F489116

General Info

Members Datasets Scaffolds Average Seq Length
1053 407 2106 91

Family's Representative Sequence

Representative Sequence 3300049775|Ga0501279_009432|Ga0501279_009432_285_569
Length 94
Sequence MCRNIRTLFNFDPPATEYEVTAAAVQFVRKLSGFNTPSKANEEVFQQAVEKLLDSLVTNAQPRNRELEQERARARSIKRFGTPNKLSVLDEDEE

Samples

Sample ID Description Type Environment
1 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
125 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
126 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
226 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
227 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
252 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
253 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
254 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
255 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
256 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
257 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
258 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
267 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
277 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
278 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
284 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
285 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
286 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
287 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
288 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
289 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
290 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
291 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
292 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
293 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
294 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
295 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
296 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
297 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
298 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
306 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
307 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
308 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
309 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
310 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
311 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
374 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
375 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
398 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
399 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
400 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
403 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
404 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
407 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.38
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 3.89
Rhizosphere 92.88
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501279_009432 3300049775 Bacteria 1306
2 SwRhRL2b_contig_3114430 2162886007 Bacteria 1043
3 MBSR1b_contig_213173 2162886012 Bacteria 2717
4 2214745541 2209111006 Bacteria 923
5 JGI24752J21851_1000874 3300001976 Unclassified 4086
6 JGI24747J21853_1026031 3300001978 Unclassified 654
7 JGI24743J22301_10002207 3300001991 Unclassified 2887
8 JGI24749J21850_1024517 3300002076 Unclassified 859
9 JGI24751J29686_10002073 3300002459 Unclassified 4066
10 rootH2_10268713 3300003320 Bacteria 2000
11 Ga0065716_1008099 3300005277 Bacteria 724
12 Ga0065704_10091348 3300005289 Bacteria 2723
13 Ga0065712_10073464 3300005290 Bacteria 4383
14 Ga0065712_10092751 3300005290 Bacteria 2281
15 Ga0065707_10232856 3300005295 Bacteria 1182
16 Ga0065707_11023869 3300005295 Unclassified 533
17 Ga0070658_10043754 3300005327 Unclassified 3617
18 Ga0070658_10134230 3300005327 Bacteria 2064
19 Ga0070658_10382133 3300005327 Bacteria 1208
20 Ga0070676_10017142 3300005328 Unclassified 4007
21 Ga0070676_10081741 3300005328 Bacteria 1961
22 Ga0070676_10373200 3300005328 Unclassified 986
23 Ga0070676_10375048 3300005328 Bacteria 984
24 Ga0070676_10871519 3300005328 Bacteria 669
25 Ga0070676_11332059 3300005328 Bacteria 549
26 Ga0070683_100007960 3300005329 Bacteria 8992
27 Ga0070690_100011015 3300005330 Bacteria 5281
28 Ga0070670_100023522 3300005331 Bacteria 5304
29 Ga0070670_100241064 3300005331 Bacteria 1574
30 Ga0070677_10003984 3300005333 Bacteria 4802
31 Ga0068869_100020514 3300005334 Unclassified 4532
32 Ga0068869_101085977 3300005334 Unclassified 700
33 Ga0070666_10028805 3300005335 Unclassified 3647
34 Ga0070666_10838585 3300005335 Bacteria 678
35 Ga0070680_100733016 3300005336 Bacteria 851
36 Ga0070680_100849585 3300005336 Bacteria 787
37 Ga0070682_100011962 3300005337 Unclassified 4965
38 Ga0070682_100168622 3300005337 Bacteria 1519
39 Ga0068868_100016343 3300005338 Bacteria 5511
40 Ga0070660_100002895 3300005339 Bacteria 11811
41 Ga0070660_100706381 3300005339 Bacteria 845
42 Ga0070689_100006913 3300005340 Bacteria 7897
43 Ga0070689_100953636 3300005340 Bacteria 761
44 Ga0070689_101057780 3300005340 Unclassified 724
45 Ga0070687_100004408 3300005343 Bacteria 5608
46 Ga0070687_100109582 3300005343 Bacteria 1560
47 Ga0070687_100390064 3300005343 Bacteria 910
48 Ga0070687_101249704 3300005343 Unclassified 549
49 Ga0070661_100004075 3300005344 Bacteria 10063
50 Ga0070661_100315941 3300005344 Bacteria 1219
51 Ga0070661_100535864 3300005344 Unclassified 941
52 Ga0070692_10530496 3300005345 Bacteria 768
53 Ga0070668_100094026 3300005347 Bacteria 2366
54 Ga0070668_100334067 3300005347 Bacteria 1279
55 Ga0070668_100931438 3300005347 Bacteria 778
56 Ga0070669_100002890 3300005353 Bacteria 12381
57 Ga0070669_100026301 3300005353 Unclassified 4186
58 Ga0070669_100129044 3300005353 Bacteria 1937
59 Ga0070669_100236679 3300005353 Bacteria 1449
60 Ga0070675_100010735 3300005354 Bacteria 7165
61 Ga0070675_101070019 3300005354 Bacteria 741
62 Ga0070671_101684216 3300005355 Bacteria 563
63 Ga0070674_100038787 3300005356 Unclassified 3213
64 Ga0070674_100082463 3300005356 Bacteria 2300
65 Ga0070673_100015210 3300005364 Bacteria 5396
66 Ga0070673_100446584 3300005364 Bacteria 1163
67 Ga0070673_101179954 3300005364 Bacteria 717
68 Ga0070688_100005040 3300005365 Bacteria 6918
69 Ga0070659_100009071 3300005366 Bacteria 7298
70 Ga0070667_100082363 3300005367 Bacteria 2755
71 Ga0070667_100094629 3300005367 Bacteria 2574
72 Ga0070667_101148949 3300005367 Bacteria 726
73 Ga0070703_10111984 3300005406 Bacteria 978
74 Ga0070709_10893696 3300005434 Bacteria 702
75 Ga0070714_101637851 3300005435 Bacteria 629
76 Ga0070714_102171047 3300005435 Unclassified 541
77 Ga0070701_10077572 3300005438 Bacteria 1791
78 Ga0070701_10243899 3300005438 Bacteria 1082
79 Ga0070701_10723674 3300005438 Unclassified 672
80 Ga0070711_100000051 3300005439 Bacteria 73775
81 Ga0070711_101221468 3300005439 Unclassified 651
82 Ga0070705_100030846 3300005440 Bacteria 2963
83 Ga0070705_100628653 3300005440 Unclassified 834
84 Ga0070705_100667159 3300005440 Bacteria 813
85 Ga0070705_101233560 3300005440 Unclassified 617
86 Ga0070700_100175064 3300005441 Bacteria 1489
87 Ga0070700_100568716 3300005441 Bacteria 883
88 Ga0070700_101865357 3300005441 Bacteria 519
89 Ga0070700_102027299 3300005441 Unclassified 500
90 Ga0070694_100052087 3300005444 Bacteria 2766
91 Ga0070694_100062368 3300005444 Bacteria 2546
92 Ga0070694_100214911 3300005444 Bacteria 1440
93 Ga0070694_100621731 3300005444 Bacteria 872
94 Ga0070694_101127156 3300005444 Bacteria 655
95 Ga0070694_101386881 3300005444 Bacteria 593
96 Ga0070708_100242184 3300005445 Bacteria 1693
97 Ga0070708_100394888 3300005445 Bacteria 1304
98 Ga0070663_100003378 3300005455 Bacteria 9214
99 Ga0070662_101270835 3300005457 Unclassified 633
100 Ga0068867_100021434 3300005459 Bacteria 4611
101 Ga0068867_100128918 3300005459 Bacteria 1964
102 Ga0068867_100323976 3300005459 Bacteria 1277
103 Ga0070707_100119380 3300005468 Bacteria 2560
104 Ga0070707_100171712 3300005468 Bacteria 2113
105 Ga0070707_100671578 3300005468 Bacteria 999
106 Ga0070707_100705755 3300005468 Bacteria 972
107 Ga0070707_100883332 3300005468 Unclassified 858
108 Ga0070707_100970239 3300005468 Bacteria 815
109 Ga0070698_100042534 3300005471 Unclassified 4661
110 Ga0070698_100470658 3300005471 Bacteria 1193
111 Ga0070698_100530303 3300005471 Bacteria 1116
112 Ga0070698_100653094 3300005471 Bacteria 993
113 Ga0070698_100772673 3300005471 Bacteria 904
114 Ga0070698_100966318 3300005471 Bacteria 798
115 Ga0070699_100000009 3300005518 Bacteria 272902
116 Ga0070699_100016451 3300005518 Bacteria 6352
117 Ga0070699_100257169 3300005518 Bacteria 1561
118 Ga0070699_100446043 3300005518 Bacteria 1173
119 Ga0070679_102200901 3300005530 Bacteria 501
120 Ga0070684_100011456 3300005535 Bacteria 7064
121 Ga0070697_100042852 3300005536 Bacteria 3663
122 Ga0070697_100705475 3300005536 Bacteria 890
123 Ga0070697_100938603 3300005536 Bacteria 768
124 Ga0070697_101131974 3300005536 Bacteria 697
125 Ga0070697_101394811 3300005536 Bacteria 626
126 Ga0070697_101689958 3300005536 Bacteria 566
127 Ga0068853_100004560 3300005539 Bacteria 10749
128 Ga0070672_100006168 3300005543 Bacteria 8024
129 Ga0070672_100072418 3300005543 Bacteria 2743
130 Ga0070672_100747285 3300005543 Bacteria 858
131 Ga0070686_100001711 3300005544 Bacteria 12277
132 Ga0070695_100002795 3300005545 Bacteria 10138
133 Ga0070695_100022182 3300005545 Bacteria 3892
134 Ga0070695_100079159 3300005545 Bacteria 2169
135 Ga0070695_100305947 3300005545 Bacteria 1177
136 Ga0070695_100419822 3300005545 Bacteria 1018
137 Ga0070695_100844823 3300005545 Bacteria 736
138 Ga0070695_101393723 3300005545 Unclassified 581
139 Ga0070696_100000103 3300005546 Bacteria 43283
140 Ga0070696_100067737 3300005546 Bacteria 2505
141 Ga0070696_100079449 3300005546 Bacteria 2321
142 Ga0070696_100508624 3300005546 Bacteria 959
143 Ga0070696_100971407 3300005546 Bacteria 708
144 Ga0070693_100353747 3300005547 Bacteria 1006
145 Ga0070665_100023633 3300005548 Bacteria 6188
146 Ga0070665_100116948 3300005548 Bacteria 2669
147 Ga0070665_100459589 3300005548 Bacteria 1283
148 Ga0070704_100006459 3300005549 Bacteria 6910
149 Ga0070704_100023915 3300005549 Bacteria 4001
150 Ga0070704_100038576 3300005549 Bacteria 3273
151 Ga0070704_100043376 3300005549 Bacteria 3118
152 Ga0070704_100146573 3300005549 Bacteria 1850
153 Ga0070704_100242049 3300005549 Bacteria 1477
154 Ga0070704_102076716 3300005549 Unclassified 528
155 Ga0068855_102385966 3300005563 Bacteria 528
156 Ga0070664_100048240 3300005564 Unclassified 3599
157 Ga0070664_100570784 3300005564 Bacteria 1047
158 Ga0070664_101341984 3300005564 Bacteria 676
159 Ga0068857_100001804 3300005577 Bacteria 17223
160 Ga0068854_100045147 3300005578 Bacteria 3132
161 Ga0068854_100057474 3300005578 Bacteria 2806
162 Ga0068856_100055851 3300005614 Unclassified 3897
163 Ga0070702_100002309 3300005615 Bacteria 8177
164 Ga0070702_100012637 3300005615 Unclassified 4238
165 Ga0068852_100003870 3300005616 Bacteria 10514
166 Ga0068852_101141155 3300005616 Bacteria 800
167 Ga0068859_100018189 3300005617 Bacteria 7064
168 Ga0068859_100301772 3300005617 Bacteria 1695
169 Ga0068859_100534081 3300005617 Bacteria 1268
170 Ga0068859_100717303 3300005617 Bacteria 1090
171 Ga0068859_101909320 3300005617 Bacteria 656
172 Ga0068859_102580169 3300005617 Bacteria 559
173 Ga0068864_100001718 3300005618 Bacteria 17995
174 Ga0068864_100039339 3300005618 Unclassified 4042
175 Ga0068866_10040011 3300005718 Bacteria 2318
176 Ga0068866_10524686 3300005718 Unclassified 788
177 Ga0068866_11041945 3300005718 Bacteria 583
178 Ga0068861_100001000 3300005719 Bacteria 17234
179 Ga0068861_100078330 3300005719 Bacteria 2580
180 Ga0068861_100104279 3300005719 Bacteria 2262
181 Ga0068861_100215185 3300005719 Unclassified 1621
182 Ga0068851_10001146 3300005834 Bacteria 11490
183 Ga0068851_10466862 3300005834 Bacteria 752
184 Ga0068851_10608771 3300005834 Unclassified 665
185 Ga0068851_11081696 3300005834 Bacteria 508
186 Ga0068870_10003241 3300005840 Bacteria 6868
187 Ga0068870_10567605 3300005840 Unclassified 766
188 Ga0068863_100217439 3300005841 Bacteria 1840
189 Ga0068863_100316452 3300005841 Bacteria 1515
190 Ga0068863_100539341 3300005841 Bacteria 1151
191 Ga0068863_100984050 3300005841 Bacteria 846
192 Ga0068863_101085661 3300005841 Bacteria 805
193 Ga0068863_102479746 3300005841 Bacteria 528
194 Ga0068858_100019053 3300005842 Bacteria 6420
195 Ga0068858_100024116 3300005842 Bacteria 5669
196 Ga0068858_100178846 3300005842 Bacteria 2002
197 Ga0068858_100860622 3300005842 Unclassified 885
198 Ga0068858_100906979 3300005842 Bacteria 862
199 Ga0068860_100009098 3300005843 Bacteria 9883
200 Ga0068860_100022746 3300005843 Bacteria 6060
201 Ga0068860_100099712 3300005843 Bacteria 2770
202 Ga0068860_100461885 3300005843 Bacteria 1263
203 Ga0068860_100661284 3300005843 Bacteria 1053
204 Ga0068860_102715438 3300005843 Bacteria 514
205 Ga0068862_100019318 3300005844 Bacteria 5686
206 Ga0068862_100043106 3300005844 Bacteria 3846
207 Ga0068862_100117474 3300005844 Bacteria 2341
208 Ga0068862_100140103 3300005844 Bacteria 2146
209 Ga0068862_100776106 3300005844 Bacteria 934
210 Ga0068862_101122991 3300005844 Bacteria 782
211 Ga0081455_10001038 3300005937 Bacteria 35067
212 Ga0081455_10039434 3300005937 Bacteria 4174
213 Ga0081455_10160748 3300005937 Bacteria 1722
214 Ga0081538_10020682 3300005981 Bacteria 4832
215 Ga0081539_10101720 3300005985 Bacteria 1463
216 Ga0081539_10168543 3300005985 Bacteria 1037
217 Ga0081539_10199199 3300005985 Bacteria 926
218 Ga0070717_10155638 3300006028 Bacteria 1980
219 Ga0070717_10223460 3300006028 Bacteria 1656
220 Ga0070717_10278778 3300006028 Bacteria 1482
221 Ga0075365_10189297 3300006038 Bacteria 1440
222 Ga0075363_100034527 3300006048 Bacteria 2641
223 Ga0075364_10130725 3300006051 Bacteria 1685
224 Ga0075432_10030950 3300006058 Bacteria 1852
225 Ga0070715_10393561 3300006163 Bacteria 768
226 Ga0070715_11096052 3300006163 Bacteria 501
227 Ga0070716_100171158 3300006173 Bacteria 1417
228 Ga0070716_100182271 3300006173 Bacteria 1380
229 Ga0070716_100409190 3300006173 Bacteria 978
230 Ga0075362_10237329 3300006177 Bacteria 894
231 Ga0075367_10752284 3300006178 Bacteria 620
232 Ga0075367_10883053 3300006178 Bacteria 570
233 Ga0075366_10100317 3300006195 Bacteria 1737
234 Ga0075370_10002939 3300006353 Bacteria 8010
235 Ga0068871_100206828 3300006358 Bacteria 1696
236 Ga0075428_100012311 3300006844 Bacteria 9516
237 Ga0075428_100024558 3300006844 Bacteria 6669
238 Ga0075428_100105243 3300006844 Bacteria 3077
239 Ga0075428_100110459 3300006844 Bacteria 2995
240 Ga0075428_100188429 3300006844 Bacteria 2231
241 Ga0075428_100462373 3300006844 Bacteria 1358
242 Ga0075428_100726168 3300006844 Bacteria 1058
243 Ga0075428_100807922 3300006844 Unclassified 997
244 Ga0075428_100827625 3300006844 Bacteria 983
245 Ga0075428_101424937 3300006844 Bacteria 727
246 Ga0075430_100021963 3300006846 Bacteria 5423
247 Ga0075430_100077636 3300006846 Bacteria 2783
248 Ga0075430_100244976 3300006846 Bacteria 1485
249 Ga0075430_100506373 3300006846 Bacteria 996
250 Ga0075430_101021477 3300006846 Bacteria 681
251 Ga0075431_100005816 3300006847 Bacteria 12202
252 Ga0075431_100039396 3300006847 Bacteria 4867
253 Ga0075431_100094535 3300006847 Bacteria 3085
254 Ga0075431_100487730 3300006847 Bacteria 1224
255 Ga0075431_100671266 3300006847 Bacteria 1015
256 Ga0075431_101124541 3300006847 Bacteria 750
257 Ga0075431_101630603 3300006847 Unclassified 602
258 Ga0075431_102216999 3300006847 Bacteria 504
259 Ga0075433_10027104 3300006852 Bacteria 4857
260 Ga0075433_10140862 3300006852 Bacteria 2143
261 Ga0075433_10148779 3300006852 Bacteria 2083
262 Ga0075433_10184747 3300006852 Bacteria 1855
263 Ga0075433_10325139 3300006852 Bacteria 1360
264 Ga0075433_10568907 3300006852 Bacteria 996
265 Ga0075433_10658115 3300006852 Unclassified 918
266 Ga0075433_10750232 3300006852 Bacteria 854
267 Ga0075433_11038011 3300006852 Bacteria 714
268 Ga0075433_11448877 3300006852 Unclassified 593
269 Ga0075434_100126522 3300006871 Bacteria 2572
270 Ga0075434_100215004 3300006871 Bacteria 1942
271 Ga0075434_100339621 3300006871 Bacteria 1523
272 Ga0075434_100587828 3300006871 Bacteria 1133
273 Ga0075434_100805161 3300006871 Bacteria 956
274 Ga0075434_100881677 3300006871 Bacteria 910
275 Ga0075434_101196689 3300006871 Bacteria 772
276 Ga0075434_102182411 3300006871 Bacteria 558
277 Ga0075434_102449067 3300006871 Unclassified 524
278 Ga0075429_100020146 3300006880 Bacteria 5784
279 Ga0075429_100226299 3300006880 Bacteria 1638
280 Ga0075429_100235586 3300006880 Bacteria 1603
281 Ga0075429_100516959 3300006880 Bacteria 1046
282 Ga0075429_100715860 3300006880 Bacteria 877
283 Ga0075429_101417303 3300006880 Bacteria 605
284 Ga0068865_100000360 3300006881 Bacteria 25145
285 Ga0068865_100002232 3300006881 Bacteria 11408
286 Ga0068865_100682004 3300006881 Bacteria 876
287 Ga0068865_100927080 3300006881 Bacteria 759
288 Ga0075436_100002851 3300006914 Bacteria 11842
289 Ga0075436_100004654 3300006914 Bacteria 9399
290 Ga0075436_100809718 3300006914 Unclassified 698
291 Ga0075436_100963202 3300006914 Bacteria 640
292 Ga0097620_100018189 3300006931 Bacteria 7064
293 Ga0097620_100301763 3300006931 Bacteria 1695
294 Ga0097620_100395269 3300006931 Bacteria 1478
295 Ga0097620_100534021 3300006931 Bacteria 1268
296 Ga0097620_100717395 3300006931 Bacteria 1090
297 Ga0097620_101909009 3300006931 Bacteria 656
298 Ga0097620_102580607 3300006931 Bacteria 559
299 Ga0075435_100000111 3300007076 Bacteria 44957
300 Ga0075435_100316070 3300007076 Bacteria 1336
301 Ga0075435_100435403 3300007076 Bacteria 1130
302 Ga0075435_100640595 3300007076 Bacteria 922
303 Ga0099794_10020192 3300007265 Bacteria 3012
304 Ga0099794_10240125 3300007265 Bacteria 933
305 Ga0099794_10387483 3300007265 Bacteria 729
306 Ga0105250_10007238 3300009092 Unclassified 4779
307 Ga0105250_10494056 3300009092 Unclassified 554
308 Ga0105240_10002677 3300009093 Bacteria 28347
309 Ga0105240_10003167 3300009093 Bacteria 25864
310 Ga0105240_10424007 3300009093 Bacteria 1494
311 Ga0105240_11276557 3300009093 Bacteria 775
312 Ga0111539_10005224 3300009094 Bacteria 16819
313 Ga0111539_10038745 3300009094 Bacteria 5751
314 Ga0111539_10126020 3300009094 Bacteria 3000
315 Ga0111539_10227833 3300009094 Bacteria 2170
316 Ga0111539_10442022 3300009094 Bacteria 1514
317 Ga0111539_10444905 3300009094 Bacteria 1509
318 Ga0111539_10893096 3300009094 Unclassified 1034
319 Ga0105245_10001566 3300009098 Bacteria 20749
320 Ga0105245_10024225 3300009098 Bacteria 5329
321 Ga0105245_10589888 3300009098 Bacteria 1137
322 Ga0105245_10651527 3300009098 Bacteria 1083
323 Ga0105245_11352387 3300009098 Bacteria 762
324 Ga0105247_10001727 3300009101 Bacteria 15386
325 Ga0105247_10124295 3300009101 Bacteria 1675
326 Ga0105247_11315699 3300009101 Bacteria 581
327 Ga0114129_10004465 3300009147 Bacteria 19731
328 Ga0114129_10024020 3300009147 Bacteria 8639
329 Ga0114129_10027059 3300009147 Bacteria 8120
330 Ga0114129_10029242 3300009147 Bacteria 7804
331 Ga0114129_10054116 3300009147 Bacteria 5628
332 Ga0114129_10073740 3300009147 Bacteria 4755
333 Ga0114129_10103447 3300009147 Bacteria 3937
334 Ga0114129_10130264 3300009147 Bacteria 3455
335 Ga0114129_10153433 3300009147 Bacteria 3151
336 Ga0114129_10353964 3300009147 Unclassified 1944
337 Ga0114129_10382746 3300009147 Bacteria 1858
338 Ga0114129_10402046 3300009147 Bacteria 1805
339 Ga0114129_10416987 3300009147 Bacteria 1767
340 Ga0114129_10460915 3300009147 Bacteria 1666
341 Ga0114129_10638064 3300009147 Bacteria 1376
342 Ga0114129_10640642 3300009147 Bacteria 1373
343 Ga0114129_10946993 3300009147 Bacteria 1088
344 Ga0114129_11011320 3300009147 Bacteria 1046
345 Ga0114129_11067762 3300009147 Bacteria 1013
346 Ga0114129_11224636 3300009147 Bacteria 934
347 Ga0114129_11292656 3300009147 Bacteria 904
348 Ga0114129_11565965 3300009147 Bacteria 808
349 Ga0114129_11597235 3300009147 Unclassified 798
350 Ga0114129_11725226 3300009147 Bacteria 763
351 Ga0114129_11814897 3300009147 Bacteria 741
352 Ga0114129_12061385 3300009147 Bacteria 689
353 Ga0114129_12210745 3300009147 Bacteria 662
354 Ga0114129_12590733 3300009147 Bacteria 605
355 Ga0114129_13161267 3300009147 Unclassified 537
356 Ga0105243_10234765 3300009148 Bacteria 1629
357 Ga0105243_10333506 3300009148 Bacteria 1386
358 Ga0105243_10343482 3300009148 Bacteria 1368
359 Ga0105243_10396872 3300009148 Bacteria 1280
360 Ga0105241_10017322 3300009174 Bacteria 5292
361 Ga0105241_10239578 3300009174 Unclassified 1533
362 Ga0105241_10811529 3300009174 Bacteria 863
363 Ga0105241_11449215 3300009174 Bacteria 659
364 Ga0105241_11668822 3300009174 Bacteria 618
365 Ga0105241_12029039 3300009174 Bacteria 567
366 Ga0105242_10011483 3300009176 Bacteria 6809
367 Ga0105242_10058808 3300009176 Bacteria 3153
368 Ga0105242_10129723 3300009176 Bacteria 2174
369 Ga0105242_10504353 3300009176 Bacteria 1151
370 Ga0105242_10556794 3300009176 Bacteria 1100
371 Ga0105248_10004184 3300009177 Bacteria 15944
372 Ga0105248_10004562 3300009177 Bacteria 15336
373 Ga0105248_10100894 3300009177 Bacteria 3253
374 Ga0105248_10183652 3300009177 Bacteria 2357
375 Ga0105248_10384705 3300009177 Bacteria 1580
376 Ga0105248_11014980 3300009177 Bacteria 937
377 Ga0105248_12063197 3300009177 Bacteria 648
378 Ga0105237_10021308 3300009545 Bacteria 6664
379 Ga0105237_12245915 3300009545 Bacteria 555
380 Ga0105238_10060584 3300009551 Bacteria 3789
381 Ga0105238_10072425 3300009551 Unclassified 3441
382 Ga0105238_10080965 3300009551 Bacteria 3236
383 Ga0105238_10143285 3300009551 Bacteria 2366
384 Ga0105238_11279981 3300009551 Bacteria 759
385 Ga0105249_10010097 3300009553 Bacteria 8287
386 Ga0105249_10348202 3300009553 Bacteria 1500
387 Ga0105249_10845741 3300009553 Bacteria 980
388 Ga0105249_10848752 3300009553 Unclassified 979
389 Ga0105249_12628690 3300009553 Bacteria 576
390 Ga0105239_10005297 3300010375 Bacteria 15155
391 Ga0105239_10045783 3300010375 Bacteria 4794
392 Ga0105239_10264712 3300010375 Bacteria 1933
393 Ga0105239_10700326 3300010375 Bacteria 1158
394 Ga0105239_11099880 3300010375 Bacteria 915
395 Ga0105239_11226065 3300010375 Bacteria 865
396 Ga0105239_12128644 3300010375 Bacteria 652
397 Ga0105239_12196971 3300010375 Bacteria 642
398 Ga0105246_10001936 3300011119 Bacteria 12499
399 Ga0105246_10013762 3300011119 Bacteria 5076
400 Ga0157341_1005136 3300012494 Bacteria 972
401 Ga0157316_1006507 3300012510 Bacteria 960
402 Ga0157338_1049723 3300012515 Bacteria 598
403 Ga0157373_10001863 3300013100 Bacteria 15980
404 Ga0157371_10005089 3300013102 Bacteria 11218
405 Ga0157370_10912702 3300013104 Bacteria 797
406 Ga0157370_11223972 3300013104 Unclassified 677
407 Ga0157369_10008338 3300013105 Bacteria 11880
408 Ga0157374_10004208 3300013296 Bacteria 12093
409 Ga0157374_10165741 3300013296 Unclassified 2153
410 Ga0157374_10502983 3300013296 Bacteria 1216
411 Ga0157374_10919467 3300013296 Bacteria 893
412 Ga0157378_10182173 3300013297 Bacteria 1977
413 Ga0157378_10350418 3300013297 Bacteria 1442
414 Ga0157378_11640700 3300013297 Unclassified 689
415 Ga0157378_11706506 3300013297 Unclassified 677
416 Ga0163162_10004988 3300013306 Bacteria 12791
417 Ga0163162_10012067 3300013306 Bacteria 8428
418 Ga0163162_10115746 3300013306 Bacteria 2781
419 Ga0163162_10383180 3300013306 Bacteria 1539
420 Ga0163162_10646309 3300013306 Bacteria 1182
421 Ga0163162_10909595 3300013306 Bacteria 993
422 Ga0163162_11841257 3300013306 Bacteria 692
423 Ga0157375_10538061 3300013308 Bacteria 1331
424 Ga0157375_11047000 3300013308 Bacteria 954
425 Ga0157375_11406180 3300013308 Bacteria 822
426 Ga0157375_13012617 3300013308 Unclassified 562
427 Ga0163163_10001132 3300014325 Bacteria 22642
428 Ga0163163_10042111 3300014325 Bacteria 4470
429 Ga0163163_10370235 3300014325 Bacteria 1490
430 Ga0163163_10397379 3300014325 Bacteria 1436
431 Ga0157380_10015898 3300014326 Bacteria 5537
432 Ga0157380_10073795 3300014326 Unclassified 2768
433 Ga0157380_10200531 3300014326 Bacteria 1770
434 Ga0157380_10219385 3300014326 Bacteria 1700
435 Ga0157380_10414357 3300014326 Bacteria 1283
436 Ga0157380_11519098 3300014326 Bacteria 723
437 Ga0157377_10000687 3300014745 Bacteria 13986
438 Ga0157379_10020264 3300014968 Bacteria 5880
439 Ga0157379_10036472 3300014968 Unclassified 4384
440 Ga0157379_10079777 3300014968 Bacteria 2931
441 Ga0157379_10325424 3300014968 Bacteria 1404
442 Ga0157379_10927584 3300014968 Unclassified 827
443 Ga0157379_11844518 3300014968 Bacteria 595
444 Ga0157379_12596892 3300014968 Bacteria 507
445 Ga0157376_10012662 3300014969 Bacteria 6269
446 Ga0157376_10114169 3300014969 Bacteria 2383
447 Ga0157376_10317197 3300014969 Bacteria 1481
448 Ga0157376_11452082 3300014969 Bacteria 718
449 Ga0163161_10017543 3300017792 Bacteria 5010
450 Ga0206350_10760061 3300020080 Unclassified 2239
451 Ga0213876_10019903 3300021384 Bacteria 3545
452 Ga0213871_10243856 3300021441 Unclassified 569
453 Ga0224712_10022644 3300022467 Unclassified 2169
454 Ga0209675_1086684 3300025291 Bacteria 571
455 Ga0207697_10001950 3300025315 Bacteria 10961
456 Ga0207656_10003429 3300025321 Bacteria 5448
457 Ga0207656_10166426 3300025321 Bacteria 1052
458 Ga0207653_10005585 3300025885 Bacteria 3925
459 Ga0207682_10008921 3300025893 Bacteria 3966
460 Ga0207642_10220963 3300025899 Bacteria 1059
461 Ga0207642_10315432 3300025899 Unclassified 911
462 Ga0207642_11065289 3300025899 Bacteria 522
463 Ga0207710_10005739 3300025900 Bacteria 5329
464 Ga0207710_10052259 3300025900 Bacteria 1837
465 Ga0207688_10239493 3300025901 Unclassified 1097
466 Ga0207680_10019037 3300025903 Unclassified 3665
467 Ga0207680_10476358 3300025903 Bacteria 888
468 Ga0207647_10006539 3300025904 Bacteria 8468
469 Ga0207647_10740891 3300025904 Unclassified 533
470 Ga0207685_10714178 3300025905 Bacteria 546
471 Ga0207699_10864754 3300025906 Bacteria 666
472 Ga0207699_11359150 3300025906 Bacteria 526
473 Ga0207645_10001595 3300025907 Bacteria 18512
474 Ga0207645_10011410 3300025907 Bacteria 6067
475 Ga0207645_10385810 3300025907 Bacteria 941
476 Ga0207645_11047211 3300025907 Bacteria 551
477 Ga0207643_10000412 3300025908 Bacteria 28337
478 Ga0207643_10502736 3300025908 Bacteria 775
479 Ga0207705_10022679 3300025909 Unclassified 4478
480 Ga0207705_10970615 3300025909 Bacteria 657
481 Ga0207684_10007234 3300025910 Bacteria 10031
482 Ga0207684_10036455 3300025910 Bacteria 4174
483 Ga0207684_10909595 3300025910 Bacteria 739
484 Ga0207654_10120644 3300025911 Bacteria 1646
485 Ga0207654_10389331 3300025911 Bacteria 967
486 Ga0207654_10590537 3300025911 Bacteria 792
487 Ga0207707_11327534 3300025912 Bacteria 577
488 Ga0207695_10000572 3300025913 Bacteria 75360
489 Ga0207695_10033659 3300025913 Bacteria 5584
490 Ga0207695_10273318 3300025913 Bacteria 1585
491 Ga0207671_10088470 3300025914 Bacteria 2330
492 Ga0207671_10506236 3300025914 Bacteria 963
493 Ga0207663_10000003 3300025916 Bacteria 458807
494 Ga0207663_10047871 3300025916 Bacteria 2642
495 Ga0207663_10462940 3300025916 Unclassified 980
496 Ga0207662_10013125 3300025918 Unclassified 4629
497 Ga0207662_10039918 3300025918 Bacteria 2756
498 Ga0207662_10557791 3300025918 Bacteria 794
499 Ga0207657_10006949 3300025919 Bacteria 11664
500 Ga0207649_10002415 3300025920 Bacteria 10457
501 Ga0207649_10200356 3300025920 Bacteria 1410
502 Ga0207649_10346540 3300025920 Bacteria 1098
503 Ga0207649_10350535 3300025920 Unclassified 1092
504 Ga0207646_10063924 3300025922 Bacteria 3285
505 Ga0207646_10092389 3300025922 Bacteria 2709
506 Ga0207646_10172997 3300025922 Bacteria 1950
507 Ga0207646_10311307 3300025922 Bacteria 1423
508 Ga0207646_10482974 3300025922 Bacteria 1117
509 Ga0207646_10569558 3300025922 Bacteria 1018
510 Ga0207646_10694788 3300025922 Unclassified 910
511 Ga0207681_10006153 3300025923 Bacteria 7363
512 Ga0207681_10117867 3300025923 Bacteria 1942
513 Ga0207681_10596757 3300025923 Bacteria 912
514 Ga0207694_10011935 3300025924 Bacteria 6551
515 Ga0207694_10116729 3300025924 Bacteria 2127
516 Ga0207694_10286119 3300025924 Bacteria 1355
517 Ga0207650_10000024 3300025925 Bacteria 299184
518 Ga0207650_10359302 3300025925 Bacteria 1200
519 Ga0207659_10017317 3300025926 Bacteria 4706
520 Ga0207659_10695544 3300025926 Bacteria 870
521 Ga0207659_11494386 3300025926 Bacteria 578
522 Ga0207687_10032787 3300025927 Bacteria 3520
523 Ga0207687_10114252 3300025927 Bacteria 2009
524 Ga0207687_10875701 3300025927 Unclassified 768
525 Ga0207687_11190547 3300025927 Bacteria 655
526 Ga0207700_10851389 3300025928 Bacteria 816
527 Ga0207700_11012503 3300025928 Unclassified 743
528 Ga0207664_11867471 3300025929 Bacteria 523
529 Ga0207644_10012416 3300025931 Bacteria 5657
530 Ga0207690_10000116 3300025932 Bacteria 65776
531 Ga0207690_10135709 3300025932 Bacteria 1806
532 Ga0207706_10003335 3300025933 Bacteria 15361
533 Ga0207706_10349050 3300025933 Bacteria 1287
534 Ga0207686_10029625 3300025934 Bacteria 3231
535 Ga0207686_10130295 3300025934 Unclassified 1724
536 Ga0207709_10016036 3300025935 Bacteria 4159
537 Ga0207670_10010066 3300025936 Bacteria 5427
538 Ga0207670_10368704 3300025936 Bacteria 1141
539 Ga0207669_10267034 3300025937 Bacteria 1283
540 Ga0207669_10866910 3300025937 Unclassified 752
541 Ga0207669_11783356 3300025937 Bacteria 526
542 Ga0207704_10003029 3300025938 Bacteria 7586
543 Ga0207704_10041879 3300025938 Bacteria 2690
544 Ga0207704_10970277 3300025938 Bacteria 718
545 Ga0207704_11312637 3300025938 Unclassified 619
546 Ga0207704_11777113 3300025938 Bacteria 530
547 Ga0207665_10100154 3300025939 Unclassified 2022
548 Ga0207665_10358593 3300025939 Bacteria 1102
549 Ga0207665_10888062 3300025939 Bacteria 707
550 Ga0207691_10000072 3300025940 Bacteria 83580
551 Ga0207691_10063684 3300025940 Bacteria 3344
552 Ga0207691_10282587 3300025940 Bacteria 1428
553 Ga0207691_10548433 3300025940 Unclassified 980
554 Ga0207691_10715056 3300025940 Bacteria 844
555 Ga0207691_10721342 3300025940 Bacteria 840
556 Ga0207691_11118279 3300025940 Unclassified 655
557 Ga0207711_10002809 3300025941 Bacteria 15313
558 Ga0207711_10007162 3300025941 Bacteria 9349
559 Ga0207711_10048635 3300025941 Bacteria 3628
560 Ga0207711_10191294 3300025941 Bacteria 1865
561 Ga0207711_10937246 3300025941 Bacteria 804
562 Ga0207711_11037697 3300025941 Bacteria 760
563 Ga0207711_11785453 3300025941 Bacteria 558
564 Ga0207689_10001019 3300025942 Bacteria 26906
565 Ga0207689_10153264 3300025942 Bacteria 1900
566 Ga0207689_10384184 3300025942 Bacteria 1169
567 Ga0207689_11460181 3300025942 Bacteria 572
568 Ga0207661_10001629 3300025944 Bacteria 15283
569 Ga0207679_10000040 3300025945 Bacteria 127317
570 Ga0207679_10120230 3300025945 Bacteria 2089
571 Ga0207679_10213060 3300025945 Bacteria 1621
572 Ga0207667_10175696 3300025949 Bacteria 2200
573 Ga0207651_10013462 3300025960 Unclassified 4682
574 Ga0207651_10083194 3300025960 Bacteria 2314
575 Ga0207651_10880954 3300025960 Bacteria 797
576 Ga0207712_10040318 3300025961 Unclassified 3204
577 Ga0207712_10128136 3300025961 Bacteria 1930
578 Ga0207712_10415241 3300025961 Bacteria 1134
579 Ga0207668_10044917 3300025972 Bacteria 3010
580 Ga0207668_10059023 3300025972 Bacteria 2685
581 Ga0207668_12081129 3300025972 Bacteria 511
582 Ga0207640_10006561 3300025981 Bacteria 6389
583 Ga0207640_10046662 3300025981 Bacteria 2790
584 Ga0207640_11392218 3300025981 Bacteria 628
585 Ga0207658_10007620 3300025986 Bacteria 7373
586 Ga0207658_10031984 3300025986 Bacteria 3741
587 Ga0207658_10460088 3300025986 Bacteria 1128
588 Ga0207658_10778193 3300025986 Unclassified 868
589 Ga0207658_11993567 3300025986 Bacteria 528
590 Ga0207677_10022824 3300026023 Bacteria 3853
591 Ga0207677_10025225 3300026023 Unclassified 3705
592 Ga0207677_11521303 3300026023 Bacteria 618
593 Ga0207703_10011299 3300026035 Bacteria 6944
594 Ga0207703_10013259 3300026035 Bacteria 6420
595 Ga0207703_10104931 3300026035 Bacteria 2402
596 Ga0207703_11036511 3300026035 Unclassified 787
597 Ga0207703_11776600 3300026035 Bacteria 593
598 Ga0207639_10011738 3300026041 Bacteria 6092
599 Ga0207678_10002689 3300026067 Bacteria 16127
600 Ga0207708_10000578 3300026075 Bacteria 28320
601 Ga0207708_10449053 3300026075 Bacteria 1073
602 Ga0207708_10634285 3300026075 Bacteria 908
603 Ga0207708_11111971 3300026075 Bacteria 689
604 Ga0207708_11392362 3300026075 Bacteria 615
605 Ga0207708_11720471 3300026075 Unclassified 551
606 Ga0207702_10042486 3300026078 Unclassified 3813
607 Ga0207641_10000030 3300026088 Bacteria 224468
608 Ga0207641_10134151 3300026088 Bacteria 2227
609 Ga0207641_10412611 3300026088 Bacteria 1299
610 Ga0207641_11189083 3300026088 Bacteria 762
611 Ga0207641_11198150 3300026088 Bacteria 759
612 Ga0207641_11670514 3300026088 Bacteria 639
613 Ga0207641_12305032 3300026088 Bacteria 538
614 Ga0207648_10001749 3300026089 Bacteria 23777
615 Ga0207648_10058501 3300026089 Bacteria 3361
616 Ga0207648_10330836 3300026089 Bacteria 1370
617 Ga0207648_10352518 3300026089 Bacteria 1327
618 Ga0207648_11473324 3300026089 Bacteria 640
619 Ga0207676_10000256 3300026095 Bacteria 46055
620 Ga0207676_10140970 3300026095 Bacteria 2063
621 Ga0207676_10193595 3300026095 Unclassified 1791
622 Ga0207676_10520753 3300026095 Bacteria 1132
623 Ga0207676_12098518 3300026095 Bacteria 564
624 Ga0207674_10002761 3300026116 Bacteria 21899
625 Ga0207675_100002584 3300026118 Bacteria 17929
626 Ga0207675_100018872 3300026118 Bacteria 6436
627 Ga0207675_100233552 3300026118 Unclassified 1775
628 Ga0207675_101943726 3300026118 Bacteria 606
629 Ga0207675_102131555 3300026118 Bacteria 577
630 Ga0207675_102222187 3300026118 Unclassified 563
631 Ga0207683_10000662 3300026121 Bacteria 31638
632 Ga0207698_10029473 3300026142 Unclassified 3932
633 Ga0207698_11119531 3300026142 Bacteria 800
634 Ga0209969_1074844 3300027360 Bacteria 540
635 Ga0209970_1050903 3300027614 Bacteria 749
636 Ga0209588_1016688 3300027671 Bacteria 2270
637 Ga0209588_1200472 3300027671 Bacteria 622
638 Ga0207428_10002611 3300027907 Bacteria 17990
639 Ga0207428_10040084 3300027907 Bacteria 3802
640 Ga0207428_10118634 3300027907 Unclassified 2030
641 Ga0207428_10479911 3300027907 Bacteria 904
642 Ga0207428_10724741 3300027907 Unclassified 710
643 Ga0265354_1000208 3300028016 Bacteria 10825
644 Ga0268266_10000003 3300028379 Bacteria 1701703
645 Ga0268266_10005234 3300028379 Bacteria 12192
646 Ga0268266_10161176 3300028379 Bacteria 2029
647 Ga0268266_10180615 3300028379 Bacteria 1921
648 Ga0268265_10004713 3300028380 Bacteria 9415
649 Ga0268265_10016427 3300028380 Bacteria 5084
650 Ga0268265_10458172 3300028380 Bacteria 1193
651 Ga0268265_10714406 3300028380 Bacteria 969
652 Ga0268265_11671659 3300028380 Bacteria 642
653 Ga0268265_11968159 3300028380 Bacteria 591
654 Ga0268264_10004409 3300028381 Bacteria 12008
655 Ga0268264_10105485 3300028381 Bacteria 2458
656 Ga0268264_10741953 3300028381 Bacteria 978
657 Ga0268264_10866014 3300028381 Unclassified 905
658 Ga0268264_10912493 3300028381 Bacteria 882
659 Ga0268264_11389480 3300028381 Bacteria 713
660 Ga0268264_11570531 3300028381 Bacteria 669
661 Ga0265322_10017324 3300028654 Bacteria 2076
662 Ga0265322_10177346 3300028654 Bacteria 610
663 Ga0307517_10022064 3300028786 Bacteria 8003
664 Ga0307517_10132566 3300028786 Bacteria 1787
665 Ga0307515_10356942 3300028794 Bacteria 1105
666 Ga0265338_10031678 3300028800 Bacteria 5179
667 Ga0265338_10239934 3300028800 Bacteria 1343
668 Ga0265770_1002281 3300030878 Unclassified 2608
669 Ga0265765_1004549 3300030879 Unclassified 1431
670 Ga0265330_10050798 3300031235 Bacteria 1818
671 Ga0265332_10000340 3300031238 Bacteria 35277
672 Ga0265328_10020289 3300031239 Bacteria 2545
673 Ga0265320_10009240 3300031240 Bacteria 5961
674 Ga0265329_10017851 3300031242 Bacteria 2434
675 Ga0265340_10176585 3300031247 Bacteria 966
676 Ga0265331_10000185 3300031250 Bacteria 76386
677 Ga0265327_10001070 3300031251 Bacteria 38165
678 Ga0265316_10001527 3300031344 Bacteria 24799
679 Ga0265316_10017451 3300031344 Bacteria 6202
680 Ga0307408_100565363 3300031548 Bacteria 1005
681 Ga0307508_10210784 3300031616 Bacteria 1543
682 Ga0307508_10348269 3300031616 Bacteria 1073
683 Ga0265314_10000268 3300031711 Bacteria 76381
684 Ga0265342_10007616 3300031712 Bacteria 7897
685 Ga0265342_10022755 3300031712 Bacteria 3979
686 Ga0307516_10018686 3300031730 Bacteria 7200
687 Ga0307516_10568203 3300031730 Bacteria 788
688 Ga0307405_10106507 3300031731 Bacteria 1891
689 Ga0307405_10763792 3300031731 Bacteria 806
690 Ga0307405_11335271 3300031731 Bacteria 625
691 Ga0307405_11966969 3300031731 Bacteria 523
692 Ga0307413_10004749 3300031824 Bacteria 5968
693 Ga0307410_10321879 3300031852 Bacteria 1227
694 Ga0307410_10625372 3300031852 Bacteria 900
695 Ga0307410_11305721 3300031852 Bacteria 635
696 Ga0307406_10078563 3300031901 Unclassified 2186
697 Ga0307406_10193174 3300031901 Bacteria 1492
698 Ga0307407_10678415 3300031903 Bacteria 774
699 Ga0307412_10011236 3300031911 Bacteria 5179
700 Ga0307412_10143018 3300031911 Bacteria 1754
701 Ga0307409_100332907 3300031995 Bacteria 1425
702 Ga0307409_100336594 3300031995 Bacteria 1418
703 Ga0307416_100148819 3300032002 Bacteria 2143
704 Ga0307416_100261620 3300032002 Bacteria 1691
705 Ga0307416_102527826 3300032002 Bacteria 612
706 Ga0307414_11546545 3300032004 Bacteria 618
707 Ga0307411_10127139 3300032005 Bacteria 1855
708 Ga0307411_10215646 3300032005 Bacteria 1485
709 Ga0307411_11145115 3300032005 Bacteria 703
710 Ga0307415_100018032 3300032126 Bacteria 4250
711 Ga0307415_100085027 3300032126 Bacteria 2272
712 Ga0307415_101404478 3300032126 Unclassified 665
713 Ga0373930_0000891 3300034816 Bacteria 4267
714 Ga0373948_0000553 3300034817 Bacteria 4725
715 Ga0373948_0030044 3300034817 Bacteria 1091
716 Ga0373950_0002266 3300034818 Bacteria 2633
717 Ga0373958_0010144 3300034819 Bacteria 1565
718 Ga0373959_0000668 3300034820 Bacteria 5874
719 Ga0373938_0001043 3300034957 Bacteria 4456
720 Ga0373926_0111296 3300035083 Bacteria 1029
721 Ga0373928_0003857 3300035084 Bacteria 2860
722 Ga0373929_0001922 3300035085 Bacteria 3884
723 Ga0373929_0144372 3300035085 Bacteria 634
724 Ga0373940_0002298 3300035088 Bacteria 3687
725 Ga0373940_0299031 3300035088 Bacteria 554
726 Ga0373940_0344466 3300035088 Bacteria 522
727 Ga0373944_0298023 3300035089 Bacteria 605
728 Ga0373949_0005397 3300035090 Bacteria 2854
729 Ga0373951_0007568 3300035091 Bacteria 2465
730 Ga0373951_0164012 3300035091 Bacteria 630
731 Ga0373952_0009076 3300035092 Bacteria 1896
732 Ga0373932_0000420 3300035112 Bacteria 12969
733 Ga0373936_0002083 3300035113 Bacteria 7421
734 Ga0373936_0049723 3300035113 Bacteria 1694
735 Ga0373939_0000402 3300035114 Bacteria 10917
736 Ga0373939_0001234 3300035114 Bacteria 6258
737 Ga0373941_0000594 3300035115 Bacteria 7325
738 Ga0373960_0001640 3300035121 Bacteria 4999
739 Ga0373960_0184128 3300035121 Bacteria 731
740 Ga0373960_0331369 3300035121 Bacteria 573
741 Ga0373943_0405134 3300035170 Bacteria 788
742 Ga0373943_0514621 3300035170 Bacteria 700
743 Ga0373946_0773945 3300035171 Bacteria 504
744 Ga0373955_0885879 3300035172 Unclassified 549
745 Ga0373942_0001546 3300035207 Bacteria 5902
746 Ga0373961_0002215 3300035241 Bacteria 5140
747 Ga0373961_0188850 3300035241 Bacteria 721
748 Ga0373962_0002277 3300035242 Bacteria 4584
749 Ga0373962_0004831 3300035242 Bacteria 3255
750 Ga0373931_0006713 3300035691 Bacteria 5399
751 Ga0373931_0020329 3300035691 Bacteria 3321
752 Ga0373931_0455970 3300035691 Bacteria 818
753 Ga0373935_0187972 3300035692 Bacteria 1421
754 Ga0373935_0756600 3300035692 Bacteria 716
755 Ga0373935_1202491 3300035692 Bacteria 565
756 Ga0373927_0114765 3300035695 Bacteria 1756
757 Ga0373933_0033790 3300035724 Bacteria 2977
758 Ga0373947_0111342 3300035725 Bacteria 1730
759 Ga0373937_0357266 3300036401 Bacteria 1384
760 Ga0373925_0166998 3300037068 Bacteria 1736
761 Ga0373925_0385574 3300037068 Bacteria 1141
762 Ga0395905_0040911 3300037471 Bacteria 4348
763 Ga0436365_0773270 3300039437 Bacteria 4763
764 Ga0436360_0193460 3300039438 Unclassified 552
765 Ga0436360_1063581 3300039438 Bacteria 745
766 Ga0436362_0108834 3300039453 Bacteria 947
767 Ga0439465_0023763 3300041413 Bacteria 1930
768 Ga0451789_1067098 3300041443 Bacteria 517
769 Ga0451800_0834949 3300041459 Bacteria 1304
770 Ga0451802_0652043 3300041460 Bacteria 1353
771 Ga0451804_0956971 3300041463 Bacteria 620
772 Ga0451807_1337868 3300041486 Bacteria 812
773 Ga0451837_1350587 3300041494 Bacteria 1688
774 Ga0451853_3024037 3300041512 Bacteria 501
775 Ga0439431_0079117 3300041997 Bacteria 884
776 Ga0439441_006024 3300042001 Bacteria 1907
777 Ga0450910_104531 3300042147 Bacteria 510
778 Ga0439435_0085167 3300042436 Unclassified 954
779 Ga0451577_0002849 3300042876 Bacteria 19885
780 Ga0451577_0558772 3300042876 Bacteria 1039
781 Ga0451577_0717526 3300042876 Bacteria 905
782 Ga0451577_1084754 3300042876 Bacteria 717
783 Ga0451577_1910139 3300042876 Bacteria 520
784 Ga0451577_2037027 3300042876 Unclassified 501
785 Ga0466969_0000504 3300044656 Bacteria 21405
786 Ga0466972_0317196 3300044658 Bacteria 728
787 Ga0453683_0000048 3300044673 Bacteria 207480
788 Ga0453683_0061455 3300044673 Bacteria 2349
789 Ga0466966_0014632 3300044684 Bacteria 5193
790 Ga0466961_0070688 3300044693 Bacteria 2215
791 Ga0466964_0012334 3300044706 Bacteria 3233
792 Ga0453684_0002176 3300044712 Bacteria 48914
793 Ga0453684_0547269 3300044712 Bacteria 1275
794 Ga0453684_0918985 3300044712 Bacteria 936
795 Ga0466971_0000577 3300044719 Bacteria 14458
796 Ga0466968_0048415 3300044735 Bacteria 1809
797 Ga0466970_0005403 3300044765 Bacteria 6337
798 Ga0466957_0007645 3300044842 Bacteria 6112
799 Ga0466959_0009199 3300045049 Bacteria 7016
800 Ga0466959_0252103 3300045049 Bacteria 1217
801 Ga0451576_0004001 3300045051 Bacteria 19619
802 Ga0451576_0039189 3300045051 Bacteria 5015
803 Ga0451576_0294104 3300045051 Bacteria 1698
804 Ga0451576_0449045 3300045051 Bacteria 1353
805 Ga0451576_0740654 3300045051 Bacteria 1032
806 Ga0451576_1060610 3300045051 Bacteria 849
807 Ga0451576_1216433 3300045051 Bacteria 786
808 Ga0451576_1403529 3300045051 Bacteria 727
809 Ga0466958_0050222 3300045836 Bacteria 2525
810 Ga0466967_0130585 3300045976 Bacteria 2332
811 Ga0495592_0112889 3300046454 Bacteria 1921
812 Ga0495603_0112955 3300046455 Bacteria 1584
813 Ga0495603_0238889 3300046455 Bacteria 1047
814 Ga0495603_0482646 3300046455 Unclassified 710
815 Ga0495580_0668786 3300046472 Bacteria 682
816 Ga0495582_0223128 3300046473 Bacteria 1079
817 Ga0495594_0221488 3300046499 Bacteria 1079
818 Ga0495594_0454915 3300046499 Bacteria 728
819 Ga0495628_0112991 3300046516 Bacteria 2088
820 Ga0495628_0406305 3300046516 Bacteria 994
821 Ga0495652_0025965 3300046529 Bacteria 5176
822 Ga0495652_0691273 3300046529 Bacteria 687
823 Ga0495586_0205572 3300046535 Bacteria 1117
824 Ga0495645_0080035 3300046543 Bacteria 2346
825 Ga0495645_0083512 3300046543 Bacteria 2289
826 Ga0495633_0139561 3300046558 Bacteria 1121
827 Ga0495668_0183206 3300046616 Bacteria 1147
828 Ga0495668_0555241 3300046616 Bacteria 634
829 Ga0495635_0739562 3300046663 Unclassified 636
830 Ga0495635_0779423 3300046663 Bacteria 617
831 Ga0495599_0003280 3300046678 Bacteria 9434
832 Ga0495647_0026791 3300046681 Bacteria 2115
833 Ga0495647_0169157 3300046681 Unclassified 946
834 Ga0495658_0327382 3300046683 Bacteria 972
835 Ga0495658_0569146 3300046683 Unclassified 726
836 Ga0495674_0612809 3300047319 Bacteria 861
837 Ga0495684_0347999 3300047471 Bacteria 1053
838 Ga0495686_0076077 3300047472 Bacteria 2057
839 Ga0495686_0255568 3300047472 Bacteria 983
840 Ga0495602_0064951 3300048088 Bacteria 3153
841 Ga0496100_1023399 3300048903 Bacteria 650
842 Ga0496101_0250701 3300048904 Bacteria 1379
843 Ga0496102_0038967 3300048905 Unclassified 4292
844 Ga0496102_0045885 3300048905 Bacteria 3968
845 Ga0496102_0448529 3300048905 Bacteria 1210
846 Ga0496103_0078449 3300048906 Bacteria 2074
847 Ga0496104_0158704 3300048907 Bacteria 2170
848 Ga0496104_0281845 3300048907 Bacteria 1575
849 Ga0496104_0747497 3300048907 Bacteria 885
850 Ga0496104_0781815 3300048907 Bacteria 861
851 Ga0496104_0848895 3300048907 Bacteria 819
852 Ga0496104_0875545 3300048907 Bacteria 803
853 Ga0496105_0048570 3300048908 Bacteria 3503
854 Ga0496105_0552775 3300048908 Bacteria 898
855 Ga0496106_0040048 3300048909 Unclassified 3508
856 Ga0496107_0197435 3300048910 Bacteria 1495
857 Ga0496108_0000567 3300048911 Bacteria 28950
858 Ga0496108_0009255 3300048911 Bacteria 7970
859 Ga0496108_0321607 3300048911 Bacteria 1349
860 Ga0496108_1090616 3300048911 Unclassified 679
861 Ga0496109_0000381 3300048912 Bacteria 40340
862 Ga0496109_0605236 3300048912 Bacteria 1032
863 Ga0496109_1704196 3300048912 Bacteria 564
864 Ga0496110_0003335 3300048913 Bacteria 12271
865 Ga0496110_0309984 3300048913 Bacteria 1438
866 Ga0496110_0371036 3300048913 Bacteria 1304
867 Ga0496111_0015632 3300048914 Bacteria 5215
868 Ga0496112_0000155 3300048915 Bacteria 43076
869 Ga0496112_0003145 3300048915 Bacteria 13552
870 Ga0496112_0094451 3300048915 Bacteria 2961
871 Ga0496113_0005322 3300048916 Bacteria 8012
872 Ga0496113_0294357 3300048916 Bacteria 1299
873 Ga0496113_0981198 3300048916 Bacteria 666
874 Ga0496115_0003595 3300048918 Bacteria 11143
875 Ga0496115_0555226 3300048918 Bacteria 917
876 Ga0496115_0757883 3300048918 Unclassified 759
877 Ga0501299_112050 3300049522 Bacteria 647
878 Ga0501031_0046272 3300049568 Bacteria 2837
879 Ga0501032_0053118 3300049569 Bacteria 2729
880 Ga0501033_0134990 3300049570 Bacteria 1785
881 Ga0501034_0003356 3300049571 Bacteria 18272
882 Ga0501034_0675539 3300049571 Bacteria 933
883 Ga0501034_1069816 3300049571 Bacteria 688
884 Ga0501036_0124428 3300049572 Bacteria 2177
885 Ga0501036_0636856 3300049572 Bacteria 883
886 Ga0501037_0005432 3300049573 Bacteria 9281
887 Ga0501038_0012194 3300049574 Bacteria 7847
888 Ga0501039_0185840 3300049575 Bacteria 1634
889 Ga0501040_0143739 3300049576 Bacteria 1681
890 Ga0501041_0053867 3300049577 Bacteria 2454
891 Ga0501041_0346188 3300049577 Bacteria 939
892 Ga0501041_0868447 3300049577 Bacteria 579
893 Ga0501042_0124395 3300049578 Bacteria 1857
894 Ga0501042_1150235 3300049578 Bacteria 566
895 Ga0501043_0021196 3300049579 Bacteria 5094
896 Ga0501043_0573732 3300049579 Bacteria 836
897 Ga0501043_0684291 3300049579 Bacteria 750
898 Ga0501046_0014620 3300049580 Bacteria 6612
899 Ga0501046_0194911 3300049580 Bacteria 1510
900 Ga0501046_0609969 3300049580 Bacteria 774
901 Ga0501047_0097004 3300049581 Bacteria 2826
902 Ga0501047_0155515 3300049581 Bacteria 2160
903 Ga0501047_0410243 3300049581 Bacteria 1187
904 Ga0501048_0111577 3300049582 Bacteria 1931
905 Ga0501048_1126016 3300049582 Unclassified 565
906 Ga0501068_0103077 3300049584 Bacteria 1769
907 Ga0501069_0013416 3300049585 Bacteria 4369
908 Ga0501070_0039978 3300049586 Bacteria 3911
909 Ga0501070_0548148 3300049586 Bacteria 926
910 Ga0501071_0123423 3300049587 Bacteria 1921
911 Ga0501071_0153901 3300049587 Bacteria 1716
912 Ga0501072_0072908 3300049588 Bacteria 2714
913 Ga0501072_1011588 3300049588 Bacteria 648
914 Ga0501072_1131515 3300049588 Bacteria 609
915 Ga0501073_0055844 3300049589 Bacteria 2762
916 Ga0501073_0501732 3300049589 Bacteria 839
917 Ga0501073_0803416 3300049589 Bacteria 648
918 Ga0501074_0114932 3300049590 Bacteria 1925
919 Ga0501074_0443767 3300049590 Bacteria 920
920 Ga0501075_0053302 3300049591 Bacteria 3042
921 Ga0501075_0906383 3300049591 Bacteria 670
922 Ga0501076_0074944 3300049592 Bacteria 2712
923 Ga0501076_0338569 3300049592 Bacteria 1234
924 Ga0501076_0580707 3300049592 Bacteria 924
925 Ga0501077_0215694 3300049593 Bacteria 1220
926 Ga0501077_0290739 3300049593 Bacteria 1041
927 Ga0501199_044918 3300049650 Bacteria 583
928 Ga0501217_002216 3300049661 Bacteria 3788
929 Ga0501223_035353 3300049663 Bacteria 972
930 Ga0501079_0003492 3300049741 Bacteria 11552
931 Ga0501079_0103649 3300049741 Bacteria 2207
932 Ga0501079_0175123 3300049741 Bacteria 1673
933 Ga0501079_0410295 3300049741 Bacteria 1063
934 Ga0501079_1096657 3300049741 Bacteria 627
935 Ga0501080_0002418 3300049742 Bacteria 16296
936 Ga0501080_0027546 3300049742 Bacteria 5284
937 Ga0501081_0086237 3300049743 Bacteria 2204
938 Ga0501083_0015634 3300049744 Bacteria 5312
939 Ga0501083_0153775 3300049744 Bacteria 1506
940 Ga0501266_053687 3300049763 Bacteria 629
941 Ga0501035_0099237 3300049822 Bacteria 2556
942 Ga0501035_0584174 3300049822 Bacteria 912
943 Ga0501045_0136534 3300049824 Bacteria 1823
944 Ga0501045_0209857 3300049824 Bacteria 1451
945 Ga0501045_0967870 3300049824 Unclassified 624
946 nmdc:mga03683_198407_c1 3300050489 Bacteria 920
947 nmdc:mga03683_89851_c1 3300050489 Bacteria 1338
948 nmdc:mga03n38_883163_c1 3300050490 Bacteria 524
949 nmdc:mga00v17_159705_c1 3300050491 Bacteria 1450
950 nmdc:mga00v17_993972_c1 3300050491 Bacteria 528
951 nmdc:mga0k408_93283_c1 3300050493 Bacteria 1770
952 nmdc:mga07m45_109884_c1 3300050496 Bacteria 1587
953 nmdc:mga07m45_567004_c1 3300050496 Bacteria 656
954 nmdc:mga07m45_6996_c1 3300050496 Bacteria 5739
955 nmdc:mga05p37_1058427_c1 3300050507 Unclassified 855
956 nmdc:mga05p37_1108960_c1 3300050507 Unclassified 828
957 nmdc:mga05p37_110_c1 3300050507 Bacteria 74328
958 nmdc:mga05p37_1316955_c1 3300050507 Unclassified 735
959 nmdc:mga05p37_191638_c1 3300050507 Bacteria 2482
960 nmdc:mga05p37_2226032_c1 3300050507 Bacteria 508
961 nmdc:mga05p37_263830_c1 3300050507 Bacteria 2060
962 nmdc:mga05p37_27580_c1 3300050507 Bacteria 4507
963 nmdc:mga05p37_282896_c1 3300050507 Bacteria 1977
964 nmdc:mga05p37_291371_c1 3300050507 Unclassified 1943
965 nmdc:mga05p37_291912_c1 3300050507 Bacteria 1941
966 nmdc:mga05p37_443022_c1 3300050507 Bacteria 1506
967 nmdc:mga05p37_471361_c1 3300050507 Bacteria 1449
968 nmdc:mga05p37_61726_c1 3300050507 Bacteria 4614
969 nmdc:mga05p37_63925_c1 3300050507 Bacteria 4529
970 nmdc:mga05p37_664669_c1 3300050507 Unclassified 1164
971 nmdc:mga05p37_7229_c1 3300050507 Bacteria 13097
972 nmdc:mga05p37_7384_c1 3300050507 Bacteria 12965
973 nmdc:mga05p37_817391_c1 3300050507 Bacteria 1017
974 nmdc:mga09592_10132_c1 3300050508 Bacteria 7668
975 nmdc:mga09592_1195531_c1 3300050508 Unclassified 629
976 nmdc:mga09592_170124_c1 3300050508 Bacteria 1884
977 nmdc:mga09592_1726713_c1 3300050508 Bacteria 504
978 nmdc:mga09592_567239_c1 3300050508 Bacteria 974
979 nmdc:mga09592_716899_c1 3300050508 Bacteria 850
980 nmdc:mga0qj67_1071473_c1 3300050509 Unclassified 630
981 nmdc:mga0qj67_374405_c1 3300050509 Bacteria 1150
982 nmdc:mga0qj67_516971_c1 3300050509 Bacteria 959
983 nmdc:mga0qj67_529412_c1 3300050509 Bacteria 946
984 nmdc:mga0qj67_862602_c1 3300050509 Bacteria 715
985 nmdc:mga0qj67_950287_c1 3300050509 Bacteria 676
986 nmdc:mga06r32_1165991_c1 3300050510 Bacteria 718
987 nmdc:mga06r32_1247500_c1 3300050510 Bacteria 688
988 nmdc:mga06r32_1638535_c1 3300050510 Bacteria 581
989 nmdc:mga06r32_21252_c1 3300050510 Bacteria 5989
990 nmdc:mga06r32_219474_c1 3300050510 Bacteria 1890
991 nmdc:mga06r32_269116_c1 3300050510 Bacteria 1691
992 nmdc:mga06r32_3279_c1 3300050510 Bacteria 14490
993 nmdc:mga06r32_798375_c1 3300050510 Bacteria 905
994 nmdc:mga06r32_857139_c1 3300050510 Bacteria 867
995 nmdc:mga08y16_128041_c1 3300050511 Unclassified 1051
996 nmdc:mga08y16_138025_c1 3300050511 Bacteria 2535
997 nmdc:mga08y16_33525_c1 3300050511 Bacteria 5393
998 nmdc:mga08y16_694263_c1 3300050511 Unclassified 1018
999 nmdc:mga08y16_828559_c1 3300050511 Unclassified 916
1000 nmdc:mga0n895_1078145_c1 3300050512 Bacteria 781
1001 nmdc:mga0n895_11608_c1 3300050512 Bacteria 7867
1002 nmdc:mga0n895_1394957_c1 3300050512 Unclassified 669
1003 nmdc:mga0n895_2236932_c1 3300050512 Unclassified 502
1004 nmdc:mga0n895_288082_c1 3300050512 Bacteria 1665
1005 nmdc:mga0n895_329972_c1 3300050512 Bacteria 1546
1006 nmdc:mga0n895_385_c1 3300050512 Bacteria 29874
1007 nmdc:mga0n895_390238_c1 3300050512 Bacteria 1408
1008 nmdc:mga0n895_535692_c1 3300050512 Bacteria 1178
1009 nmdc:mga0n895_817741_c1 3300050512 Unclassified 921
1010 nmdc:mga0n895_97866_c1 3300050512 Bacteria 2940
1011 nmdc:mga0rr50_1179_c1 3300050513 Bacteria 14205
1012 nmdc:mga0rr50_171677_c1 3300050513 Unclassified 1767
1013 nmdc:mga0rr50_1751886_c1 3300050513 Bacteria 523
1014 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
1015 nmdc:mga0rr50_847261_c1 3300050513 Bacteria 780
1016 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
1017 nmdc:mga08x19_1271053_c1 3300050514 Unclassified 521
1018 nmdc:mga08x19_174243_c1 3300050514 Bacteria 1466
1019 nmdc:mga08x19_2049_c1 3300050514 Bacteria 12353
1020 nmdc:mga0a205_1118606_c1 3300050515 Bacteria 635
1021 nmdc:mga0a205_11522_c1 3300050515 Bacteria 6294
1022 nmdc:mga0a205_127884_c1 3300050515 Bacteria 2441
1023 nmdc:mga0a205_129726_c1 3300050515 Unclassified 2422
1024 nmdc:mga0a205_1302256_c1 3300050515 Bacteria 574
1025 nmdc:mga0a205_1419280_c1 3300050515 Unclassified 542
1026 nmdc:mga0a205_149691_c1 3300050515 Bacteria 2234
1027 nmdc:mga0a205_179057_c1 3300050515 Bacteria 2014
1028 nmdc:mga0a205_182221_c1 3300050515 Bacteria 1994
1029 nmdc:mga0a205_243181_c1 3300050515 Bacteria 1680
1030 nmdc:mga0a205_25791_c1 3300050515 Bacteria 5600
1031 nmdc:mga0a205_343778_c1 3300050515 Bacteria 1360
1032 nmdc:mga0a205_34397_c1 3300050515 Bacteria 4862
1033 nmdc:mga0a205_50794_c1 3300050515 Bacteria 4003
1034 nmdc:mga0a205_579282_c1 3300050515 Bacteria 976
1035 nmdc:mga0a205_719758_c1 3300050515 Bacteria 847
1036 nmdc:mga0a205_758381_c1 3300050515 Unclassified 819
1037 nmdc:mga0a205_864773_c1 3300050515 Bacteria 751
1038 Ga0500555_160871 3300053103 Bacteria 548
1039 Ga0500577_0001894 3300053142 Bacteria 5364
1040 Ga0500588_0365936 3300053146 Bacteria 548
1041 Ga0500603_176393 3300053150 Bacteria 671
1042 Ga0501084_0068540 3300054114 Bacteria 2970
1043 Ga0501084_0148283 3300054114 Bacteria 1976
1044 Ga0501084_0446384 3300054114 Bacteria 1094
1045 Ga0501084_0883388 3300054114 Bacteria 752
1046 Ga0590071_002004 3300059421 Bacteria 5211
1047 Ga0590075_001711 3300059424 Bacteria 5383
1048 Ga0590077_001254 3300059426 Bacteria 6075
1049 Ga0501082_0005096 3300060353 Bacteria 11447
1050 Ga0501082_0068545 3300060353 Bacteria 3054
1051 Ga0501082_0091570 3300060353 Bacteria 2625
1052 Ga0530510_0456194 3300061734 Bacteria 967
1053 2915608251 2915606848 Bacteria 6032732
1054 Ga0501279_009432
1055 SwRhRL2b_contig_3114430
1056 MBSR1b_contig_213173
1057 2214745541
1058 JGI24752J21851_1000874
1059 JGI24747J21853_1026031
1060 JGI24743J22301_10002207
1061 JGI24749J21850_1024517
1062 JGI24751J29686_10002073
1063 rootH2_10268713
1064 Ga0065716_1008099
1065 Ga0065704_10091348
1066 Ga0065712_10073464
1067 Ga0065712_10092751
1068 Ga0065707_10232856
1069 Ga0065707_11023869
1070 Ga0070658_10043754
1071 Ga0070658_10134230
1072 Ga0070658_10382133
1073 Ga0070676_10017142
1074 Ga0070676_10081741
1075 Ga0070676_10373200
1076 Ga0070676_10375048
1077 Ga0070676_10871519
1078 Ga0070676_11332059
1079 Ga0070683_100007960
1080 Ga0070690_100011015
1081 Ga0070670_100023522
1082 Ga0070670_100241064
1083 Ga0070677_10003984
1084 Ga0068869_100020514
1085 Ga0068869_101085977
1086 Ga0070666_10028805
1087 Ga0070666_10838585
1088 Ga0070680_100733016
1089 Ga0070680_100849585
1090 Ga0070682_100011962
1091 Ga0070682_100168622
1092 Ga0068868_100016343
1093 Ga0070660_100002895
1094 Ga0070660_100706381
1095 Ga0070689_100006913
1096 Ga0070689_100953636
1097 Ga0070689_101057780
1098 Ga0070687_100004408
1099 Ga0070687_100109582
1100 Ga0070687_100390064
1101 Ga0070687_101249704
1102 Ga0070661_100004075
1103 Ga0070661_100315941
1104 Ga0070661_100535864
1105 Ga0070692_10530496
1106 Ga0070668_100094026
1107 Ga0070668_100334067
1108 Ga0070668_100931438
1109 Ga0070669_100002890
1110 Ga0070669_100026301
1111 Ga0070669_100129044
1112 Ga0070669_100236679
1113 Ga0070675_100010735
1114 Ga0070675_101070019
1115 Ga0070671_101684216
1116 Ga0070674_100038787
1117 Ga0070674_100082463
1118 Ga0070673_100015210
1119 Ga0070673_100446584
1120 Ga0070673_101179954
1121 Ga0070688_100005040
1122 Ga0070659_100009071
1123 Ga0070667_100082363
1124 Ga0070667_100094629
1125 Ga0070667_101148949
1126 Ga0070703_10111984
1127 Ga0070709_10893696
1128 Ga0070714_101637851
1129 Ga0070714_102171047
1130 Ga0070701_10077572
1131 Ga0070701_10243899
1132 Ga0070701_10723674
1133 Ga0070711_100000051
1134 Ga0070711_101221468
1135 Ga0070705_100030846
1136 Ga0070705_100628653
1137 Ga0070705_100667159
1138 Ga0070705_101233560
1139 Ga0070700_100175064
1140 Ga0070700_100568716
1141 Ga0070700_101865357
1142 Ga0070700_102027299
1143 Ga0070694_100052087
1144 Ga0070694_100062368
1145 Ga0070694_100214911
1146 Ga0070694_100621731
1147 Ga0070694_101127156
1148 Ga0070694_101386881
1149 Ga0070708_100242184
1150 Ga0070708_100394888
1151 Ga0070663_100003378
1152 Ga0070662_101270835
1153 Ga0068867_100021434
1154 Ga0068867_100128918
1155 Ga0068867_100323976
1156 Ga0070707_100119380
1157 Ga0070707_100171712
1158 Ga0070707_100671578
1159 Ga0070707_100705755
1160 Ga0070707_100883332
1161 Ga0070707_100970239
1162 Ga0070698_100042534
1163 Ga0070698_100470658
1164 Ga0070698_100530303
1165 Ga0070698_100653094
1166 Ga0070698_100772673
1167 Ga0070698_100966318
1168 Ga0070699_100000009
1169 Ga0070699_100016451
1170 Ga0070699_100257169
1171 Ga0070699_100446043
1172 Ga0070679_102200901
1173 Ga0070684_100011456
1174 Ga0070697_100042852
1175 Ga0070697_100705475
1176 Ga0070697_100938603
1177 Ga0070697_101131974
1178 Ga0070697_101394811
1179 Ga0070697_101689958
1180 Ga0068853_100004560
1181 Ga0070672_100006168
1182 Ga0070672_100072418
1183 Ga0070672_100747285
1184 Ga0070686_100001711
1185 Ga0070695_100002795
1186 Ga0070695_100022182
1187 Ga0070695_100079159
1188 Ga0070695_100305947
1189 Ga0070695_100419822
1190 Ga0070695_100844823
1191 Ga0070695_101393723
1192 Ga0070696_100000103
1193 Ga0070696_100067737
1194 Ga0070696_100079449
1195 Ga0070696_100508624
1196 Ga0070696_100971407
1197 Ga0070693_100353747
1198 Ga0070665_100023633
1199 Ga0070665_100116948
1200 Ga0070665_100459589
1201 Ga0070704_100006459
1202 Ga0070704_100023915
1203 Ga0070704_100038576
1204 Ga0070704_100043376
1205 Ga0070704_100146573
1206 Ga0070704_100242049
1207 Ga0070704_102076716
1208 Ga0068855_102385966
1209 Ga0070664_100048240
1210 Ga0070664_100570784
1211 Ga0070664_101341984
1212 Ga0068857_100001804
1213 Ga0068854_100045147
1214 Ga0068854_100057474
1215 Ga0068856_100055851
1216 Ga0070702_100002309
1217 Ga0070702_100012637
1218 Ga0068852_100003870
1219 Ga0068852_101141155
1220 Ga0068859_100018189
1221 Ga0068859_100301772
1222 Ga0068859_100534081
1223 Ga0068859_100717303
1224 Ga0068859_101909320
1225 Ga0068859_102580169
1226 Ga0068864_100001718
1227 Ga0068864_100039339
1228 Ga0068866_10040011
1229 Ga0068866_10524686
1230 Ga0068866_11041945
1231 Ga0068861_100001000
1232 Ga0068861_100078330
1233 Ga0068861_100104279
1234 Ga0068861_100215185
1235 Ga0068851_10001146
1236 Ga0068851_10466862
1237 Ga0068851_10608771
1238 Ga0068851_11081696
1239 Ga0068870_10003241
1240 Ga0068870_10567605
1241 Ga0068863_100217439
1242 Ga0068863_100316452
1243 Ga0068863_100539341
1244 Ga0068863_100984050
1245 Ga0068863_101085661
1246 Ga0068863_102479746
1247 Ga0068858_100019053
1248 Ga0068858_100024116
1249 Ga0068858_100178846
1250 Ga0068858_100860622
1251 Ga0068858_100906979
1252 Ga0068860_100009098
1253 Ga0068860_100022746
1254 Ga0068860_100099712
1255 Ga0068860_100461885
1256 Ga0068860_100661284
1257 Ga0068860_102715438
1258 Ga0068862_100019318
1259 Ga0068862_100043106
1260 Ga0068862_100117474
1261 Ga0068862_100140103
1262 Ga0068862_100776106
1263 Ga0068862_101122991
1264 Ga0081455_10001038
1265 Ga0081455_10039434
1266 Ga0081455_10160748
1267 Ga0081538_10020682
1268 Ga0081539_10101720
1269 Ga0081539_10168543
1270 Ga0081539_10199199
1271 Ga0070717_10155638
1272 Ga0070717_10223460
1273 Ga0070717_10278778
1274 Ga0075365_10189297
1275 Ga0075363_100034527
1276 Ga0075364_10130725
1277 Ga0075432_10030950
1278 Ga0070715_10393561
1279 Ga0070715_11096052
1280 Ga0070716_100171158
1281 Ga0070716_100182271
1282 Ga0070716_100409190
1283 Ga0075362_10237329
1284 Ga0075367_10752284
1285 Ga0075367_10883053
1286 Ga0075366_10100317
1287 Ga0075370_10002939
1288 Ga0068871_100206828
1289 Ga0075428_100012311
1290 Ga0075428_100024558
1291 Ga0075428_100105243
1292 Ga0075428_100110459
1293 Ga0075428_100188429
1294 Ga0075428_100462373
1295 Ga0075428_100726168
1296 Ga0075428_100807922
1297 Ga0075428_100827625
1298 Ga0075428_101424937
1299 Ga0075430_100021963
1300 Ga0075430_100077636
1301 Ga0075430_100244976
1302 Ga0075430_100506373
1303 Ga0075430_101021477
1304 Ga0075431_100005816
1305 Ga0075431_100039396
1306 Ga0075431_100094535
1307 Ga0075431_100487730
1308 Ga0075431_100671266
1309 Ga0075431_101124541
1310 Ga0075431_101630603
1311 Ga0075431_102216999
1312 Ga0075433_10027104
1313 Ga0075433_10140862
1314 Ga0075433_10148779
1315 Ga0075433_10184747
1316 Ga0075433_10325139
1317 Ga0075433_10568907
1318 Ga0075433_10658115
1319 Ga0075433_10750232
1320 Ga0075433_11038011
1321 Ga0075433_11448877
1322 Ga0075434_100126522
1323 Ga0075434_100215004
1324 Ga0075434_100339621
1325 Ga0075434_100587828
1326 Ga0075434_100805161
1327 Ga0075434_100881677
1328 Ga0075434_101196689
1329 Ga0075434_102182411
1330 Ga0075434_102449067
1331 Ga0075429_100020146
1332 Ga0075429_100226299
1333 Ga0075429_100235586
1334 Ga0075429_100516959
1335 Ga0075429_100715860
1336 Ga0075429_101417303
1337 Ga0068865_100000360
1338 Ga0068865_100002232
1339 Ga0068865_100682004
1340 Ga0068865_100927080
1341 Ga0075436_100002851
1342 Ga0075436_100004654
1343 Ga0075436_100809718
1344 Ga0075436_100963202
1345 Ga0097620_100018189
1346 Ga0097620_100301763
1347 Ga0097620_100395269
1348 Ga0097620_100534021
1349 Ga0097620_100717395
1350 Ga0097620_101909009
1351 Ga0097620_102580607
1352 Ga0075435_100000111
1353 Ga0075435_100316070
1354 Ga0075435_100435403
1355 Ga0075435_100640595
1356 Ga0099794_10020192
1357 Ga0099794_10240125
1358 Ga0099794_10387483
1359 Ga0105250_10007238
1360 Ga0105250_10494056
1361 Ga0105240_10002677
1362 Ga0105240_10003167
1363 Ga0105240_10424007
1364 Ga0105240_11276557
1365 Ga0111539_10005224
1366 Ga0111539_10038745
1367 Ga0111539_10126020
1368 Ga0111539_10227833
1369 Ga0111539_10442022
1370 Ga0111539_10444905
1371 Ga0111539_10893096
1372 Ga0105245_10001566
1373 Ga0105245_10024225
1374 Ga0105245_10589888
1375 Ga0105245_10651527
1376 Ga0105245_11352387
1377 Ga0105247_10001727
1378 Ga0105247_10124295
1379 Ga0105247_11315699
1380 Ga0114129_10004465
1381 Ga0114129_10024020
1382 Ga0114129_10027059
1383 Ga0114129_10029242
1384 Ga0114129_10054116
1385 Ga0114129_10073740
1386 Ga0114129_10103447
1387 Ga0114129_10130264
1388 Ga0114129_10153433
1389 Ga0114129_10353964
1390 Ga0114129_10382746
1391 Ga0114129_10402046
1392 Ga0114129_10416987
1393 Ga0114129_10460915
1394 Ga0114129_10638064
1395 Ga0114129_10640642
1396 Ga0114129_10946993
1397 Ga0114129_11011320
1398 Ga0114129_11067762
1399 Ga0114129_11224636
1400 Ga0114129_11292656
1401 Ga0114129_11565965
1402 Ga0114129_11597235
1403 Ga0114129_11725226
1404 Ga0114129_11814897
1405 Ga0114129_12061385
1406 Ga0114129_12210745
1407 Ga0114129_12590733
1408 Ga0114129_13161267
1409 Ga0105243_10234765
1410 Ga0105243_10333506
1411 Ga0105243_10343482
1412 Ga0105243_10396872
1413 Ga0105241_10017322
1414 Ga0105241_10239578
1415 Ga0105241_10811529
1416 Ga0105241_11449215
1417 Ga0105241_11668822
1418 Ga0105241_12029039
1419 Ga0105242_10011483
1420 Ga0105242_10058808
1421 Ga0105242_10129723
1422 Ga0105242_10504353
1423 Ga0105242_10556794
1424 Ga0105248_10004184
1425 Ga0105248_10004562
1426 Ga0105248_10100894
1427 Ga0105248_10183652
1428 Ga0105248_10384705
1429 Ga0105248_11014980
1430 Ga0105248_12063197
1431 Ga0105237_10021308
1432 Ga0105237_12245915
1433 Ga0105238_10060584
1434 Ga0105238_10072425
1435 Ga0105238_10080965
1436 Ga0105238_10143285
1437 Ga0105238_11279981
1438 Ga0105249_10010097
1439 Ga0105249_10348202
1440 Ga0105249_10845741
1441 Ga0105249_10848752
1442 Ga0105249_12628690
1443 Ga0105239_10005297
1444 Ga0105239_10045783
1445 Ga0105239_10264712
1446 Ga0105239_10700326
1447 Ga0105239_11099880
1448 Ga0105239_11226065
1449 Ga0105239_12128644
1450 Ga0105239_12196971
1451 Ga0105246_10001936
1452 Ga0105246_10013762
1453 Ga0157341_1005136
1454 Ga0157316_1006507
1455 Ga0157338_1049723
1456 Ga0157373_10001863
1457 Ga0157371_10005089
1458 Ga0157370_10912702
1459 Ga0157370_11223972
1460 Ga0157369_10008338
1461 Ga0157374_10004208
1462 Ga0157374_10165741
1463 Ga0157374_10502983
1464 Ga0157374_10919467
1465 Ga0157378_10182173
1466 Ga0157378_10350418
1467 Ga0157378_11640700
1468 Ga0157378_11706506
1469 Ga0163162_10004988
1470 Ga0163162_10012067
1471 Ga0163162_10115746
1472 Ga0163162_10383180
1473 Ga0163162_10646309
1474 Ga0163162_10909595
1475 Ga0163162_11841257
1476 Ga0157375_10538061
1477 Ga0157375_11047000
1478 Ga0157375_11406180
1479 Ga0157375_13012617
1480 Ga0163163_10001132
1481 Ga0163163_10042111
1482 Ga0163163_10370235
1483 Ga0163163_10397379
1484 Ga0157380_10015898
1485 Ga0157380_10073795
1486 Ga0157380_10200531
1487 Ga0157380_10219385
1488 Ga0157380_10414357
1489 Ga0157380_11519098
1490 Ga0157377_10000687
1491 Ga0157379_10020264
1492 Ga0157379_10036472
1493 Ga0157379_10079777
1494 Ga0157379_10325424
1495 Ga0157379_10927584
1496 Ga0157379_11844518
1497 Ga0157379_12596892
1498 Ga0157376_10012662
1499 Ga0157376_10114169
1500 Ga0157376_10317197
1501 Ga0157376_11452082
1502 Ga0163161_10017543
1503 Ga0206350_10760061
1504 Ga0213876_10019903
1505 Ga0213871_10243856
1506 Ga0224712_10022644
1507 Ga0209675_1086684
1508 Ga0207697_10001950
1509 Ga0207656_10003429
1510 Ga0207656_10166426
1511 Ga0207653_10005585
1512 Ga0207682_10008921
1513 Ga0207642_10220963
1514 Ga0207642_10315432
1515 Ga0207642_11065289
1516 Ga0207710_10005739
1517 Ga0207710_10052259
1518 Ga0207688_10239493
1519 Ga0207680_10019037
1520 Ga0207680_10476358
1521 Ga0207647_10006539
1522 Ga0207647_10740891
1523 Ga0207685_10714178
1524 Ga0207699_10864754
1525 Ga0207699_11359150
1526 Ga0207645_10001595
1527 Ga0207645_10011410
1528 Ga0207645_10385810
1529 Ga0207645_11047211
1530 Ga0207643_10000412
1531 Ga0207643_10502736
1532 Ga0207705_10022679
1533 Ga0207705_10970615
1534 Ga0207684_10007234
1535 Ga0207684_10036455
1536 Ga0207684_10909595
1537 Ga0207654_10120644
1538 Ga0207654_10389331
1539 Ga0207654_10590537
1540 Ga0207707_11327534
1541 Ga0207695_10000572
1542 Ga0207695_10033659
1543 Ga0207695_10273318
1544 Ga0207671_10088470
1545 Ga0207671_10506236
1546 Ga0207663_10000003
1547 Ga0207663_10047871
1548 Ga0207663_10462940
1549 Ga0207662_10013125
1550 Ga0207662_10039918
1551 Ga0207662_10557791
1552 Ga0207657_10006949
1553 Ga0207649_10002415
1554 Ga0207649_10200356
1555 Ga0207649_10346540
1556 Ga0207649_10350535
1557 Ga0207646_10063924
1558 Ga0207646_10092389
1559 Ga0207646_10172997
1560 Ga0207646_10311307
1561 Ga0207646_10482974
1562 Ga0207646_10569558
1563 Ga0207646_10694788
1564 Ga0207681_10006153
1565 Ga0207681_10117867
1566 Ga0207681_10596757
1567 Ga0207694_10011935
1568 Ga0207694_10116729
1569 Ga0207694_10286119
1570 Ga0207650_10000024
1571 Ga0207650_10359302
1572 Ga0207659_10017317
1573 Ga0207659_10695544
1574 Ga0207659_11494386
1575 Ga0207687_10032787
1576 Ga0207687_10114252
1577 Ga0207687_10875701
1578 Ga0207687_11190547
1579 Ga0207700_10851389
1580 Ga0207700_11012503
1581 Ga0207664_11867471
1582 Ga0207644_10012416
1583 Ga0207690_10000116
1584 Ga0207690_10135709
1585 Ga0207706_10003335
1586 Ga0207706_10349050
1587 Ga0207686_10029625
1588 Ga0207686_10130295
1589 Ga0207709_10016036
1590 Ga0207670_10010066
1591 Ga0207670_10368704
1592 Ga0207669_10267034
1593 Ga0207669_10866910
1594 Ga0207669_11783356
1595 Ga0207704_10003029
1596 Ga0207704_10041879
1597 Ga0207704_10970277
1598 Ga0207704_11312637
1599 Ga0207704_11777113
1600 Ga0207665_10100154
1601 Ga0207665_10358593
1602 Ga0207665_10888062
1603 Ga0207691_10000072
1604 Ga0207691_10063684
1605 Ga0207691_10282587
1606 Ga0207691_10548433
1607 Ga0207691_10715056
1608 Ga0207691_10721342
1609 Ga0207691_11118279
1610 Ga0207711_10002809
1611 Ga0207711_10007162
1612 Ga0207711_10048635
1613 Ga0207711_10191294
1614 Ga0207711_10937246
1615 Ga0207711_11037697
1616 Ga0207711_11785453
1617 Ga0207689_10001019
1618 Ga0207689_10153264
1619 Ga0207689_10384184
1620 Ga0207689_11460181
1621 Ga0207661_10001629
1622 Ga0207679_10000040
1623 Ga0207679_10120230
1624 Ga0207679_10213060
1625 Ga0207667_10175696
1626 Ga0207651_10013462
1627 Ga0207651_10083194
1628 Ga0207651_10880954
1629 Ga0207712_10040318
1630 Ga0207712_10128136
1631 Ga0207712_10415241
1632 Ga0207668_10044917
1633 Ga0207668_10059023
1634 Ga0207668_12081129
1635 Ga0207640_10006561
1636 Ga0207640_10046662
1637 Ga0207640_11392218
1638 Ga0207658_10007620
1639 Ga0207658_10031984
1640 Ga0207658_10460088
1641 Ga0207658_10778193
1642 Ga0207658_11993567
1643 Ga0207677_10022824
1644 Ga0207677_10025225
1645 Ga0207677_11521303
1646 Ga0207703_10011299
1647 Ga0207703_10013259
1648 Ga0207703_10104931
1649 Ga0207703_11036511
1650 Ga0207703_11776600
1651 Ga0207639_10011738
1652 Ga0207678_10002689
1653 Ga0207708_10000578
1654 Ga0207708_10449053
1655 Ga0207708_10634285
1656 Ga0207708_11111971
1657 Ga0207708_11392362
1658 Ga0207708_11720471
1659 Ga0207702_10042486
1660 Ga0207641_10000030
1661 Ga0207641_10134151
1662 Ga0207641_10412611
1663 Ga0207641_11189083
1664 Ga0207641_11198150
1665 Ga0207641_11670514
1666 Ga0207641_12305032
1667 Ga0207648_10001749
1668 Ga0207648_10058501
1669 Ga0207648_10330836
1670 Ga0207648_10352518
1671 Ga0207648_11473324
1672 Ga0207676_10000256
1673 Ga0207676_10140970
1674 Ga0207676_10193595
1675 Ga0207676_10520753
1676 Ga0207676_12098518
1677 Ga0207674_10002761
1678 Ga0207675_100002584
1679 Ga0207675_100018872
1680 Ga0207675_100233552
1681 Ga0207675_101943726
1682 Ga0207675_102131555
1683 Ga0207675_102222187
1684 Ga0207683_10000662
1685 Ga0207698_10029473
1686 Ga0207698_11119531
1687 Ga0209969_1074844
1688 Ga0209970_1050903
1689 Ga0209588_1016688
1690 Ga0209588_1200472
1691 Ga0207428_10002611
1692 Ga0207428_10040084
1693 Ga0207428_10118634
1694 Ga0207428_10479911
1695 Ga0207428_10724741
1696 Ga0265354_1000208
1697 Ga0268266_10000003
1698 Ga0268266_10005234
1699 Ga0268266_10161176
1700 Ga0268266_10180615
1701 Ga0268265_10004713
1702 Ga0268265_10016427
1703 Ga0268265_10458172
1704 Ga0268265_10714406
1705 Ga0268265_11671659
1706 Ga0268265_11968159
1707 Ga0268264_10004409
1708 Ga0268264_10105485
1709 Ga0268264_10741953
1710 Ga0268264_10866014
1711 Ga0268264_10912493
1712 Ga0268264_11389480
1713 Ga0268264_11570531
1714 Ga0265322_10017324
1715 Ga0265322_10177346
1716 Ga0307517_10022064
1717 Ga0307517_10132566
1718 Ga0307515_10356942
1719 Ga0265338_10031678
1720 Ga0265338_10239934
1721 Ga0265770_1002281
1722 Ga0265765_1004549
1723 Ga0265330_10050798
1724 Ga0265332_10000340
1725 Ga0265328_10020289
1726 Ga0265320_10009240
1727 Ga0265329_10017851
1728 Ga0265340_10176585
1729 Ga0265331_10000185
1730 Ga0265327_10001070
1731 Ga0265316_10001527
1732 Ga0265316_10017451
1733 Ga0307408_100565363
1734 Ga0307508_10210784
1735 Ga0307508_10348269
1736 Ga0265314_10000268
1737 Ga0265342_10007616
1738 Ga0265342_10022755
1739 Ga0307516_10018686
1740 Ga0307516_10568203
1741 Ga0307405_10106507
1742 Ga0307405_10763792
1743 Ga0307405_11335271
1744 Ga0307405_11966969
1745 Ga0307413_10004749
1746 Ga0307410_10321879
1747 Ga0307410_10625372
1748 Ga0307410_11305721
1749 Ga0307406_10078563
1750 Ga0307406_10193174
1751 Ga0307407_10678415
1752 Ga0307412_10011236
1753 Ga0307412_10143018
1754 Ga0307409_100332907
1755 Ga0307409_100336594
1756 Ga0307416_100148819
1757 Ga0307416_100261620
1758 Ga0307416_102527826
1759 Ga0307414_11546545
1760 Ga0307411_10127139
1761 Ga0307411_10215646
1762 Ga0307411_11145115
1763 Ga0307415_100018032
1764 Ga0307415_100085027
1765 Ga0307415_101404478
1766 Ga0373930_0000891
1767 Ga0373948_0000553
1768 Ga0373948_0030044
1769 Ga0373950_0002266
1770 Ga0373958_0010144
1771 Ga0373959_0000668
1772 Ga0373938_0001043
1773 Ga0373926_0111296
1774 Ga0373928_0003857
1775 Ga0373929_0001922
1776 Ga0373929_0144372
1777 Ga0373940_0002298
1778 Ga0373940_0299031
1779 Ga0373940_0344466
1780 Ga0373944_0298023
1781 Ga0373949_0005397
1782 Ga0373951_0007568
1783 Ga0373951_0164012
1784 Ga0373952_0009076
1785 Ga0373932_0000420
1786 Ga0373936_0002083
1787 Ga0373936_0049723
1788 Ga0373939_0000402
1789 Ga0373939_0001234
1790 Ga0373941_0000594
1791 Ga0373960_0001640
1792 Ga0373960_0184128
1793 Ga0373960_0331369
1794 Ga0373943_0405134
1795 Ga0373943_0514621
1796 Ga0373946_0773945
1797 Ga0373955_0885879
1798 Ga0373942_0001546
1799 Ga0373961_0002215
1800 Ga0373961_0188850
1801 Ga0373962_0002277
1802 Ga0373962_0004831
1803 Ga0373931_0006713
1804 Ga0373931_0020329
1805 Ga0373931_0455970
1806 Ga0373935_0187972
1807 Ga0373935_0756600
1808 Ga0373935_1202491
1809 Ga0373927_0114765
1810 Ga0373933_0033790
1811 Ga0373947_0111342
1812 Ga0373937_0357266
1813 Ga0373925_0166998
1814 Ga0373925_0385574
1815 Ga0395905_0040911
1816 Ga0436365_0773270
1817 Ga0436360_0193460
1818 Ga0436360_1063581
1819 Ga0436362_0108834
1820 Ga0439465_0023763
1821 Ga0451789_1067098
1822 Ga0451800_0834949
1823 Ga0451802_0652043
1824 Ga0451804_0956971
1825 Ga0451807_1337868
1826 Ga0451837_1350587
1827 Ga0451853_3024037
1828 Ga0439431_0079117
1829 Ga0439441_006024
1830 Ga0450910_104531
1831 Ga0439435_0085167
1832 Ga0451577_0002849
1833 Ga0451577_0558772
1834 Ga0451577_0717526
1835 Ga0451577_1084754
1836 Ga0451577_1910139
1837 Ga0451577_2037027
1838 Ga0466969_0000504
1839 Ga0466972_0317196
1840 Ga0453683_0000048
1841 Ga0453683_0061455
1842 Ga0466966_0014632
1843 Ga0466961_0070688
1844 Ga0466964_0012334
1845 Ga0453684_0002176
1846 Ga0453684_0547269
1847 Ga0453684_0918985
1848 Ga0466971_0000577
1849 Ga0466968_0048415
1850 Ga0466970_0005403
1851 Ga0466957_0007645
1852 Ga0466959_0009199
1853 Ga0466959_0252103
1854 Ga0451576_0004001
1855 Ga0451576_0039189
1856 Ga0451576_0294104
1857 Ga0451576_0449045
1858 Ga0451576_0740654
1859 Ga0451576_1060610
1860 Ga0451576_1216433
1861 Ga0451576_1403529
1862 Ga0466958_0050222
1863 Ga0466967_0130585
1864 Ga0495592_0112889
1865 Ga0495603_0112955
1866 Ga0495603_0238889
1867 Ga0495603_0482646
1868 Ga0495580_0668786
1869 Ga0495582_0223128
1870 Ga0495594_0221488
1871 Ga0495594_0454915
1872 Ga0495628_0112991
1873 Ga0495628_0406305
1874 Ga0495652_0025965
1875 Ga0495652_0691273
1876 Ga0495586_0205572
1877 Ga0495645_0080035
1878 Ga0495645_0083512
1879 Ga0495633_0139561
1880 Ga0495668_0183206
1881 Ga0495668_0555241
1882 Ga0495635_0739562
1883 Ga0495635_0779423
1884 Ga0495599_0003280
1885 Ga0495647_0026791
1886 Ga0495647_0169157
1887 Ga0495658_0327382
1888 Ga0495658_0569146
1889 Ga0495674_0612809
1890 Ga0495684_0347999
1891 Ga0495686_0076077
1892 Ga0495686_0255568
1893 Ga0495602_0064951
1894 Ga0496100_1023399
1895 Ga0496101_0250701
1896 Ga0496102_0038967
1897 Ga0496102_0045885
1898 Ga0496102_0448529
1899 Ga0496103_0078449
1900 Ga0496104_0158704
1901 Ga0496104_0281845
1902 Ga0496104_0747497
1903 Ga0496104_0781815
1904 Ga0496104_0848895
1905 Ga0496104_0875545
1906 Ga0496105_0048570
1907 Ga0496105_0552775
1908 Ga0496106_0040048
1909 Ga0496107_0197435
1910 Ga0496108_0000567
1911 Ga0496108_0009255
1912 Ga0496108_0321607
1913 Ga0496108_1090616
1914 Ga0496109_0000381
1915 Ga0496109_0605236
1916 Ga0496109_1704196
1917 Ga0496110_0003335
1918 Ga0496110_0309984
1919 Ga0496110_0371036
1920 Ga0496111_0015632
1921 Ga0496112_0000155
1922 Ga0496112_0003145
1923 Ga0496112_0094451
1924 Ga0496113_0005322
1925 Ga0496113_0294357
1926 Ga0496113_0981198
1927 Ga0496115_0003595
1928 Ga0496115_0555226
1929 Ga0496115_0757883
1930 Ga0501299_112050
1931 Ga0501031_0046272
1932 Ga0501032_0053118
1933 Ga0501033_0134990
1934 Ga0501034_0003356
1935 Ga0501034_0675539
1936 Ga0501034_1069816
1937 Ga0501036_0124428
1938 Ga0501036_0636856
1939 Ga0501037_0005432
1940 Ga0501038_0012194
1941 Ga0501039_0185840
1942 Ga0501040_0143739
1943 Ga0501041_0053867
1944 Ga0501041_0346188
1945 Ga0501041_0868447
1946 Ga0501042_0124395
1947 Ga0501042_1150235
1948 Ga0501043_0021196
1949 Ga0501043_0573732
1950 Ga0501043_0684291
1951 Ga0501046_0014620
1952 Ga0501046_0194911
1953 Ga0501046_0609969
1954 Ga0501047_0097004
1955 Ga0501047_0155515
1956 Ga0501047_0410243
1957 Ga0501048_0111577
1958 Ga0501048_1126016
1959 Ga0501068_0103077
1960 Ga0501069_0013416
1961 Ga0501070_0039978
1962 Ga0501070_0548148
1963 Ga0501071_0123423
1964 Ga0501071_0153901
1965 Ga0501072_0072908
1966 Ga0501072_1011588
1967 Ga0501072_1131515
1968 Ga0501073_0055844
1969 Ga0501073_0501732
1970 Ga0501073_0803416
1971 Ga0501074_0114932
1972 Ga0501074_0443767
1973 Ga0501075_0053302
1974 Ga0501075_0906383
1975 Ga0501076_0074944
1976 Ga0501076_0338569
1977 Ga0501076_0580707
1978 Ga0501077_0215694
1979 Ga0501077_0290739
1980 Ga0501199_044918
1981 Ga0501217_002216
1982 Ga0501223_035353
1983 Ga0501079_0003492
1984 Ga0501079_0103649
1985 Ga0501079_0175123
1986 Ga0501079_0410295
1987 Ga0501079_1096657
1988 Ga0501080_0002418
1989 Ga0501080_0027546
1990 Ga0501081_0086237
1991 Ga0501083_0015634
1992 Ga0501083_0153775
1993 Ga0501266_053687
1994 Ga0501035_0099237
1995 Ga0501035_0584174
1996 Ga0501045_0136534
1997 Ga0501045_0209857
1998 Ga0501045_0967870
1999 nmdc:mga03683_198407_c1
2000 nmdc:mga03683_89851_c1
2001 nmdc:mga03n38_883163_c1
2002 nmdc:mga00v17_159705_c1
2003 nmdc:mga00v17_993972_c1
2004 nmdc:mga0k408_93283_c1
2005 nmdc:mga07m45_109884_c1
2006 nmdc:mga07m45_567004_c1
2007 nmdc:mga07m45_6996_c1
2008 nmdc:mga05p37_1058427_c1
2009 nmdc:mga05p37_1108960_c1
2010 nmdc:mga05p37_110_c1
2011 nmdc:mga05p37_1316955_c1
2012 nmdc:mga05p37_191638_c1
2013 nmdc:mga05p37_2226032_c1
2014 nmdc:mga05p37_263830_c1
2015 nmdc:mga05p37_27580_c1
2016 nmdc:mga05p37_282896_c1
2017 nmdc:mga05p37_291371_c1
2018 nmdc:mga05p37_291912_c1
2019 nmdc:mga05p37_443022_c1
2020 nmdc:mga05p37_471361_c1
2021 nmdc:mga05p37_61726_c1
2022 nmdc:mga05p37_63925_c1
2023 nmdc:mga05p37_664669_c1
2024 nmdc:mga05p37_7229_c1
2025 nmdc:mga05p37_7384_c1
2026 nmdc:mga05p37_817391_c1
2027 nmdc:mga09592_10132_c1
2028 nmdc:mga09592_1195531_c1
2029 nmdc:mga09592_170124_c1
2030 nmdc:mga09592_1726713_c1
2031 nmdc:mga09592_567239_c1
2032 nmdc:mga09592_716899_c1
2033 nmdc:mga0qj67_1071473_c1
2034 nmdc:mga0qj67_374405_c1
2035 nmdc:mga0qj67_516971_c1
2036 nmdc:mga0qj67_529412_c1
2037 nmdc:mga0qj67_862602_c1
2038 nmdc:mga0qj67_950287_c1
2039 nmdc:mga06r32_1165991_c1
2040 nmdc:mga06r32_1247500_c1
2041 nmdc:mga06r32_1638535_c1
2042 nmdc:mga06r32_21252_c1
2043 nmdc:mga06r32_219474_c1
2044 nmdc:mga06r32_269116_c1
2045 nmdc:mga06r32_3279_c1
2046 nmdc:mga06r32_798375_c1
2047 nmdc:mga06r32_857139_c1
2048 nmdc:mga08y16_128041_c1
2049 nmdc:mga08y16_138025_c1
2050 nmdc:mga08y16_33525_c1
2051 nmdc:mga08y16_694263_c1
2052 nmdc:mga08y16_828559_c1
2053 nmdc:mga0n895_1078145_c1
2054 nmdc:mga0n895_11608_c1
2055 nmdc:mga0n895_1394957_c1
2056 nmdc:mga0n895_2236932_c1
2057 nmdc:mga0n895_288082_c1
2058 nmdc:mga0n895_329972_c1
2059 nmdc:mga0n895_385_c1
2060 nmdc:mga0n895_390238_c1
2061 nmdc:mga0n895_535692_c1
2062 nmdc:mga0n895_817741_c1
2063 nmdc:mga0n895_97866_c1
2064 nmdc:mga0rr50_1179_c1
2065 nmdc:mga0rr50_171677_c1
2066 nmdc:mga0rr50_1751886_c1
2067 nmdc:mga0rr50_3_c1
2068 nmdc:mga0rr50_847261_c1
2069 nmdc:mga08x19_10_c1
2070 nmdc:mga08x19_1271053_c1
2071 nmdc:mga08x19_174243_c1
2072 nmdc:mga08x19_2049_c1
2073 nmdc:mga0a205_1118606_c1
2074 nmdc:mga0a205_11522_c1
2075 nmdc:mga0a205_127884_c1
2076 nmdc:mga0a205_129726_c1
2077 nmdc:mga0a205_1302256_c1
2078 nmdc:mga0a205_1419280_c1
2079 nmdc:mga0a205_149691_c1
2080 nmdc:mga0a205_179057_c1
2081 nmdc:mga0a205_182221_c1
2082 nmdc:mga0a205_243181_c1
2083 nmdc:mga0a205_25791_c1
2084 nmdc:mga0a205_343778_c1
2085 nmdc:mga0a205_34397_c1
2086 nmdc:mga0a205_50794_c1
2087 nmdc:mga0a205_579282_c1
2088 nmdc:mga0a205_719758_c1
2089 nmdc:mga0a205_758381_c1
2090 nmdc:mga0a205_864773_c1
2091 Ga0500555_160871
2092 Ga0500577_0001894
2093 Ga0500588_0365936
2094 Ga0500603_176393
2095 Ga0501084_0068540
2096 Ga0501084_0148283
2097 Ga0501084_0446384
2098 Ga0501084_0883388
2099 Ga0590071_002004
2100 Ga0590075_001711
2101 Ga0590077_001254
2102 Ga0501082_0005096
2103 Ga0501082_0068545
2104 Ga0501082_0091570
2105 Ga0530510_0456194
2106 2915608251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

1

71

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8glv-assembly1.cif.gz_AR 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.6406 15 61
8j07-assembly1.cif.gz_n8 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.6326 15 61
5wi4-assembly1.cif.gz_C crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5899 6 61
5wi4-assembly1.cif.gz_A crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5896 6 61
5wi4-assembly1.cif.gz_B crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5875 6 61
ID Description Score Start End Superfamily
4hj4A00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.66 12 62 3.30.450.20
2jqhA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5762 17 59 1.20.58.80
3d36B02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.5529 15 69 1.10.287.130
af_Q94255_26_115_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.55 17 88 1.10.225.10
3zdmB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.539 15 55 1.20.5.420
ID Description Score Start End GO Terms
AF-A0A2V8STA0-F1-model_v4 DUF2277 domain-containing protein 1 1 87
AF-A0A529FDB9-F1-model_v4 DUF2277 domain-containing protein 0.9993 1 70
AF-A0A841AF04-F1-model_v4 DUF2277 domain-containing protein 0.9987 1 72
AF-A0A838THA4-F1-model_v4 DUF2277 domain-containing protein 0.994 1 86
AF-A0A3N5PKK7-F1-model_v4 DUF2277 domain-containing protein 0.9874 1 87

Map