1114 |
| 277 | Ga0105239_10909995 | 3300010375 | Bacteria | 1010 |
| 278 | Ga0105239_11142778 | 3300010375 | Bacteria | 897 |
| 279 | Ga0105239_13432695 | 3300010375 | Bacteria | 515 |
| 280 | Ga0105246_10085714 | 3300011119 | Bacteria | 2256 |
| 281 | Ga0105246_10089670 | 3300011119 | Bacteria | 2213 |
| 282 | Ga0105246_10199271 | 3300011119 | Bacteria | 1555 |
| 283 | Ga0105246_10233447 | 3300011119 | Bacteria | 1450 |
| 284 | Ga0105246_10783537 | 3300011119 | Bacteria | 844 |
| 285 | Ga0105246_10839555 | 3300011119 | Bacteria | 818 |
| 286 | Ga0105246_11006436 | 3300011119 | Bacteria | 755 |
| 287 | Ga0157323_1011445 | 3300012495 | Bacteria | 715 |
| 288 | Ga0157323_1011788 | 3300012495 | Bacteria | 710 |
| 289 | Ga0157370_10026904 | 3300013104 | Bacteria | 5674 |
| 290 | Ga0157374_10019278 | 3300013296 | Bacteria | 6036 |
| 291 | Ga0157374_10066182 | 3300013296 | Bacteria | 3396 |
| 292 | Ga0157374_10110883 | 3300013296 | Bacteria | 2639 |
| 293 | Ga0157374_10388075 | 3300013296 | Bacteria | 1392 |
| 294 | Ga0157374_12404282 | 3300013296 | Bacteria | 554 |
| 295 | Ga0157378_10031236 | 3300013297 | Bacteria | 4704 |
| 296 | Ga0157378_10547367 | 3300013297 | Bacteria | 1162 |
| 297 | Ga0163162_10044547 | 3300013306 | Bacteria | 4444 |
| 298 | Ga0163162_10129391 | 3300013306 | Bacteria | 2633 |
| 299 | Ga0163162_10235980 | 3300013306 | Bacteria | 1959 |
| 300 | Ga0163162_11179575 | 3300013306 | Bacteria | 869 |
| 301 | Ga0157372_10494544 | 3300013307 | Bacteria | 1426 |
| 302 | Ga0157375_10154583 | 3300013308 | Bacteria | 2432 |
| 303 | Ga0157375_10174025 | 3300013308 | Bacteria | 2301 |
| 304 | Ga0157375_10174992 | 3300013308 | Bacteria | 2295 |
| 305 | Ga0157375_10227133 | 3300013308 | Bacteria | 2025 |
| 306 | Ga0157375_10836715 | 3300013308 | Bacteria | 1067 |
| 307 | Ga0163163_10057665 | 3300014325 | Bacteria | 3840 |
| 308 | Ga0163163_10073225 | 3300014325 | Bacteria | 3416 |
| 309 | Ga0163163_10203034 | 3300014325 | Bacteria | 2031 |
| 310 | Ga0157380_10109465 | 3300014326 | Bacteria | 2318 |
| 311 | Ga0157380_10157219 | 3300014326 | Bacteria | 1971 |
| 312 | Ga0182008_10227787 | 3300014497 | Bacteria | 955 |
| 313 | Ga0182008_10263072 | 3300014497 | Bacteria | 893 |
| 314 | Ga0157377_10149709 | 3300014745 | Bacteria | 1442 |
| 315 | Ga0157377_10686845 | 3300014745 | Bacteria | 741 |
| 316 | Ga0157379_10060147 | 3300014968 | Bacteria | 3396 |
| 317 | Ga0157379_10344996 | 3300014968 | Bacteria | 1362 |
| 318 | Ga0157379_11240093 | 3300014968 | Bacteria | 718 |
| 319 | Ga0157376_10046724 | 3300014969 | Bacteria | 3572 |
| 320 | Ga0157376_10555669 | 3300014969 | Bacteria | 1137 |
| 321 | Ga0157376_12963154 | 3300014969 | Bacteria | 514 |
| 322 | Ga0163161_10088848 | 3300017792 | Bacteria | 2284 |
| 323 | Ga0163161_11063447 | 3300017792 | Bacteria | 694 |
| 324 | Ga0163161_11198956 | 3300017792 | Bacteria | 656 |
| 325 | Ga0206356_10120399 | 3300020070 | Bacteria | 749 |
| 326 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 327 | Ga0214542_1037420 | 3300021321 | Bacteria | 1384 |
| 328 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 329 | Ga0214545_1035280 | 3300021324 | Bacteria | 1666 |
| 330 | Ga0214543_1000111 | 3300021327 | Bacteria | 106517 |
| 331 | Ga0214543_1033779 | 3300021327 | Bacteria | 1803 |
| 332 | Ga0213876_10295971 | 3300021384 | Bacteria | 860 |
| 333 | Ga0209563_102320 | 3300025230 | Bacteria | 4365 |
| 334 | Ga0209677_101639 | 3300025253 | Bacteria | 9408 |
| 335 | Ga0209677_102591 | 3300025253 | Bacteria | 6615 |
| 336 | Ga0209148_1006467 | 3300025254 | Bacteria | 2537 |
| 337 | Ga0209233_1004340 | 3300025261 | Bacteria | 4839 |
| 338 | Ga0209233_1008872 | 3300025261 | Bacteria | 3083 |
| 339 | Ga0209233_1027348 | 3300025261 | Bacteria | 1383 |
| 340 | Ga0209455_1001472 | 3300025272 | Bacteria | 10597 |
| 341 | Ga0209455_1001710 | 3300025272 | Bacteria | 9395 |
| 342 | Ga0209564_1006563 | 3300025295 | Bacteria | 6245 |
| 343 | Ga0209564_1031518 | 3300025295 | Bacteria | 1617 |
| 344 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 345 | Ga0209758_1003592 | 3300025297 | Bacteria | 13874 |
| 346 | Ga0209758_1003725 | 3300025297 | Bacteria | 13511 |
| 347 | Ga0209758_1005478 | 3300025297 | Bacteria | 9742 |
| 348 | Ga0209758_1046037 | 3300025297 | Bacteria | 1577 |
| 349 | Ga0209256_1004953 | 3300025299 | Bacteria | 7982 |
| 350 | Ga0209256_1027989 | 3300025299 | Bacteria | 1598 |
| 351 | Ga0207426_1002013 | 3300025302 | Bacteria | 14342 |
| 352 | Ga0207426_1034873 | 3300025302 | Bacteria | 1611 |
| 353 | Ga0209257_1003378 | 3300025304 | Bacteria | 13780 |
| 354 | Ga0207697_10065223 | 3300025315 | Bacteria | 1519 |
| 355 | Ga0207697_10216603 | 3300025315 | Bacteria | 844 |
| 356 | Ga0207697_10443720 | 3300025315 | Bacteria | 575 |
| 357 | Ga0207692_10407209 | 3300025898 | Bacteria | 849 |
| 358 | Ga0207692_10450057 | 3300025898 | Bacteria | 810 |
| 359 | Ga0207692_10650649 | 3300025898 | Bacteria | 681 |
| 360 | Ga0207642_10020324 | 3300025899 | Bacteria | 2589 |
| 361 | Ga0207642_10396173 | 3300025899 | Bacteria | 825 |
| 362 | Ga0207642_10469724 | 3300025899 | Bacteria | 765 |
| 363 | Ga0207710_10164150 | 3300025900 | Bacteria | 1083 |
| 364 | Ga0207688_10019383 | 3300025901 | Bacteria | 3705 |
| 365 | Ga0207688_10088637 | 3300025901 | Bacteria | 1774 |
| 366 | Ga0207688_10089460 | 3300025901 | Bacteria | 1766 |
| 367 | Ga0207688_10344528 | 3300025901 | Bacteria | 917 |
| 368 | Ga0207680_10163305 | 3300025903 | Bacteria | 1495 |
| 369 | Ga0207680_10169761 | 3300025903 | Bacteria | 1468 |
| 370 | Ga0207647_10011423 | 3300025904 | Bacteria | 6230 |
| 371 | Ga0207685_10233027 | 3300025905 | Bacteria | 882 |
| 372 | Ga0207699_10129981 | 3300025906 | Bacteria | 1641 |
| 373 | Ga0207645_10092170 | 3300025907 | Bacteria | 1949 |
| 374 | Ga0207645_10184660 | 3300025907 | Bacteria | 1369 |
| 375 | Ga0207705_10061486 | 3300025909 | Bacteria | 2713 |
| 376 | Ga0207705_10216616 | 3300025909 | Bacteria | 1453 |
| 377 | Ga0207705_10234508 | 3300025909 | Bacteria | 1396 |
| 378 | Ga0207684_10186080 | 3300025910 | Bacteria | 1791 |
| 379 | Ga0207684_10639812 | 3300025910 | Bacteria | 907 |
| 380 | Ga0207654_10014746 | 3300025911 | Bacteria | 4042 |
| 381 | Ga0207654_10463892 | 3300025911 | Bacteria | 890 |
| 382 | Ga0207707_10011000 | 3300025912 | Bacteria | 7874 |
| 383 | Ga0207707_11354883 | 3300025912 | Bacteria | 569 |
| 384 | Ga0207695_10234230 | 3300025913 | Bacteria | 1739 |
| 385 | Ga0207671_10083323 | 3300025914 | Bacteria | 2401 |
| 386 | Ga0207671_10119378 | 3300025914 | Bacteria | 2014 |
| 387 | Ga0207671_10307417 | 3300025914 | Bacteria | 1253 |
| 388 | Ga0207671_10703069 | 3300025914 | Bacteria | 804 |
| 389 | Ga0207693_10009325 | 3300025915 | Bacteria | 8001 |
| 390 | Ga0207693_10017747 | 3300025915 | Bacteria | 5675 |
| 391 | Ga0207693_10122761 | 3300025915 | Bacteria | 2040 |
| 392 | Ga0207693_10244528 | 3300025915 | Bacteria | 1408 |
| 393 | Ga0207663_10025502 | 3300025916 | Bacteria | 3419 |
| 394 | Ga0207663_10100721 | 3300025916 | Bacteria | 1939 |
| 395 | Ga0207657_10166797 | 3300025919 | Bacteria | 1786 |
| 396 | Ga0207657_10556936 | 3300025919 | Bacteria | 896 |
| 397 | Ga0207657_11061567 | 3300025919 | Bacteria | 620 |
| 398 | Ga0207649_10066665 | 3300025920 | Bacteria | 2283 |
| 399 | Ga0207652_10158337 | 3300025921 | Bacteria | 2029 |
| 400 | Ga0207646_10261644 | 3300025922 | Bacteria | 1563 |
| 401 | Ga0207681_10214086 | 3300025923 | Bacteria | 1487 |
| 402 | Ga0207681_10901979 | 3300025923 | Bacteria | 740 |
| 403 | Ga0207681_11009395 | 3300025923 | Bacteria | 698 |
| 404 | Ga0207694_10122221 | 3300025924 | Bacteria | 2079 |
| 405 | Ga0207694_10572641 | 3300025924 | Bacteria | 949 |
| 406 | Ga0207694_10628845 | 3300025924 | Bacteria | 904 |
| 407 | Ga0207694_11328088 | 3300025924 | Bacteria | 608 |
| 408 | Ga0207650_10562013 | 3300025925 | Bacteria | 957 |
| 409 | Ga0207659_10220386 | 3300025926 | Bacteria | 1525 |
| 410 | Ga0207659_10550945 | 3300025926 | Bacteria | 980 |
| 411 | Ga0207687_10299895 | 3300025927 | Bacteria | 1294 |
| 412 | Ga0207687_10691934 | 3300025927 | Bacteria | 865 |
| 413 | Ga0207700_11115625 | 3300025928 | Bacteria | 705 |
| 414 | Ga0207700_11704156 | 3300025928 | Bacteria | 556 |
| 415 | Ga0207664_11208542 | 3300025929 | Bacteria | 674 |
| 416 | Ga0207644_10178384 | 3300025931 | Bacteria | 1663 |
| 417 | Ga0207644_10273138 | 3300025931 | Bacteria | 1355 |
| 418 | Ga0207644_10516522 | 3300025931 | Bacteria | 986 |
| 419 | Ga0207644_11006653 | 3300025931 | Bacteria | 699 |
| 420 | Ga0207690_10268274 | 3300025932 | Bacteria | 1325 |
| 421 | Ga0207690_11222132 | 3300025932 | Bacteria | 628 |
| 422 | Ga0207706_10020636 | 3300025933 | Bacteria | 5921 |
| 423 | Ga0207706_10218356 | 3300025933 | Bacteria | 1670 |
| 424 | Ga0207706_10465884 | 3300025933 | Bacteria | 1092 |
| 425 | Ga0207686_10170721 | 3300025934 | Bacteria | 1533 |
| 426 | Ga0207686_10256367 | 3300025934 | Bacteria | 1280 |
| 427 | Ga0207686_10445902 | 3300025934 | Bacteria | 995 |
| 428 | Ga0207686_10692655 | 3300025934 | Bacteria | 809 |
| 429 | Ga0207709_10041130 | 3300025935 | Bacteria | 2772 |
| 430 | Ga0207709_11248901 | 3300025935 | Bacteria | 613 |
| 431 | Ga0207709_11616757 | 3300025935 | Bacteria | 538 |
| 432 | Ga0207670_10039211 | 3300025936 | Bacteria | 3101 |
| 433 | Ga0207670_10925765 | 3300025936 | Bacteria | 731 |
| 434 | Ga0207669_10007035 | 3300025937 | Bacteria | 5176 |
| 435 | Ga0207704_10062027 | 3300025938 | Bacteria | 2322 |
| 436 | Ga0207704_10133658 | 3300025938 | Bacteria | 1723 |
| 437 | Ga0207665_10023296 | 3300025939 | Bacteria | 4078 |
| 438 | Ga0207665_10101928 | 3300025939 | Bacteria | 2005 |
| 439 | Ga0207665_10651826 | 3300025939 | Bacteria | 825 |
| 440 | Ga0207665_11424140 | 3300025939 | Bacteria | 551 |
| 441 | Ga0207691_10103322 | 3300025940 | Bacteria | 2541 |
| 442 | Ga0207691_10552016 | 3300025940 | Bacteria | 977 |
| 443 | Ga0207711_10316425 | 3300025941 | Bacteria | 1441 |
| 444 | Ga0207711_10334427 | 3300025941 | Bacteria | 1401 |
| 445 | Ga0207689_10391727 | 3300025942 | Bacteria | 1157 |
| 446 | Ga0207689_10443619 | 3300025942 | Bacteria | 1084 |
| 447 | Ga0207689_10627672 | 3300025942 | Bacteria | 905 |
| 448 | Ga0207689_11080396 | 3300025942 | Bacteria | 676 |
| 449 | Ga0207661_10570559 | 3300025944 | Bacteria | 1037 |
| 450 | Ga0207661_10576659 | 3300025944 | Bacteria | 1032 |
| 451 | Ga0207679_10318278 | 3300025945 | Bacteria | 1346 |
| 452 | Ga0207679_11130151 | 3300025945 | Bacteria | 719 |
| 453 | Ga0207667_10050380 | 3300025949 | Bacteria | 4394 |
| 454 | Ga0207667_12040882 | 3300025949 | Bacteria | 533 |
| 455 | Ga0207651_10064111 | 3300025960 | Bacteria | 2570 |
| 456 | Ga0207668_10008217 | 3300025972 | Bacteria | 6216 |
| 457 | Ga0207668_10173030 | 3300025972 | Bacteria | 1695 |
| 458 | Ga0207668_10262230 | 3300025972 | Bacteria | 1409 |
| 459 | Ga0207668_10683879 | 3300025972 | Bacteria | 900 |
| 460 | Ga0207668_10836322 | 3300025972 | Bacteria | 817 |
| 461 | Ga0207640_10048550 | 3300025981 | Bacteria | 2745 |
| 462 | Ga0207640_10123950 | 3300025981 | Bacteria | 1857 |
| 463 | Ga0207658_10075824 | 3300025986 | Bacteria | 2560 |
| 464 | Ga0207658_10180619 | 3300025986 | Bacteria | 1746 |
| 465 | Ga0207658_10554862 | 3300025986 | Bacteria | 1028 |
| 466 | Ga0207658_10837159 | 3300025986 | Bacteria | 836 |
| 467 | Ga0207658_11253074 | 3300025986 | Bacteria | 678 |
| 468 | Ga0207658_12090848 | 3300025986 | Bacteria | 515 |
| 469 | Ga0207677_10110732 | 3300026023 | Bacteria | 2044 |
| 470 | Ga0207677_10234842 | 3300026023 | Bacteria | 1480 |
| 471 | Ga0207677_10527442 | 3300026023 | Bacteria | 1025 |
| 472 | Ga0207677_10535789 | 3300026023 | Bacteria | 1018 |
| 473 | Ga0207677_11600840 | 3300026023 | Bacteria | 603 |
| 474 | Ga0207703_10193232 | 3300026035 | Bacteria | 1804 |
| 475 | Ga0207639_10098940 | 3300026041 | Bacteria | 2352 |
| 476 | Ga0207639_10164849 | 3300026041 | Bacteria | 1871 |
| 477 | Ga0207639_10167178 | 3300026041 | Bacteria | 1859 |
| 478 | Ga0207639_10249569 | 3300026041 | Bacteria | 1547 |
| 479 | Ga0207639_11186091 | 3300026041 | Bacteria | 716 |
| 480 | Ga0207678_10004216 | 3300026067 | Bacteria | 12904 |
| 481 | Ga0207678_10060134 | 3300026067 | Bacteria | 3268 |
| 482 | Ga0207678_10089469 | 3300026067 | Bacteria | 2631 |
| 483 | Ga0207678_10099974 | 3300026067 | Bacteria | 2478 |
| 484 | Ga0207678_10123758 | 3300026067 | Bacteria | 2207 |
| 485 | Ga0207678_10227790 | 3300026067 | Bacteria | 1596 |
| 486 | Ga0207678_10397726 | 3300026067 | Bacteria | 1193 |
| 487 | Ga0207678_10402078 | 3300026067 | Bacteria | 1186 |
| 488 | Ga0207708_10049842 | 3300026075 | Bacteria | 3189 |
| 489 | Ga0207702_10229418 | 3300026078 | Bacteria | 1734 |
| 490 | Ga0207702_10327935 | 3300026078 | Bacteria | 1459 |
| 491 | Ga0207641_10308005 | 3300026088 | Bacteria | 1498 |
| 492 | Ga0207641_10365347 | 3300026088 | Bacteria | 1379 |
| 493 | Ga0207641_10951971 | 3300026088 | Bacteria | 854 |
| 494 | Ga0207641_11255460 | 3300026088 | Bacteria | 741 |
| 495 | Ga0207648_10097170 | 3300026089 | Bacteria | 2578 |
| 496 | Ga0207648_10293405 | 3300026089 | Bacteria | 1456 |
| 497 | Ga0207676_10162342 | 3300026095 | Bacteria | 1937 |
| 498 | Ga0207676_10669756 | 3300026095 | Bacteria | 1003 |
| 499 | Ga0207676_10894876 | 3300026095 | Bacteria | 870 |
| 500 | Ga0207674_10091381 | 3300026116 | Bacteria | 3034 |
| 501 | Ga0207674_10309414 | 3300026116 | Bacteria | 1529 |
| 502 | Ga0207675_100049241 | 3300026118 | Bacteria | 3933 |
| 503 | Ga0207675_100126297 | 3300026118 | Bacteria | 2423 |
| 504 | Ga0207683_10029544 | 3300026121 | Bacteria | 4746 |
| 505 | Ga0207683_10051305 | 3300026121 | Bacteria | 3614 |
| 506 | Ga0207683_10060366 | 3300026121 | Bacteria | 3333 |
| 507 | Ga0207683_10212381 | 3300026121 | Bacteria | 1762 |
| 508 | Ga0207683_10972293 | 3300026121 | Bacteria | 788 |
| 509 | Ga0207683_11677118 | 3300026121 | Bacteria | 585 |
| 510 | Ga0207683_11865045 | 3300026121 | Bacteria | 550 |
| 511 | Ga0207698_10367021 | 3300026142 | Bacteria | 1365 |
| 512 | Ga0207698_10554453 | 3300026142 | Bacteria | 1127 |
| 513 | Ga0209179_1008779 | 3300027512 | Bacteria | 1714 |
| 514 | Ga0209588_1019784 | 3300027671 | Bacteria | 2105 |
| 515 | Ga0207428_10368040 | 3300027907 | Bacteria | 1056 |
| 516 | Ga0207428_10923875 | 3300027907 | Bacteria | 616 |
| 517 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 518 | Ga0268266_10003686 | 3300028379 | Bacteria | 15118 |
| 519 | Ga0268266_10094515 | 3300028379 | Bacteria | 2624 |
| 520 | Ga0268266_10190353 | 3300028379 | Bacteria | 1873 |
| 521 | Ga0268266_10388186 | 3300028379 | Bacteria | 1318 |
| 522 | Ga0268266_10654635 | 3300028379 | Bacteria | 1011 |
| 523 | Ga0268266_10731320 | 3300028379 | Bacteria | 954 |
| 524 | Ga0268266_10742093 | 3300028379 | Bacteria | 947 |
| 525 | Ga0268266_11265124 | 3300028379 | Bacteria | 713 |
| 526 | Ga0268265_10061941 | 3300028380 | Bacteria | 2873 |
| 527 | Ga0268265_10124640 | 3300028380 | Bacteria | 2129 |
| 528 | Ga0268265_10192550 | 3300028380 | Bacteria | 1762 |
| 529 | Ga0268265_10198444 | 3300028380 | Bacteria | 1738 |
| 530 | Ga0268265_10480048 | 3300028380 | Bacteria | 1167 |
| 531 | Ga0268265_10564923 | 3300028380 | Bacteria | 1082 |
| 532 | Ga0268264_10192667 | 3300028381 | Bacteria | 1859 |
| 533 | Ga0265318_10079770 | 3300028577 | Bacteria | 1209 |
| 534 | Ga0265323_10018266 | 3300028653 | Bacteria | 2715 |
| 535 | Ga0265322_10117807 | 3300028654 | Bacteria | 756 |
| 536 | Ga0265336_10000415 | 3300028666 | Bacteria | 26412 |
| 537 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 538 | Ga0307517_10111579 | 3300028786 | Bacteria | 2077 |
| 539 | Ga0265338_10010045 | 3300028800 | Bacteria | 11184 |
| 540 | Ga0265324_10017627 | 3300029957 | Bacteria | 2597 |
| 541 | Ga0307513_10418783 | 3300031456 | Bacteria | 1070 |
| 542 | Ga0307509_10128015 | 3300031507 | Bacteria | 2501 |
| 543 | Ga0307408_100232397 | 3300031548 | Bacteria | 1511 |
| 544 | Ga0307508_10127944 | 3300031616 | Bacteria | 2143 |
| 545 | Ga0307516_10046388 | 3300031730 | Bacteria | 4287 |
| 546 | Ga0307516_10053240 | 3300031730 | Bacteria | 3958 |
| 547 | Ga0307405_10315500 | 3300031731 | Bacteria | 1192 |
| 548 | Ga0307405_10505101 | 3300031731 | Bacteria | 970 |
| 549 | Ga0307413_10171007 | 3300031824 | Bacteria | 1538 |
| 550 | Ga0307413_11473637 | 3300031824 | Bacteria | 601 |
| 551 | Ga0307410_11425331 | 3300031852 | Bacteria | 609 |
| 552 | Ga0307407_10761295 | 3300031903 | Bacteria | 734 |
| 553 | Ga0307412_10401698 | 3300031911 | Bacteria | 1116 |
| 554 | Ga0307409_100546889 | 3300031995 | Bacteria | 1136 |
| 555 | Ga0307416_101218302 | 3300032002 | Bacteria | 858 |
| 556 | Ga0307414_11399194 | 3300032004 | Bacteria | 650 |
| 557 | Ga0307411_10076739 | 3300032005 | Bacteria | 2285 |
| 558 | Ga0307411_10843113 | 3300032005 | Bacteria | 810 |
| 559 | Ga0307411_11395977 | 3300032005 | Bacteria | 641 |
| 560 | Ga0307415_100297967 | 3300032126 | Bacteria | 1334 |
| 561 | Ga0307507_10560606 | 3300033179 | Bacteria | 600 |
| 562 | Ga0307510_10007562 | 3300033180 | Bacteria | 12946 |
| 563 | Ga0307510_10327889 | 3300033180 | Bacteria | 986 |
| 564 | Ga0373940_0200791 | 3300035088 | Bacteria | 655 |
| 565 | Ga0373940_0336714 | 3300035088 | Bacteria | 527 |
| 566 | Ga0373952_0095837 | 3300035092 | Bacteria | 777 |
| 567 | Ga0373936_0043384 | 3300035113 | Bacteria | 1807 |
| 568 | Ga0373945_0075784 | 3300035116 | Bacteria | 1281 |
| 569 | Ga0373945_0101051 | 3300035116 | Bacteria | 1128 |
| 570 | Ga0373956_0259800 | 3300035119 | Bacteria | 826 |
| 571 | Ga0373943_0121755 | 3300035170 | Bacteria | 1387 |
| 572 | Ga0373943_0139389 | 3300035170 | Bacteria | 1305 |
| 573 | Ga0373943_0152823 | 3300035170 | Bacteria | 1251 |
| 574 | Ga0373946_0176394 | 3300035171 | Bacteria | 1012 |
| 575 | Ga0373946_0267866 | 3300035171 | Bacteria | 837 |
| 576 | Ga0373955_0071154 | 3300035172 | Bacteria | 1945 |
| 577 | Ga0373924_0048356 | 3300035410 | Bacteria | 1757 |
| 578 | Ga0373931_0020927 | 3300035691 | Bacteria | 3277 |
| 579 | Ga0373935_0000520 | 3300035692 | Bacteria | 20054 |
| 580 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 581 | Ga0373927_0009305 | 3300035695 | Bacteria | 6590 |
| 582 | Ga0373927_0039246 | 3300035695 | Bacteria | 3073 |
| 583 | Ga0373947_0001392 | 3300035725 | Bacteria | 14902 |
| 584 | Ga0373947_0038071 | 3300035725 | Bacteria | 2855 |
| 585 | Ga0373947_0165966 | 3300035725 | Bacteria | 1430 |
| 586 | Ga0373937_0048844 | 3300036401 | Bacteria | 3874 |
| 587 | Ga0373925_0009905 | 3300037068 | Bacteria | 6924 |
| 588 | Ga0373925_0013452 | 3300037068 | Bacteria | 5923 |
| 589 | Ga0373925_0023664 | 3300037068 | Bacteria | 4482 |
| 590 | Ga0373925_0390614 | 3300037068 | Bacteria | 1134 |
| 591 | Ga0395899_0154753 | 3300037312 | Bacteria | 1623 |
| 592 | Ga0395900_0016187 | 3300037418 | Bacteria | 7597 |
| 593 | Ga0395898_0475635 | 3300037466 | Bacteria | 1189 |
| 594 | Ga0395905_0081275 | 3300037471 | Bacteria | 3037 |
| 595 | Ga0395905_0147099 | 3300037471 | Bacteria | 2217 |
| 596 | Ga0395905_0344285 | 3300037471 | Bacteria | 1382 |
| 597 | Ga0395905_0860914 | 3300037471 | Bacteria | 809 |
| 598 | Ga0436364_0581979 | 3300037853 | Bacteria | 989 |
| 599 | Ga0395901_0097370 | 3300038443 | Bacteria | 3084 |
| 600 | Ga0395901_0733717 | 3300038443 | Bacteria | 982 |
| 601 | Ga0436365_0808674 | 3300039437 | Bacteria | 1431 |
| 602 | Ga0436365_0939911 | 3300039437 | Bacteria | 867 |
| 603 | Ga0436363_1563002 | 3300039450 | Bacteria | 508 |
| 604 | Ga0436362_1153757 | 3300039453 | Bacteria | 603 |
| 605 | Ga0439466_0205551 | 3300041411 | Bacteria | 599 |
| 606 | Ga0439465_0093118 | 3300041413 | Bacteria | 1033 |
| 607 | Ga0451787_184996 | 3300041441 | Bacteria | 635 |
| 608 | Ga0451787_288168 | 3300041441 | Bacteria | 801 |
| 609 | Ga0451793_0362601 | 3300041452 | Bacteria | 827 |
| 610 | Ga0451797_1560878 | 3300041453 | Bacteria | 544 |
| 611 | Ga0451800_1224866 | 3300041459 | Bacteria | 940 |
| 612 | Ga0451802_1494618 | 3300041460 | Bacteria | 619 |
| 613 | Ga0451833_0138182 | 3300041491 | Bacteria | 1056 |
| 614 | Ga0451841_0540834 | 3300041498 | Bacteria | 1072 |
| 615 | Ga0451849_0041184 | 3300041505 | Bacteria | 1084 |
| 616 | Ga0451849_0883225 | 3300041505 | Bacteria | 701 |
| 617 | Ga0451851_0496392 | 3300041507 | Bacteria | 914 |
| 618 | Ga0451851_0647873 | 3300041507 | Bacteria | 516 |
| 619 | Ga0451851_1102993 | 3300041507 | Bacteria | 532 |
| 620 | Ga0451853_1338784 | 3300041512 | Bacteria | 1004 |
| 621 | Ga0451853_3741495 | 3300041512 | Bacteria | 815 |
| 622 | Ga0439458_0159765 | 3300042157 | Bacteria | 606 |
| 623 | Ga0466972_0013988 | 3300044658 | Bacteria | 4024 |
| 624 | Ga0466965_0127668 | 3300044683 | Bacteria | 1317 |
| 625 | Ga0466964_0264110 | 3300044706 | Bacteria | 854 |
| 626 | Ga0466971_0157021 | 3300044719 | Bacteria | 1064 |
| 627 | Ga0466968_0003372 | 3300044735 | Bacteria | 5903 |
| 628 | Ga0466957_0105153 | 3300044842 | Bacteria | 1784 |
| 629 | Ga0466957_1093303 | 3300044842 | Bacteria | 575 |
| 630 | Ga0466960_0008649 | 3300044901 | Bacteria | 4174 |
| 631 | Ga0466960_0130216 | 3300044901 | Bacteria | 1327 |
| 632 | Ga0466959_0154824 | 3300045049 | Bacteria | 1614 |
| 633 | Ga0495617_231405 | 3300046452 | Bacteria | 572 |
| 634 | Ga0495592_0036407 | 3300046454 | Bacteria | 3707 |
| 635 | Ga0495603_0000051 | 3300046455 | Bacteria | 50402 |
| 636 | Ga0495603_0072096 | 3300046455 | Bacteria | 2029 |
| 637 | Ga0495603_0074766 | 3300046455 | Bacteria | 1989 |
| 638 | Ga0495603_0074854 | 3300046455 | Bacteria | 1988 |
| 639 | Ga0495590_0077288 | 3300046457 | Bacteria | 1171 |
| 640 | Ga0495629_0000182 | 3300046459 | Bacteria | 56655 |
| 641 | Ga0495629_0896585 | 3300046459 | Bacteria | 581 |
| 642 | Ga0495638_0021430 | 3300046460 | Bacteria | 4259 |
| 643 | Ga0495638_0139137 | 3300046460 | Bacteria | 1418 |
| 644 | Ga0495638_0266085 | 3300046460 | Bacteria | 938 |
| 645 | Ga0495638_0526218 | 3300046460 | Bacteria | 591 |
| 646 | Ga0495638_0526497 | 3300046460 | Bacteria | 591 |
| 647 | Ga0495641_0006374 | 3300046461 | Bacteria | 7658 |
| 648 | Ga0495653_0200693 | 3300046463 | Bacteria | 1354 |
| 649 | Ga0495650_0130564 | 3300046471 | Bacteria | 917 |
| 650 | Ga0495580_0004021 | 3300046472 | Bacteria | 12411 |
| 651 | Ga0495580_0291464 | 3300046472 | Bacteria | 1112 |
| 652 | Ga0495582_0000137 | 3300046473 | Bacteria | 39425 |
| 653 | Ga0495582_0229642 | 3300046473 | Bacteria | 1062 |
| 654 | Ga0495582_0482908 | 3300046473 | Bacteria | 716 |
| 655 | Ga0495605_0227921 | 3300046474 | Bacteria | 803 |
| 656 | Ga0495639_0002873 | 3300046475 | Bacteria | 7493 |
| 657 | Ga0495639_0254363 | 3300046475 | Bacteria | 869 |
| 658 | Ga0495639_0620166 | 3300046475 | Bacteria | 557 |
| 659 | Ga0495662_0000583 | 3300046476 | Bacteria | 16810 |
| 660 | Ga0495664_0009075 | 3300046477 | Bacteria | 5560 |
| 661 | Ga0495584_0104087 | 3300046491 | Bacteria | 1435 |
| 662 | Ga0495584_0181275 | 3300046491 | Bacteria | 1070 |
| 663 | Ga0495584_0403064 | 3300046491 | Bacteria | 695 |
| 664 | Ga0495584_0507590 | 3300046491 | Bacteria | 614 |
| 665 | Ga0495585_0029073 | 3300046492 | Bacteria | 3148 |
| 666 | Ga0495585_0275017 | 3300046492 | Bacteria | 834 |
| 667 | Ga0495594_0001833 | 3300046499 | Bacteria | 11057 |
| 668 | Ga0495594_0042613 | 3300046499 | Bacteria | 2486 |
| 669 | Ga0495594_0107854 | 3300046499 | Bacteria | 1569 |
| 670 | Ga0495596_0063639 | 3300046500 | Bacteria | 1435 |
| 671 | Ga0495596_0194477 | 3300046500 | Bacteria | 788 |
| 672 | Ga0495607_0393938 | 3300046501 | Bacteria | 631 |
| 673 | Ga0495583_0025223 | 3300046506 | Bacteria | 2974 |
| 674 | Ga0495606_0119588 | 3300046507 | Bacteria | 1578 |
| 675 | Ga0495606_0122562 | 3300046507 | Bacteria | 1554 |
| 676 | Ga0495606_0157047 | 3300046507 | Bacteria | 1330 |
| 677 | Ga0495606_0444146 | 3300046507 | Bacteria | 666 |
| 678 | Ga0495610_0100069 | 3300046512 | Bacteria | 1300 |
| 679 | Ga0495616_0162322 | 3300046513 | Bacteria | 1004 |
| 680 | Ga0495618_0523518 | 3300046514 | Bacteria | 713 |
| 681 | Ga0495620_0159318 | 3300046515 | Bacteria | 877 |
| 682 | Ga0495620_0169679 | 3300046515 | Bacteria | 846 |
| 683 | Ga0495628_0021321 | 3300046516 | Bacteria | 5332 |
| 684 | Ga0495630_0002625 | 3300046517 | Bacteria | 12446 |
| 685 | Ga0495630_0269329 | 3300046517 | Bacteria | 1301 |
| 686 | Ga0495630_1347834 | 3300046517 | Bacteria | 537 |
| 687 | Ga0495631_0015803 | 3300046518 | Bacteria | 3609 |
| 688 | Ga0495631_0089133 | 3300046518 | Bacteria | 1328 |
| 689 | Ga0495631_0197719 | 3300046518 | Bacteria | 860 |
| 690 | Ga0495631_0511994 | 3300046518 | Bacteria | 511 |
| 691 | Ga0495632_0055923 | 3300046519 | Bacteria | 1930 |
| 692 | Ga0495632_0138876 | 3300046519 | Bacteria | 1128 |
| 693 | Ga0495632_0148961 | 3300046519 | Bacteria | 1082 |
| 694 | Ga0495632_0294698 | 3300046519 | Bacteria | 720 |
| 695 | Ga0495643_0012291 | 3300046522 | Bacteria | 5170 |
| 696 | Ga0495643_0074090 | 3300046522 | Bacteria | 1784 |
| 697 | Ga0495643_0250555 | 3300046522 | Bacteria | 827 |
| 698 | Ga0495644_0091283 | 3300046523 | Bacteria | 1150 |
| 699 | Ga0495644_0220346 | 3300046523 | Bacteria | 733 |
| 700 | Ga0495648_0146427 | 3300046524 | Bacteria | 1237 |
| 701 | Ga0495648_0336875 | 3300046524 | Bacteria | 694 |
| 702 | Ga0495663_0064127 | 3300046525 | Bacteria | 1159 |
| 703 | Ga0495666_0386634 | 3300046526 | Bacteria | 629 |
| 704 | Ga0495666_0391769 | 3300046526 | Bacteria | 625 |
| 705 | Ga0495642_0166942 | 3300046528 | Bacteria | 956 |
| 706 | Ga0495652_0037670 | 3300046529 | Bacteria | 4194 |
| 707 | Ga0495654_0349189 | 3300046530 | Bacteria | 595 |
| 708 | Ga0495665_0001239 | 3300046531 | Bacteria | 13612 |
| 709 | Ga0495640_0004375 | 3300046533 | Bacteria | 11274 |
| 710 | Ga0495598_0046091 | 3300046537 | Bacteria | 1294 |
| 711 | Ga0495621_0018971 | 3300046539 | Bacteria | 2240 |
| 712 | Ga0495597_0033416 | 3300046542 | Bacteria | 2329 |
| 713 | Ga0495597_0051282 | 3300046542 | Bacteria | 1820 |
| 714 | Ga0495597_0344586 | 3300046542 | Bacteria | 572 |
| 715 | Ga0495622_0005490 | 3300046557 | Bacteria | 5879 |
| 716 | Ga0495622_0016785 | 3300046557 | Bacteria | 3410 |
| 717 | Ga0495622_0135417 | 3300046557 | Bacteria | 1120 |
| 718 | Ga0495622_0205157 | 3300046557 | Bacteria | 877 |
| 719 | Ga0495633_0109329 | 3300046558 | Bacteria | 1282 |
| 720 | Ga0495633_0242170 | 3300046558 | Bacteria | 824 |
| 721 | Ga0495667_0011352 | 3300046559 | Bacteria | 6031 |
| 722 | Ga0495656_0016955 | 3300046615 | Bacteria | 2772 |
| 723 | Ga0495656_0200527 | 3300046615 | Bacteria | 990 |
| 724 | Ga0495656_0214078 | 3300046615 | Bacteria | 961 |
| 725 | Ga0495668_0026683 | 3300046616 | Bacteria | 3276 |
| 726 | Ga0495668_0029504 | 3300046616 | Bacteria | 3099 |
| 727 | Ga0495668_0029734 | 3300046616 | Bacteria | 3086 |
| 728 | Ga0495668_0052320 | 3300046616 | Bacteria | 2260 |
| 729 | Ga0495668_0203406 | 3300046616 | Bacteria | 1084 |
| 730 | Ga0495668_0482000 | 3300046616 | Bacteria | 683 |
| 731 | Ga0495634_0002221 | 3300046642 | Bacteria | 16276 |
| 732 | Ga0495611_0126279 | 3300046648 | Bacteria | 1193 |
| 733 | Ga0495625_0058534 | 3300046660 | Bacteria | 2738 |
| 734 | Ga0495625_0094413 | 3300046660 | Bacteria | 2064 |
| 735 | Ga0495625_0140569 | 3300046660 | Bacteria | 1629 |
| 736 | Ga0495625_0185164 | 3300046660 | Bacteria | 1382 |
| 737 | Ga0495625_0391655 | 3300046660 | Bacteria | 870 |
| 738 | Ga0495625_0711609 | 3300046660 | Bacteria | 592 |
| 739 | Ga0495635_0001455 | 3300046663 | Bacteria | 15846 |
| 740 | Ga0495635_0978415 | 3300046663 | Bacteria | 539 |
| 741 | Ga0495659_0061547 | 3300046664 | Bacteria | 1387 |
| 742 | Ga0495661_0247668 | 3300046665 | Bacteria | 911 |
| 743 | Ga0495588_0046469 | 3300046674 | Bacteria | 2227 |
| 744 | Ga0495588_0082492 | 3300046674 | Bacteria | 1679 |
| 745 | Ga0495657_0147798 | 3300046675 | Bacteria | 1461 |
| 746 | Ga0495646_0048867 | 3300046680 | Bacteria | 2569 |
| 747 | Ga0495647_0032438 | 3300046681 | Bacteria | 1946 |
| 748 | Ga0495647_0223727 | 3300046681 | Bacteria | 831 |
| 749 | Ga0495658_0469737 | 3300046683 | Bacteria | 804 |
| 750 | Ga0495669_0007993 | 3300046684 | Bacteria | 4439 |
| 751 | Ga0495669_0255061 | 3300046684 | Bacteria | 842 |
| 752 | Ga0495669_0316823 | 3300046684 | Bacteria | 752 |
| 753 | Ga0495669_0470253 | 3300046684 | Bacteria | 611 |
| 754 | Ga0495613_0047965 | 3300046689 | Bacteria | 3154 |
| 755 | Ga0495624_0000898 | 3300046690 | Bacteria | 23624 |
| 756 | Ga0495624_0145609 | 3300046690 | Bacteria | 1450 |
| 757 | Ga0495624_0564993 | 3300046690 | Bacteria | 679 |
| 758 | Ga0495670_0250616 | 3300046691 | Bacteria | 944 |
| 759 | Ga0495670_0334925 | 3300046691 | Bacteria | 813 |
| 760 | Ga0495671_0084494 | 3300046692 | Bacteria | 1555 |
| 761 | Ga0495671_0089738 | 3300046692 | Bacteria | 1505 |
| 762 | Ga0495671_0101526 | 3300046692 | Bacteria | 1406 |
| 763 | Ga0495671_0165256 | 3300046692 | Bacteria | 1076 |
| 764 | Ga0495649_0097432 | 3300046694 | Bacteria | 1565 |
| 765 | Ga0495649_0157413 | 3300046694 | Bacteria | 1192 |
| 766 | Ga0495649_0193763 | 3300046694 | Bacteria | 1057 |
| 767 | Ga0495589_0103033 | 3300046794 | Bacteria | 1380 |
| 768 | Ga0495589_0111160 | 3300046794 | Bacteria | 1322 |
| 769 | Ga0495589_0129712 | 3300046794 | Bacteria | 1211 |
| 770 | Ga0495600_0113596 | 3300046809 | Bacteria | 1763 |
| 771 | Ga0495581_0007805 | 3300047315 | Bacteria | 6197 |
| 772 | Ga0495581_0081158 | 3300047315 | Bacteria | 1878 |
| 773 | Ga0495581_0425001 | 3300047315 | Bacteria | 774 |
| 774 | Ga0495636_0097970 | 3300047318 | Bacteria | 1279 |
| 775 | Ga0495636_0194356 | 3300047318 | Bacteria | 925 |
| 776 | Ga0495636_0656702 | 3300047318 | Bacteria | 515 |
| 777 | Ga0495674_0010092 | 3300047319 | Bacteria | 8948 |
| 778 | Ga0495672_0025981 | 3300047320 | Bacteria | 3742 |
| 779 | Ga0495672_0239678 | 3300047320 | Bacteria | 886 |
| 780 | Ga0495672_0474812 | 3300047320 | Bacteria | 560 |
| 781 | Ga0495676_0110086 | 3300047321 | Bacteria | 2023 |
| 782 | Ga0495676_0127701 | 3300047321 | Bacteria | 1840 |
| 783 | Ga0495680_0404157 | 3300047322 | Bacteria | 942 |
| 784 | Ga0495683_0064475 | 3300047323 | Bacteria | 1809 |
| 785 | Ga0495683_0478557 | 3300047323 | Bacteria | 508 |
| 786 | Ga0495687_027560 | 3300047443 | Bacteria | 2657 |
| 787 | Ga0495687_047752 | 3300047443 | Bacteria | 1841 |
| 788 | Ga0495677_0067538 | 3300047445 | Bacteria | 1330 |
| 789 | Ga0495677_0172629 | 3300047445 | Bacteria | 837 |
| 790 | Ga0495679_138495 | 3300047446 | Bacteria | 658 |
| 791 | Ga0495685_140734 | 3300047447 | Bacteria | 786 |
| 792 | Ga0495673_0022298 | 3300047469 | Bacteria | 3107 |
| 793 | Ga0495673_0103713 | 3300047469 | Bacteria | 1146 |
| 794 | Ga0495673_0160362 | 3300047469 | Bacteria | 864 |
| 795 | Ga0495673_0256112 | 3300047469 | Bacteria | 638 |
| 796 | Ga0495673_0293941 | 3300047469 | Bacteria | 584 |
| 797 | Ga0495684_0045864 | 3300047471 | Bacteria | 3344 |
| 798 | Ga0495686_0143402 | 3300047472 | Bacteria | 1408 |
| 799 | Ga0495686_0250754 | 3300047472 | Bacteria | 995 |
| 800 | Ga0495593_0000469 | 3300047673 | Bacteria | 22695 |
| 801 | Ga0495602_0385915 | 3300048088 | Bacteria | 1002 |
| 802 | Ga0495614_0001926 | 3300048089 | Bacteria | 9106 |
| 803 | Ga0495614_0409324 | 3300048089 | Bacteria | 638 |
| 804 | Ga0495615_0197116 | 3300048090 | Bacteria | 620 |
| 805 | Ga0495626_0275345 | 3300048091 | Bacteria | 670 |
| 806 | Ga0496100_0001098 | 3300048903 | Bacteria | 13078 |
| 807 | Ga0496100_0137249 | 3300048903 | Bacteria | 1729 |
| 808 | Ga0496100_0223380 | 3300048903 | Bacteria | 1383 |
| 809 | Ga0496101_0011608 | 3300048904 | Bacteria | 5851 |
| 810 | Ga0496101_0232477 | 3300048904 | Bacteria | 1433 |
| 811 | Ga0496101_0541375 | 3300048904 | Bacteria | 920 |
| 812 | Ga0496101_0546160 | 3300048904 | Bacteria | 916 |
| 813 | Ga0496101_0933369 | 3300048904 | Bacteria | 683 |
| 814 | Ga0496102_0008520 | 3300048905 | Bacteria | 8791 |
| 815 | Ga0496102_0153816 | 3300048905 | Bacteria | 2162 |
| 816 | Ga0496102_0199985 | 3300048905 | Bacteria | 1883 |
| 817 | Ga0496102_0380154 | 3300048905 | Bacteria | 1329 |
| 818 | Ga0496102_0381156 | 3300048905 | Bacteria | 1327 |
| 819 | Ga0496102_0410219 | 3300048905 | Bacteria | 1273 |
| 820 | Ga0496102_0438380 | 3300048905 | Bacteria | 1226 |
| 821 | Ga0496102_0476410 | 3300048905 | Bacteria | 1169 |
| 822 | Ga0496102_0861647 | 3300048905 | Bacteria | 828 |
| 823 | Ga0496103_0010717 | 3300048906 | Bacteria | 5424 |
| 824 | Ga0496103_0037555 | 3300048906 | Bacteria | 2968 |
| 825 | Ga0496103_0405205 | 3300048906 | Bacteria | 876 |
| 826 | Ga0496103_0424841 | 3300048906 | Bacteria | 853 |
| 827 | Ga0496103_1061774 | 3300048906 | Bacteria | 502 |
| 828 | Ga0496104_0021810 | 3300048907 | Bacteria | 5883 |
| 829 | Ga0496104_0026734 | 3300048907 | Bacteria | 5332 |
| 830 | Ga0496104_0037264 | 3300048907 | Bacteria | 4548 |
| 831 | Ga0496104_0116018 | 3300048907 | Bacteria | 2570 |
| 832 | Ga0496104_0208151 | 3300048907 | Bacteria | 1868 |
| 833 | Ga0496104_1671737 | 3300048907 | Bacteria | 539 |
| 834 | Ga0496104_1770519 | 3300048907 | Bacteria | 520 |
| 835 | Ga0496105_0030338 | 3300048908 | Bacteria | 4430 |
| 836 | Ga0496105_0120936 | 3300048908 | Bacteria | 2159 |
| 837 | Ga0496105_0207100 | 3300048908 | Bacteria | 1600 |
| 838 | Ga0496105_0286727 | 3300048908 | Bacteria | 1326 |
| 839 | Ga0496105_0345596 | 3300048908 | Bacteria | 1189 |
| 840 | Ga0496106_0026464 | 3300048909 | Bacteria | 4320 |
| 841 | Ga0496106_0123661 | 3300048909 | Bacteria | 2024 |
| 842 | Ga0496106_0396800 | 3300048909 | Bacteria | 1109 |
| 843 | Ga0496106_0500576 | 3300048909 | Bacteria | 976 |
| 844 | Ga0496106_0680497 | 3300048909 | Bacteria | 821 |
| 845 | Ga0496107_0021497 | 3300048910 | Bacteria | 4560 |
| 846 | Ga0496108_0042075 | 3300048911 | Bacteria | 3813 |
| 847 | Ga0496108_0196577 | 3300048911 | Bacteria | 1749 |
| 848 | Ga0496108_0208945 | 3300048911 | Bacteria | 1694 |
| 849 | Ga0496108_0256025 | 3300048911 | Bacteria | 1523 |
| 850 | Ga0496108_0540220 | 3300048911 | Bacteria | 1017 |
| 851 | Ga0496109_0049778 | 3300048912 | Bacteria | 3815 |
| 852 | Ga0496109_0293021 | 3300048912 | Bacteria | 1534 |
| 853 | Ga0496109_0365792 | 3300048912 | Bacteria | 1362 |
| 854 | Ga0496109_0380566 | 3300048912 | Bacteria | 1333 |
| 855 | Ga0496110_0066685 | 3300048913 | Bacteria | 3183 |
| 856 | Ga0496110_0091129 | 3300048913 | Bacteria | 2727 |
| 857 | Ga0496110_0288249 | 3300048913 | Bacteria | 1495 |
| 858 | Ga0496110_0515209 | 3300048913 | Bacteria | 1088 |
| 859 | Ga0496110_1657088 | 3300048913 | Bacteria | 550 |
| 860 | Ga0496111_0040302 | 3300048914 | Bacteria | 3350 |
| 861 | Ga0496111_0599596 | 3300048914 | Bacteria | 806 |
| 862 | Ga0496111_0678287 | 3300048914 | Bacteria | 751 |
| 863 | Ga0496112_0023844 | 3300048915 | Bacteria | 5852 |
| 864 | Ga0496112_0025634 | 3300048915 | Bacteria | 5663 |
| 865 | Ga0496112_0174342 | 3300048915 | Bacteria | 2116 |
| 866 | Ga0496112_0353164 | 3300048915 | Bacteria | 1412 |
| 867 | Ga0496112_0731438 | 3300048915 | Bacteria | 916 |
| 868 | Ga0496113_0015425 | 3300048916 | Bacteria | 5250 |
| 869 | Ga0496113_0054139 | 3300048916 | Bacteria | 3002 |
| 870 | Ga0496113_0716176 | 3300048916 | Bacteria | 798 |
| 871 | Ga0496113_1305035 | 3300048916 | Bacteria | 564 |
| 872 | Ga0496114_0033230 | 3300048917 | Bacteria | 4249 |
| 873 | Ga0496114_0345394 | 3300048917 | Bacteria | 1316 |
| 874 | Ga0496114_0400728 | 3300048917 | Bacteria | 1215 |
| 875 | Ga0496114_0793411 | 3300048917 | Bacteria | 825 |
| 876 | Ga0496114_1533587 | 3300048917 | Bacteria | 554 |
| 877 | Ga0496115_0017046 | 3300048918 | Bacteria | 5541 |
| 878 | Ga0496115_0159969 | 3300048918 | Bacteria | 1861 |
| 879 | Ga0496115_0288059 | 3300048918 | Bacteria | 1348 |
| 880 | Ga0496115_0468347 | 3300048918 | Bacteria | 1016 |
| 881 | Ga0496115_0868630 | 3300048918 | Bacteria | 697 |
| 882 | Ga0496116_0198582 | 3300048919 | Bacteria | 1053 |
| 883 | Ga0496118_0065065 | 3300048921 | Bacteria | 2670 |
| 884 | Ga0496118_0086044 | 3300048921 | Bacteria | 2186 |
| 885 | Ga0496118_0087129 | 3300048921 | Bacteria | 2167 |
| 886 | Ga0496118_0120126 | 3300048921 | Bacteria | 1716 |
| 887 | Ga0496118_0153875 | 3300048921 | Bacteria | 1434 |
| 888 | Ga0496118_0310668 | 3300048921 | Bacteria | 860 |
| 889 | Ga0496119_0043743 | 3300048922 | Bacteria | 2827 |
| 890 | Ga0496119_0044857 | 3300048922 | Bacteria | 2778 |
| 891 | Ga0496119_0046704 | 3300048922 | Bacteria | 2701 |
| 892 | Ga0496119_0189829 | 3300048922 | Bacteria | 1071 |
| 893 | Ga0496120_0012720 | 3300048923 | Bacteria | 5708 |
| 894 | Ga0496120_0220357 | 3300048923 | Bacteria | 907 |
| 895 | Ga0496121_0000265 | 3300048924 | Bacteria | 109251 |
| 896 | Ga0496121_0011669 | 3300048924 | Bacteria | 9712 |
| 897 | Ga0496121_0028222 | 3300048924 | Bacteria | 5229 |
| 898 | Ga0496121_0044559 | 3300048924 | Bacteria | 3824 |
| 899 | Ga0496121_0120593 | 3300048924 | Bacteria | 1981 |
| 900 | Ga0496121_0267964 | 3300048924 | Bacteria | 1175 |
| 901 | Ga0496121_0412556 | 3300048924 | Bacteria | 881 |
| 902 | Ga0496121_0479793 | 3300048924 | Bacteria | 794 |
| 903 | Ga0496121_0481239 | 3300048924 | Bacteria | 793 |
| 904 | Ga0496122_0090249 | 3300048925 | Bacteria | 2092 |
| 905 | Ga0496122_0093188 | 3300048925 | Bacteria | 2044 |
| 906 | Ga0496122_0298659 | 3300048925 | Bacteria | 870 |
| 907 | Ga0496124_0213718 | 3300048927 | Bacteria | 1457 |
| 908 | Ga0496124_0226852 | 3300048927 | Bacteria | 1400 |
| 909 | Ga0496124_0262119 | 3300048927 | Bacteria | 1271 |
| 910 | Ga0496124_0331448 | 3300048927 | Bacteria | 1085 |
| 911 | Ga0496125_0000176 | 3300048928 | Bacteria | 140746 |
| 912 | Ga0496125_0034884 | 3300048928 | Bacteria | 4426 |
| 913 | Ga0496125_0137109 | 3300048928 | Bacteria | 1709 |
| 914 | Ga0496125_0206435 | 3300048928 | Bacteria | 1281 |
| 915 | Ga0496126_0011852 | 3300048929 | Bacteria | 8969 |
| 916 | Ga0496126_0015449 | 3300048929 | Bacteria | 7677 |
| 917 | Ga0496126_0072217 | 3300048929 | Bacteria | 3070 |
| 918 | Ga0496126_0122354 | 3300048929 | Bacteria | 2255 |
| 919 | Ga0496126_0177512 | 3300048929 | Bacteria | 1811 |
| 920 | Ga0496126_0262004 | 3300048929 | Bacteria | 1437 |
| 921 | Ga0496126_0444729 | 3300048929 | Bacteria | 1044 |
| 922 | Ga0496126_1143757 | 3300048929 | Bacteria | 576 |
| 923 | Ga0495682_0018288 | 3300049460 | Bacteria | 2641 |
| 924 | Ga0495682_0053712 | 3300049460 | Bacteria | 1463 |
| 925 | Ga0495682_0066545 | 3300049460 | Bacteria | 1299 |
| 926 | Ga0495682_0213564 | 3300049460 | Bacteria | 684 |
| 927 | Ga0501038_0265551 | 3300049574 | Bacteria | 1355 |
| 928 | Ga0501040_0715101 | 3300049576 | Bacteria | 724 |
| 929 | Ga0501042_0374282 | 3300049578 | Bacteria | 1031 |
| 930 | Ga0501067_0604891 | 3300049583 | Bacteria | 615 |
| 931 | Ga0501074_0394278 | 3300049590 | Bacteria | 982 |
| 932 | nmdc:mga03683_107519_c1 | 3300050489 | Bacteria | 1230 |
| 933 | nmdc:mga03683_489268_c1 | 3300050489 | Bacteria | 595 |
| 934 | nmdc:mga03n38_12993_c1 | 3300050490 | Bacteria | 3150 |
| 935 | nmdc:mga03n38_483662_c1 | 3300050490 | Bacteria | 693 |
| 936 | nmdc:mga00v17_69660_c1 | 3300050491 | Bacteria | 2177 |
| 937 | nmdc:mga00v17_866497_c1 | 3300050491 | Bacteria | 573 |
| 938 | nmdc:mga00v17_86774_c1 | 3300050491 | Bacteria | 1961 |
| 939 | nmdc:mga0yw44_124038_c1 | 3300050492 | Bacteria | 1666 |
| 940 | nmdc:mga0yw44_187882_c1 | 3300050492 | Bacteria | 1362 |
| 941 | nmdc:mga0yw44_19763_c1 | 3300050492 | Bacteria | 3722 |
| 942 | nmdc:mga0yw44_31797_c1 | 3300050492 | Bacteria | 3071 |
| 943 | nmdc:mga0yw44_514125_c1 | 3300050492 | Bacteria | 813 |
| 944 | nmdc:mga0yw44_5454_c2 | 3300050492 | Bacteria | 5426 |
| 945 | nmdc:mga0yw44_638498_c1 | 3300050492 | Bacteria | 723 |
| 946 | nmdc:mga0k408_148173_c1 | 3300050493 | Bacteria | 1397 |
| 947 | nmdc:mga0k408_179196_c1 | 3300050493 | Bacteria | 1264 |
| 948 | nmdc:mga0k408_519503_c1 | 3300050493 | Bacteria | 705 |
| 949 | nmdc:mga0k408_571476_c1 | 3300050493 | Bacteria | 668 |
| 950 | nmdc:mga06z11_199789_c1 | 3300050494 | Bacteria | 1161 |
| 951 | nmdc:mga06z11_217349_c1 | 3300050494 | Bacteria | 1116 |
| 952 | nmdc:mga06z11_224365_c1 | 3300050494 | Bacteria | 1099 |
| 953 | nmdc:mga06z11_298090_c1 | 3300050494 | Bacteria | 958 |
| 954 | nmdc:mga06z11_8466_c1 | 3300050494 | Bacteria | 4291 |
| 955 | nmdc:mga06z11_93967_c1 | 3300050494 | Bacteria | 1633 |
| 956 | nmdc:mga04h51_252344_c1 | 3300050495 | Bacteria | 707 |
| 957 | nmdc:mga07m45_107497_c1 | 3300050496 | Bacteria | 1605 |
| 958 | nmdc:mga07m45_190315_c1 | 3300050496 | Bacteria | 1193 |
| 959 | nmdc:mga07m45_54052_c1 | 3300050496 | Bacteria | 2270 |
| 960 | nmdc:mga07m45_59524_c1 | 3300050496 | Bacteria | 2161 |
| 961 | nmdc:mga07m45_81713_c1 | 3300050496 | Bacteria | 1845 |
| 962 | nmdc:mga09592_265942_c1 | 3300050508 | Bacteria | 1487 |
| 963 | nmdc:mga06r32_893179_c1 | 3300050510 | Bacteria | 845 |
| 964 | nmdc:mga08y16_1146190_c1 | 3300050511 | Bacteria | 750 |
| 965 | nmdc:mga08y16_1285024_c1 | 3300050511 | Bacteria | 699 |
| 966 | nmdc:mga08y16_635192_c1 | 3300050511 | Bacteria | 1073 |
| 967 | nmdc:mga0n895_832353_c1 | 3300050512 | Bacteria | 912 |
| 968 | nmdc:mga0rr50_546422_c1 | 3300050513 | Bacteria | 986 |
| 969 | nmdc:mga0a205_695597_c1 | 3300050515 | Bacteria | 866 |
| 970 | Ga0495601_0301790 | 3300053077 | Bacteria | 1043 |
| 971 | Ga0495612_0157977 | 3300053078 | Bacteria | 989 |
| 972 | Ga0495655_0012324 | 3300053083 | Bacteria | 1740 |
| 973 | Ga0495655_0185941 | 3300053083 | Bacteria | 672 |
| 974 | Ga0495595_0031235 | 3300053084 | Bacteria | 2393 |
| 975 | Ga0495619_0187040 | 3300053085 | Bacteria | 1433 |
| 976 | Ga0500578_0070175 | 3300053086 | Bacteria | 2234 |
| 977 | Ga0500646_0389642 | 3300053090 | Bacteria | 513 |
| 978 | Ga0500647_0073432 | 3300053091 | Bacteria | 1642 |
| 979 | Ga0500647_0193872 | 3300053091 | Bacteria | 925 |
| 980 | Ga0500583_0098116 | 3300053092 | Bacteria | 1432 |
| 981 | Ga0500583_0108192 | 3300053092 | Bacteria | 1367 |
| 982 | Ga0500583_0314451 | 3300053092 | Bacteria | 764 |
| 983 | Ga0500566_0000078 | 3300053094 | Bacteria | 47558 |
| 984 | Ga0500566_0076330 | 3300053094 | Bacteria | 1873 |
| 985 | Ga0500640_000121 | 3300053095 | Bacteria | 14580 |
| 986 | Ga0500640_061554 | 3300053095 | Bacteria | 1626 |
| 987 | Ga0500641_0167005 | 3300053096 | Bacteria | 948 |
| 988 | Ga0500641_0341232 | 3300053096 | Bacteria | 604 |
| 989 | Ga0500554_118757 | 3300053102 | Bacteria | 891 |
| 990 | Ga0500555_031686 | 3300053103 | Bacteria | 1497 |
| 991 | Ga0500555_040212 | 3300053103 | Bacteria | 1304 |
| 992 | Ga0500556_0030267 | 3300053104 | Bacteria | 1833 |
| 993 | Ga0500557_000011 | 3300053105 | Bacteria | 117471 |
| 994 | Ga0500569_018952 | 3300053109 | Bacteria | 1785 |
| 995 | Ga0500569_084458 | 3300053109 | Bacteria | 1020 |
| 996 | Ga0500572_000170 | 3300053111 | Bacteria | 22863 |
| 997 | Ga0500572_110411 | 3300053111 | Bacteria | 884 |
| 998 | Ga0500580_261947 | 3300053113 | Bacteria | 503 |
| 999 | Ga0500591_077793 | 3300053115 | Bacteria | 1484 |
| 1000 | Ga0500592_023529 | 3300053116 | Bacteria | 993 |
| 1001 | Ga0500594_0047298 | 3300053118 | Bacteria | 1200 |
| 1002 | Ga0500595_002442 | 3300053119 | Bacteria | 9222 |
| 1003 | Ga0500595_002477 | 3300053119 | Bacteria | 9136 |
| 1004 | Ga0500595_004672 | 3300053119 | Bacteria | 6088 |
| 1005 | Ga0500595_026908 | 3300053119 | Bacteria | 1976 |
| 1006 | Ga0500597_339561 | 3300053120 | Bacteria | 588 |
| 1007 | Ga0500608_084601 | 3300053122 | Bacteria | 1492 |
| 1008 | Ga0500608_232489 | 3300053122 | Bacteria | 734 |
| 1009 | Ga0500614_004910 | 3300053123 | Bacteria | 2813 |
| 1010 | Ga0500642_0000090 | 3300053130 | Bacteria | 46849 |
| 1011 | Ga0500642_0008061 | 3300053130 | Bacteria | 3580 |
| 1012 | Ga0500642_0199702 | 3300053130 | Bacteria | 931 |
| 1013 | Ga0500658_0072704 | 3300053134 | Bacteria | 1455 |
| 1014 | Ga0500658_0143484 | 3300053134 | Bacteria | 1072 |
| 1015 | Ga0500559_0009508 | 3300053136 | Bacteria | 4201 |
| 1016 | Ga0500559_0016864 | 3300053136 | Bacteria | 3085 |
| 1017 | Ga0500561_0058078 | 3300053137 | Bacteria | 1076 |
| 1018 | Ga0500568_0011274 | 3300053139 | Bacteria | 4161 |
| 1019 | Ga0500568_0037366 | 3300053139 | Bacteria | 1970 |
| 1020 | Ga0500590_085257 | 3300053148 | Bacteria | 1543 |
| 1021 | Ga0500590_096457 | 3300053148 | Bacteria | 1427 |
| 1022 | Ga0500603_000081 | 3300053150 | Bacteria | 22182 |
| 1023 | Ga0500603_001666 | 3300053150 | Bacteria | 5003 |
| 1024 | Ga0500620_100532 | 3300053155 | Bacteria | 1011 |
| 1025 | Ga0500627_0007990 | 3300053158 | Bacteria | 3728 |
| 1026 | Ga0500627_0078704 | 3300053158 | Bacteria | 1467 |
| 1027 | Ga0500627_0293144 | 3300053158 | Bacteria | 712 |
| 1028 | Ga0500627_0441489 | 3300053158 | Bacteria | 549 |
| 1029 | Ga0500630_004509 | 3300053159 | Bacteria | 6772 |
| 1030 | Ga0500634_0113939 | 3300053161 | Bacteria | 1328 |
| 1031 | Ga0500638_021427 | 3300053162 | Bacteria | 3054 |
| 1032 | Ga0500639_000028 | 3300053163 | Bacteria | 77951 |
| 1033 | Ga0500639_131622 | 3300053163 | Bacteria | 1184 |
| 1034 | Ga0500636_0049352 | 3300053177 | Bacteria | 2476 |
| 1035 | Ga0500636_0065953 | 3300053177 | Bacteria | 2106 |
| 1036 | Ga0500636_0200828 | 3300053177 | Bacteria | 1055 |
| 1037 | Ga0500636_0398985 | 3300053177 | Bacteria | 639 |
| 1038 | Ga0500637_0020909 | 3300053178 | Bacteria | 3551 |
| 1039 | Ga0500637_0039902 | 3300053178 | Bacteria | 2649 |
| 1040 | Ga0500637_0125685 | 3300053178 | Bacteria | 1487 |
| 1041 | Ga0500570_131027 | 3300053724 | Bacteria | 952 |
| 1042 | Ga0500625_002925 | 3300053729 | Bacteria | 6585 |
| 1043 | Ga0500645_161204 | 3300053730 | Bacteria | 615 |
| 1044 | Ga0500596_000324 | 3300053735 | Bacteria | 8556 |
| 1045 | Ga0500601_003418 | 3300053737 | Bacteria | 1721 |
| 1046 | Ga0500661_002428 | 3300055283 | Bacteria | 3509 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10267474 | Ga0105239_102674742 | 131 |
| 2 | 3300044901 | Ga0466960_0008649 | Ga0466960_0008649_2044_2442 | 132 |
| 3 | 3300048914 | Ga0496111_0678287 | Ga0496111_0678287_174_572 | 132 |
| 4 | 3300053105 | Ga0500557_000011 | Ga0500557_000011_42629_43027 | 132 |
| 5 | 3300053120 | Ga0500597_339561 | Ga0500597_339561_30_428 | 132 |
| 6 | 3300053177 | Ga0500636_0200828 | Ga0500636_0200828_54_452 | 132 |
| 7 | 3300053729 | Ga0500625_002925 | Ga0500625_002925_4797_5195 | 132 |
| 8 | 3300025230 | Ga0209563_102320 | Ga0209563_1023202 | 133 |
| 9 | 3300003215 | JGI25153J46596_10002543 | JGI25153J46596_1000254311 | 134 |
| 10 | 3300003771 | Ga0055526_1039847 | Ga0055526_10398471 | 134 |
| 11 | 3300003775 | Ga0055524_1036995 | Ga0055524_10369951 | 134 |
| 12 | 3300003794 | Ga0055531_10001939 | Ga0055531_100019395 | 134 |
| 13 | 3300004625 | Ga0055543_1004643 | Ga0055543_10046436 | 134 |
| 14 | 3300005262 | Ga0065165_1001641 | Ga0065165_100164114 | 134 |
| 15 | 3300005262 | Ga0065165_1003060 | Ga0065165_100306010 | 134 |
| 16 | 3300005262 | Ga0065165_1006123 | Ga0065165_10061233 | 134 |
| 17 | 3300005327 | Ga0070658_10012558 | Ga0070658_100125587 | 134 |
| 18 | 3300005329 | Ga0070683_100983887 | Ga0070683_1009838872 | 134 |
| 19 | 3300005331 | Ga0070670_100431462 | Ga0070670_1004314621 | 134 |
| 20 | 3300005335 | Ga0070666_10242701 | Ga0070666_102427012 | 134 |
| 21 | 3300005339 | Ga0070660_100773748 | Ga0070660_1007737481 | 134 |
| 22 | 3300005353 | Ga0070669_100077152 | Ga0070669_1000771522 | 134 |
| 23 | 3300005354 | Ga0070675_100444799 | Ga0070675_1004447991 | 134 |
| 24 | 3300005355 | Ga0070671_100385853 | Ga0070671_1003858532 | 134 |
| 25 | 3300005364 | Ga0070673_100722271 | Ga0070673_1007222712 | 134 |
| 26 | 3300005455 | Ga0070663_100173392 | Ga0070663_1001733921 | 134 |
| 27 | 3300005457 | Ga0070662_101016872 | Ga0070662_1010168722 | 134 |
| 28 | 3300005563 | Ga0068855_100157617 | Ga0068855_1001576172 | 134 |
| 29 | 3300005564 | Ga0070664_101292608 | Ga0070664_1012926082 | 134 |
| 30 | 3300005578 | Ga0068854_100081574 | Ga0068854_1000815743 | 134 |
| 31 | 3300005614 | Ga0068856_100225909 | Ga0068856_1002259092 | 134 |
| 32 | 3300005616 | Ga0068852_100061105 | Ga0068852_1000611053 | 134 |
| 33 | 3300005616 | Ga0068852_100271608 | Ga0068852_1002716081 | 134 |
| 34 | 3300006038 | Ga0075365_10032321 | Ga0075365_100323213 | 134 |
| 35 | 3300006048 | Ga0075363_100428285 | Ga0075363_1004282851 | 134 |
| 36 | 3300006177 | Ga0075362_10136051 | Ga0075362_101360512 | 134 |
| 37 | 3300006186 | Ga0075369_10095939 | Ga0075369_100959392 | 134 |
| 38 | 3300006186 | Ga0075369_10137108 | Ga0075369_101371082 | 134 |
| 39 | 3300006186 | Ga0075369_10206152 | Ga0075369_102061522 | 134 |
| 40 | 3300006195 | Ga0075366_10050422 | Ga0075366_100504224 | 134 |
| 41 | 3300006195 | Ga0075366_10196605 | Ga0075366_101966052 | 134 |
| 42 | 3300006237 | Ga0097621_100795721 | Ga0097621_1007957212 | 134 |
| 43 | 3300006353 | Ga0075370_10005105 | Ga0075370_100051054 | 134 |
| 44 | 3300006353 | Ga0075370_10094272 | Ga0075370_100942722 | 134 |
| 45 | 3300009093 | Ga0105240_10502270 | Ga0105240_105022702 | 134 |
| 46 | 3300009101 | Ga0105247_10406197 | Ga0105247_104061972 | 134 |
| 47 | 3300009174 | Ga0105241_10392659 | Ga0105241_103926591 | 134 |
| 48 | 3300009177 | Ga0105248_10172136 | Ga0105248_101721363 | 134 |
| 49 | 3300009545 | Ga0105237_10137184 | Ga0105237_101371843 | 134 |
| 50 | 3300009553 | Ga0105249_10311426 | Ga0105249_103114261 | 134 |
| 51 | 3300010375 | Ga0105239_10126823 | Ga0105239_101268232 | 134 |
| 52 | 3300010375 | Ga0105239_10753928 | Ga0105239_107539281 | 134 |
| 53 | 3300011119 | Ga0105246_11006436 | Ga0105246_110064361 | 134 |
| 54 | 3300012495 | Ga0157323_1011445 | Ga0157323_10114451 | 134 |
| 55 | 3300013296 | Ga0157374_10110883 | Ga0157374_101108833 | 134 |
| 56 | 3300013306 | Ga0163162_10235980 | Ga0163162_102359804 | 134 |
| 57 | 3300014325 | Ga0163163_10057665 | Ga0163163_100576654 | 134 |
| 58 | 3300014745 | Ga0157377_10149709 | Ga0157377_101497092 | 134 |
| 59 | 3300014969 | Ga0157376_12963154 | Ga0157376_129631542 | 134 |
| 60 | 3300020070 | Ga0206356_10120399 | Ga0206356_101203991 | 134 |
| 61 | 3300021321 | Ga0214542_1000004 | Ga0214542_100000446 | 134 |
| 62 | 3300021321 | Ga0214542_1037420 | Ga0214542_10374202 | 134 |
| 63 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005351 | 134 |
| 64 | 3300021324 | Ga0214545_1035280 | Ga0214545_10352802 | 134 |
| 65 | 3300021327 | Ga0214543_1000111 | Ga0214543_100011162 | 134 |
| 66 | 3300021327 | Ga0214543_1033779 | Ga0214543_10337792 | 134 |
| 67 | 3300025253 | Ga0209677_102591 | Ga0209677_1025912 | 134 |
| 68 | 3300025261 | Ga0209233_1004340 | Ga0209233_10043406 | 134 |
| 69 | 3300025261 | Ga0209233_1027348 | Ga0209233_10273482 | 134 |
| 70 | 3300025295 | Ga0209564_1006563 | Ga0209564_10065631 | 134 |
| 71 | 3300025295 | Ga0209564_1031518 | Ga0209564_10315182 | 134 |
| 72 | 3300025297 | Ga0209758_1000102 | Ga0209758_1000102173 | 134 |
| 73 | 3300025297 | Ga0209758_1003592 | Ga0209758_10035928 | 134 |
| 74 | 3300025297 | Ga0209758_1003725 | Ga0209758_100372511 | 134 |
| 75 | 3300025297 | Ga0209758_1046037 | Ga0209758_10460372 | 134 |
| 76 | 3300025299 | Ga0209256_1004953 | Ga0209256_100495310 | 134 |
| 77 | 3300025299 | Ga0209256_1027989 | Ga0209256_10279892 | 134 |
| 78 | 3300025302 | Ga0207426_1002013 | Ga0207426_100201315 | 134 |
| 79 | 3300025304 | Ga0209257_1003378 | Ga0209257_10033784 | 134 |
| 80 | 3300025315 | Ga0207697_10065223 | Ga0207697_100652232 | 134 |
| 81 | 3300025901 | Ga0207688_10344528 | Ga0207688_103445282 | 134 |
| 82 | 3300025904 | Ga0207647_10011423 | Ga0207647_100114239 | 134 |
| 83 | 3300025909 | Ga0207705_10216616 | Ga0207705_102166162 | 134 |
| 84 | 3300025911 | Ga0207654_10463892 | Ga0207654_104638922 | 134 |
| 85 | 3300025914 | Ga0207671_10703069 | Ga0207671_107030691 | 134 |
| 86 | 3300025919 | Ga0207657_11061567 | Ga0207657_110615672 | 134 |
| 87 | 3300025923 | Ga0207681_10214086 | Ga0207681_102140862 | 134 |
| 88 | 3300025925 | Ga0207650_10562013 | Ga0207650_105620132 | 134 |
| 89 | 3300025926 | Ga0207659_10550945 | Ga0207659_105509452 | 134 |
| 90 | 3300025931 | Ga0207644_11006653 | Ga0207644_110066531 | 134 |
| 91 | 3300025933 | Ga0207706_10218356 | Ga0207706_102183563 | 134 |
| 92 | 3300025941 | Ga0207711_10334427 | Ga0207711_103344272 | 134 |
| 93 | 3300025944 | Ga0207661_10576659 | Ga0207661_105766592 | 134 |
| 94 | 3300025986 | Ga0207658_10837159 | Ga0207658_108371592 | 134 |
| 95 | 3300026041 | Ga0207639_10098940 | Ga0207639_100989401 | 134 |
| 96 | 3300026041 | Ga0207639_10164849 | Ga0207639_101648493 | 134 |
| 97 | 3300026067 | Ga0207678_10099974 | Ga0207678_100999742 | 134 |
| 98 | 3300026067 | Ga0207678_10397726 | Ga0207678_103977263 | 134 |
| 99 | 3300026078 | Ga0207702_10327935 | Ga0207702_103279352 | 134 |
| 100 | 3300026088 | Ga0207641_11255460 | Ga0207641_112554601 | 134 |
| 101 | 3300026095 | Ga0207676_10669756 | Ga0207676_106697562 | 134 |
| 102 | 3300026116 | Ga0207674_10091381 | Ga0207674_100913813 | 134 |
| 103 | 3300026142 | Ga0207698_10367021 | Ga0207698_103670212 | 134 |
| 104 | 3300028379 | Ga0268266_10190353 | Ga0268266_101903532 | 134 |
| 105 | 3300028380 | Ga0268265_10564923 | Ga0268265_105649232 | 134 |
| 106 | 3300037312 | Ga0395899_0154753 | Ga0395899_0154753_230_634 | 134 |
| 107 | 3300037418 | Ga0395900_0016187 | Ga0395900_0016187_4810_5214 | 134 |
| 108 | 3300037471 | Ga0395905_0344285 | Ga0395905_0344285_287_691 | 134 |
| 109 | 3300038443 | Ga0395901_0097370 | Ga0395901_0097370_1884_2288 | 134 |
| 110 | 3300041441 | Ga0451787_288168 | Ga0451787_288168_40_444 | 134 |
| 111 | 3300041491 | Ga0451833_0138182 | Ga0451833_0138182_624_1034 | 134 |
| 112 | 3300041498 | Ga0451841_0540834 | Ga0451841_0540834_388_798 | 134 |
| 113 | 3300041505 | Ga0451849_0041184 | Ga0451849_0041184_155_559 | 134 |
| 114 | 3300041507 | Ga0451851_0647873 | Ga0451851_0647873_18_428 | 134 |
| 115 | 3300041512 | Ga0451853_3741495 | Ga0451853_3741495_324_734 | 134 |
| 116 | 3300044683 | Ga0466965_0127668 | Ga0466965_0127668_255_659 | 134 |
| 117 | 3300044901 | Ga0466960_0130216 | Ga0466960_0130216_823_1227 | 134 |
| 118 | 3300046471 | Ga0495650_0130564 | Ga0495650_0130564_32_436 | 134 |
| 119 | 3300046507 | Ga0495606_0157047 | Ga0495606_0157047_303_707 | 134 |
| 120 | 3300046522 | Ga0495643_0012291 | Ga0495643_0012291_2788_3192 | 134 |
| 121 | 3300046522 | Ga0495643_0250555 | Ga0495643_0250555_83_487 | 134 |
| 122 | 3300046524 | Ga0495648_0146427 | Ga0495648_0146427_106_510 | 134 |
| 123 | 3300046542 | Ga0495597_0033416 | Ga0495597_0033416_1641_2045 | 134 |
| 124 | 3300046694 | Ga0495649_0157413 | Ga0495649_0157413_655_1059 | 134 |
| 125 | 3300046694 | Ga0495649_0193763 | Ga0495649_0193763_155_559 | 134 |
| 126 | 3300047320 | Ga0495672_0239678 | Ga0495672_0239678_205_609 | 134 |
| 127 | 3300047323 | Ga0495683_0064475 | Ga0495683_0064475_1092_1496 | 134 |
| 128 | 3300047443 | Ga0495687_027560 | Ga0495687_027560_1850_2254 | 134 |
| 129 | 3300047443 | Ga0495687_047752 | Ga0495687_047752_728_1132 | 134 |
| 130 | 3300047469 | Ga0495673_0103713 | Ga0495673_0103713_54_458 | 134 |
| 131 | 3300048903 | Ga0496100_0223380 | Ga0496100_0223380_599_1003 | 134 |
| 132 | 3300048905 | Ga0496102_0476410 | Ga0496102_0476410_533_937 | 134 |
| 133 | 3300048906 | Ga0496103_0037555 | Ga0496103_0037555_2000_2404 | 134 |
| 134 | 3300048906 | Ga0496103_0424841 | Ga0496103_0424841_364_768 | 134 |
| 135 | 3300048907 | Ga0496104_0021810 | Ga0496104_0021810_401_805 | 134 |
| 136 | 3300048908 | Ga0496105_0120936 | Ga0496105_0120936_233_637 | 134 |
| 137 | 3300048908 | Ga0496105_0207100 | Ga0496105_0207100_166_576 | 134 |
| 138 | 3300048911 | Ga0496108_0208945 | Ga0496108_0208945_736_1140 | 134 |
| 139 | 3300048911 | Ga0496108_0256025 | Ga0496108_0256025_524_928 | 134 |
| 140 | 3300048912 | Ga0496109_0293021 | Ga0496109_0293021_698_1102 | 134 |
| 141 | 3300048912 | Ga0496109_0365792 | Ga0496109_0365792_944_1348 | 134 |
| 142 | 3300048913 | Ga0496110_0091129 | Ga0496110_0091129_1563_1967 | 134 |
| 143 | 3300048914 | Ga0496111_0599596 | Ga0496111_0599596_261_665 | 134 |
| 144 | 3300048915 | Ga0496112_0174342 | Ga0496112_0174342_1145_1549 | 134 |
| 145 | 3300048916 | Ga0496113_0716176 | Ga0496113_0716176_345_749 | 134 |
| 146 | 3300048917 | Ga0496114_0400728 | Ga0496114_0400728_167_571 | 134 |
| 147 | 3300048921 | Ga0496118_0120126 | Ga0496118_0120126_673_1077 | 134 |
| 148 | 3300048921 | Ga0496118_0153875 | Ga0496118_0153875_500_904 | 134 |
| 149 | 3300048922 | Ga0496119_0044857 | Ga0496119_0044857_1957_2361 | 134 |
| 150 | 3300048924 | Ga0496121_0412556 | Ga0496121_0412556_448_852 | 134 |
| 151 | 3300048925 | Ga0496122_0298659 | Ga0496122_0298659_137_541 | 134 |
| 152 | 3300048927 | Ga0496124_0226852 | Ga0496124_0226852_213_617 | 134 |
| 153 | 3300050490 | nmdc:mga03n38_483662_c1 | nmdc:mga03n38_483662_c1_249_653 | 134 |
| 154 | 3300050491 | nmdc:mga00v17_866497_c1 | nmdc:mga00v17_866497_c1_35_445 | 134 |
| 155 | 3300050492 | nmdc:mga0yw44_19763_c1 | nmdc:mga0yw44_19763_c1_2098_2508 | 134 |
| 156 | 3300050492 | nmdc:mga0yw44_514125_c1 | nmdc:mga0yw44_514125_c1_380_784 | 134 |
| 157 | 3300050493 | nmdc:mga0k408_179196_c1 | nmdc:mga0k408_179196_c1_346_750 | 134 |
| 158 | 3300050494 | nmdc:mga06z11_217349_c1 | nmdc:mga06z11_217349_c1_374_778 | 134 |
| 159 | 3300050496 | nmdc:mga07m45_59524_c1 | nmdc:mga07m45_59524_c1_324_728 | 134 |
| 160 | 3300053083 | Ga0495655_0185941 | Ga0495655_0185941_213_617 | 134 |
| 161 | 3300053086 | Ga0500578_0070175 | Ga0500578_0070175_838_1242 | 134 |
| 162 | 3300053094 | Ga0500566_0076330 | Ga0500566_0076330_558_968 | 134 |
| 163 | 3300053095 | Ga0500640_061554 | Ga0500640_061554_1041_1496 | 134 |
| 164 | 3300053096 | Ga0500641_0167005 | Ga0500641_0167005_289_693 | 134 |
| 165 | 3300053102 | Ga0500554_118757 | Ga0500554_118757_182_586 | 134 |
| 166 | 3300053103 | Ga0500555_031686 | Ga0500555_031686_654_1058 | 134 |
| 167 | 3300053109 | Ga0500569_084458 | Ga0500569_084458_551_955 | 134 |
| 168 | 3300053111 | Ga0500572_110411 | Ga0500572_110411_291_695 | 134 |
| 169 | 3300053119 | Ga0500595_026908 | Ga0500595_026908_1505_1909 | 134 |
| 170 | 3300053122 | Ga0500608_084601 | Ga0500608_084601_423_827 | 134 |
| 171 | 3300053130 | Ga0500642_0008061 | Ga0500642_0008061_995_1399 | 134 |
| 172 | 3300053136 | Ga0500559_0016864 | Ga0500559_0016864_1521_1925 | 134 |
| 173 | 3300053139 | Ga0500568_0037366 | Ga0500568_0037366_1074_1478 | 134 |
| 174 | 3300053148 | Ga0500590_085257 | Ga0500590_085257_227_631 | 134 |
| 175 | 3300053155 | Ga0500620_100532 | Ga0500620_100532_444_848 | 134 |
| 176 | 3300053158 | Ga0500627_0007990 | Ga0500627_0007990_2126_2530 | 134 |
| 177 | 3300053178 | Ga0500637_0125685 | Ga0500637_0125685_373_777 | 134 |
| 178 | 3300055283 | Ga0500661_002428 | Ga0500661_002428_54_458 | 134 |
| 179 | 3300005536 | Ga0070697_101484915 | Ga0070697_1014849151 | 135 |
| 180 | 3300007265 | Ga0099794_10102428 | Ga0099794_101024282 | 135 |
| 181 | 3300014497 | Ga0182008_10227787 | Ga0182008_102277872 | 135 |
| 182 | 3300028380 | Ga0268265_10061941 | Ga0268265_100619413 | 135 |
| 183 | 3300039437 | Ga0436365_0808674 | Ga0436365_0808674_601_1008 | 135 |
| 184 | 3300044658 | Ga0466972_0013988 | Ga0466972_0013988_2265_2672 | 135 |
| 185 | 3300044706 | Ga0466964_0264110 | Ga0466964_0264110_85_492 | 135 |
| 186 | 3300044735 | Ga0466968_0003372 | Ga0466968_0003372_2172_2579 | 135 |
| 187 | 3300046514 | Ga0495618_0523518 | Ga0495618_0523518_234_641 | 135 |
| 188 | 3300046524 | Ga0495648_0336875 | Ga0495648_0336875_117_524 | 135 |
| 189 | 3300046526 | Ga0495666_0386634 | Ga0495666_0386634_74_481 | 135 |
| 190 | 3300046616 | Ga0495668_0482000 | Ga0495668_0482000_261_668 | 135 |
| 191 | 3300047320 | Ga0495672_0474812 | Ga0495672_0474812_64_471 | 135 |
| 192 | 3300048921 | Ga0496118_0086044 | Ga0496118_0086044_1100_1507 | 135 |
| 193 | 3300048923 | Ga0496120_0220357 | Ga0496120_0220357_203_610 | 135 |
| 194 | 3300048924 | Ga0496121_0044559 | Ga0496121_0044559_792_1199 | 135 |
| 195 | 3300048928 | Ga0496125_0034884 | Ga0496125_0034884_2154_2561 | 135 |
| 196 | 3300049460 | Ga0495682_0018288 | Ga0495682_0018288_245_652 | 135 |
| 197 | 3300053091 | Ga0500647_0193872 | Ga0500647_0193872_17_424 | 135 |
| 198 | 3300053122 | Ga0500608_232489 | Ga0500608_232489_313_720 | 135 |
| 199 | 3300053130 | Ga0500642_0000090 | Ga0500642_0000090_9151_9558 | 135 |
| 200 | 3300053177 | Ga0500636_0049352 | Ga0500636_0049352_1188_1595 | 135 |
| 201 | 3300053737 | Ga0500601_003418 | Ga0500601_003418_1077_1484 | 135 |
| 202 | iso_pu_bacteria | 2513237098 | 2513673294 | 135 |
| 203 | iso_pu_bacteria | 2524023210 | 2524465862 | 135 |
| 204 | iso_pu_bacteria | 2885383462 | 2885387305 | 135 |
| 205 | iso_pu_bacteria | 2903768456 | 2903774357 | 135 |
| 206 | 3300007788 | Ga0099795_10217289 | Ga0099795_102172892 | 136 |
| 207 | 3300010159 | Ga0099796_10151157 | Ga0099796_101511572 | 136 |
| 208 | 3300035088 | Ga0373940_0200791 | Ga0373940_0200791_221_631 | 136 |
| 209 | 3300035116 | Ga0373945_0101051 | Ga0373945_0101051_681_1091 | 136 |
| 210 | 3300035691 | Ga0373931_0020927 | Ga0373931_0020927_875_1285 | 136 |
| 211 | 3300037471 | Ga0395905_0147099 | Ga0395905_0147099_1158_1568 | 136 |
| 212 | 3300041460 | Ga0451802_1494618 | Ga0451802_1494618_169_579 | 136 |
| 213 | 3300046459 | Ga0495629_0896585 | Ga0495629_0896585_15_425 | 136 |
| 214 | 3300046475 | Ga0495639_0254363 | Ga0495639_0254363_82_492 | 136 |
| 215 | 3300046517 | Ga0495630_0269329 | Ga0495630_0269329_420_830 | 136 |
| 216 | 3300046518 | Ga0495631_0197719 | Ga0495631_0197719_266_676 | 136 |
| 217 | 3300046530 | Ga0495654_0349189 | Ga0495654_0349189_143_553 | 136 |
| 218 | 3300046615 | Ga0495656_0200527 | Ga0495656_0200527_174_584 | 136 |
| 219 | 3300046660 | Ga0495625_0391655 | Ga0495625_0391655_86_496 | 136 |
| 220 | 3300047446 | Ga0495679_138495 | Ga0495679_138495_74_484 | 136 |
| 221 | 3300047469 | Ga0495673_0160362 | Ga0495673_0160362_264_674 | 136 |
| 222 | 3300047472 | Ga0495686_0250754 | Ga0495686_0250754_170_580 | 136 |
| 223 | 3300048907 | Ga0496104_0026734 | Ga0496104_0026734_480_890 | 136 |
| 224 | 3300048908 | Ga0496105_0345596 | Ga0496105_0345596_85_495 | 136 |
| 225 | 3300048913 | Ga0496110_0515209 | Ga0496110_0515209_538_948 | 136 |
| 226 | 3300048914 | Ga0496111_0040302 | Ga0496111_0040302_522_932 | 136 |
| 227 | 3300048915 | Ga0496112_0025634 | Ga0496112_0025634_4843_5253 | 136 |
| 228 | 3300048918 | Ga0496115_0159969 | Ga0496115_0159969_983_1393 | 136 |
| 229 | 3300048918 | Ga0496115_0868630 | Ga0496115_0868630_194_604 | 136 |
| 230 | 3300048924 | Ga0496121_0011669 | Ga0496121_0011669_1684_2094 | 136 |
| 231 | 3300048925 | Ga0496122_0090249 | Ga0496122_0090249_1389_1799 | 136 |
| 232 | 3300048928 | Ga0496125_0000176 | Ga0496125_0000176_28791_29201 | 136 |
| 233 | 3300050494 | nmdc:mga06z11_224365_c1 | nmdc:mga06z11_224365_c1_294_704 | 136 |
| 234 | 3300053091 | Ga0500647_0073432 | Ga0500647_0073432_730_1140 | 136 |
| 235 | 3300053094 | Ga0500566_0000078 | Ga0500566_0000078_32722_33132 | 136 |
| 236 | 3300053095 | Ga0500640_000121 | Ga0500640_000121_10312_10722 | 136 |
| 237 | 3300053111 | Ga0500572_000170 | Ga0500572_000170_9147_9557 | 136 |
| 238 | 3300053113 | Ga0500580_261947 | Ga0500580_261947_82_492 | 136 |
| 239 | 3300053115 | Ga0500591_077793 | Ga0500591_077793_681_1091 | 136 |
| 240 | 3300053116 | Ga0500592_023529 | Ga0500592_023529_36_446 | 136 |
| 241 | 3300053123 | Ga0500614_004910 | Ga0500614_004910_745_1155 | 136 |
| 242 | 3300053136 | Ga0500559_0009508 | Ga0500559_0009508_2828_3238 | 136 |
| 243 | 3300053150 | Ga0500603_000081 | Ga0500603_000081_9147_9557 | 136 |
| 244 | 3300053159 | Ga0500630_004509 | Ga0500630_004509_4049_4459 | 136 |
| 245 | 3300053162 | Ga0500638_021427 | Ga0500638_021427_334_744 | 136 |
| 246 | 3300053163 | Ga0500639_000028 | Ga0500639_000028_68854_69264 | 136 |
| 247 | 3300053177 | Ga0500636_0065953 | Ga0500636_0065953_889_1302 | 136 |
| 248 | 3300053724 | Ga0500570_131027 | Ga0500570_131027_278_688 | 136 |
| 249 | 3300053735 | Ga0500596_000324 | Ga0500596_000324_7589_7999 | 136 |
| 250 | 3300004625 | Ga0055543_1057955 | Ga0055543_10579552 | 137 |
| 251 | 3300005262 | Ga0065165_1060395 | Ga0065165_10603952 | 137 |
| 252 | 3300005841 | Ga0068863_101101683 | Ga0068863_1011016832 | 137 |
| 253 | 3300005937 | Ga0081455_10265399 | Ga0081455_102653992 | 137 |
| 254 | 3300005983 | Ga0081540_1007306 | Ga0081540_10073068 | 137 |
| 255 | 3300005983 | Ga0081540_1233257 | Ga0081540_12332571 | 137 |
| 256 | 3300006871 | Ga0075434_100189929 | Ga0075434_1001899292 | 137 |
| 257 | 3300007788 | Ga0099795_10142251 | Ga0099795_101422512 | 137 |
| 258 | 3300009176 | Ga0105242_11303406 | Ga0105242_113034061 | 137 |
| 259 | 3300025302 | Ga0207426_1034873 | Ga0207426_10348732 | 137 |
| 260 | 3300025936 | Ga0207670_10925765 | Ga0207670_109257651 | 137 |
| 261 | 3300037471 | Ga0395905_0081275 | Ga0395905_0081275_794_1207 | 137 |
| 262 | 3300038443 | Ga0395901_0733717 | Ga0395901_0733717_180_593 | 137 |
| 263 | 3300041505 | Ga0451849_0883225 | Ga0451849_0883225_59_472 | 137 |
| 264 | 3300047472 | Ga0495686_0143402 | Ga0495686_0143402_766_1179 | 137 |
| 265 | 3300048904 | Ga0496101_0232477 | Ga0496101_0232477_711_1124 | 137 |
| 266 | 3300048905 | Ga0496102_0381156 | Ga0496102_0381156_873_1286 | 137 |
| 267 | 3300048917 | Ga0496114_0793411 | Ga0496114_0793411_127_540 | 137 |
| 268 | 3300048918 | Ga0496115_0468347 | Ga0496115_0468347_238_651 | 137 |
| 269 | 3300048924 | Ga0496121_0000265 | Ga0496121_0000265_50358_50798 | 137 |
| 270 | 3300048924 | Ga0496121_0120593 | Ga0496121_0120593_946_1359 | 137 |
| 271 | 3300048927 | Ga0496124_0213718 | Ga0496124_0213718_513_926 | 137 |
| 272 | 3300053104 | Ga0500556_0030267 | Ga0500556_0030267_1304_1717 | 137 |
| 273 | 3300053119 | Ga0500595_002442 | Ga0500595_002442_7298_7711 | 137 |
| 274 | 3300053119 | Ga0500595_002477 | Ga0500595_002477_2782_3195 | 137 |
| 275 | 3300053139 | Ga0500568_0011274 | Ga0500568_0011274_2353_2766 | 137 |
| 276 | 3300003214 | JGI25165J46597_1048384 | JGI25165J46597_10483841 | 138 |
| 277 | 3300003752 | Ga0055539_1006053 | Ga0055539_10060532 | 138 |
| 278 | 3300005434 | Ga0070709_10001487 | Ga0070709_1000148713 | 138 |
| 279 | 3300005436 | Ga0070713_100375492 | Ga0070713_1003754922 | 138 |
| 280 | 3300005436 | Ga0070713_100634323 | Ga0070713_1006343231 | 138 |
| 281 | 3300005439 | Ga0070711_100009103 | Ga0070711_1000091036 | 138 |
| 282 | 3300005445 | Ga0070708_100064842 | Ga0070708_1000648425 | 138 |
| 283 | 3300005468 | Ga0070707_100067780 | Ga0070707_1000677802 | 138 |
| 284 | 3300005471 | Ga0070698_100901362 | Ga0070698_1009013622 | 138 |
| 285 | 3300005546 | Ga0070696_101316213 | Ga0070696_1013162131 | 138 |
| 286 | 3300005548 | Ga0070665_101278437 | Ga0070665_1012784371 | 138 |
| 287 | 3300005983 | Ga0081540_1026662 | Ga0081540_10266624 | 138 |
| 288 | 3300006038 | Ga0075365_10504620 | Ga0075365_105046202 | 138 |
| 289 | 3300006038 | Ga0075365_10836182 | Ga0075365_108361822 | 138 |
| 290 | 3300006051 | Ga0075364_10339815 | Ga0075364_103398153 | 138 |
| 291 | 3300006175 | Ga0070712_100377683 | Ga0070712_1003776832 | 138 |
| 292 | 3300006175 | Ga0070712_100685446 | Ga0070712_1006854462 | 138 |
| 293 | 3300007265 | Ga0099794_10044583 | Ga0099794_100445834 | 138 |
| 294 | 3300007788 | Ga0099795_10002812 | Ga0099795_100028121 | 138 |
| 295 | 3300007788 | Ga0099795_10043944 | Ga0099795_100439443 | 138 |
| 296 | 3300009094 | Ga0111539_10071397 | Ga0111539_100713975 | 138 |
| 297 | 3300009551 | Ga0105238_11314755 | Ga0105238_113147552 | 138 |
| 298 | 3300010159 | Ga0099796_10009289 | Ga0099796_100092892 | 138 |
| 299 | 3300010159 | Ga0099796_10295163 | Ga0099796_102951632 | 138 |
| 300 | 3300010375 | Ga0105239_10043909 | Ga0105239_100439096 | 138 |
| 301 | 3300010375 | Ga0105239_10909995 | Ga0105239_109099952 | 138 |
| 302 | 3300010375 | Ga0105239_13432695 | Ga0105239_134326951 | 138 |
| 303 | 3300012495 | Ga0157323_1011788 | Ga0157323_10117881 | 138 |
| 304 | 3300013297 | Ga0157378_10031236 | Ga0157378_100312366 | 138 |
| 305 | 3300013308 | Ga0157375_10836715 | Ga0157375_108367151 | 138 |
| 306 | 3300021384 | Ga0213876_10295971 | Ga0213876_102959712 | 138 |
| 307 | 3300025253 | Ga0209677_101639 | Ga0209677_1016399 | 138 |
| 308 | 3300025254 | Ga0209148_1006467 | Ga0209148_10064674 | 138 |
| 309 | 3300025261 | Ga0209233_1008872 | Ga0209233_10088721 | 138 |
| 310 | 3300025272 | Ga0209455_1001472 | Ga0209455_100147213 | 138 |
| 311 | 3300025272 | Ga0209455_1001710 | Ga0209455_10017106 | 138 |
| 312 | 3300025898 | Ga0207692_10450057 | Ga0207692_104500572 | 138 |
| 313 | 3300025898 | Ga0207692_10650649 | Ga0207692_106506491 | 138 |
| 314 | 3300025906 | Ga0207699_10129981 | Ga0207699_101299811 | 138 |
| 315 | 3300025910 | Ga0207684_10639812 | Ga0207684_106398122 | 138 |
| 316 | 3300025915 | Ga0207693_10017747 | Ga0207693_100177472 | 138 |
| 317 | 3300025916 | Ga0207663_10100721 | Ga0207663_101007213 | 138 |
| 318 | 3300025922 | Ga0207646_10261644 | Ga0207646_102616442 | 138 |
| 319 | 3300025924 | Ga0207694_10628845 | Ga0207694_106288452 | 138 |
| 320 | 3300025928 | Ga0207700_11115625 | Ga0207700_111156251 | 138 |
| 321 | 3300025939 | Ga0207665_10101928 | Ga0207665_101019283 | 138 |
| 322 | 3300025972 | Ga0207668_10262230 | Ga0207668_102622303 | 138 |
| 323 | 3300027512 | Ga0209179_1008779 | Ga0209179_10087793 | 138 |
| 324 | 3300027671 | Ga0209588_1019784 | Ga0209588_10197842 | 138 |
| 325 | 3300028379 | Ga0268266_11265124 | Ga0268266_112651242 | 138 |
| 326 | 3300028577 | Ga0265318_10079770 | Ga0265318_100797702 | 138 |
| 327 | 3300028653 | Ga0265323_10018266 | Ga0265323_100182664 | 138 |
| 328 | 3300028654 | Ga0265322_10117807 | Ga0265322_101178072 | 138 |
| 329 | 3300028666 | Ga0265336_10000415 | Ga0265336_1000041525 | 138 |
| 330 | 3300028800 | Ga0265338_10010045 | Ga0265338_1001004515 | 138 |
| 331 | 3300029957 | Ga0265324_10017627 | Ga0265324_100176272 | 138 |
| 332 | 3300035088 | Ga0373940_0336714 | Ga0373940_0336714_43_459 | 138 |
| 333 | 3300035092 | Ga0373952_0095837 | Ga0373952_0095837_332_748 | 138 |
| 334 | 3300035170 | Ga0373943_0139389 | Ga0373943_0139389_566_982 | 138 |
| 335 | 3300035171 | Ga0373946_0267866 | Ga0373946_0267866_181_597 | 138 |
| 336 | 3300035695 | Ga0373927_0009305 | Ga0373927_0009305_5368_5784 | 138 |
| 337 | 3300035725 | Ga0373947_0038071 | Ga0373947_0038071_322_738 | 138 |
| 338 | 3300037068 | Ga0373925_0023664 | Ga0373925_0023664_3912_4328 | 138 |
| 339 | 3300037068 | Ga0373925_0390614 | Ga0373925_0390614_365_781 | 138 |
| 340 | 3300037466 | Ga0395898_0475635 | Ga0395898_0475635_747_1163 | 138 |
| 341 | 3300037853 | Ga0436364_0581979 | Ga0436364_0581979_523_939 | 138 |
| 342 | 3300039450 | Ga0436363_1563002 | Ga0436363_1563002_82_498 | 138 |
| 343 | 3300042157 | Ga0439458_0159765 | Ga0439458_0159765_44_460 | 138 |
| 344 | 3300044719 | Ga0466971_0157021 | Ga0466971_0157021_76_492 | 138 |
| 345 | 3300044842 | Ga0466957_0105153 | Ga0466957_0105153_229_645 | 138 |
| 346 | 3300044842 | Ga0466957_1093303 | Ga0466957_1093303_39_455 | 138 |
| 347 | 3300045049 | Ga0466959_0154824 | Ga0466959_0154824_119_535 | 138 |
| 348 | 3300046455 | Ga0495603_0072096 | Ga0495603_0072096_776_1192 | 138 |
| 349 | 3300046455 | Ga0495603_0074766 | Ga0495603_0074766_853_1269 | 138 |
| 350 | 3300046457 | Ga0495590_0077288 | Ga0495590_0077288_336_752 | 138 |
| 351 | 3300046460 | Ga0495638_0266085 | Ga0495638_0266085_133_549 | 138 |
| 352 | 3300046472 | Ga0495580_0291464 | Ga0495580_0291464_671_1087 | 138 |
| 353 | 3300046473 | Ga0495582_0229642 | Ga0495582_0229642_513_929 | 138 |
| 354 | 3300046491 | Ga0495584_0104087 | Ga0495584_0104087_825_1241 | 138 |
| 355 | 3300046491 | Ga0495584_0181275 | Ga0495584_0181275_11_427 | 138 |
| 356 | 3300046491 | Ga0495584_0403064 | Ga0495584_0403064_253_669 | 138 |
| 357 | 3300046491 | Ga0495584_0507590 | Ga0495584_0507590_10_426 | 138 |
| 358 | 3300046492 | Ga0495585_0275017 | Ga0495585_0275017_65_481 | 138 |
| 359 | 3300046499 | Ga0495594_0107854 | Ga0495594_0107854_369_785 | 138 |
| 360 | 3300046500 | Ga0495596_0194477 | Ga0495596_0194477_362_778 | 138 |
| 361 | 3300046501 | Ga0495607_0393938 | Ga0495607_0393938_148_564 | 138 |
| 362 | 3300046507 | Ga0495606_0122562 | Ga0495606_0122562_764_1180 | 138 |
| 363 | 3300046517 | Ga0495630_1347834 | Ga0495630_1347834_28_444 | 138 |
| 364 | 3300046518 | Ga0495631_0089133 | Ga0495631_0089133_458_874 | 138 |
| 365 | 3300046518 | Ga0495631_0511994 | Ga0495631_0511994_72_488 | 138 |
| 366 | 3300046523 | Ga0495644_0220346 | Ga0495644_0220346_29_445 | 138 |
| 367 | 3300046528 | Ga0495642_0166942 | Ga0495642_0166942_120_536 | 138 |
| 368 | 3300046537 | Ga0495598_0046091 | Ga0495598_0046091_581_997 | 138 |
| 369 | 3300046539 | Ga0495621_0018971 | Ga0495621_0018971_1345_1761 | 138 |
| 370 | 3300046542 | Ga0495597_0344586 | Ga0495597_0344586_140_556 | 138 |
| 371 | 3300046557 | Ga0495622_0005490 | Ga0495622_0005490_2549_2965 | 138 |
| 372 | 3300046557 | Ga0495622_0135417 | Ga0495622_0135417_654_1070 | 138 |
| 373 | 3300046557 | Ga0495622_0205157 | Ga0495622_0205157_392_808 | 138 |
| 374 | 3300046616 | Ga0495668_0203406 | Ga0495668_0203406_314_730 | 138 |
| 375 | 3300046648 | Ga0495611_0126279 | Ga0495611_0126279_321_737 | 138 |
| 376 | 3300046660 | Ga0495625_0140569 | Ga0495625_0140569_764_1180 | 138 |
| 377 | 3300046660 | Ga0495625_0185164 | Ga0495625_0185164_393_809 | 138 |
| 378 | 3300046674 | Ga0495588_0082492 | Ga0495588_0082492_912_1328 | 138 |
| 379 | 3300046681 | Ga0495647_0223727 | Ga0495647_0223727_349_765 | 138 |
| 380 | 3300046684 | Ga0495669_0007993 | Ga0495669_0007993_1090_1506 | 138 |
| 381 | 3300046684 | Ga0495669_0255061 | Ga0495669_0255061_389_805 | 138 |
| 382 | 3300046690 | Ga0495624_0145609 | Ga0495624_0145609_916_1332 | 138 |
| 383 | 3300046690 | Ga0495624_0564993 | Ga0495624_0564993_227_643 | 138 |
| 384 | 3300046692 | Ga0495671_0101526 | Ga0495671_0101526_261_677 | 138 |
| 385 | 3300046794 | Ga0495589_0111160 | Ga0495589_0111160_574_990 | 138 |
| 386 | 3300046794 | Ga0495589_0129712 | Ga0495589_0129712_779_1195 | 138 |
| 387 | 3300047315 | Ga0495581_0081158 | Ga0495581_0081158_1376_1792 | 138 |
| 388 | 3300047321 | Ga0495676_0110086 | Ga0495676_0110086_78_494 | 138 |
| 389 | 3300047469 | Ga0495673_0293941 | Ga0495673_0293941_110_526 | 138 |
| 390 | 3300048091 | Ga0495626_0275345 | Ga0495626_0275345_34_450 | 138 |
| 391 | 3300048904 | Ga0496101_0546160 | Ga0496101_0546160_137_553 | 138 |
| 392 | 3300048905 | Ga0496102_0410219 | Ga0496102_0410219_838_1254 | 138 |
| 393 | 3300048905 | Ga0496102_0861647 | Ga0496102_0861647_173_589 | 138 |
| 394 | 3300048906 | Ga0496103_1061774 | Ga0496103_1061774_69_485 | 138 |
| 395 | 3300048907 | Ga0496104_1770519 | Ga0496104_1770519_54_470 | 138 |
| 396 | 3300048917 | Ga0496114_0345394 | Ga0496114_0345394_645_1061 | 138 |
| 397 | 3300048919 | Ga0496116_0198582 | Ga0496116_0198582_214_630 | 138 |
| 398 | 3300048921 | Ga0496118_0065065 | Ga0496118_0065065_1295_1711 | 138 |
| 399 | 3300048922 | Ga0496119_0189829 | Ga0496119_0189829_155_571 | 138 |
| 400 | 3300048924 | Ga0496121_0028222 | Ga0496121_0028222_1083_1499 | 138 |
| 401 | 3300048924 | Ga0496121_0479793 | Ga0496121_0479793_68_484 | 138 |
| 402 | 3300048927 | Ga0496124_0262119 | Ga0496124_0262119_281_697 | 138 |
| 403 | 3300048927 | Ga0496124_0331448 | Ga0496124_0331448_60_476 | 138 |
| 404 | 3300048928 | Ga0496125_0137109 | Ga0496125_0137109_256_672 | 138 |
| 405 | 3300048928 | Ga0496125_0206435 | Ga0496125_0206435_126_542 | 138 |
| 406 | 3300048929 | Ga0496126_0015449 | Ga0496126_0015449_4362_4778 | 138 |
| 407 | 3300048929 | Ga0496126_0072217 | Ga0496126_0072217_786_1202 | 138 |
| 408 | 3300048929 | Ga0496126_0122354 | Ga0496126_0122354_696_1112 | 138 |
| 409 | 3300048929 | Ga0496126_0177512 | Ga0496126_0177512_1322_1738 | 138 |
| 410 | 3300049460 | Ga0495682_0066545 | Ga0495682_0066545_863_1279 | 138 |
| 411 | 3300049574 | Ga0501038_0265551 | Ga0501038_0265551_569_985 | 138 |
| 412 | 3300049590 | Ga0501074_0394278 | Ga0501074_0394278_521_937 | 138 |
| 413 | 3300050489 | nmdc:mga03683_489268_c1 | nmdc:mga03683_489268_c1_168_584 | 138 |
| 414 | 3300050492 | nmdc:mga0yw44_187882_c1 | nmdc:mga0yw44_187882_c1_469_912 | 138 |
| 415 | 3300050492 | nmdc:mga0yw44_638498_c1 | nmdc:mga0yw44_638498_c1_138_554 | 138 |
| 416 | 3300050495 | nmdc:mga04h51_252344_c1 | nmdc:mga04h51_252344_c1_180_596 | 138 |
| 417 | 3300050496 | nmdc:mga07m45_107497_c1 | nmdc:mga07m45_107497_c1_968_1384 | 138 |
| 418 | 3300053092 | Ga0500583_0098116 | Ga0500583_0098116_923_1339 | 138 |
| 419 | 3300053103 | Ga0500555_040212 | Ga0500555_040212_736_1152 | 138 |
| 420 | 3300053119 | Ga0500595_004672 | Ga0500595_004672_3809_4225 | 138 |
| 421 | 3300053130 | Ga0500642_0199702 | Ga0500642_0199702_71_487 | 138 |
| 422 | 3300053134 | Ga0500658_0072704 | Ga0500658_0072704_748_1164 | 138 |
| 423 | 3300053150 | Ga0500603_001666 | Ga0500603_001666_450_866 | 138 |
| 424 | 3300053158 | Ga0500627_0441489 | Ga0500627_0441489_112_528 | 138 |
| 425 | 3300053163 | Ga0500639_131622 | Ga0500639_131622_310_726 | 138 |
| 426 | 3300053177 | Ga0500636_0398985 | Ga0500636_0398985_100_516 | 138 |
| 427 | 3300053178 | Ga0500637_0020909 | Ga0500637_0020909_2795_3211 | 138 |
| 428 | 3300053178 | Ga0500637_0039902 | Ga0500637_0039902_817_1233 | 138 |
| 429 | 3300005327 | Ga0070658_10023514 | Ga0070658_100235144 | 139 |
| 430 | 3300005327 | Ga0070658_10102491 | Ga0070658_101024913 | 139 |
| 431 | 3300005329 | Ga0070683_100650545 | Ga0070683_1006505452 | 139 |
| 432 | 3300005331 | Ga0070670_100190496 | Ga0070670_1001904963 | 139 |
| 433 | 3300005337 | Ga0070682_100036436 | Ga0070682_1000364363 | 139 |
| 434 | 3300005338 | Ga0068868_100061212 | Ga0068868_1000612121 | 139 |
| 435 | 3300005338 | Ga0068868_100487663 | Ga0068868_1004876632 | 139 |
| 436 | 3300005339 | Ga0070660_101235354 | Ga0070660_1012353541 | 139 |
| 437 | 3300005344 | Ga0070661_100090117 | Ga0070661_1000901173 | 139 |
| 438 | 3300005354 | Ga0070675_100256096 | Ga0070675_1002560962 | 139 |
| 439 | 3300005355 | Ga0070671_100300849 | Ga0070671_1003008492 | 139 |
| 440 | 3300005355 | Ga0070671_100593258 | Ga0070671_1005932582 | 139 |
| 441 | 3300005364 | Ga0070673_100071969 | Ga0070673_1000719694 | 139 |
| 442 | 3300005366 | Ga0070659_101699146 | Ga0070659_1016991461 | 139 |
| 443 | 3300005367 | Ga0070667_101488193 | Ga0070667_1014881931 | 139 |
| 444 | 3300005435 | Ga0070714_100228898 | Ga0070714_1002288982 | 139 |
| 445 | 3300005437 | Ga0070710_10648292 | Ga0070710_106482921 | 139 |
| 446 | 3300005439 | Ga0070711_101810257 | Ga0070711_1018102571 | 139 |
| 447 | 3300005445 | Ga0070708_100690600 | Ga0070708_1006906002 | 139 |
| 448 | 3300005455 | Ga0070663_100004680 | Ga0070663_1000046805 | 139 |
| 449 | 3300005455 | Ga0070663_100320808 | Ga0070663_1003208083 | 139 |
| 450 | 3300005456 | Ga0070678_100045978 | Ga0070678_1000459784 | 139 |
| 451 | 3300005456 | Ga0070678_100345611 | Ga0070678_1003456112 | 139 |
| 452 | 3300005458 | Ga0070681_10012465 | Ga0070681_100124658 | 139 |
| 453 | 3300005467 | Ga0070706_100473639 | Ga0070706_1004736391 | 139 |
| 454 | 3300005530 | Ga0070679_100018130 | Ga0070679_1000181302 | 139 |
| 455 | 3300005539 | Ga0068853_101321949 | Ga0068853_1013219491 | 139 |
| 456 | 3300005539 | Ga0068853_101927947 | Ga0068853_1019279471 | 139 |
| 457 | 3300005543 | Ga0070672_100719582 | Ga0070672_1007195822 | 139 |
| 458 | 3300005548 | Ga0070665_100013100 | Ga0070665_1000131003 | 139 |
| 459 | 3300005548 | Ga0070665_100142934 | Ga0070665_1001429343 | 139 |
| 460 | 3300005563 | Ga0068855_100007494 | Ga0068855_1000074948 | 139 |
| 461 | 3300005564 | Ga0070664_100451693 | Ga0070664_1004516931 | 139 |
| 462 | 3300005614 | Ga0068856_100257385 | Ga0068856_1002573853 | 139 |
| 463 | 3300005615 | Ga0070702_100504825 | Ga0070702_1005048252 | 139 |
| 464 | 3300005616 | Ga0068852_100391056 | Ga0068852_1003910561 | 139 |
| 465 | 3300005616 | Ga0068852_102611884 | Ga0068852_1026118841 | 139 |
| 466 | 3300005618 | Ga0068864_100189671 | Ga0068864_1001896713 | 139 |
| 467 | 3300005841 | Ga0068863_101336523 | Ga0068863_1013365231 | 139 |
| 468 | 3300005983 | Ga0081540_1001339 | Ga0081540_100133910 | 139 |
| 469 | 3300005983 | Ga0081540_1076704 | Ga0081540_10767043 | 139 |
| 470 | 3300005983 | Ga0081540_1101767 | Ga0081540_11017672 | 139 |
| 471 | 3300006038 | Ga0075365_10016437 | Ga0075365_100164375 | 139 |
| 472 | 3300006038 | Ga0075365_10075675 | Ga0075365_100756754 | 139 |
| 473 | 3300006048 | Ga0075363_100014770 | Ga0075363_1000147707 | 139 |
| 474 | 3300006048 | Ga0075363_100122388 | Ga0075363_1001223883 | 139 |
| 475 | 3300006051 | Ga0075364_10319221 | Ga0075364_103192212 | 139 |
| 476 | 3300006173 | Ga0070716_100154821 | Ga0070716_1001548213 | 139 |
| 477 | 3300006173 | Ga0070716_100367307 | Ga0070716_1003673072 | 139 |
| 478 | 3300006175 | Ga0070712_100217090 | Ga0070712_1002170902 | 139 |
| 479 | 3300006175 | Ga0070712_100413189 | Ga0070712_1004131893 | 139 |
| 480 | 3300006178 | Ga0075367_10040157 | Ga0075367_100401574 | 139 |
| 481 | 3300006178 | Ga0075367_10192724 | Ga0075367_101927242 | 139 |
| 482 | 3300006178 | Ga0075367_10388212 | Ga0075367_103882121 | 139 |
| 483 | 3300006353 | Ga0075370_10020322 | Ga0075370_100203226 | 139 |
| 484 | 3300006353 | Ga0075370_10201833 | Ga0075370_102018332 | 139 |
| 485 | 3300006358 | Ga0068871_100031423 | Ga0068871_1000314236 | 139 |
| 486 | 3300009093 | Ga0105240_10309970 | Ga0105240_103099703 | 139 |
| 487 | 3300009098 | Ga0105245_11602772 | Ga0105245_116027721 | 139 |
| 488 | 3300009148 | Ga0105243_10501348 | Ga0105243_105013482 | 139 |
| 489 | 3300009148 | Ga0105243_10638961 | Ga0105243_106389612 | 139 |
| 490 | 3300009174 | Ga0105241_10514380 | Ga0105241_105143801 | 139 |
| 491 | 3300009176 | Ga0105242_10506722 | Ga0105242_105067222 | 139 |
| 492 | 3300009177 | Ga0105248_11181365 | Ga0105248_111813651 | 139 |
| 493 | 3300009545 | Ga0105237_10208119 | Ga0105237_102081192 | 139 |
| 494 | 3300009545 | Ga0105237_11045357 | Ga0105237_110453572 | 139 |
| 495 | 3300009551 | Ga0105238_10202605 | Ga0105238_102026053 | 139 |
| 496 | 3300009551 | Ga0105238_10572463 | Ga0105238_105724631 | 139 |
| 497 | 3300009551 | Ga0105238_10575588 | Ga0105238_105755882 | 139 |
| 498 | 3300010159 | Ga0099796_10520424 | Ga0099796_105204241 | 139 |
| 499 | 3300010375 | Ga0105239_10048229 | Ga0105239_100482295 | 139 |
| 500 | 3300011119 | Ga0105246_10089670 | Ga0105246_100896702 | 139 |
| 501 | 3300013104 | Ga0157370_10026904 | Ga0157370_100269044 | 139 |
| 502 | 3300013296 | Ga0157374_10019278 | Ga0157374_100192785 | 139 |
| 503 | 3300013306 | Ga0163162_10044547 | Ga0163162_100445473 | 139 |
| 504 | 3300013308 | Ga0157375_10174025 | Ga0157375_101740254 | 139 |
| 505 | 3300014325 | Ga0163163_10073225 | Ga0163163_100732252 | 139 |
| 506 | 3300014325 | Ga0163163_10203034 | Ga0163163_102030343 | 139 |
| 507 | 3300014497 | Ga0182008_10263072 | Ga0182008_102630722 | 139 |
| 508 | 3300014968 | Ga0157379_10060147 | Ga0157379_100601475 | 139 |
| 509 | 3300014968 | Ga0157379_11240093 | Ga0157379_112400932 | 139 |
| 510 | 3300014969 | Ga0157376_10046724 | Ga0157376_100467243 | 139 |
| 511 | 3300017792 | Ga0163161_11063447 | Ga0163161_110634471 | 139 |
| 512 | 3300025898 | Ga0207692_10407209 | Ga0207692_104072092 | 139 |
| 513 | 3300025900 | Ga0207710_10164150 | Ga0207710_101641501 | 139 |
| 514 | 3300025901 | Ga0207688_10088637 | Ga0207688_100886373 | 139 |
| 515 | 3300025909 | Ga0207705_10061486 | Ga0207705_100614865 | 139 |
| 516 | 3300025909 | Ga0207705_10234508 | Ga0207705_102345082 | 139 |
| 517 | 3300025910 | Ga0207684_10186080 | Ga0207684_101860802 | 139 |
| 518 | 3300025912 | Ga0207707_10011000 | Ga0207707_100110006 | 139 |
| 519 | 3300025913 | Ga0207695_10234230 | Ga0207695_102342303 | 139 |
| 520 | 3300025914 | Ga0207671_10307417 | Ga0207671_103074172 | 139 |
| 521 | 3300025915 | Ga0207693_10122761 | Ga0207693_101227612 | 139 |
| 522 | 3300025915 | Ga0207693_10244528 | Ga0207693_102445281 | 139 |
| 523 | 3300025919 | Ga0207657_10556936 | Ga0207657_105569362 | 139 |
| 524 | 3300025920 | Ga0207649_10066665 | Ga0207649_100666653 | 139 |
| 525 | 3300025921 | Ga0207652_10158337 | Ga0207652_101583372 | 139 |
| 526 | 3300025924 | Ga0207694_10572641 | Ga0207694_105726411 | 139 |
| 527 | 3300025924 | Ga0207694_11328088 | Ga0207694_113280881 | 139 |
| 528 | 3300025928 | Ga0207700_11704156 | Ga0207700_117041561 | 139 |
| 529 | 3300025929 | Ga0207664_11208542 | Ga0207664_112085422 | 139 |
| 530 | 3300025931 | Ga0207644_10178384 | Ga0207644_101783842 | 139 |
| 531 | 3300025931 | Ga0207644_10273138 | Ga0207644_102731382 | 139 |
| 532 | 3300025934 | Ga0207686_10445902 | Ga0207686_104459022 | 139 |
| 533 | 3300025935 | Ga0207709_11248901 | Ga0207709_112489011 | 139 |
| 534 | 3300025938 | Ga0207704_10133658 | Ga0207704_101336582 | 139 |
| 535 | 3300025939 | Ga0207665_10651826 | Ga0207665_106518262 | 139 |
| 536 | 3300025944 | Ga0207661_10570559 | Ga0207661_105705591 | 139 |
| 537 | 3300025945 | Ga0207679_11130151 | Ga0207679_111301512 | 139 |
| 538 | 3300025949 | Ga0207667_10050380 | Ga0207667_100503803 | 139 |
| 539 | 3300025960 | Ga0207651_10064111 | Ga0207651_100641113 | 139 |
| 540 | 3300025972 | Ga0207668_10836322 | Ga0207668_108363221 | 139 |
| 541 | 3300025986 | Ga0207658_12090848 | Ga0207658_120908481 | 139 |
| 542 | 3300026023 | Ga0207677_10110732 | Ga0207677_101107324 | 139 |
| 543 | 3300026023 | Ga0207677_11600840 | Ga0207677_116008401 | 139 |
| 544 | 3300026041 | Ga0207639_10249569 | Ga0207639_102495691 | 139 |
| 545 | 3300026041 | Ga0207639_11186091 | Ga0207639_111860911 | 139 |
| 546 | 3300026067 | Ga0207678_10004216 | Ga0207678_1000421615 | 139 |
| 547 | 3300026067 | Ga0207678_10402078 | Ga0207678_104020781 | 139 |
| 548 | 3300026078 | Ga0207702_10229418 | Ga0207702_102294181 | 139 |
| 549 | 3300026088 | Ga0207641_10308005 | Ga0207641_103080053 | 139 |
| 550 | 3300026095 | Ga0207676_10162342 | Ga0207676_101623423 | 139 |
| 551 | 3300026121 | Ga0207683_10029544 | Ga0207683_100295445 | 139 |
| 552 | 3300026121 | Ga0207683_11677118 | Ga0207683_116771181 | 139 |
| 553 | 3300026142 | Ga0207698_10554453 | Ga0207698_105544531 | 139 |
| 554 | 3300028379 | Ga0268266_10001136 | Ga0268266_1000113620 | 139 |
| 555 | 3300028379 | Ga0268266_10094515 | Ga0268266_100945153 | 139 |
| 556 | 3300028379 | Ga0268266_10654635 | Ga0268266_106546352 | 139 |
| 557 | 3300031456 | Ga0307513_10418783 | Ga0307513_104187833 | 139 |
| 558 | 3300031616 | Ga0307508_10127944 | Ga0307508_101279444 | 139 |
| 559 | 3300031730 | Ga0307516_10046388 | Ga0307516_100463882 | 139 |
| 560 | 3300031730 | Ga0307516_10053240 | Ga0307516_100532404 | 139 |
| 561 | 3300031731 | Ga0307405_10315500 | Ga0307405_103155003 | 139 |
| 562 | 3300032005 | Ga0307411_11395977 | Ga0307411_113959771 | 139 |
| 563 | 3300033180 | Ga0307510_10327889 | Ga0307510_103278892 | 139 |
| 564 | 3300035113 | Ga0373936_0043384 | Ga0373936_0043384_492_911 | 139 |
| 565 | 3300035119 | Ga0373956_0259800 | Ga0373956_0259800_218_637 | 139 |
| 566 | 3300035170 | Ga0373943_0121755 | Ga0373943_0121755_14_433 | 139 |
| 567 | 3300035170 | Ga0373943_0152823 | Ga0373943_0152823_46_465 | 139 |
| 568 | 3300035172 | Ga0373955_0071154 | Ga0373955_0071154_214_633 | 139 |
| 569 | 3300035410 | Ga0373924_0048356 | Ga0373924_0048356_22_441 | 139 |
| 570 | 3300035692 | Ga0373935_0000520 | Ga0373935_0000520_8350_8769 | 139 |
| 571 | 3300035695 | Ga0373927_0000046 | Ga0373927_0000046_53650_54069 | 139 |
| 572 | 3300035725 | Ga0373947_0001392 | Ga0373947_0001392_3309_3728 | 139 |
| 573 | 3300036401 | Ga0373937_0048844 | Ga0373937_0048844_993_1412 | 139 |
| 574 | 3300037068 | Ga0373925_0009905 | Ga0373925_0009905_979_1398 | 139 |
| 575 | 3300037471 | Ga0395905_0860914 | Ga0395905_0860914_372_791 | 139 |
| 576 | 3300039437 | Ga0436365_0939911 | Ga0436365_0939911_361_786 | 139 |
| 577 | 3300039453 | Ga0436362_1153757 | Ga0436362_1153757_67_489 | 139 |
| 578 | 3300041453 | Ga0451797_1560878 | Ga0451797_1560878_13_432 | 139 |
| 579 | 3300041459 | Ga0451800_1224866 | Ga0451800_1224866_195_614 | 139 |
| 580 | 3300041507 | Ga0451851_0496392 | Ga0451851_0496392_222_641 | 139 |
| 581 | 3300041512 | Ga0451853_1338784 | Ga0451853_1338784_83_502 | 139 |
| 582 | 3300046454 | Ga0495592_0036407 | Ga0495592_0036407_336_755 | 139 |
| 583 | 3300046455 | Ga0495603_0000051 | Ga0495603_0000051_16811_17230 | 139 |
| 584 | 3300046459 | Ga0495629_0000182 | Ga0495629_0000182_44703_45122 | 139 |
| 585 | 3300046461 | Ga0495641_0006374 | Ga0495641_0006374_1407_1826 | 139 |
| 586 | 3300046463 | Ga0495653_0200693 | Ga0495653_0200693_747_1166 | 139 |
| 587 | 3300046472 | Ga0495580_0004021 | Ga0495580_0004021_905_1324 | 139 |
| 588 | 3300046473 | Ga0495582_0000137 | Ga0495582_0000137_33363_33782 | 139 |
| 589 | 3300046473 | Ga0495582_0482908 | Ga0495582_0482908_179_598 | 139 |
| 590 | 3300046475 | Ga0495639_0002873 | Ga0495639_0002873_5772_6191 | 139 |
| 591 | 3300046475 | Ga0495639_0620166 | Ga0495639_0620166_58_477 | 139 |
| 592 | 3300046476 | Ga0495662_0000583 | Ga0495662_0000583_1176_1595 | 139 |
| 593 | 3300046477 | Ga0495664_0009075 | Ga0495664_0009075_2584_3003 | 139 |
| 594 | 3300046499 | Ga0495594_0001833 | Ga0495594_0001833_9615_10034 | 139 |
| 595 | 3300046516 | Ga0495628_0021321 | Ga0495628_0021321_2311_2730 | 139 |
| 596 | 3300046517 | Ga0495630_0002625 | Ga0495630_0002625_11171_11590 | 139 |
| 597 | 3300046523 | Ga0495644_0091283 | Ga0495644_0091283_639_1058 | 139 |
| 598 | 3300046526 | Ga0495666_0391769 | Ga0495666_0391769_108_527 | 139 |
| 599 | 3300046529 | Ga0495652_0037670 | Ga0495652_0037670_1422_1841 | 139 |
| 600 | 3300046531 | Ga0495665_0001239 | Ga0495665_0001239_9450_9869 | 139 |
| 601 | 3300046533 | Ga0495640_0004375 | Ga0495640_0004375_281_700 | 139 |
| 602 | 3300046557 | Ga0495622_0016785 | Ga0495622_0016785_1121_1540 | 139 |
| 603 | 3300046559 | Ga0495667_0011352 | Ga0495667_0011352_527_946 | 139 |
| 604 | 3300046616 | Ga0495668_0029504 | Ga0495668_0029504_1806_2225 | 139 |
| 605 | 3300046642 | Ga0495634_0002221 | Ga0495634_0002221_2604_3023 | 139 |
| 606 | 3300046660 | Ga0495625_0711609 | Ga0495625_0711609_21_440 | 139 |
| 607 | 3300046663 | Ga0495635_0001455 | Ga0495635_0001455_11129_11548 | 139 |
| 608 | 3300046674 | Ga0495588_0046469 | Ga0495588_0046469_1682_2101 | 139 |
| 609 | 3300046675 | Ga0495657_0147798 | Ga0495657_0147798_966_1385 | 139 |
| 610 | 3300046680 | Ga0495646_0048867 | Ga0495646_0048867_1335_1754 | 139 |
| 611 | 3300046681 | Ga0495647_0032438 | Ga0495647_0032438_250_669 | 139 |
| 612 | 3300046684 | Ga0495669_0470253 | Ga0495669_0470253_142_561 | 139 |
| 613 | 3300046689 | Ga0495613_0047965 | Ga0495613_0047965_1430_1849 | 139 |
| 614 | 3300046690 | Ga0495624_0000898 | Ga0495624_0000898_13136_13555 | 139 |
| 615 | 3300046692 | Ga0495671_0165256 | Ga0495671_0165256_268_687 | 139 |
| 616 | 3300046809 | Ga0495600_0113596 | Ga0495600_0113596_469_888 | 139 |
| 617 | 3300047315 | Ga0495581_0007805 | Ga0495581_0007805_2070_2489 | 139 |
| 618 | 3300047315 | Ga0495581_0425001 | Ga0495581_0425001_177_596 | 139 |
| 619 | 3300047319 | Ga0495674_0010092 | Ga0495674_0010092_2495_2914 | 139 |
| 620 | 3300047320 | Ga0495672_0025981 | Ga0495672_0025981_2949_3368 | 139 |
| 621 | 3300047321 | Ga0495676_0127701 | Ga0495676_0127701_720_1139 | 139 |
| 622 | 3300047322 | Ga0495680_0404157 | Ga0495680_0404157_349_768 | 139 |
| 623 | 3300047469 | Ga0495673_0022298 | Ga0495673_0022298_1024_1443 | 139 |
| 624 | 3300047471 | Ga0495684_0045864 | Ga0495684_0045864_2107_2526 | 139 |
| 625 | 3300047673 | Ga0495593_0000469 | Ga0495593_0000469_16081_16500 | 139 |
| 626 | 3300048088 | Ga0495602_0385915 | Ga0495602_0385915_111_530 | 139 |
| 627 | 3300048089 | Ga0495614_0001926 | Ga0495614_0001926_203_622 | 139 |
| 628 | 3300048089 | Ga0495614_0409324 | Ga0495614_0409324_83_502 | 139 |
| 629 | 3300048903 | Ga0496100_0001098 | Ga0496100_0001098_6537_6956 | 139 |
| 630 | 3300048904 | Ga0496101_0011608 | Ga0496101_0011608_2333_2752 | 139 |
| 631 | 3300048905 | Ga0496102_0199985 | Ga0496102_0199985_1033_1452 | 139 |
| 632 | 3300048905 | Ga0496102_0380154 | Ga0496102_0380154_524_943 | 139 |
| 633 | 3300048906 | Ga0496103_0010717 | Ga0496103_0010717_1109_1528 | 139 |
| 634 | 3300048907 | Ga0496104_0037264 | Ga0496104_0037264_3128_3547 | 139 |
| 635 | 3300048907 | Ga0496104_0208151 | Ga0496104_0208151_1366_1785 | 139 |
| 636 | 3300048908 | Ga0496105_0030338 | Ga0496105_0030338_1016_1435 | 139 |
| 637 | 3300048909 | Ga0496106_0026464 | Ga0496106_0026464_1268_1687 | 139 |
| 638 | 3300048910 | Ga0496107_0021497 | Ga0496107_0021497_1231_1650 | 139 |
| 639 | 3300048911 | Ga0496108_0042075 | Ga0496108_0042075_854_1273 | 139 |
| 640 | 3300048912 | Ga0496109_0049778 | Ga0496109_0049778_2350_2769 | 139 |
| 641 | 3300048913 | Ga0496110_0066685 | Ga0496110_0066685_1280_1699 | 139 |
| 642 | 3300048915 | Ga0496112_0023844 | Ga0496112_0023844_2816_3235 | 139 |
| 643 | 3300048916 | Ga0496113_0015425 | Ga0496113_0015425_2198_2617 | 139 |
| 644 | 3300048916 | Ga0496113_1305035 | Ga0496113_1305035_72_491 | 139 |
| 645 | 3300048917 | Ga0496114_0033230 | Ga0496114_0033230_1091_1510 | 139 |
| 646 | 3300048917 | Ga0496114_1533587 | Ga0496114_1533587_120_539 | 139 |
| 647 | 3300048918 | Ga0496115_0017046 | Ga0496115_0017046_2110_2529 | 139 |
| 648 | 3300048918 | Ga0496115_0288059 | Ga0496115_0288059_391_810 | 139 |
| 649 | 3300048921 | Ga0496118_0087129 | Ga0496118_0087129_482_901 | 139 |
| 650 | 3300048922 | Ga0496119_0043743 | Ga0496119_0043743_986_1405 | 139 |
| 651 | 3300048923 | Ga0496120_0012720 | Ga0496120_0012720_3432_3851 | 139 |
| 652 | 3300048925 | Ga0496122_0093188 | Ga0496122_0093188_1059_1535 | 139 |
| 653 | 3300048929 | Ga0496126_0011852 | Ga0496126_0011852_4951_5427 | 139 |
| 654 | 3300048929 | Ga0496126_0262004 | Ga0496126_0262004_786_1205 | 139 |
| 655 | 3300048929 | Ga0496126_1143757 | Ga0496126_1143757_73_492 | 139 |
| 656 | 3300049460 | Ga0495682_0213564 | Ga0495682_0213564_135_554 | 139 |
| 657 | 3300050490 | nmdc:mga03n38_12993_c1 | nmdc:mga03n38_12993_c1_2478_2897 | 139 |
| 658 | 3300050491 | nmdc:mga00v17_86774_c1 | nmdc:mga00v17_86774_c1_149_568 | 139 |
| 659 | 3300050492 | nmdc:mga0yw44_31797_c1 | nmdc:mga0yw44_31797_c1_1961_2380 | 139 |
| 660 | 3300050493 | nmdc:mga0k408_148173_c1 | nmdc:mga0k408_148173_c1_552_971 | 139 |
| 661 | 3300050494 | nmdc:mga06z11_8466_c1 | nmdc:mga06z11_8466_c1_2212_2631 | 139 |
| 662 | 3300050494 | nmdc:mga06z11_93967_c1 | nmdc:mga06z11_93967_c1_384_821 | 139 |
| 663 | 3300050496 | nmdc:mga07m45_190315_c1 | nmdc:mga07m45_190315_c1_474_911 | 139 |
| 664 | 3300050496 | nmdc:mga07m45_54052_c1 | nmdc:mga07m45_54052_c1_1804_2223 | 139 |
| 665 | 3300053077 | Ga0495601_0301790 | Ga0495601_0301790_222_641 | 139 |
| 666 | 3300053078 | Ga0495612_0157977 | Ga0495612_0157977_88_507 | 139 |
| 667 | 3300053083 | Ga0495655_0012324 | Ga0495655_0012324_897_1316 | 139 |
| 668 | 3300053084 | Ga0495595_0031235 | Ga0495595_0031235_147_566 | 139 |
| 669 | 3300053085 | Ga0495619_0187040 | Ga0495619_0187040_754_1173 | 139 |
| 670 | 3300053090 | Ga0500646_0389642 | Ga0500646_0389642_38_457 | 139 |
| 671 | 3300053092 | Ga0500583_0314451 | Ga0500583_0314451_119_538 | 139 |
| 672 | 3300053158 | Ga0500627_0293144 | Ga0500627_0293144_266_685 | 139 |
| 673 | iso_pu_bacteria | 2728368998 | 2728751746 | 139 |
| 674 | iso_pu_bacteria | 8056681323 | 8056685557 | 139 |
| 675 | 3300005439 | Ga0070711_100004982 | Ga0070711_1000049822 | 140 |
| 676 | 3300005985 | Ga0081539_10000848 | Ga0081539_1000084825 | 140 |
| 677 | 3300006163 | Ga0070715_10503674 | Ga0070715_105036741 | 140 |
| 678 | 3300006173 | Ga0070716_100034174 | Ga0070716_1000341743 | 140 |
| 679 | 3300006175 | Ga0070712_100073635 | Ga0070712_1000736352 | 140 |
| 680 | 3300025905 | Ga0207685_10233027 | Ga0207685_102330271 | 140 |
| 681 | 3300025915 | Ga0207693_10009325 | Ga0207693_1000932510 | 140 |
| 682 | 3300025916 | Ga0207663_10025502 | Ga0207663_100255026 | 140 |
| 683 | 3300025934 | Ga0207686_10692655 | Ga0207686_106926551 | 140 |
| 684 | 3300025939 | Ga0207665_10023296 | Ga0207665_100232966 | 140 |
| 685 | 3300025939 | Ga0207665_11424140 | Ga0207665_114241401 | 140 |
| 686 | 3300025940 | Ga0207691_10552016 | Ga0207691_105520162 | 140 |
| 687 | 3300026121 | Ga0207683_11865045 | Ga0207683_118650451 | 140 |
| 688 | 3300028786 | Ga0307517_10000098 | Ga0307517_10000098109 | 140 |
| 689 | 3300035116 | Ga0373945_0075784 | Ga0373945_0075784_456_878 | 140 |
| 690 | 3300035171 | Ga0373946_0176394 | Ga0373946_0176394_39_461 | 140 |
| 691 | 3300035695 | Ga0373927_0039246 | Ga0373927_0039246_1251_1673 | 140 |
| 692 | 3300035725 | Ga0373947_0165966 | Ga0373947_0165966_792_1214 | 140 |
| 693 | 3300037068 | Ga0373925_0013452 | Ga0373925_0013452_4406_4828 | 140 |
| 694 | 3300046683 | Ga0495658_0469737 | Ga0495658_0469737_346_768 | 140 |
| 695 | 3300048903 | Ga0496100_0137249 | Ga0496100_0137249_990_1412 | 140 |
| 696 | 3300048909 | Ga0496106_0500576 | Ga0496106_0500576_100_522 | 140 |
| 697 | 3300048913 | Ga0496110_1657088 | Ga0496110_1657088_36_458 | 140 |
| 698 | 3300002070 | JGI24750J21931_1029154 | JGI24750J21931_10291541 | 141 |
| 699 | 3300003215 | JGI25153J46596_10010032 | JGI25153J46596_100100322 | 141 |
| 700 | 3300003659 | JGI25404J52841_10077133 | JGI25404J52841_100771331 | 141 |
| 701 | 3300005328 | Ga0070676_10179448 | Ga0070676_101794482 | 141 |
| 702 | 3300005330 | Ga0070690_100368152 | Ga0070690_1003681522 | 141 |
| 703 | 3300005334 | Ga0068869_100073753 | Ga0068869_1000737534 | 141 |
| 704 | 3300005334 | Ga0068869_100170574 | Ga0068869_1001705743 | 141 |
| 705 | 3300005334 | Ga0068869_100726511 | Ga0068869_1007265111 | 141 |
| 706 | 3300005334 | Ga0068869_101009791 | Ga0068869_1010097911 | 141 |
| 707 | 3300005337 | Ga0070682_101668905 | Ga0070682_1016689051 | 141 |
| 708 | 3300005338 | Ga0068868_100149026 | Ga0068868_1001490263 | 141 |
| 709 | 3300005338 | Ga0068868_100645846 | Ga0068868_1006458462 | 141 |
| 710 | 3300005340 | Ga0070689_100029472 | Ga0070689_1000294721 | 141 |
| 711 | 3300005347 | Ga0070668_100194020 | Ga0070668_1001940202 | 141 |
| 712 | 3300005347 | Ga0070668_101210569 | Ga0070668_1012105691 | 141 |
| 713 | 3300005353 | Ga0070669_100647603 | Ga0070669_1006476031 | 141 |
| 714 | 3300005354 | Ga0070675_100494369 | Ga0070675_1004943692 | 141 |
| 715 | 3300005354 | Ga0070675_100671313 | Ga0070675_1006713132 | 141 |
| 716 | 3300005356 | Ga0070674_100018587 | Ga0070674_1000185876 | 141 |
| 717 | 3300005364 | Ga0070673_101609494 | Ga0070673_1016094941 | 141 |
| 718 | 3300005365 | Ga0070688_100332304 | Ga0070688_1003323041 | 141 |
| 719 | 3300005365 | Ga0070688_100379429 | Ga0070688_1003794291 | 141 |
| 720 | 3300005366 | Ga0070659_100890205 | Ga0070659_1008902051 | 141 |
| 721 | 3300005367 | Ga0070667_100171236 | Ga0070667_1001712363 | 141 |
| 722 | 3300005438 | Ga0070701_10812765 | Ga0070701_108127651 | 141 |
| 723 | 3300005441 | Ga0070700_100015418 | Ga0070700_1000154185 | 141 |
| 724 | 3300005455 | Ga0070663_100073751 | Ga0070663_1000737514 | 141 |
| 725 | 3300005455 | Ga0070663_100089274 | Ga0070663_1000892742 | 141 |
| 726 | 3300005456 | Ga0070678_100160527 | Ga0070678_1001605272 | 141 |
| 727 | 3300005456 | Ga0070678_100700049 | Ga0070678_1007000491 | 141 |
| 728 | 3300005457 | Ga0070662_100100370 | Ga0070662_1001003703 | 141 |
| 729 | 3300005457 | Ga0070662_100145701 | Ga0070662_1001457012 | 141 |
| 730 | 3300005459 | Ga0068867_100077329 | Ga0068867_1000773292 | 141 |
| 731 | 3300005471 | Ga0070698_100028998 | Ga0070698_1000289982 | 141 |
| 732 | 3300005518 | Ga0070699_100633627 | Ga0070699_1006336271 | 141 |
| 733 | 3300005536 | Ga0070697_101292512 | Ga0070697_1012925121 | 141 |
| 734 | 3300005539 | Ga0068853_100432519 | Ga0068853_1004325192 | 141 |
| 735 | 3300005543 | Ga0070672_100036650 | Ga0070672_1000366507 | 141 |
| 736 | 3300005544 | Ga0070686_100061402 | Ga0070686_1000614024 | 141 |
| 737 | 3300005548 | Ga0070665_100030279 | Ga0070665_1000302796 | 141 |
| 738 | 3300005548 | Ga0070665_100062009 | Ga0070665_1000620094 | 141 |
| 739 | 3300005548 | Ga0070665_100154541 | Ga0070665_1001545412 | 141 |
| 740 | 3300005548 | Ga0070665_100176827 | Ga0070665_1001768272 | 141 |
| 741 | 3300005548 | Ga0070665_100475717 | Ga0070665_1004757172 | 141 |
| 742 | 3300005548 | Ga0070665_100602714 | Ga0070665_1006027142 | 141 |
| 743 | 3300005548 | Ga0070665_101315473 | Ga0070665_1013154732 | 141 |
| 744 | 3300005563 | Ga0068855_100173800 | Ga0068855_1001738002 | 141 |
| 745 | 3300005578 | Ga0068854_100515802 | Ga0068854_1005158022 | 141 |
| 746 | 3300005578 | Ga0068854_100557659 | Ga0068854_1005576591 | 141 |
| 747 | 3300005614 | Ga0068856_100252283 | Ga0068856_1002522833 | 141 |
| 748 | 3300005614 | Ga0068856_100446153 | Ga0068856_1004461532 | 141 |
| 749 | 3300005615 | Ga0070702_100030788 | Ga0070702_1000307881 | 141 |
| 750 | 3300005615 | Ga0070702_100256668 | Ga0070702_1002566683 | 141 |
| 751 | 3300005617 | Ga0068859_100029233 | Ga0068859_1000292333 | 141 |
| 752 | 3300005617 | Ga0068859_100157976 | Ga0068859_1001579763 | 141 |
| 753 | 3300005618 | Ga0068864_100031862 | Ga0068864_1000318627 | 141 |
| 754 | 3300005618 | Ga0068864_101871951 | Ga0068864_1018719512 | 141 |
| 755 | 3300005718 | Ga0068866_10037646 | Ga0068866_100376462 | 141 |
| 756 | 3300005719 | Ga0068861_100258607 | Ga0068861_1002586072 | 141 |
| 757 | 3300005719 | Ga0068861_101750191 | Ga0068861_1017501911 | 141 |
| 758 | 3300005840 | Ga0068870_10624676 | Ga0068870_106246761 | 141 |
| 759 | 3300005841 | Ga0068863_100276087 | Ga0068863_1002760872 | 141 |
| 760 | 3300005842 | Ga0068858_100060155 | Ga0068858_1000601552 | 141 |
| 761 | 3300005842 | Ga0068858_100266626 | Ga0068858_1002666263 | 141 |
| 762 | 3300005843 | Ga0068860_100247013 | Ga0068860_1002470133 | 141 |
| 763 | 3300005843 | Ga0068860_100270075 | Ga0068860_1002700752 | 141 |
| 764 | 3300005844 | Ga0068862_100085066 | Ga0068862_1000850662 | 141 |
| 765 | 3300005844 | Ga0068862_100170988 | Ga0068862_1001709882 | 141 |
| 766 | 3300005844 | Ga0068862_100228976 | Ga0068862_1002289762 | 141 |
| 767 | 3300005844 | Ga0068862_100315519 | Ga0068862_1003155193 | 141 |
| 768 | 3300005937 | Ga0081455_10029662 | Ga0081455_100296625 | 141 |
| 769 | 3300005937 | Ga0081455_10109650 | Ga0081455_101096502 | 141 |
| 770 | 3300005983 | Ga0081540_1007193 | Ga0081540_10071938 | 141 |
| 771 | 3300005983 | Ga0081540_1007993 | Ga0081540_10079936 | 141 |
| 772 | 3300005983 | Ga0081540_1016547 | Ga0081540_10165475 | 141 |
| 773 | 3300005983 | Ga0081540_1116499 | Ga0081540_11164992 | 141 |
| 774 | 3300005985 | Ga0081539_10012348 | Ga0081539_100123489 | 141 |
| 775 | 3300006038 | Ga0075365_10041163 | Ga0075365_100411634 | 141 |
| 776 | 3300006038 | Ga0075365_10082863 | Ga0075365_100828632 | 141 |
| 777 | 3300006038 | Ga0075365_10728030 | Ga0075365_107280301 | 141 |
| 778 | 3300006042 | Ga0075368_10003948 | Ga0075368_100039482 | 141 |
| 779 | 3300006048 | Ga0075363_100155479 | Ga0075363_1001554792 | 141 |
| 780 | 3300006048 | Ga0075363_100418580 | Ga0075363_1004185802 | 141 |
| 781 | 3300006051 | Ga0075364_10058712 | Ga0075364_100587123 | 141 |
| 782 | 3300006177 | Ga0075362_10086410 | Ga0075362_100864102 | 141 |
| 783 | 3300006178 | Ga0075367_10075171 | Ga0075367_100751714 | 141 |
| 784 | 3300006178 | Ga0075367_10136379 | Ga0075367_101363793 | 141 |
| 785 | 3300006186 | Ga0075369_10239910 | Ga0075369_102399102 | 141 |
| 786 | 3300006195 | Ga0075366_10024888 | Ga0075366_100248884 | 141 |
| 787 | 3300006195 | Ga0075366_10032034 | Ga0075366_100320343 | 141 |
| 788 | 3300006195 | Ga0075366_10483993 | Ga0075366_104839931 | 141 |
| 789 | 3300006195 | Ga0075366_10551633 | Ga0075366_105516331 | 141 |
| 790 | 3300006195 | Ga0075366_10637687 | Ga0075366_106376871 | 141 |
| 791 | 3300006237 | Ga0097621_100647048 | Ga0097621_1006470482 | 141 |
| 792 | 3300006353 | Ga0075370_10138407 | Ga0075370_101384071 | 141 |
| 793 | 3300006358 | Ga0068871_100104460 | Ga0068871_1001044603 | 141 |
| 794 | 3300006358 | Ga0068871_101681277 | Ga0068871_1016812771 | 141 |
| 795 | 3300006844 | Ga0075428_100157112 | Ga0075428_1001571126 | 141 |
| 796 | 3300006871 | Ga0075434_100444533 | Ga0075434_1004445332 | 141 |
| 797 | 3300006881 | Ga0068865_100109505 | Ga0068865_1001095054 | 141 |
| 798 | 3300006881 | Ga0068865_100849440 | Ga0068865_1008494402 | 141 |
| 799 | 3300006881 | Ga0068865_101658442 | Ga0068865_1016584422 | 141 |
| 800 | 3300006914 | Ga0075436_100624736 | Ga0075436_1006247361 | 141 |
| 801 | 3300006931 | Ga0097620_100029232 | Ga0097620_1000292323 | 141 |
| 802 | 3300006931 | Ga0097620_100157985 | Ga0097620_1001579853 | 141 |
| 803 | 3300007076 | Ga0075435_100341705 | Ga0075435_1003417053 | 141 |
| 804 | 3300009094 | Ga0111539_11000866 | Ga0111539_110008662 | 141 |
| 805 | 3300009098 | Ga0105245_10060551 | Ga0105245_100605514 | 141 |
| 806 | 3300009148 | Ga0105243_10702884 | Ga0105243_107028843 | 141 |
| 807 | 3300009148 | Ga0105243_10737151 | Ga0105243_107371512 | 141 |
| 808 | 3300009174 | Ga0105241_10012915 | Ga0105241_100129157 | 141 |
| 809 | 3300009176 | Ga0105242_10035582 | Ga0105242_100355826 | 141 |
| 810 | 3300009545 | Ga0105237_10018023 | Ga0105237_1001802310 | 141 |
| 811 | 3300009545 | Ga0105237_10448755 | Ga0105237_104487552 | 141 |
| 812 | 3300009553 | Ga0105249_10513667 | Ga0105249_105136672 | 141 |
| 813 | 3300009553 | Ga0105249_10910747 | Ga0105249_109107472 | 141 |
| 814 | 3300010375 | Ga0105239_10741915 | Ga0105239_107419152 | 141 |
| 815 | 3300010375 | Ga0105239_11142778 | Ga0105239_111427782 | 141 |
| 816 | 3300011119 | Ga0105246_10085714 | Ga0105246_100857142 | 141 |
| 817 | 3300011119 | Ga0105246_10199271 | Ga0105246_101992713 | 141 |
| 818 | 3300011119 | Ga0105246_10233447 | Ga0105246_102334471 | 141 |
| 819 | 3300011119 | Ga0105246_10783537 | Ga0105246_107835371 | 141 |
| 820 | 3300011119 | Ga0105246_10839555 | Ga0105246_108395551 | 141 |
| 821 | 3300013296 | Ga0157374_10066182 | Ga0157374_100661824 | 141 |
| 822 | 3300013296 | Ga0157374_10388075 | Ga0157374_103880751 | 141 |
| 823 | 3300013296 | Ga0157374_12404282 | Ga0157374_124042821 | 141 |
| 824 | 3300013297 | Ga0157378_10547367 | Ga0157378_105473671 | 141 |
| 825 | 3300013306 | Ga0163162_10129391 | Ga0163162_101293912 | 141 |
| 826 | 3300013306 | Ga0163162_11179575 | Ga0163162_111795751 | 141 |
| 827 | 3300013307 | Ga0157372_10494544 | Ga0157372_104945442 | 141 |
| 828 | 3300013308 | Ga0157375_10154583 | Ga0157375_101545832 | 141 |
| 829 | 3300013308 | Ga0157375_10174992 | Ga0157375_101749923 | 141 |
| 830 | 3300013308 | Ga0157375_10227133 | Ga0157375_102271333 | 141 |
| 831 | 3300014326 | Ga0157380_10109465 | Ga0157380_101094652 | 141 |
| 832 | 3300014326 | Ga0157380_10157219 | Ga0157380_101572192 | 141 |
| 833 | 3300014745 | Ga0157377_10686845 | Ga0157377_106868451 | 141 |
| 834 | 3300014968 | Ga0157379_10344996 | Ga0157379_103449962 | 141 |
| 835 | 3300014969 | Ga0157376_10555669 | Ga0157376_105556692 | 141 |
| 836 | 3300017792 | Ga0163161_10088848 | Ga0163161_100888483 | 141 |
| 837 | 3300017792 | Ga0163161_11198956 | Ga0163161_111989561 | 141 |
| 838 | 3300025297 | Ga0209758_1005478 | Ga0209758_10054785 | 141 |
| 839 | 3300025315 | Ga0207697_10216603 | Ga0207697_102166032 | 141 |
| 840 | 3300025315 | Ga0207697_10443720 | Ga0207697_104437201 | 141 |
| 841 | 3300025899 | Ga0207642_10020324 | Ga0207642_100203242 | 141 |
| 842 | 3300025899 | Ga0207642_10396173 | Ga0207642_103961731 | 141 |
| 843 | 3300025899 | Ga0207642_10469724 | Ga0207642_104697242 | 141 |
| 844 | 3300025901 | Ga0207688_10019383 | Ga0207688_100193832 | 141 |
| 845 | 3300025901 | Ga0207688_10089460 | Ga0207688_100894603 | 141 |
| 846 | 3300025903 | Ga0207680_10163305 | Ga0207680_101633053 | 141 |
| 847 | 3300025903 | Ga0207680_10169761 | Ga0207680_101697611 | 141 |
| 848 | 3300025907 | Ga0207645_10092170 | Ga0207645_100921703 | 141 |
| 849 | 3300025907 | Ga0207645_10184660 | Ga0207645_101846602 | 141 |
| 850 | 3300025911 | Ga0207654_10014746 | Ga0207654_100147463 | 141 |
| 851 | 3300025912 | Ga0207707_11354883 | Ga0207707_113548831 | 141 |
| 852 | 3300025914 | Ga0207671_10083323 | Ga0207671_100833234 | 141 |
| 853 | 3300025914 | Ga0207671_10119378 | Ga0207671_101193784 | 141 |
| 854 | 3300025919 | Ga0207657_10166797 | Ga0207657_101667972 | 141 |
| 855 | 3300025923 | Ga0207681_10901979 | Ga0207681_109019792 | 141 |
| 856 | 3300025923 | Ga0207681_11009395 | Ga0207681_110093951 | 141 |
| 857 | 3300025924 | Ga0207694_10122221 | Ga0207694_101222212 | 141 |
| 858 | 3300025926 | Ga0207659_10220386 | Ga0207659_102203862 | 141 |
| 859 | 3300025927 | Ga0207687_10299895 | Ga0207687_102998952 | 141 |
| 860 | 3300025927 | Ga0207687_10691934 | Ga0207687_106919341 | 141 |
| 861 | 3300025931 | Ga0207644_10516522 | Ga0207644_105165221 | 141 |
| 862 | 3300025932 | Ga0207690_10268274 | Ga0207690_102682741 | 141 |
| 863 | 3300025932 | Ga0207690_11222132 | Ga0207690_112221321 | 141 |
| 864 | 3300025933 | Ga0207706_10020636 | Ga0207706_100206366 | 141 |
| 865 | 3300025933 | Ga0207706_10465884 | Ga0207706_104658842 | 141 |
| 866 | 3300025934 | Ga0207686_10170721 | Ga0207686_101707212 | 141 |
| 867 | 3300025934 | Ga0207686_10256367 | Ga0207686_102563673 | 141 |
| 868 | 3300025935 | Ga0207709_10041130 | Ga0207709_100411303 | 141 |
| 869 | 3300025935 | Ga0207709_11616757 | Ga0207709_116167571 | 141 |
| 870 | 3300025936 | Ga0207670_10039211 | Ga0207670_100392115 | 141 |
| 871 | 3300025937 | Ga0207669_10007035 | Ga0207669_100070354 | 141 |
| 872 | 3300025938 | Ga0207704_10062027 | Ga0207704_100620272 | 141 |
| 873 | 3300025940 | Ga0207691_10103322 | Ga0207691_101033224 | 141 |
| 874 | 3300025941 | Ga0207711_10316425 | Ga0207711_103164252 | 141 |
| 875 | 3300025942 | Ga0207689_10391727 | Ga0207689_103917272 | 141 |
| 876 | 3300025942 | Ga0207689_10443619 | Ga0207689_104436192 | 141 |
| 877 | 3300025942 | Ga0207689_10627672 | Ga0207689_106276722 | 141 |
| 878 | 3300025942 | Ga0207689_11080396 | Ga0207689_110803961 | 141 |
| 879 | 3300025945 | Ga0207679_10318278 | Ga0207679_103182782 | 141 |
| 880 | 3300025949 | Ga0207667_12040882 | Ga0207667_120408821 | 141 |
| 881 | 3300025972 | Ga0207668_10008217 | Ga0207668_100082174 | 141 |
| 882 | 3300025972 | Ga0207668_10173030 | Ga0207668_101730303 | 141 |
| 883 | 3300025972 | Ga0207668_10683879 | Ga0207668_106838792 | 141 |
| 884 | 3300025981 | Ga0207640_10048550 | Ga0207640_100485503 | 141 |
| 885 | 3300025981 | Ga0207640_10123950 | Ga0207640_101239502 | 141 |
| 886 | 3300025986 | Ga0207658_10075824 | Ga0207658_100758245 | 141 |
| 887 | 3300025986 | Ga0207658_10180619 | Ga0207658_101806193 | 141 |
| 888 | 3300025986 | Ga0207658_10554862 | Ga0207658_105548621 | 141 |
| 889 | 3300025986 | Ga0207658_11253074 | Ga0207658_112530741 | 141 |
| 890 | 3300026023 | Ga0207677_10234842 | Ga0207677_102348421 | 141 |
| 891 | 3300026023 | Ga0207677_10527442 | Ga0207677_105274421 | 141 |
| 892 | 3300026023 | Ga0207677_10535789 | Ga0207677_105357892 | 141 |
| 893 | 3300026035 | Ga0207703_10193232 | Ga0207703_101932321 | 141 |
| 894 | 3300026041 | Ga0207639_10167178 | Ga0207639_101671782 | 141 |
| 895 | 3300026067 | Ga0207678_10060134 | Ga0207678_100601343 | 141 |
| 896 | 3300026067 | Ga0207678_10089469 | Ga0207678_100894693 | 141 |
| 897 | 3300026067 | Ga0207678_10123758 | Ga0207678_101237583 | 141 |
| 898 | 3300026067 | Ga0207678_10227790 | Ga0207678_102277902 | 141 |
| 899 | 3300026075 | Ga0207708_10049842 | Ga0207708_100498423 | 141 |
| 900 | 3300026088 | Ga0207641_10365347 | Ga0207641_103653472 | 141 |
| 901 | 3300026088 | Ga0207641_10951971 | Ga0207641_109519712 | 141 |
| 902 | 3300026089 | Ga0207648_10097170 | Ga0207648_100971702 | 141 |
| 903 | 3300026089 | Ga0207648_10293405 | Ga0207648_102934053 | 141 |
| 904 | 3300026095 | Ga0207676_10894876 | Ga0207676_108948762 | 141 |
| 905 | 3300026116 | Ga0207674_10309414 | Ga0207674_103094142 | 141 |
| 906 | 3300026118 | Ga0207675_100049241 | Ga0207675_1000492413 | 141 |
| 907 | 3300026118 | Ga0207675_100126297 | Ga0207675_1001262975 | 141 |
| 908 | 3300026121 | Ga0207683_10051305 | Ga0207683_100513055 | 141 |
| 909 | 3300026121 | Ga0207683_10060366 | Ga0207683_100603664 | 141 |
| 910 | 3300026121 | Ga0207683_10212381 | Ga0207683_102123812 | 141 |
| 911 | 3300026121 | Ga0207683_10972293 | Ga0207683_109722931 | 141 |
| 912 | 3300027907 | Ga0207428_10368040 | Ga0207428_103680402 | 141 |
| 913 | 3300027907 | Ga0207428_10923875 | Ga0207428_109238751 | 141 |
| 914 | 3300028379 | Ga0268266_10003686 | Ga0268266_1000368617 | 141 |
| 915 | 3300028379 | Ga0268266_10388186 | Ga0268266_103881861 | 141 |
| 916 | 3300028379 | Ga0268266_10731320 | Ga0268266_107313201 | 141 |
| 917 | 3300028379 | Ga0268266_10742093 | Ga0268266_107420932 | 141 |
| 918 | 3300028380 | Ga0268265_10124640 | Ga0268265_101246402 | 141 |
| 919 | 3300028380 | Ga0268265_10192550 | Ga0268265_101925503 | 141 |
| 920 | 3300028380 | Ga0268265_10198444 | Ga0268265_101984442 | 141 |
| 921 | 3300028380 | Ga0268265_10480048 | Ga0268265_104800481 | 141 |
| 922 | 3300028381 | Ga0268264_10192667 | Ga0268264_101926672 | 141 |
| 923 | 3300028786 | Ga0307517_10111579 | Ga0307517_101115792 | 141 |
| 924 | 3300031507 | Ga0307509_10128015 | Ga0307509_101280152 | 141 |
| 925 | 3300031548 | Ga0307408_100232397 | Ga0307408_1002323972 | 141 |
| 926 | 3300031731 | Ga0307405_10505101 | Ga0307405_105051012 | 141 |
| 927 | 3300031824 | Ga0307413_10171007 | Ga0307413_101710072 | 141 |
| 928 | 3300031824 | Ga0307413_11473637 | Ga0307413_114736371 | 141 |
| 929 | 3300031852 | Ga0307410_11425331 | Ga0307410_114253311 | 141 |
| 930 | 3300031903 | Ga0307407_10761295 | Ga0307407_107612951 | 141 |
| 931 | 3300031911 | Ga0307412_10401698 | Ga0307412_104016982 | 141 |
| 932 | 3300031995 | Ga0307409_100546889 | Ga0307409_1005468892 | 141 |
| 933 | 3300032002 | Ga0307416_101218302 | Ga0307416_1012183022 | 141 |
| 934 | 3300032004 | Ga0307414_11399194 | Ga0307414_113991941 | 141 |
| 935 | 3300032005 | Ga0307411_10076739 | Ga0307411_100767394 | 141 |
| 936 | 3300032005 | Ga0307411_10843113 | Ga0307411_108431131 | 141 |
| 937 | 3300032126 | Ga0307415_100297967 | Ga0307415_1002979672 | 141 |
| 938 | 3300033179 | Ga0307507_10560606 | Ga0307507_105606062 | 141 |
| 939 | 3300033180 | Ga0307510_10007562 | Ga0307510_1000756213 | 141 |
| 940 | 3300041411 | Ga0439466_0205551 | Ga0439466_0205551_85_510 | 141 |
| 941 | 3300041413 | Ga0439465_0093118 | Ga0439465_0093118_16_450 | 141 |
| 942 | 3300041441 | Ga0451787_184996 | Ga0451787_184996_58_483 | 141 |
| 943 | 3300041452 | Ga0451793_0362601 | Ga0451793_0362601_92_517 | 141 |
| 944 | 3300041507 | Ga0451851_1102993 | Ga0451851_1102993_16_447 | 141 |
| 945 | 3300046452 | Ga0495617_231405 | Ga0495617_231405_34_459 | 141 |
| 946 | 3300046455 | Ga0495603_0074854 | Ga0495603_0074854_700_1125 | 141 |
| 947 | 3300046460 | Ga0495638_0021430 | Ga0495638_0021430_2312_2737 | 141 |
| 948 | 3300046460 | Ga0495638_0139137 | Ga0495638_0139137_635_1060 | 141 |
| 949 | 3300046460 | Ga0495638_0526218 | Ga0495638_0526218_112_537 | 141 |
| 950 | 3300046460 | Ga0495638_0526497 | Ga0495638_0526497_108_533 | 141 |
| 951 | 3300046474 | Ga0495605_0227921 | Ga0495605_0227921_28_453 | 141 |
| 952 | 3300046492 | Ga0495585_0029073 | Ga0495585_0029073_2144_2569 | 141 |
| 953 | 3300046499 | Ga0495594_0042613 | Ga0495594_0042613_2042_2467 | 141 |
| 954 | 3300046500 | Ga0495596_0063639 | Ga0495596_0063639_624_1049 | 141 |
| 955 | 3300046506 | Ga0495583_0025223 | Ga0495583_0025223_1449_1922 | 141 |
| 956 | 3300046507 | Ga0495606_0119588 | Ga0495606_0119588_474_947 | 141 |
| 957 | 3300046507 | Ga0495606_0444146 | Ga0495606_0444146_194_619 | 141 |
| 958 | 3300046512 | Ga0495610_0100069 | Ga0495610_0100069_363_836 | 141 |
| 959 | 3300046513 | Ga0495616_0162322 | Ga0495616_0162322_199_624 | 141 |
| 960 | 3300046515 | Ga0495620_0159318 | Ga0495620_0159318_179_604 | 141 |
| 961 | 3300046515 | Ga0495620_0169679 | Ga0495620_0169679_331_756 | 141 |
| 962 | 3300046518 | Ga0495631_0015803 | Ga0495631_0015803_2770_3195 | 141 |
| 963 | 3300046519 | Ga0495632_0055923 | Ga0495632_0055923_1246_1671 | 141 |
| 964 | 3300046519 | Ga0495632_0138876 | Ga0495632_0138876_360_785 | 141 |
| 965 | 3300046519 | Ga0495632_0148961 | Ga0495632_0148961_89_514 | 141 |
| 966 | 3300046519 | Ga0495632_0294698 | Ga0495632_0294698_15_440 | 141 |
| 967 | 3300046522 | Ga0495643_0074090 | Ga0495643_0074090_896_1321 | 141 |
| 968 | 3300046525 | Ga0495663_0064127 | Ga0495663_0064127_335_760 | 141 |
| 969 | 3300046542 | Ga0495597_0051282 | Ga0495597_0051282_93_518 | 141 |
| 970 | 3300046558 | Ga0495633_0109329 | Ga0495633_0109329_818_1243 | 141 |
| 971 | 3300046558 | Ga0495633_0242170 | Ga0495633_0242170_255_680 | 141 |
| 972 | 3300046615 | Ga0495656_0016955 | Ga0495656_0016955_68_493 | 141 |
| 973 | 3300046615 | Ga0495656_0214078 | Ga0495656_0214078_100_525 | 141 |
| 974 | 3300046616 | Ga0495668_0026683 | Ga0495668_0026683_1438_1911 | 141 |
| 975 | 3300046616 | Ga0495668_0029734 | Ga0495668_0029734_1376_1801 | 141 |
| 976 | 3300046616 | Ga0495668_0052320 | Ga0495668_0052320_1292_1717 | 141 |
| 977 | 3300046660 | Ga0495625_0058534 | Ga0495625_0058534_906_1331 | 141 |
| 978 | 3300046660 | Ga0495625_0094413 | Ga0495625_0094413_930_1355 | 141 |
| 979 | 3300046663 | Ga0495635_0978415 | Ga0495635_0978415_94_519 | 141 |
| 980 | 3300046664 | Ga0495659_0061547 | Ga0495659_0061547_333_758 | 141 |
| 981 | 3300046665 | Ga0495661_0247668 | Ga0495661_0247668_205_630 | 141 |
| 982 | 3300046684 | Ga0495669_0316823 | Ga0495669_0316823_277_702 | 141 |
| 983 | 3300046691 | Ga0495670_0250616 | Ga0495670_0250616_48_473 | 141 |
| 984 | 3300046691 | Ga0495670_0334925 | Ga0495670_0334925_194_619 | 141 |
| 985 | 3300046692 | Ga0495671_0084494 | Ga0495671_0084494_770_1195 | 141 |
| 986 | 3300046692 | Ga0495671_0089738 | Ga0495671_0089738_773_1198 | 141 |
| 987 | 3300046694 | Ga0495649_0097432 | Ga0495649_0097432_341_766 | 141 |
| 988 | 3300046794 | Ga0495589_0103033 | Ga0495589_0103033_48_473 | 141 |
| 989 | 3300047318 | Ga0495636_0097970 | Ga0495636_0097970_632_1057 | 141 |
| 990 | 3300047318 | Ga0495636_0194356 | Ga0495636_0194356_36_461 | 141 |
| 991 | 3300047318 | Ga0495636_0656702 | Ga0495636_0656702_38_463 | 141 |
| 992 | 3300047323 | Ga0495683_0478557 | Ga0495683_0478557_41_466 | 141 |
| 993 | 3300047445 | Ga0495677_0067538 | Ga0495677_0067538_539_964 | 141 |
| 994 | 3300047445 | Ga0495677_0172629 | Ga0495677_0172629_72_497 | 141 |
| 995 | 3300047447 | Ga0495685_140734 | Ga0495685_140734_41_466 | 141 |
| 996 | 3300047469 | Ga0495673_0256112 | Ga0495673_0256112_56_529 | 141 |
| 997 | 3300048090 | Ga0495615_0197116 | Ga0495615_0197116_108_533 | 141 |
| 998 | 3300048904 | Ga0496101_0541375 | Ga0496101_0541375_137_610 | 141 |
| 999 | 3300048904 | Ga0496101_0933369 | Ga0496101_0933369_52_477 | 141 |
| 1000 | 3300048905 | Ga0496102_0008520 | Ga0496102_0008520_6641_7114 | 141 |
| 1001 | 3300048905 | Ga0496102_0153816 | Ga0496102_0153816_751_1176 | 141 |
| 1002 | 3300048905 | Ga0496102_0438380 | Ga0496102_0438380_745_1170 | 141 |
| 1003 | 3300048906 | Ga0496103_0405205 | Ga0496103_0405205_61_486 | 141 |
| 1004 | 3300048907 | Ga0496104_0116018 | Ga0496104_0116018_1970_2395 | 141 |
| 1005 | 3300048907 | Ga0496104_1671737 | Ga0496104_1671737_92_517 | 141 |
| 1006 | 3300048908 | Ga0496105_0286727 | Ga0496105_0286727_798_1271 | 141 |
| 1007 | 3300048909 | Ga0496106_0123661 | Ga0496106_0123661_188_613 | 141 |
| 1008 | 3300048909 | Ga0496106_0396800 | Ga0496106_0396800_602_1027 | 141 |
| 1009 | 3300048909 | Ga0496106_0680497 | Ga0496106_0680497_205_630 | 141 |
| 1010 | 3300048911 | Ga0496108_0196577 | Ga0496108_0196577_1111_1536 | 141 |
| 1011 | 3300048911 | Ga0496108_0540220 | Ga0496108_0540220_111_536 | 141 |
| 1012 | 3300048912 | Ga0496109_0380566 | Ga0496109_0380566_401_826 | 141 |
| 1013 | 3300048913 | Ga0496110_0288249 | Ga0496110_0288249_412_837 | 141 |
| 1014 | 3300048915 | Ga0496112_0353164 | Ga0496112_0353164_150_575 | 141 |
| 1015 | 3300048915 | Ga0496112_0731438 | Ga0496112_0731438_222_695 | 141 |
| 1016 | 3300048916 | Ga0496113_0054139 | Ga0496113_0054139_1466_1939 | 141 |
| 1017 | 3300048921 | Ga0496118_0310668 | Ga0496118_0310668_160_585 | 141 |
| 1018 | 3300048922 | Ga0496119_0046704 | Ga0496119_0046704_1473_1898 | 141 |
| 1019 | 3300048924 | Ga0496121_0267964 | Ga0496121_0267964_658_1083 | 141 |
| 1020 | 3300048924 | Ga0496121_0481239 | Ga0496121_0481239_212_637 | 141 |
| 1021 | 3300048929 | Ga0496126_0444729 | Ga0496126_0444729_251_676 | 141 |
| 1022 | 3300049460 | Ga0495682_0053712 | Ga0495682_0053712_632_1105 | 141 |
| 1023 | 3300049576 | Ga0501040_0715101 | Ga0501040_0715101_238_663 | 141 |
| 1024 | 3300049578 | Ga0501042_0374282 | Ga0501042_0374282_526_951 | 141 |
| 1025 | 3300049583 | Ga0501067_0604891 | Ga0501067_0604891_101_526 | 141 |
| 1026 | 3300050489 | nmdc:mga03683_107519_c1 | nmdc:mga03683_107519_c1_336_761 | 141 |
| 1027 | 3300050491 | nmdc:mga00v17_69660_c1 | nmdc:mga00v17_69660_c1_789_1262 | 141 |
| 1028 | 3300050492 | nmdc:mga0yw44_124038_c1 | nmdc:mga0yw44_124038_c1_961_1386 | 141 |
| 1029 | 3300050492 | nmdc:mga0yw44_5454_c2 | nmdc:mga0yw44_5454_c2_4851_5276 | 141 |
| 1030 | 3300050493 | nmdc:mga0k408_519503_c1 | nmdc:mga0k408_519503_c1_88_513 | 141 |
| 1031 | 3300050493 | nmdc:mga0k408_571476_c1 | nmdc:mga0k408_571476_c1_92_517 | 141 |
| 1032 | 3300050494 | nmdc:mga06z11_199789_c1 | nmdc:mga06z11_199789_c1_493_918 | 141 |
| 1033 | 3300050494 | nmdc:mga06z11_298090_c1 | nmdc:mga06z11_298090_c1_124_549 | 141 |
| 1034 | 3300050496 | nmdc:mga07m45_81713_c1 | nmdc:mga07m45_81713_c1_634_1059 | 141 |
| 1035 | 3300050508 | nmdc:mga09592_265942_c1 | nmdc:mga09592_265942_c1_219_644 | 141 |
| 1036 | 3300050510 | nmdc:mga06r32_893179_c1 | nmdc:mga06r32_893179_c1_98_523 | 141 |
| 1037 | 3300050511 | nmdc:mga08y16_1146190_c1 | nmdc:mga08y16_1146190_c1_46_471 | 141 |
| 1038 | 3300050511 | nmdc:mga08y16_1285024_c1 | nmdc:mga08y16_1285024_c1_164_589 | 141 |
| 1039 | 3300050511 | nmdc:mga08y16_635192_c1 | nmdc:mga08y16_635192_c1_212_637 | 141 |
| 1040 | 3300050512 | nmdc:mga0n895_832353_c1 | nmdc:mga0n895_832353_c1_19_444 | 141 |
| 1041 | 3300050513 | nmdc:mga0rr50_546422_c1 | nmdc:mga0rr50_546422_c1_128_553 | 141 |
| 1042 | 3300050515 | nmdc:mga0a205_695597_c1 | nmdc:mga0a205_695597_c1_65_490 | 141 |
| 1043 | 3300053092 | Ga0500583_0108192 | Ga0500583_0108192_548_973 | 141 |
| 1044 | 3300053096 | Ga0500641_0341232 | Ga0500641_0341232_139_564 | 141 |
| 1045 | 3300053109 | Ga0500569_018952 | Ga0500569_018952_1049_1474 | 141 |
| 1046 | 3300053118 | Ga0500594_0047298 | Ga0500594_0047298_201_647 | 141 |
| 1047 | 3300053134 | Ga0500658_0143484 | Ga0500658_0143484_176_601 | 141 |
| 1048 | 3300053137 | Ga0500561_0058078 | Ga0500561_0058078_534_959 | 141 |
| 1049 | 3300053148 | Ga0500590_096457 | Ga0500590_096457_969_1394 | 141 |
| 1050 | 3300053158 | Ga0500627_0078704 | Ga0500627_0078704_280_705 | 141 |
| 1051 | 3300053161 | Ga0500634_0113939 | Ga0500634_0113939_850_1275 | 141 |
| 1052 | 3300053730 | Ga0500645_161204 | Ga0500645_161204_108_533 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zyf-assembly2.cif.gz_C | crystal structure of streptococcus pyogenes type ii-a cas2 | 0.6766 | 2 | 117 |
| 3exc-assembly1.cif.gz_X-2 | structure of the rna'se sso8090 from sulfolobus solfataricus | 0.6616 | 1 | 113 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.6369 | 1 | 114 |
| 5zyf-assembly3.cif.gz_F | crystal structure of streptococcus pyogenes type ii-a cas2 | 0.6278 | 2 | 117 |
| 3zo7-assembly1.cif.gz_E | crystal structure of clcfe27a with substrate | 0.6131 | 1 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6369 | 1 | 114 | 3.30.70.1060 |
| 4tnoA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6346 | 1 | 113 | 3.30.70.240 |
| 4tnoA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6277 | 1 | 113 | 3.30.70.240 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.621 | 1 | 114 | 3.30.70.1060 |
| af_Q1LYG6_500_570_3.30.70.870 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 | 0.5972 | 1 | 112 | 3.30.70.870 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1B6H1-F1-model_v4 | YciI family protein | 0.7527 | 1 | 126 |
|
| AF-A0A503WCB3-F1-model_v4 | YciI family protein | 0.7526 | 1 | 129 |
|
| AF-X6EJ73-F1-model_v4 | deleted | 0.7492 | 1 | 132 |
|
| AF-A0A0F6YML2-F1-model_v4 | PhnB protein | 0.7471 | 1 | 125 |
|
| AF-A0A4Q1UNU8-F1-model_v4 | Transcription initiation protein | 0.7456 | 1 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar