F489120

General Info

Members Datasets Scaffolds Average Seq Length
1054 423 1054 50

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1078915|JGI24736J21556_10789151
Length 54
Sequence MPKGNRSIISLECPVCKRRNYSTTKNRRKSQDKLELSKFCPWCRKHTDHKEGKV

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
138 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
139 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
157 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
250 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
253 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
254 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
255 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
263 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
270 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
274 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
275 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
276 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
277 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
278 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
279 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
280 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
281 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
282 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
283 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
284 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
285 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
286 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
287 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
288 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
289 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
290 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
291 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
292 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
293 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
294 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
295 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
296 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
297 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
298 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
299 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
342 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
369 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
376 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
401 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
402 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
405 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
407 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
423 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 3.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 2.18
Rhizosphere 95.16
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004572 3300000549 Bacteria 1794
2 JGI24736J21556_1078915 3300001904 Bacteria 516
3 JGI24752J21851_1019788 3300001976 Bacteria 878
4 JGI24746J21847_1003481 3300001977 Bacteria 2482
5 JGI24747J21853_1004504 3300001978 Bacteria 1253
6 JGI24737J22298_10015109 3300001990 Bacteria 2499
7 JGI24743J22301_10001659 3300001991 Bacteria 3160
8 JGI24750J21931_1010309 3300002070 Bacteria 1216
9 JGI24750J21931_1013551 3300002070 Bacteria 1090
10 JGI24745J21846_1012438 3300002073 Bacteria 977
11 JGI24748J21848_1011226 3300002074 Bacteria 1055
12 JGI24738J21930_10034985 3300002075 Bacteria 1023
13 JGI24749J21850_1001134 3300002076 Bacteria 3786
14 JGI24744J21845_10024765 3300002077 Bacteria 1173
15 JGI24035J26624_1010268 3300002126 Bacteria 929
16 JGI24033J26618_1030436 3300002155 Bacteria 724
17 JGI24742J22300_10046791 3300002244 Bacteria 778
18 JGI24742J22300_10123144 3300002244 Bacteria 513
19 JGI24751J29686_10001570 3300002459 Bacteria 4720
20 rootL2_10015190 3300003322 Bacteria 3006
21 JGI25404J52841_10008784 3300003659 Bacteria 2158
22 Ga0058859_10031327 3300004798 Bacteria 1149
23 Ga0058859_11679412 3300004798 Bacteria 719
24 Ga0058859_11795058 3300004798 Bacteria 749
25 Ga0058860_12109938 3300004801 Bacteria 1732
26 Ga0058860_12218590 3300004801 Bacteria 675
27 Ga0058862_12775106 3300004803 Bacteria 812
28 Ga0058862_12857261 3300004803 Bacteria 1309
29 Ga0065704_10004364 3300005289 Bacteria 3418
30 Ga0065704_10040355 3300005289 Bacteria 1016
31 Ga0065704_10332004 3300005289 Bacteria 836
32 Ga0065712_10003180 3300005290 Bacteria 5260
33 Ga0065712_10031979 3300005290 Bacteria 1120
34 Ga0065712_10051647 3300005290 Bacteria 749
35 Ga0065712_10086694 3300005290 Bacteria 2621
36 Ga0065715_10053782 3300005293 Bacteria 1130
37 Ga0065715_10225253 3300005293 Bacteria 1255
38 Ga0065715_10345118 3300005293 Bacteria 950
39 Ga0065715_10453518 3300005293 Bacteria 823
40 Ga0065715_10552740 3300005293 Bacteria 731
41 Ga0065715_10656145 3300005293 Bacteria 676
42 Ga0065715_10695372 3300005293 Bacteria 656
43 Ga0065715_10919226 3300005293 Bacteria 563
44 Ga0065707_10002895 3300005295 Bacteria 5630
45 Ga0065707_10027870 3300005295 Bacteria 1477
46 Ga0065707_10604539 3300005295 Bacteria 688
47 Ga0065707_10741998 3300005295 Bacteria 622
48 Ga0065707_10902817 3300005295 Bacteria 566
49 Ga0065707_10976468 3300005295 Bacteria 531
50 Ga0065707_11098298 3300005295 Bacteria 516
51 Ga0070658_10005024 3300005327 Bacteria 10769
52 Ga0070658_11939020 3300005327 Bacteria 509
53 Ga0070676_10002393 3300005328 Bacteria 9604
54 Ga0070676_10491550 3300005328 Bacteria 870
55 Ga0070676_10595526 3300005328 Bacteria 797
56 Ga0070676_10647349 3300005328 Bacteria 767
57 Ga0070676_10680290 3300005328 Bacteria 750
58 Ga0070676_10684122 3300005328 Bacteria 748
59 Ga0070683_100000094 3300005329 Bacteria 58242
60 Ga0070683_100001323 3300005329 Bacteria 18858
61 Ga0070683_100036179 3300005329 Bacteria 4516
62 Ga0070683_101580343 3300005329 Bacteria 631
63 Ga0070683_101628540 3300005329 Bacteria 621
64 Ga0070690_100000500 3300005330 Bacteria 19616
65 Ga0070690_100776090 3300005330 Bacteria 742
66 Ga0070690_101047610 3300005330 Bacteria 645
67 Ga0070690_101051337 3300005330 Bacteria 644
68 Ga0070690_101378213 3300005330 Bacteria 567
69 Ga0070670_100004270 3300005331 Bacteria 11957
70 Ga0070670_100016953 3300005331 Bacteria 6253
71 Ga0070670_100260887 3300005331 Bacteria 1510
72 Ga0070670_101031600 3300005331 Bacteria 749
73 Ga0070670_101130782 3300005331 Bacteria 715
74 Ga0070670_101931683 3300005331 Bacteria 544
75 Ga0070670_102046394 3300005331 Bacteria 528
76 Ga0070677_10000073 3300005333 Bacteria 31761
77 Ga0070677_10248660 3300005333 Bacteria 881
78 Ga0070677_10494885 3300005333 Bacteria 662
79 Ga0068869_100012627 3300005334 Bacteria 5586
80 Ga0068869_100587407 3300005334 Bacteria 939
81 Ga0070666_10000730 3300005335 Bacteria 19913
82 Ga0070666_10039674 3300005335 Bacteria 3139
83 Ga0070680_100149467 3300005336 Bacteria 1961
84 Ga0070680_100376351 3300005336 Bacteria 1209
85 Ga0070680_100697413 3300005336 Bacteria 873
86 Ga0070682_100194809 3300005337 Bacteria 1425
87 Ga0070682_100419657 3300005337 Bacteria 1017
88 Ga0070682_101669821 3300005337 Bacteria 553
89 Ga0068868_100125900 3300005338 Bacteria 2093
90 Ga0068868_100814076 3300005338 Bacteria 844
91 Ga0068868_100984944 3300005338 Bacteria 770
92 Ga0068868_101229391 3300005338 Bacteria 694
93 Ga0068868_102026188 3300005338 Bacteria 547
94 Ga0070660_100000181 3300005339 Bacteria 41585
95 Ga0070660_100379575 3300005339 Bacteria 1167
96 Ga0070689_100000949 3300005340 Bacteria 18052
97 Ga0070689_100041204 3300005340 Bacteria 3544
98 Ga0070689_100109280 3300005340 Bacteria 2198
99 Ga0070691_10020695 3300005341 Bacteria 3040
100 Ga0070691_10450638 3300005341 Bacteria 735
101 Ga0070691_10939951 3300005341 Bacteria 536
102 Ga0070687_100000024 3300005343 Bacteria 47595
103 Ga0070687_100208653 3300005343 Bacteria 1188
104 Ga0070687_100482813 3300005343 Bacteria 831
105 Ga0070687_100892946 3300005343 Bacteria 637
106 Ga0070661_100006519 3300005344 Bacteria 8054
107 Ga0070661_100078230 3300005344 Bacteria 2439
108 Ga0070661_100252775 3300005344 Bacteria 1361
109 Ga0070661_101822398 3300005344 Bacteria 517
110 Ga0070692_10005628 3300005345 Bacteria 5370
111 Ga0070692_10053554 3300005345 Bacteria 2104
112 Ga0070668_100000448 3300005347 Bacteria 27291
113 Ga0070668_100068776 3300005347 Bacteria 2753
114 Ga0070668_100348544 3300005347 Bacteria 1253
115 Ga0070668_101024720 3300005347 Bacteria 743
116 Ga0070668_101188794 3300005347 Bacteria 691
117 Ga0070668_101417960 3300005347 Bacteria 634
118 Ga0070668_102289010 3300005347 Bacteria 500
119 Ga0070669_100001019 3300005353 Bacteria 20404
120 Ga0070669_100166876 3300005353 Bacteria 1714
121 Ga0070669_100222261 3300005353 Bacteria 1493
122 Ga0070669_100449834 3300005353 Bacteria 1061
123 Ga0070669_101667002 3300005353 Bacteria 555
124 Ga0070675_100001940 3300005354 Bacteria 15307
125 Ga0070675_100118030 3300005354 Bacteria 2252
126 Ga0070675_100210042 3300005354 Bacteria 1692
127 Ga0070675_100293359 3300005354 Bacteria 1431
128 Ga0070675_100310247 3300005354 Bacteria 1392
129 Ga0070675_100478685 3300005354 Bacteria 1119
130 Ga0070675_101538363 3300005354 Bacteria 614
131 Ga0070675_101727039 3300005354 Bacteria 577
132 Ga0070675_101977356 3300005354 Bacteria 538
133 Ga0070671_100004331 3300005355 Bacteria 11229
134 Ga0070671_100013832 3300005355 Bacteria 6512
135 Ga0070671_100222326 3300005355 Bacteria 1602
136 Ga0070671_100319994 3300005355 Bacteria 1322
137 Ga0070671_100348479 3300005355 Bacteria 1264
138 Ga0070671_100639326 3300005355 Bacteria 921
139 Ga0070674_100000350 3300005356 Bacteria 22871
140 Ga0070674_100011938 3300005356 Bacteria 5312
141 Ga0070674_100404224 3300005356 Bacteria 1116
142 Ga0070674_100445341 3300005356 Bacteria 1068
143 Ga0070674_100457466 3300005356 Bacteria 1055
144 Ga0070674_100771977 3300005356 Bacteria 828
145 Ga0070674_101383746 3300005356 Bacteria 630
146 Ga0070673_100001346 3300005364 Bacteria 14336
147 Ga0070673_100076042 3300005364 Bacteria 2710
148 Ga0070673_100174521 3300005364 Bacteria 1836
149 Ga0070673_101406459 3300005364 Bacteria 657
150 Ga0070673_101415377 3300005364 Bacteria 654
151 Ga0070673_102062034 3300005364 Bacteria 542
152 Ga0070673_102324411 3300005364 Bacteria 510
153 Ga0070688_100001135 3300005365 Bacteria 13337
154 Ga0070688_100222985 3300005365 Bacteria 1329
155 Ga0070688_101416895 3300005365 Bacteria 563
156 Ga0070659_100000114 3300005366 Bacteria 59686
157 Ga0070659_100451301 3300005366 Bacteria 1091
158 Ga0070659_100605689 3300005366 Bacteria 942
159 Ga0070667_100011084 3300005367 Bacteria 7458
160 Ga0070667_100397655 3300005367 Bacteria 1254
161 Ga0070667_100855240 3300005367 Bacteria 846
162 Ga0070667_101332600 3300005367 Bacteria 673
163 Ga0070667_101699404 3300005367 Bacteria 594
164 Ga0070709_11210828 3300005434 Bacteria 607
165 Ga0070714_101686849 3300005435 Bacteria 619
166 Ga0070710_10868430 3300005437 Bacteria 649
167 Ga0070701_10081817 3300005438 Bacteria 1750
168 Ga0070701_10220990 3300005438 Bacteria 1130
169 Ga0070701_10566287 3300005438 Bacteria 747
170 Ga0070701_10848837 3300005438 Bacteria 627
171 Ga0070711_100149287 3300005439 Bacteria 1761
172 Ga0070711_101361141 3300005439 Bacteria 617
173 Ga0070705_100005491 3300005440 Bacteria 6180
174 Ga0070705_100105034 3300005440 Bacteria 1793
175 Ga0070705_100157732 3300005440 Bacteria 1513
176 Ga0070705_101585444 3300005440 Bacteria 551
177 Ga0070705_101718673 3300005440 Bacteria 530
178 Ga0070700_100028912 3300005441 Bacteria 3302
179 Ga0070700_100773277 3300005441 Bacteria 771
180 Ga0070700_101755166 3300005441 Bacteria 533
181 Ga0070694_100576539 3300005444 Bacteria 904
182 Ga0070694_100716209 3300005444 Bacteria 815
183 Ga0070708_101447076 3300005445 Bacteria 641
184 Ga0070663_100000874 3300005455 Bacteria 16393
185 Ga0070663_100359031 3300005455 Bacteria 1181
186 Ga0070663_100743866 3300005455 Bacteria 837
187 Ga0070663_101672599 3300005455 Bacteria 569
188 Ga0070678_100017053 3300005456 Bacteria 4664
189 Ga0070678_100150458 3300005456 Bacteria 1874
190 Ga0070678_100328891 3300005456 Bacteria 1307
191 Ga0070678_100428434 3300005456 Bacteria 1155
192 Ga0070678_101203545 3300005456 Bacteria 702
193 Ga0070678_101325008 3300005456 Bacteria 670
194 Ga0070662_100000254 3300005457 Bacteria 31552
195 Ga0070662_100160245 3300005457 Bacteria 1759
196 Ga0070662_100285152 3300005457 Bacteria 1337
197 Ga0070662_100432249 3300005457 Bacteria 1091
198 Ga0070681_10188493 3300005458 Bacteria 1982
199 Ga0068867_100001968 3300005459 Bacteria 14326
200 Ga0068867_100230883 3300005459 Bacteria 1496
201 Ga0068867_102344089 3300005459 Bacteria 508
202 Ga0070685_10000248 3300005466 Bacteria 35336
203 Ga0070685_11325340 3300005466 Bacteria 550
204 Ga0070706_100402100 3300005467 Bacteria 1275
205 Ga0070706_100996574 3300005467 Bacteria 773
206 Ga0070706_101450878 3300005467 Bacteria 628
207 Ga0070707_100857225 3300005468 Bacteria 873
208 Ga0070707_101604448 3300005468 Bacteria 617
209 Ga0070698_100545640 3300005471 Bacteria 1099
210 Ga0070698_100647762 3300005471 Bacteria 998
211 Ga0070698_100758412 3300005471 Bacteria 914
212 Ga0070698_101000005 3300005471 Bacteria 783
213 Ga0070698_101386398 3300005471 Bacteria 654
214 Ga0070699_100022962 3300005518 Bacteria 5373
215 Ga0070699_100157512 3300005518 Bacteria 2010
216 Ga0070699_101208046 3300005518 Bacteria 694
217 Ga0070699_101258879 3300005518 Bacteria 678
218 Ga0070679_100047014 3300005530 Bacteria 4303
219 Ga0070679_100145145 3300005530 Bacteria 2351
220 Ga0070679_101616621 3300005530 Bacteria 596
221 Ga0070684_101395598 3300005535 Bacteria 660
222 Ga0070697_100017739 3300005536 Bacteria 5607
223 Ga0070697_100185598 3300005536 Bacteria 1763
224 Ga0070697_100237925 3300005536 Bacteria 1554
225 Ga0070697_100363324 3300005536 Bacteria 1251
226 Ga0070697_100382838 3300005536 Bacteria 1219
227 Ga0070697_101178657 3300005536 Bacteria 683
228 Ga0070697_102008942 3300005536 Bacteria 518
229 Ga0070697_102047032 3300005536 Bacteria 512
230 Ga0068853_100001786 3300005539 Bacteria 15823
231 Ga0068853_100795112 3300005539 Bacteria 906
232 Ga0068853_100874452 3300005539 Bacteria 863
233 Ga0070672_100001452 3300005543 Bacteria 14678
234 Ga0070672_100482531 3300005543 Bacteria 1070
235 Ga0070672_100504860 3300005543 Bacteria 1046
236 Ga0070672_100591520 3300005543 Bacteria 966
237 Ga0070672_100624797 3300005543 Bacteria 940
238 Ga0070672_100860402 3300005543 Bacteria 800
239 Ga0070672_100967376 3300005543 Bacteria 753
240 Ga0070672_101298966 3300005543 Bacteria 650
241 Ga0070672_101719387 3300005543 Bacteria 563
242 Ga0070686_100000328 3300005544 Bacteria 31173
243 Ga0070686_100488886 3300005544 Bacteria 953
244 Ga0070695_100084673 3300005545 Bacteria 2104
245 Ga0070695_100225615 3300005545 Bacteria 1352
246 Ga0070695_100264406 3300005545 Bacteria 1258
247 Ga0070695_100409840 3300005545 Bacteria 1030
248 Ga0070695_100861656 3300005545 Bacteria 729
249 Ga0070695_101132041 3300005545 Bacteria 642
250 Ga0070696_100265354 3300005546 Bacteria 1303
251 Ga0070696_100736174 3300005546 Bacteria 807
252 Ga0070696_101885441 3300005546 Bacteria 518
253 Ga0070693_100010528 3300005547 Bacteria 4636
254 Ga0070693_100019888 3300005547 Bacteria 3531
255 Ga0070665_100010583 3300005548 Bacteria 9339
256 Ga0070665_100094954 3300005548 Bacteria 2986
257 Ga0070665_101664565 3300005548 Bacteria 646
258 Ga0070665_102548169 3300005548 Bacteria 513
259 Ga0070665_102594652 3300005548 Bacteria 507
260 Ga0070704_100066182 3300005549 Bacteria 2605
261 Ga0070704_100116336 3300005549 Bacteria 2044
262 Ga0070704_100529830 3300005549 Bacteria 1026
263 Ga0070704_100564894 3300005549 Bacteria 996
264 Ga0070704_100831770 3300005549 Bacteria 827
265 Ga0070704_101162770 3300005549 Bacteria 703
266 Ga0068855_100006422 3300005563 Bacteria 14313
267 Ga0070664_100000479 3300005564 Bacteria 30222
268 Ga0070664_100053438 3300005564 Bacteria 3424
269 Ga0070664_100145251 3300005564 Bacteria 2091
270 Ga0070664_100221069 3300005564 Bacteria 1694
271 Ga0070664_100324039 3300005564 Bacteria 1397
272 Ga0070664_101470377 3300005564 Bacteria 644
273 Ga0070664_101582707 3300005564 Bacteria 621
274 Ga0070664_101725164 3300005564 Bacteria 594
275 Ga0068857_100092103 3300005577 Bacteria 2714
276 Ga0068857_100252079 3300005577 Bacteria 1618
277 Ga0068857_100525451 3300005577 Bacteria 1112
278 Ga0068857_101448132 3300005577 Bacteria 669
279 Ga0068857_101734987 3300005577 Bacteria 611
280 Ga0068854_100000012 3300005578 Bacteria 167969
281 Ga0068854_100421747 3300005578 Bacteria 1108
282 Ga0068856_100009855 3300005614 Bacteria 9275
283 Ga0068856_100408964 3300005614 Bacteria 1376
284 Ga0070702_100798555 3300005615 Bacteria 729
285 Ga0070702_101400910 3300005615 Bacteria 571
286 Ga0070702_101444887 3300005615 Bacteria 564
287 Ga0068852_100000438 3300005616 Bacteria 27633
288 Ga0068852_101346269 3300005616 Bacteria 736
289 Ga0068859_100001092 3300005617 Bacteria 27670
290 Ga0068859_100039272 3300005617 Bacteria 4748
291 Ga0068859_100138831 3300005617 Bacteria 2504
292 Ga0068859_100200996 3300005617 Bacteria 2078
293 Ga0068859_100381046 3300005617 Bacteria 1506
294 Ga0068859_100683477 3300005617 Bacteria 1118
295 Ga0068859_100777959 3300005617 Bacteria 1045
296 Ga0068859_101466948 3300005617 Bacteria 753
297 Ga0068859_101995864 3300005617 Bacteria 641
298 Ga0068859_103024518 3300005617 Bacteria 513
299 Ga0068864_100003452 3300005618 Bacteria 13060
300 Ga0068864_101039382 3300005618 Bacteria 813
301 Ga0068864_101310556 3300005618 Bacteria 725
302 Ga0068864_101754632 3300005618 Bacteria 626
303 Ga0068866_10000117 3300005718 Bacteria 34561
304 Ga0068866_10117443 3300005718 Bacteria 1494
305 Ga0068866_10302363 3300005718 Bacteria 999
306 Ga0068866_10328422 3300005718 Bacteria 965
307 Ga0068861_100000082 3300005719 Bacteria 45733
308 Ga0068861_100257033 3300005719 Bacteria 1493
309 Ga0068861_100270266 3300005719 Bacteria 1459
310 Ga0068861_101375880 3300005719 Bacteria 689
311 Ga0068861_101744180 3300005719 Bacteria 616
312 Ga0068861_102284504 3300005719 Bacteria 543
313 Ga0068861_102712449 3300005719 Bacteria 500
314 Ga0068851_10000775 3300005834 Bacteria 13747
315 Ga0068851_10163626 3300005834 Bacteria 1224
316 Ga0068870_10000643 3300005840 Bacteria 13325
317 Ga0068870_10200553 3300005840 Bacteria 1209
318 Ga0068870_10209859 3300005840 Bacteria 1186
319 Ga0068870_10412482 3300005840 Bacteria 882
320 Ga0068870_11065030 3300005840 Bacteria 580
321 Ga0068863_100053675 3300005841 Bacteria 3820
322 Ga0068863_100153808 3300005841 Bacteria 2201
323 Ga0068863_100160112 3300005841 Bacteria 2156
324 Ga0068863_100862685 3300005841 Bacteria 904
325 Ga0068863_100954509 3300005841 Bacteria 859
326 Ga0068863_101007866 3300005841 Bacteria 836
327 Ga0068863_101786294 3300005841 Bacteria 625
328 Ga0068863_102587286 3300005841 Bacteria 516
329 Ga0068858_100008887 3300005842 Bacteria 9632
330 Ga0068858_100055604 3300005842 Bacteria 3658
331 Ga0068858_100276704 3300005842 Bacteria 1598
332 Ga0068858_100424644 3300005842 Bacteria 1278
333 Ga0068858_100740245 3300005842 Bacteria 957
334 Ga0068858_100803785 3300005842 Bacteria 918
335 Ga0068858_101417176 3300005842 Bacteria 685
336 Ga0068858_101621266 3300005842 Bacteria 639
337 Ga0068858_101741107 3300005842 Bacteria 615
338 Ga0068860_100005800 3300005843 Bacteria 12434
339 Ga0068860_100087378 3300005843 Bacteria 2968
340 Ga0068860_100234785 3300005843 Bacteria 1782
341 Ga0068860_100239764 3300005843 Bacteria 1763
342 Ga0068860_102175836 3300005843 Bacteria 576
343 Ga0068860_102213821 3300005843 Bacteria 571
344 Ga0068862_100004232 3300005844 Bacteria 12159
345 Ga0068862_100559879 3300005844 Bacteria 1093
346 Ga0068862_100988725 3300005844 Bacteria 831
347 Ga0068862_101429418 3300005844 Bacteria 695
348 Ga0068862_102738881 3300005844 Bacteria 505
349 Ga0081455_10843341 3300005937 Bacteria 573
350 Ga0081538_10128689 3300005981 Bacteria 1196
351 Ga0081540_1000029 3300005983 Bacteria 150173
352 Ga0081540_1056204 3300005983 Bacteria 1912
353 Ga0081540_1142334 3300005983 Bacteria 960
354 Ga0075365_10018282 3300006038 Bacteria 4308
355 Ga0075364_11063440 3300006051 Bacteria 550
356 Ga0070715_10542746 3300006163 Bacteria 673
357 Ga0070716_100952370 3300006173 Bacteria 676
358 Ga0070716_101296152 3300006173 Bacteria 589
359 Ga0070712_100223757 3300006175 Bacteria 1491
360 Ga0070712_100559918 3300006175 Bacteria 964
361 Ga0075362_10210142 3300006177 Bacteria 949
362 Ga0075367_10084871 3300006178 Bacteria 1921
363 Ga0075366_10940781 3300006195 Bacteria 539
364 Ga0097621_100003466 3300006237 Bacteria 10878
365 Ga0097621_100376089 3300006237 Bacteria 1268
366 Ga0097621_102275822 3300006237 Bacteria 518
367 Ga0075370_10708837 3300006353 Bacteria 612
368 Ga0068871_100202666 3300006358 Bacteria 1713
369 Ga0068871_100573959 3300006358 Bacteria 1023
370 Ga0068871_100758126 3300006358 Bacteria 892
371 Ga0068871_100964830 3300006358 Bacteria 793
372 Ga0068871_101055072 3300006358 Bacteria 759
373 Ga0075428_100000017 3300006844 Bacteria 147833
374 Ga0075428_100122904 3300006844 Bacteria 2825
375 Ga0075428_100355670 3300006844 Bacteria 1571
376 Ga0075428_100535412 3300006844 Bacteria 1252
377 Ga0075428_100653282 3300006844 Bacteria 1121
378 Ga0075428_101016031 3300006844 Bacteria 877
379 Ga0075428_101262432 3300006844 Bacteria 777
380 Ga0075428_101585530 3300006844 Bacteria 685
381 Ga0075431_100454296 3300006847 Bacteria 1276
382 Ga0075431_100870242 3300006847 Bacteria 872
383 Ga0075431_101270423 3300006847 Bacteria 698
384 Ga0075431_101677678 3300006847 Bacteria 592
385 Ga0075431_101800493 3300006847 Bacteria 568
386 Ga0075431_102020647 3300006847 Bacteria 531
387 Ga0075433_10080040 3300006852 Bacteria 2879
388 Ga0075433_10387441 3300006852 Bacteria 1234
389 Ga0075433_10854000 3300006852 Bacteria 795
390 Ga0075433_11062040 3300006852 Bacteria 705
391 Ga0075434_100062039 3300006871 Bacteria 3720
392 Ga0075434_100081239 3300006871 Bacteria 3238
393 Ga0075434_100480998 3300006871 Bacteria 1263
394 Ga0075434_101113613 3300006871 Bacteria 803
395 Ga0075434_101652856 3300006871 Bacteria 649
396 Ga0075429_100218567 3300006880 Bacteria 1669
397 Ga0075429_100569260 3300006880 Bacteria 993
398 Ga0075429_100955460 3300006880 Bacteria 749
399 Ga0075429_101397996 3300006880 Bacteria 609
400 Ga0075429_101951224 3300006880 Bacteria 508
401 Ga0068865_100001281 3300006881 Bacteria 14624
402 Ga0068865_100789144 3300006881 Bacteria 818
403 Ga0068865_101512768 3300006881 Bacteria 602
404 Ga0075436_100041067 3300006914 Bacteria 3192
405 Ga0075436_100497311 3300006914 Bacteria 892
406 Ga0097620_100001091 3300006931 Bacteria 27670
407 Ga0097620_100039275 3300006931 Bacteria 4748
408 Ga0097620_100138842 3300006931 Bacteria 2504
409 Ga0097620_100200999 3300006931 Bacteria 2078
410 Ga0097620_100381001 3300006931 Bacteria 1506
411 Ga0097620_100683432 3300006931 Bacteria 1118
412 Ga0097620_100777969 3300006931 Bacteria 1045
413 Ga0097620_101466850 3300006931 Bacteria 753
414 Ga0097620_101995948 3300006931 Bacteria 641
415 Ga0097620_103024717 3300006931 Bacteria 513
416 Ga0075435_100139306 3300007076 Bacteria 2035
417 Ga0075435_100167535 3300007076 Bacteria 1853
418 Ga0075435_100679141 3300007076 Bacteria 895
419 Ga0075435_101255482 3300007076 Bacteria 648
420 Ga0075435_101527835 3300007076 Bacteria 585
421 Ga0099794_10439460 3300007265 Bacteria 683
422 Ga0105251_10631004 3300009011 Bacteria 511
423 Ga0105244_10475922 3300009036 Bacteria 575
424 Ga0105240_12001730 3300009093 Bacteria 602
425 Ga0111539_10000002 3300009094 Bacteria 983359
426 Ga0111539_10042697 3300009094 Bacteria 5443
427 Ga0111539_10044169 3300009094 Bacteria 5339
428 Ga0111539_10270295 3300009094 Bacteria 1979
429 Ga0111539_10274086 3300009094 Bacteria 1964
430 Ga0111539_10350905 3300009094 Bacteria 1717
431 Ga0111539_10627249 3300009094 Bacteria 1252
432 Ga0111539_11731278 3300009094 Bacteria 725
433 Ga0105245_10288050 3300009098 Bacteria 1608
434 Ga0105245_11649356 3300009098 Bacteria 693
435 Ga0105245_12592370 3300009098 Bacteria 560
436 Ga0105247_10015895 3300009101 Bacteria 4506
437 Ga0105247_10975541 3300009101 Bacteria 660
438 Ga0114129_10000509 3300009147 Bacteria 47512
439 Ga0114129_10365441 3300009147 Bacteria 1908
440 Ga0114129_10975264 3300009147 Bacteria 1069
441 Ga0105243_11580024 3300009148 Bacteria 682
442 Ga0105243_12227874 3300009148 Bacteria 585
443 Ga0105243_12901923 3300009148 Bacteria 520
444 Ga0105242_12732161 3300009176 Bacteria 544
445 Ga0105248_10395727 3300009177 Bacteria 1556
446 Ga0105248_10690097 3300009177 Bacteria 1152
447 Ga0105248_11198546 3300009177 Bacteria 858
448 Ga0105248_11983211 3300009177 Bacteria 661
449 Ga0105248_12070481 3300009177 Bacteria 647
450 Ga0105248_12193160 3300009177 Bacteria 628
451 Ga0105249_11261524 3300009553 Bacteria 810
452 Ga0105249_12579814 3300009553 Bacteria 580
453 Ga0105239_12397902 3300010375 Bacteria 614
454 Ga0105246_10192241 3300011119 Bacteria 1581
455 Ga0105246_11338443 3300011119 Bacteria 665
456 Ga0105246_11713458 3300011119 Bacteria 598
457 Ga0105246_12604410 3300011119 Bacteria 500
458 Ga0157339_1031008 3300012505 Bacteria 625
459 Ga0157324_1035544 3300012506 Bacteria 586
460 Ga0157316_1063998 3300012510 Bacteria 539
461 Ga0157373_11571628 3300013100 Bacteria 503
462 Ga0157371_10585155 3300013102 Bacteria 829
463 Ga0157370_10223927 3300013104 Bacteria 1742
464 Ga0157378_10322335 3300013297 Bacteria 1501
465 Ga0157378_11235082 3300013297 Bacteria 787
466 Ga0157378_12427885 3300013297 Bacteria 576
467 Ga0163162_11532987 3300013306 Bacteria 759
468 Ga0163162_11547671 3300013306 Bacteria 756
469 Ga0157372_11160058 3300013307 Bacteria 893
470 Ga0157375_10271476 3300013308 Bacteria 1858
471 Ga0157375_10870603 3300013308 Bacteria 1046
472 Ga0157375_10949579 3300013308 Bacteria 1002
473 Ga0157375_11118753 3300013308 Bacteria 922
474 Ga0157375_11406652 3300013308 Bacteria 822
475 Ga0157375_12140289 3300013308 Bacteria 666
476 Ga0157375_13424004 3300013308 Bacteria 528
477 Ga0163163_10036900 3300014325 Bacteria 4750
478 Ga0163163_10164016 3300014325 Bacteria 2268
479 Ga0163163_11176712 3300014325 Bacteria 829
480 Ga0163163_11324055 3300014325 Bacteria 782
481 Ga0163163_12213081 3300014325 Bacteria 609
482 Ga0157380_10516509 3300014326 Bacteria 1164
483 Ga0157380_10613105 3300014326 Bacteria 1079
484 Ga0157380_10694493 3300014326 Bacteria 1022
485 Ga0157380_10781362 3300014326 Bacteria 970
486 Ga0157380_11225276 3300014326 Bacteria 795
487 Ga0157380_11607233 3300014326 Bacteria 706
488 Ga0157380_11688341 3300014326 Bacteria 691
489 Ga0157380_12915429 3300014326 Bacteria 544
490 Ga0157380_13357676 3300014326 Bacteria 512
491 Ga0182008_10955012 3300014497 Bacteria 508
492 Ga0157377_10428196 3300014745 Bacteria 908
493 Ga0157377_10699403 3300014745 Bacteria 736
494 Ga0157377_10963933 3300014745 Bacteria 643
495 Ga0157379_10211948 3300014968 Bacteria 1754
496 Ga0157379_10668718 3300014968 Bacteria 973
497 Ga0157376_10307712 3300014969 Bacteria 1502
498 Ga0157376_11144007 3300014969 Bacteria 805
499 Ga0157376_12311194 3300014969 Bacteria 577
500 Ga0157376_12635227 3300014969 Bacteria 543
501 Ga0157376_12741822 3300014969 Bacteria 533
502 Ga0157376_12850998 3300014969 Bacteria 523
503 Ga0163161_10059207 3300017792 Bacteria 2785
504 Ga0163161_10301685 3300017792 Bacteria 1261
505 Ga0163161_11537248 3300017792 Bacteria 585
506 Ga0206356_10251847 3300020070 Bacteria 697
507 Ga0206349_1652271 3300020075 Bacteria 545
508 Ga0206355_1138463 3300020076 Bacteria 570
509 Ga0206355_1183705 3300020076 Bacteria 2525
510 Ga0206352_10435916 3300020078 Bacteria 1011
511 Ga0206350_11371603 3300020080 Bacteria 836
512 Ga0213874_10271349 3300021377 Bacteria 631
513 Ga0207697_10000724 3300025315 Bacteria 18757
514 Ga0207697_10017846 3300025315 Bacteria 2914
515 Ga0207697_10300439 3300025315 Bacteria 712
516 Ga0207697_10329868 3300025315 Bacteria 677
517 Ga0207656_10013340 3300025321 Bacteria 3139
518 Ga0207682_10000142 3300025893 Bacteria 32254
519 Ga0207642_10000304 3300025899 Bacteria 14761
520 Ga0207710_10008608 3300025900 Bacteria 4303
521 Ga0207710_10028970 3300025900 Bacteria 2406
522 Ga0207688_10003488 3300025901 Bacteria 8578
523 Ga0207680_10000437 3300025903 Bacteria 19719
524 Ga0207680_10462487 3300025903 Bacteria 901
525 Ga0207680_11250675 3300025903 Bacteria 529
526 Ga0207647_10003364 3300025904 Bacteria 11995
527 Ga0207647_10512210 3300025904 Bacteria 668
528 Ga0207699_10883484 3300025906 Bacteria 659
529 Ga0207645_10000238 3300025907 Bacteria 45589
530 Ga0207645_10144050 3300025907 Bacteria 1553
531 Ga0207645_10558522 3300025907 Bacteria 777
532 Ga0207645_11067925 3300025907 Bacteria 545
533 Ga0207643_10000376 3300025908 Bacteria 30007
534 Ga0207643_10150032 3300025908 Bacteria 1397
535 Ga0207643_10388630 3300025908 Bacteria 881
536 Ga0207643_10517479 3300025908 Bacteria 764
537 Ga0207643_10589447 3300025908 Bacteria 715
538 Ga0207705_10015275 3300025909 Bacteria 5513
539 Ga0207684_10165126 3300025910 Bacteria 1907
540 Ga0207684_11427571 3300025910 Bacteria 566
541 Ga0207684_11494849 3300025910 Bacteria 550
542 Ga0207654_10012178 3300025911 Bacteria 4403
543 Ga0207707_10007464 3300025912 Bacteria 9524
544 Ga0207695_10105565 3300025913 Bacteria 2804
545 Ga0207671_10001461 3300025914 Bacteria 27305
546 Ga0207693_10451145 3300025915 Bacteria 1005
547 Ga0207663_10047077 3300025916 Bacteria 2661
548 Ga0207663_10662500 3300025916 Bacteria 824
549 Ga0207660_10021664 3300025917 Bacteria 4325
550 Ga0207660_10081516 3300025917 Bacteria 2378
551 Ga0207660_11205196 3300025917 Bacteria 616
552 Ga0207662_10000368 3300025918 Bacteria 20298
553 Ga0207662_10608641 3300025918 Bacteria 761
554 Ga0207662_10610379 3300025918 Bacteria 760
555 Ga0207657_10000132 3300025919 Bacteria 75342
556 Ga0207649_10027667 3300025920 Bacteria 3330
557 Ga0207649_10156462 3300025920 Bacteria 1575
558 Ga0207652_10050537 3300025921 Bacteria 3563
559 Ga0207652_11173720 3300025921 Bacteria 669
560 Ga0207646_10633209 3300025922 Bacteria 959
561 Ga0207646_10941604 3300025922 Bacteria 765
562 Ga0207646_10992149 3300025922 Bacteria 742
563 Ga0207646_11119282 3300025922 Bacteria 692
564 Ga0207681_10000518 3300025923 Bacteria 26766
565 Ga0207681_10121335 3300025923 Bacteria 1917
566 Ga0207681_10197675 3300025923 Bacteria 1542
567 Ga0207681_10847259 3300025923 Bacteria 764
568 Ga0207681_10969468 3300025923 Bacteria 713
569 Ga0207694_10003451 3300025924 Bacteria 12562
570 Ga0207650_10000037 3300025925 Bacteria 211825
571 Ga0207650_10133877 3300025925 Bacteria 1942
572 Ga0207650_10774390 3300025925 Bacteria 813
573 Ga0207650_10976316 3300025925 Bacteria 720
574 Ga0207650_11138991 3300025925 Bacteria 664
575 Ga0207650_11164516 3300025925 Bacteria 656
576 Ga0207650_11342384 3300025925 Bacteria 608
577 Ga0207659_10000012 3300025926 Bacteria 198502
578 Ga0207659_10167480 3300025926 Bacteria 1731
579 Ga0207659_10658060 3300025926 Bacteria 895
580 Ga0207659_11307753 3300025926 Bacteria 622
581 Ga0207687_10284104 3300025927 Bacteria 1327
582 Ga0207644_10001828 3300025931 Bacteria 13817
583 Ga0207644_10139417 3300025931 Bacteria 1866
584 Ga0207644_10588455 3300025931 Bacteria 923
585 Ga0207690_10000434 3300025932 Bacteria 27237
586 Ga0207690_10069537 3300025932 Bacteria 2422
587 Ga0207706_10000419 3300025933 Bacteria 45590
588 Ga0207706_10010042 3300025933 Bacteria 8675
589 Ga0207706_10442069 3300025933 Bacteria 1125
590 Ga0207706_11425107 3300025933 Bacteria 568
591 Ga0207686_10012502 3300025934 Bacteria 4667
592 Ga0207709_10011122 3300025935 Bacteria 4963
593 Ga0207709_11321466 3300025935 Bacteria 596
594 Ga0207670_10000026 3300025936 Bacteria 131381
595 Ga0207669_10000981 3300025937 Bacteria 12105
596 Ga0207669_10018866 3300025937 Bacteria 3578
597 Ga0207669_10216296 3300025937 Bacteria 1403
598 Ga0207669_10553544 3300025937 Bacteria 928
599 Ga0207669_10888221 3300025937 Bacteria 744
600 Ga0207669_11336877 3300025937 Bacteria 609
601 Ga0207704_10001879 3300025938 Bacteria 9402
602 Ga0207665_11581066 3300025939 Bacteria 520
603 Ga0207691_10000101 3300025940 Bacteria 75334
604 Ga0207691_10523510 3300025940 Bacteria 1006
605 Ga0207711_10000026 3300025941 Bacteria 254807
606 Ga0207711_10124922 3300025941 Bacteria 2301
607 Ga0207711_10340827 3300025941 Bacteria 1387
608 Ga0207689_10000999 3300025942 Bacteria 27152
609 Ga0207689_10391452 3300025942 Bacteria 1158
610 Ga0207689_10512904 3300025942 Bacteria 1005
611 Ga0207661_10004428 3300025944 Bacteria 9857
612 Ga0207661_10037912 3300025944 Bacteria 3774
613 Ga0207661_10764113 3300025944 Bacteria 890
614 Ga0207661_11373696 3300025944 Bacteria 648
615 Ga0207661_11703449 3300025944 Bacteria 576
616 Ga0207679_10000393 3300025945 Bacteria 31420
617 Ga0207679_10001292 3300025945 Bacteria 15820
618 Ga0207679_10007830 3300025945 Bacteria 6789
619 Ga0207679_10319244 3300025945 Bacteria 1344
620 Ga0207667_10005424 3300025949 Bacteria 15550
621 Ga0207651_10000112 3300025960 Bacteria 34954
622 Ga0207651_10063113 3300025960 Bacteria 2585
623 Ga0207712_10002247 3300025961 Bacteria 12549
624 Ga0207712_11389854 3300025961 Bacteria 628
625 Ga0207668_10003548 3300025972 Bacteria 9171
626 Ga0207668_10194260 3300025972 Bacteria 1611
627 Ga0207668_10446977 3300025972 Bacteria 1102
628 Ga0207640_10001473 3300025981 Bacteria 12692
629 Ga0207658_10000036 3300025986 Bacteria 152337
630 Ga0207658_11228910 3300025986 Bacteria 685
631 Ga0207658_11725005 3300025986 Bacteria 572
632 Ga0207677_10000459 3300026023 Bacteria 27353
633 Ga0207677_10350386 3300026023 Bacteria 1237
634 Ga0207677_10740944 3300026023 Bacteria 875
635 Ga0207703_10003676 3300026035 Bacteria 12782
636 Ga0207703_11240962 3300026035 Bacteria 717
637 Ga0207703_12111535 3300026035 Bacteria 539
638 Ga0207639_10010826 3300026041 Bacteria 6324
639 Ga0207678_10001767 3300026067 Bacteria 19799
640 Ga0207678_10204688 3300026067 Bacteria 1688
641 Ga0207708_10114338 3300026075 Bacteria 2098
642 Ga0207708_11520295 3300026075 Bacteria 588
643 Ga0207702_10013600 3300026078 Bacteria 6757
644 Ga0207641_10001084 3300026088 Bacteria 27391
645 Ga0207641_10411463 3300026088 Bacteria 1300
646 Ga0207641_10453515 3300026088 Bacteria 1240
647 Ga0207641_10615867 3300026088 Bacteria 1064
648 Ga0207641_11881359 3300026088 Bacteria 600
649 Ga0207648_10000449 3300026089 Bacteria 45590
650 Ga0207648_11947316 3300026089 Bacteria 549
651 Ga0207676_10000726 3300026095 Bacteria 25850
652 Ga0207676_12160258 3300026095 Unclassified 555
653 Ga0207674_10017732 3300026116 Bacteria 7759
654 Ga0207674_10139947 3300026116 Bacteria 2380
655 Ga0207674_10140708 3300026116 Bacteria 2372
656 Ga0207675_100000037 3300026118 Bacteria 93479
657 Ga0207675_100208345 3300026118 Bacteria 1880
658 Ga0207675_101240442 3300026118 Bacteria 766
659 Ga0207675_101749155 3300026118 Bacteria 641
660 Ga0207675_102051990 3300026118 Bacteria 589
661 Ga0207683_10000506 3300026121 Bacteria 35979
662 Ga0207683_10218366 3300026121 Bacteria 1737
663 Ga0207683_10448030 3300026121 Bacteria 1190
664 Ga0207683_11197926 3300026121 Bacteria 704
665 Ga0207683_11644140 3300026121 Bacteria 592
666 Ga0207683_12021902 3300026121 Bacteria 525
667 Ga0207698_10001702 3300026142 Bacteria 12820
668 Ga0209967_1032069 3300027364 Bacteria 787
669 Ga0209984_1061099 3300027424 Bacteria 558
670 Ga0210002_1033805 3300027617 Bacteria 856
671 Ga0209983_1088459 3300027665 Bacteria 697
672 Ga0209588_1229479 3300027671 Bacteria 572
673 Ga0209971_1121391 3300027682 Bacteria 643
674 Ga0209998_10182524 3300027717 Bacteria 546
675 Ga0209974_10225013 3300027876 Bacteria 699
676 Ga0209974_10242946 3300027876 Bacteria 676
677 Ga0207428_10000004 3300027907 Bacteria 727800
678 Ga0207428_10030983 3300027907 Bacteria 4419
679 Ga0207428_10054932 3300027907 Bacteria 3169
680 Ga0207428_10367852 3300027907 Bacteria 1056
681 Ga0268266_10000156 3300028379 Bacteria 128575
682 Ga0268266_11138777 3300028379 Bacteria 755
683 Ga0268266_11735628 3300028379 Bacteria 599
684 Ga0268265_10000855 3300028380 Bacteria 28534
685 Ga0268265_10038559 3300028380 Bacteria 3515
686 Ga0268265_10186346 3300028380 Bacteria 1788
687 Ga0268265_11145116 3300028380 Bacteria 774
688 Ga0268265_11223607 3300028380 Bacteria 749
689 Ga0268265_12349821 3300028380 Bacteria 540
690 Ga0268264_10000090 3300028381 Bacteria 234383
691 Ga0268264_10277661 3300028381 Bacteria 1568
692 Ga0268264_10336024 3300028381 Bacteria 1433
693 Ga0268264_11289779 3300028381 Bacteria 740
694 Ga0268264_11880225 3300028381 Bacteria 608
695 Ga0265332_10200700 3300031238 Bacteria 829
696 Ga0265331_10215794 3300031250 Bacteria 863
697 Ga0265316_10164478 3300031344 Bacteria 1658
698 Ga0307408_100239976 3300031548 Bacteria 1489
699 Ga0307408_100307082 3300031548 Bacteria 1331
700 Ga0316576_10185680 3300031727 Bacteria 1568
701 Ga0307405_10838037 3300031731 Bacteria 773
702 Ga0307405_11462002 3300031731 Bacteria 599
703 Ga0307413_11382370 3300031824 Bacteria 619
704 Ga0307406_10830787 3300031901 Bacteria 782
705 Ga0307406_11988421 3300031901 Bacteria 519
706 Ga0307407_10461032 3300031903 Bacteria 924
707 Ga0307407_10632376 3300031903 Bacteria 800
708 Ga0307407_11579761 3300031903 Bacteria 520
709 Ga0307412_11876898 3300031911 Bacteria 552
710 Ga0307409_100099346 3300031995 Bacteria 2410
711 Ga0307409_101705155 3300031995 Bacteria 659
712 Ga0307409_101915690 3300031995 Bacteria 622
713 Ga0307409_102762325 3300031995 Bacteria 519
714 Ga0307416_100847193 3300032002 Bacteria 1012
715 Ga0307416_100919822 3300032002 Bacteria 975
716 Ga0307416_101039903 3300032002 Bacteria 923
717 Ga0307416_102243701 3300032002 Bacteria 647
718 Ga0307411_10865099 3300032005 Bacteria 801
719 Ga0307415_100637849 3300032126 Bacteria 953
720 Ga0307415_100661168 3300032126 Bacteria 938
721 Ga0316580_10230074 3300032139 Bacteria 572
722 Ga0373958_0118957 3300034819 Bacteria 637
723 Ga0373926_0095583 3300035083 Bacteria 1108
724 Ga0373929_0057286 3300035085 Bacteria 905
725 Ga0373934_0108730 3300035086 Bacteria 1124
726 Ga0373934_0110993 3300035086 Bacteria 1112
727 Ga0373940_0261932 3300035088 Bacteria 586
728 Ga0373949_0263861 3300035090 Bacteria 536
729 Ga0373923_0707967 3300035111 Bacteria 500
730 Ga0373932_0365339 3300035112 Bacteria 552
731 Ga0373941_0043987 3300035115 Bacteria 1392
732 Ga0373953_0121062 3300035117 Bacteria 1111
733 Ga0373954_0004418 3300035118 Bacteria 6051
734 Ga0373956_0004023 3300035119 Bacteria 5906
735 Ga0373957_0242027 3300035120 Bacteria 758
736 Ga0373960_0257277 3300035121 Bacteria 636
737 Ga0373960_0291862 3300035121 Bacteria 604
738 Ga0373960_0422008 3300035121 Bacteria 518
739 Ga0373955_0071638 3300035172 Bacteria 1939
740 Ga0373955_0641886 3300035172 Bacteria 651
741 Ga0373924_0175712 3300035410 Bacteria 942
742 Ga0373935_0588040 3300035692 Bacteria 813
743 Ga0373927_0046192 3300035695 Bacteria 2818
744 Ga0373937_0131705 3300036401 Bacteria 2335
745 Ga0373937_1316823 3300036401 Bacteria 670
746 Ga0316582_0473590 3300036647 Bacteria 863
747 Ga0400491_05839 3300038727 Bacteria 2221
748 Ga0436365_0792880 3300039437 Bacteria 600
749 Ga0436363_1539500 3300039450 Bacteria 1630
750 Ga0439453_0023785 3300041408 Bacteria 1120
751 Ga0439461_0023618 3300041410 Bacteria 1238
752 Ga0451791_0576223 3300041451 Bacteria 786
753 Ga0451791_0601765 3300041451 Bacteria 778
754 Ga0451798_0553446 3300041458 Bacteria 746
755 Ga0451837_0776061 3300041494 Bacteria 578
756 Ga0451845_0569374 3300041501 Bacteria 669
757 Ga0451845_0705662 3300041501 Bacteria 804
758 Ga0451848_10600 3300041504 Bacteria 500
759 Ga0451853_3373278 3300041512 Bacteria 1065
760 Ga0439433_0067066 3300041999 Bacteria 861
761 Ga0439448_0182765 3300042005 Bacteria 733
762 Ga0439451_036312 3300042009 Bacteria 991
763 Ga0439454_047718 3300042011 Bacteria 716
764 Ga0439455_0028811 3300042012 Bacteria 1369
765 Ga0439457_061005 3300042014 Bacteria 854
766 Ga0439462_0157175 3300042015 Bacteria 640
767 Ga0450912_022375 3300042116 Bacteria 619
768 Ga0450920_003080 3300042122 Bacteria 2877
769 Ga0450923_001669 3300042125 Bacteria 3012
770 Ga0450894_000786 3300042131 Bacteria 5166
771 Ga0450895_000378 3300042132 Bacteria 2465
772 Ga0450895_012963 3300042132 Bacteria 729
773 Ga0450896_009967 3300042133 Bacteria 1329
774 Ga0450899_011216 3300042135 Bacteria 998
775 Ga0439446_0002581 3300042156 Bacteria 4366
776 Ga0439446_0208736 3300042156 Bacteria 662
777 Ga0450908_020949 3300042184 Bacteria 1148
778 Ga0439434_0002754 3300042435 Bacteria 5122
779 Ga0439435_0014359 3300042436 Bacteria 1956
780 Ga0439459_0029157 3300042438 Bacteria 1112
781 Ga0439464_0225796 3300042439 Bacteria 601
782 Ga0439460_0377211 3300042461 Bacteria 502
783 Ga0451577_0498262 3300042876 Bacteria 1106
784 Ga0451577_0636787 3300042876 Bacteria 967
785 Ga0453683_0053588 3300044673 Bacteria 2524
786 Ga0453683_0096485 3300044673 Bacteria 1855
787 Ga0453683_0401546 3300044673 Bacteria 883
788 Ga0453683_0634480 3300044673 Bacteria 698
789 Ga0453684_0024329 3300044712 Bacteria 8857
790 Ga0453684_0115797 3300044712 Bacteria 3247
791 Ga0453684_0138714 3300044712 Bacteria 2907
792 Ga0453684_0453090 3300044712 Bacteria 1428
793 Ga0451576_0026098 3300045051 Bacteria 6285
794 Ga0451576_0171103 3300045051 Bacteria 2267
795 Ga0451576_0358412 3300045051 Bacteria 1527
796 Ga0451576_0659526 3300045051 Bacteria 1099
797 Ga0451576_0907465 3300045051 Bacteria 924
798 Ga0451576_1491830 3300045051 Bacteria 702
799 Ga0451576_2557255 3300045051 Bacteria 521
800 Ga0495603_0275351 3300046455 Bacteria 968
801 Ga0495629_0421594 3300046459 Bacteria 906
802 Ga0495651_0919944 3300046462 Bacteria 534
803 Ga0495580_0802896 3300046472 Bacteria 610
804 Ga0495664_0938036 3300046477 Bacteria 505
805 Ga0495630_1062220 3300046517 Bacteria 614
806 Ga0495663_0098784 3300046525 Bacteria 959
807 Ga0495586_0488388 3300046535 Bacteria 710
808 Ga0495609_0309350 3300046538 Bacteria 642
809 Ga0495668_0530353 3300046616 Bacteria 649
810 Ga0495634_0041616 3300046642 Bacteria 3120
811 Ga0495658_0068988 3300046683 Bacteria 2048
812 Ga0495658_0815812 3300046683 Bacteria 597
813 Ga0495613_0526537 3300046689 Bacteria 793
814 Ga0495670_0416147 3300046691 Bacteria 727
815 Ga0495636_0267158 3300047318 Bacteria 794
816 Ga0495672_0002464 3300047320 Bacteria 17011
817 Ga0495685_291208 3300047447 Bacteria 514
818 Ga0495614_0199635 3300048089 Bacteria 905
819 Ga0495626_0374905 3300048091 Bacteria 553
820 Ga0496100_0793316 3300048903 Bacteria 742
821 Ga0496100_1084499 3300048903 Bacteria 631
822 Ga0496101_0574208 3300048904 Bacteria 892
823 Ga0496102_0521311 3300048905 Bacteria 1111
824 Ga0496103_0747079 3300048906 Bacteria 619
825 Ga0496104_0004897 3300048907 Bacteria 11678
826 Ga0496105_0311917 3300048908 Bacteria 1263
827 Ga0496107_0489041 3300048910 Bacteria 913
828 Ga0496108_0000658 3300048911 Bacteria 26635
829 Ga0496109_0011768 3300048912 Bacteria 7529
830 Ga0496109_0095825 3300048912 Bacteria 2748
831 Ga0496109_0688905 3300048912 Bacteria 959
832 Ga0496109_0881463 3300048912 Bacteria 833
833 Ga0496110_0033880 3300048913 Bacteria 4420
834 Ga0496110_1155401 3300048913 Bacteria 683
835 Ga0496110_1836776 3300048913 Bacteria 516
836 Ga0496112_0009883 3300048915 Bacteria 8625
837 Ga0496112_0545395 3300048915 Bacteria 1094
838 Ga0496112_0554222 3300048915 Bacteria 1083
839 Ga0496113_1135973 3300048916 Bacteria 612
840 Ga0496125_0751795 3300048928 Bacteria 511
841 Ga0501306_044899 3300049127 Bacteria 695
842 Ga0501309_015734 3300049129 Bacteria 1026
843 Ga0501305_097530 3300049161 Bacteria 544
844 Ga0501292_067738 3300049515 Bacteria 659
845 Ga0501312_110697 3300049528 Bacteria 523
846 Ga0501313_040458 3300049529 Bacteria 625
847 Ga0501315_103948 3300049531 Bacteria 504
848 Ga0501318_015245 3300049534 Bacteria 916
849 Ga0501319_009823 3300049535 Bacteria 754
850 Ga0501321_027855 3300049537 Bacteria 740
851 Ga0501321_029343 3300049537 Bacteria 727
852 Ga0501323_074601 3300049539 Bacteria 547
853 Ga0501325_018991 3300049541 Bacteria 709
854 Ga0501031_0171039 3300049568 Bacteria 1420
855 Ga0501031_0285866 3300049568 Bacteria 1069
856 Ga0501031_0571448 3300049568 Bacteria 728
857 Ga0501032_0040830 3300049569 Bacteria 3152
858 Ga0501033_0636794 3300049570 Bacteria 729
859 Ga0501033_1096856 3300049570 Bacteria 529
860 Ga0501034_0037393 3300049571 Bacteria 4914
861 Ga0501034_0096601 3300049571 Bacteria 2950
862 Ga0501034_0112215 3300049571 Bacteria 2716
863 Ga0501036_0067215 3300049572 Bacteria 3032
864 Ga0501036_0328612 3300049572 Bacteria 1277
865 Ga0501036_0754311 3300049572 Bacteria 803
866 Ga0501036_0835578 3300049572 Bacteria 757
867 Ga0501036_1691777 3300049572 Bacteria 510
868 Ga0501037_0120192 3300049573 Bacteria 1889
869 Ga0501037_0287476 3300049573 Bacteria 1144
870 Ga0501037_0429266 3300049573 Bacteria 904
871 Ga0501037_0609759 3300049573 Bacteria 732
872 Ga0501038_0012873 3300049574 Bacteria 7634
873 Ga0501038_0105891 3300049574 Bacteria 2335
874 Ga0501038_0449695 3300049574 Bacteria 991
875 Ga0501039_0313832 3300049575 Bacteria 1232
876 Ga0501039_0365469 3300049575 Bacteria 1133
877 Ga0501039_1355157 3300049575 Bacteria 548
878 Ga0501040_0006547 3300049576 Bacteria 7562
879 Ga0501040_0876652 3300049576 Bacteria 650
880 Ga0501040_1006733 3300049576 Bacteria 604
881 Ga0501041_0014846 3300049577 Bacteria 4624
882 Ga0501041_0030844 3300049577 Bacteria 3236
883 Ga0501041_0343112 3300049577 Bacteria 943
884 Ga0501042_0039517 3300049578 Bacteria 3353
885 Ga0501042_0100169 3300049578 Bacteria 2083
886 Ga0501042_0181118 3300049578 Bacteria 1520
887 Ga0501042_0309575 3300049578 Bacteria 1141
888 Ga0501042_0458589 3300049578 Bacteria 924
889 Ga0501042_0500644 3300049578 Bacteria 882
890 Ga0501042_0565847 3300049578 Bacteria 826
891 Ga0501042_1367850 3300049578 Bacteria 516
892 Ga0501043_0027314 3300049579 Bacteria 4481
893 Ga0501043_0038310 3300049579 Bacteria 3769
894 Ga0501043_0189802 3300049579 Bacteria 1598
895 Ga0501046_0002275 3300049580 Bacteria 18106
896 Ga0501046_0176973 3300049580 Bacteria 1597
897 Ga0501046_0199609 3300049580 Bacteria 1489
898 Ga0501046_0390831 3300049580 Bacteria 1006
899 Ga0501046_1051855 3300049580 Bacteria 564
900 Ga0501046_1140300 3300049580 Bacteria 537
901 Ga0501047_0025147 3300049581 Bacteria 5720
902 Ga0501047_0184413 3300049581 Bacteria 1952
903 Ga0501047_0466493 3300049581 Bacteria 1091
904 Ga0501048_0179363 3300049582 Bacteria 1501
905 Ga0501048_0197876 3300049582 Bacteria 1424
906 Ga0501048_0401275 3300049582 Bacteria 980
907 Ga0501048_0707647 3300049582 Bacteria 723
908 Ga0501048_1238148 3300049582 Bacteria 537
909 Ga0501048_1357835 3300049582 Bacteria 511
910 Ga0501067_0157007 3300049583 Bacteria 1267
911 Ga0501068_0594834 3300049584 Bacteria 721
912 Ga0501068_1107826 3300049584 Bacteria 524
913 Ga0501069_0710597 3300049585 Bacteria 606
914 Ga0501069_0944057 3300049585 Bacteria 526
915 Ga0501071_0018416 3300049587 Bacteria 4834
916 Ga0501071_0067056 3300049587 Bacteria 2609
917 Ga0501071_0925038 3300049587 Bacteria 673
918 Ga0501072_0128959 3300049588 Bacteria 2015
919 Ga0501072_0247455 3300049588 Bacteria 1420
920 Ga0501072_0694870 3300049588 Bacteria 800
921 Ga0501072_0780570 3300049588 Bacteria 749
922 Ga0501072_0800186 3300049588 Bacteria 738
923 Ga0501072_0807251 3300049588 Bacteria 735
924 Ga0501072_0874141 3300049588 Bacteria 703
925 Ga0501072_1264405 3300049588 Bacteria 572
926 Ga0501073_0233769 3300049589 Bacteria 1269
927 Ga0501074_0150139 3300049590 Bacteria 1666
928 Ga0501074_0185176 3300049590 Bacteria 1485
929 Ga0501074_0374671 3300049590 Bacteria 1010
930 Ga0501075_0544097 3300049591 Bacteria 886
931 Ga0501075_0571092 3300049591 Bacteria 863
932 Ga0501075_1427584 3300049591 Bacteria 524
933 Ga0501076_0002067 3300049592 Bacteria 13745
934 Ga0501076_0015943 3300049592 Bacteria 5687
935 Ga0501076_0165987 3300049592 Bacteria 1799
936 Ga0501076_0193268 3300049592 Bacteria 1661
937 Ga0501076_0297024 3300049592 Bacteria 1324
938 Ga0501076_0638679 3300049592 Bacteria 878
939 Ga0501076_1207689 3300049592 Bacteria 622
940 Ga0501076_1210229 3300049592 Bacteria 622
941 Ga0501077_0009857 3300049593 Bacteria 5943
942 Ga0501077_0726427 3300049593 Bacteria 638
943 Ga0501077_0817668 3300049593 Bacteria 599
944 Ga0501217_295153 3300049661 Bacteria 534
945 Ga0501225_0129961 3300049705 Bacteria 754
946 Ga0501079_0001902 3300049741 Bacteria 14973
947 Ga0501079_0053819 3300049741 Bacteria 3105
948 Ga0501079_0365763 3300049741 Bacteria 1130
949 Ga0501079_0734069 3300049741 Bacteria 777
950 Ga0501079_1005604 3300049741 Bacteria 657
951 Ga0501079_1487773 3300049741 Bacteria 533
952 Ga0501080_0149023 3300049742 Bacteria 2163
953 Ga0501080_0198283 3300049742 Bacteria 1843
954 Ga0501081_0001000 3300049743 Bacteria 16843
955 Ga0501081_0160123 3300049743 Bacteria 1622
956 Ga0501081_0173194 3300049743 Bacteria 1559
957 Ga0501081_0769329 3300049743 Bacteria 724
958 Ga0501081_0829009 3300049743 Bacteria 696
959 Ga0501083_0046353 3300049744 Bacteria 2939
960 Ga0501083_0163514 3300049744 Bacteria 1455
961 Ga0501274_027122 3300049771 Bacteria 628
962 Ga0501035_0000901 3300049822 Bacteria 31399
963 Ga0501035_0236442 3300049822 Bacteria 1555
964 Ga0501035_0503293 3300049822 Bacteria 997
965 Ga0501035_0842153 3300049822 Bacteria 730
966 Ga0501035_0842737 3300049822 Bacteria 730
967 Ga0501044_0245704 3300049823 Bacteria 1732
968 Ga0501045_0206499 3300049824 Bacteria 1463
969 Ga0501045_0217869 3300049824 Bacteria 1422
970 Ga0501045_0293769 3300049824 Bacteria 1209
971 Ga0501045_0361671 3300049824 Bacteria 1080
972 Ga0501045_0983307 3300049824 Bacteria 619
973 nmdc:mga03683_183227_c1 3300050489 Bacteria 956
974 nmdc:mga06z11_95702_c1 3300050494 Bacteria 1620
975 nmdc:mga07m45_639155_c1 3300050496 Bacteria 613
976 nmdc:mga05p37_117437_c1 3300050507 Bacteria 3269
977 nmdc:mga05p37_1232308_c1 3300050507 Bacteria 770
978 nmdc:mga05p37_174_c1 3300050507 Bacteria 62666
979 nmdc:mga05p37_200209_c1 3300050507 Bacteria 2419
980 nmdc:mga09592_1358389_c1 3300050508 Bacteria 582
981 nmdc:mga09592_51946_c1 3300050508 Bacteria 3458
982 nmdc:mga09592_708228_c1 3300050508 Bacteria 856
983 nmdc:mga09592_926749_c1 3300050508 Bacteria 731
984 nmdc:mga0qj67_732324_c1 3300050509 Bacteria 785
985 nmdc:mga0qj67_797599_c1 3300050509 Bacteria 748
986 nmdc:mga06r32_191119_c1 3300050510 Bacteria 2035
987 nmdc:mga06r32_214748_c1 3300050510 Bacteria 1911
988 nmdc:mga06r32_881431_c1 3300050510 Bacteria 852
989 nmdc:mga08y16_128140_c1 3300050511 Bacteria 2640
990 nmdc:mga08y16_1538_c1 3300050511 Bacteria 23197
991 nmdc:mga08y16_26595_c1 3300050511 Bacteria 6100
992 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
993 nmdc:mga08y16_3103_c1 3300050511 Bacteria 17195
994 nmdc:mga08y16_767182_c1 3300050511 Bacteria 959
995 nmdc:mga0n895_1015863_c1 3300050512 Bacteria 810
996 nmdc:mga0n895_1111214_c1 3300050512 Bacteria 767
997 nmdc:mga0n895_125267_c1 3300050512 Bacteria 2593
998 nmdc:mga0n895_44765_c1 3300050512 Bacteria 4316
999 nmdc:mga0n895_681698_c1 3300050512 Bacteria 1025
1000 nmdc:mga0n895_685089_c1 3300050512 Bacteria 1022
1001 nmdc:mga0n895_846321_c1 3300050512 Bacteria 903
1002 nmdc:mga0rr50_1362613_c1 3300050513 Bacteria 601
1003 nmdc:mga0rr50_330267_c1 3300050513 Bacteria 1280
1004 nmdc:mga0rr50_52386_c1 3300050513 Bacteria 3033
1005 nmdc:mga0rr50_827335_c1 3300050513 Bacteria 790
1006 nmdc:mga08x19_11737_c1 3300050514 Bacteria 5276
1007 nmdc:mga08x19_382385_c1 3300050514 Bacteria 986
1008 nmdc:mga08x19_460310_c1 3300050514 Bacteria 896
1009 nmdc:mga0a205_1098745_c1 3300050515 Bacteria 643
1010 nmdc:mga0a205_183324_c1 3300050515 Bacteria 1987
1011 nmdc:mga0a205_206237_c1 3300050515 Bacteria 1855
1012 nmdc:mga0a205_606744_c1 3300050515 Bacteria 947
1013 Ga0495601_0715683 3300053077 Bacteria 638
1014 Ga0495601_0734447 3300053077 Bacteria 629
1015 Ga0495612_0216178 3300053078 Bacteria 848
1016 Ga0495595_0602330 3300053084 Bacteria 562
1017 Ga0500555_074997 3300053103 Bacteria 887
1018 Ga0500593_195985 3300053117 Bacteria 734
1019 Ga0500652_038557 3300053131 Bacteria 1912
1020 Ga0501084_0013715 3300054114 Bacteria 6708
1021 Ga0501084_0028474 3300054114 Bacteria 4670
1022 Ga0501084_0051048 3300054114 Bacteria 3461
1023 Ga0501084_0410611 3300054114 Bacteria 1144
1024 Ga0501084_0508714 3300054114 Bacteria 1018
1025 Ga0501084_0979122 3300054114 Bacteria 711
1026 Ga0501084_1116090 3300054114 Bacteria 662
1027 Ga0590071_051739 3300059421 Bacteria 997
1028 Ga0590075_044273 3300059424 Bacteria 1139
1029 Ga0590077_001873 3300059426 Bacteria 4670
1030 Ga0587084_067786 3300059477 Bacteria 668
1031 Ga0587066_187893 3300059490 Bacteria 536
1032 Ga0587077_053157 3300059493 Bacteria 854
1033 Ga0587083_0101888 3300059505 Bacteria 716
1034 Ga0587091_084709 3300059511 Bacteria 718
1035 Ga0587092_060075 3300059512 Bacteria 709
1036 Ga0587098_004049 3300059604 Bacteria 1357
1037 Ga0587125_011106 3300059607 Bacteria 940
1038 Ga0587101_025346 3300059623 Bacteria 888
1039 Ga0587109_052056 3300059624 Bacteria 842
1040 Ga0587062_138704 3300059639 Bacteria 506
1041 Ga0587067_110345 3300059640 Bacteria 648
1042 Ga0587072_017653 3300059643 Bacteria 1232
1043 Ga0587107_091275 3300059652 Bacteria 589
1044 Ga0587111_0047244 3300060346 Bacteria 938
1045 Ga0587111_0227301 3300060346 Bacteria 542
1046 Ga0501082_0001088 3300060353 Bacteria 24065
1047 Ga0501082_0036253 3300060353 Bacteria 4249
1048 Ga0501082_0232190 3300060353 Bacteria 1605
1049 Ga0501082_0237293 3300060353 Bacteria 1587
1050 Ga0530510_0024932 3300061734 Bacteria 4274
1051 Ga0530510_0029412 3300061734 Bacteria 3943
1052 Ga0530510_0251002 3300061734 Bacteria 1318
1053 Ga0530510_0284775 3300061734 Bacteria 1235
1054 Ga0530510_1039631 3300061734 Bacteria 627

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002244 JGI24742J22300_10123144 JGI24742J22300_101231442 43
2 3300003322 rootL2_10015190 rootL2_100151901 43
3 3300005293 Ga0065715_10919226 Ga0065715_109192262 43
4 3300005295 Ga0065707_11098298 Ga0065707_110982983 43
5 3300005331 Ga0070670_101031600 Ga0070670_1010316002 43
6 3300005333 Ga0070677_10248660 Ga0070677_102486602 43
7 3300005335 Ga0070666_10039674 Ga0070666_100396744 43
8 3300005347 Ga0070668_101417960 Ga0070668_1014179602 43
9 3300005353 Ga0070669_100166876 Ga0070669_1001668762 43
10 3300005354 Ga0070675_101538363 Ga0070675_1015383631 43
11 3300005356 Ga0070674_100404224 Ga0070674_1004042242 43
12 3300005367 Ga0070667_100855240 Ga0070667_1008552402 43
13 3300005456 Ga0070678_100150458 Ga0070678_1001504582 43
14 3300005457 Ga0070662_100160245 Ga0070662_1001602452 43
15 3300005459 Ga0068867_102344089 Ga0068867_1023440892 43
16 3300005539 Ga0068853_100874452 Ga0068853_1008744523 43
17 3300005564 Ga0070664_101470377 Ga0070664_1014703772 43
18 3300005564 Ga0070664_101582707 Ga0070664_1015827072 43
19 3300005577 Ga0068857_101448132 Ga0068857_1014481322 43
20 3300005578 Ga0068854_100421747 Ga0068854_1004217472 43
21 3300005616 Ga0068852_101346269 Ga0068852_1013462692 43
22 3300005719 Ga0068861_100270266 Ga0068861_1002702662 43
23 3300005842 Ga0068858_101741107 Ga0068858_1017411072 43
24 3300005981 Ga0081538_10128689 Ga0081538_101286892 43
25 3300006038 Ga0075365_10018282 Ga0075365_100182826 43
26 3300006195 Ga0075366_10940781 Ga0075366_109407812 43
27 3300006871 Ga0075434_100081239 Ga0075434_1000812391 43
28 3300006881 Ga0068865_101512768 Ga0068865_1015127682 43
29 3300013306 Ga0163162_11547671 Ga0163162_115476711 43
30 3300014325 Ga0163163_11176712 Ga0163163_111767122 43
31 3300014497 Ga0182008_10955012 Ga0182008_109550121 43
32 3300042011 Ga0439454_047718 Ga0439454_047718_552_701 43
33 3300049577 Ga0501041_0343112 Ga0501041_0343112_143_292 43
34 3300049578 Ga0501042_0458589 Ga0501042_0458589_682_831 43
35 3300049580 Ga0501046_1051855 Ga0501046_1051855_23_172 43
36 3300049584 Ga0501068_1107826 Ga0501068_1107826_354_503 43
37 3300049587 Ga0501071_0067056 Ga0501071_0067056_864_1013 43
38 3300049588 Ga0501072_0780570 Ga0501072_0780570_460_609 43
39 3300049590 Ga0501074_0185176 Ga0501074_0185176_456_605 43
40 3300049592 Ga0501076_0015943 Ga0501076_0015943_1894_2043 43
41 3300049741 Ga0501079_0053819 Ga0501079_0053819_668_817 43
42 3300049824 Ga0501045_0206499 Ga0501045_0206499_527_676 43
43 3300054114 Ga0501084_0508714 Ga0501084_0508714_51_200 43
44 3300060353 Ga0501082_0237293 Ga0501082_0237293_684_833 43
45 3300002070 JGI24750J21931_1010309 JGI24750J21931_10103094 44
46 3300005367 Ga0070667_101332600 Ga0070667_1013326001 44
47 3300005438 Ga0070701_10220990 Ga0070701_102209902 44
48 3300005546 Ga0070696_100265354 Ga0070696_1002653541 44
49 3300005549 Ga0070704_100564894 Ga0070704_1005648942 44
50 3300005840 Ga0068870_10209859 Ga0068870_102098592 44
51 3300005843 Ga0068860_102213821 Ga0068860_1022138212 44
52 3300009553 Ga0105249_12579814 Ga0105249_125798142 44
53 3300013308 Ga0157375_13424004 Ga0157375_134240041 44
54 3300014325 Ga0163163_11324055 Ga0163163_113240553 44
55 3300014326 Ga0157380_10694493 Ga0157380_106944931 44
56 3300014326 Ga0157380_13357676 Ga0157380_133576762 44
57 3300025903 Ga0207680_10462487 Ga0207680_104624872 44
58 3300025908 Ga0207643_10517479 Ga0207643_105174792 44
59 3300025923 Ga0207681_10121335 Ga0207681_101213352 44
60 3300025925 Ga0207650_10774390 Ga0207650_107743902 44
61 3300025926 Ga0207659_11307753 Ga0207659_113077532 44
62 3300025933 Ga0207706_10010042 Ga0207706_100100422 44
63 3300025937 Ga0207669_10553544 Ga0207669_105535442 44
64 3300025972 Ga0207668_10446977 Ga0207668_104469772 44
65 3300026121 Ga0207683_10218366 Ga0207683_102183662 44
66 3300035086 Ga0373934_0108730 Ga0373934_0108730_931_1080 44
67 3300046683 Ga0495658_0815812 Ga0495658_0815812_211_360 44
68 3300048091 Ga0495626_0374905 Ga0495626_0374905_382_531 44
69 3300049587 Ga0501071_0925038 Ga0501071_0925038_219_368 44
70 3300049588 Ga0501072_0807251 Ga0501072_0807251_248_397 44
71 3300049592 Ga0501076_0638679 Ga0501076_0638679_298_447 44
72 3300026088 Ga0207641_10411463 Ga0207641_104114634 48
73 3300000549 LJQas_1004572 LJQas_10045722 49
74 3300001904 JGI24736J21556_1078915 JGI24736J21556_10789151 49
75 3300001976 JGI24752J21851_1019788 JGI24752J21851_10197883 49
76 3300001977 JGI24746J21847_1003481 JGI24746J21847_10034815 49
77 3300001978 JGI24747J21853_1004504 JGI24747J21853_10045043 49
78 3300001990 JGI24737J22298_10015109 JGI24737J22298_100151095 49
79 3300001991 JGI24743J22301_10001659 JGI24743J22301_100016594 49
80 3300002070 JGI24750J21931_1013551 JGI24750J21931_10135513 49
81 3300002073 JGI24745J21846_1012438 JGI24745J21846_10124382 49
82 3300002074 JGI24748J21848_1011226 JGI24748J21848_10112263 49
83 3300002075 JGI24738J21930_10034985 JGI24738J21930_100349852 49
84 3300002076 JGI24749J21850_1001134 JGI24749J21850_10011347 49
85 3300002077 JGI24744J21845_10024765 JGI24744J21845_100247653 49
86 3300002126 JGI24035J26624_1010268 JGI24035J26624_10102682 49
87 3300002155 JGI24033J26618_1030436 JGI24033J26618_10304362 49
88 3300002244 JGI24742J22300_10046791 JGI24742J22300_100467913 49
89 3300002459 JGI24751J29686_10001570 JGI24751J29686_100015703 49
90 3300003659 JGI25404J52841_10008784 JGI25404J52841_100087843 49
91 3300004798 Ga0058859_10031327 Ga0058859_100313272 49
92 3300004798 Ga0058859_11679412 Ga0058859_116794122 49
93 3300004798 Ga0058859_11795058 Ga0058859_117950582 49
94 3300004801 Ga0058860_12109938 Ga0058860_121099384 49
95 3300004801 Ga0058860_12218590 Ga0058860_122185902 49
96 3300004803 Ga0058862_12775106 Ga0058862_127751061 49
97 3300004803 Ga0058862_12857261 Ga0058862_128572613 49
98 3300005289 Ga0065704_10004364 Ga0065704_100043648 49
99 3300005289 Ga0065704_10040355 Ga0065704_100403553 49
100 3300005289 Ga0065704_10332004 Ga0065704_103320041 49
101 3300005290 Ga0065712_10003180 Ga0065712_100031809 49
102 3300005290 Ga0065712_10031979 Ga0065712_100319792 49
103 3300005290 Ga0065712_10051647 Ga0065712_100516472 49
104 3300005290 Ga0065712_10086694 Ga0065712_100866947 49
105 3300005293 Ga0065715_10053782 Ga0065715_100537822 49
106 3300005293 Ga0065715_10225253 Ga0065715_102252532 49
107 3300005293 Ga0065715_10345118 Ga0065715_103451181 49
108 3300005293 Ga0065715_10453518 Ga0065715_104535182 49
109 3300005293 Ga0065715_10552740 Ga0065715_105527402 49
110 3300005293 Ga0065715_10656145 Ga0065715_106561452 49
111 3300005293 Ga0065715_10695372 Ga0065715_106953723 49
112 3300005295 Ga0065707_10002895 Ga0065707_100028959 49
113 3300005295 Ga0065707_10027870 Ga0065707_100278702 49
114 3300005295 Ga0065707_10604539 Ga0065707_106045393 49
115 3300005295 Ga0065707_10741998 Ga0065707_107419982 49
116 3300005295 Ga0065707_10902817 Ga0065707_109028173 49
117 3300005295 Ga0065707_10976468 Ga0065707_109764682 49
118 3300005327 Ga0070658_10005024 Ga0070658_1000502415 49
119 3300005327 Ga0070658_11939020 Ga0070658_119390203 49
120 3300005328 Ga0070676_10002393 Ga0070676_100023932 49
121 3300005328 Ga0070676_10491550 Ga0070676_104915503 49
122 3300005328 Ga0070676_10595526 Ga0070676_105955261 49
123 3300005328 Ga0070676_10647349 Ga0070676_106473491 49
124 3300005328 Ga0070676_10680290 Ga0070676_106802901 49
125 3300005328 Ga0070676_10684122 Ga0070676_106841223 49
126 3300005329 Ga0070683_100000094 Ga0070683_10000009455 49
127 3300005329 Ga0070683_100001323 Ga0070683_10000132313 49
128 3300005329 Ga0070683_100036179 Ga0070683_1000361795 49
129 3300005329 Ga0070683_101580343 Ga0070683_1015803431 49
130 3300005329 Ga0070683_101628540 Ga0070683_1016285402 49
131 3300005330 Ga0070690_100000500 Ga0070690_10000050015 49
132 3300005330 Ga0070690_100776090 Ga0070690_1007760903 49
133 3300005330 Ga0070690_101047610 Ga0070690_1010476102 49
134 3300005330 Ga0070690_101051337 Ga0070690_1010513372 49
135 3300005330 Ga0070690_101378213 Ga0070690_1013782133 49
136 3300005331 Ga0070670_100004270 Ga0070670_1000042705 49
137 3300005331 Ga0070670_100016953 Ga0070670_1000169535 49
138 3300005331 Ga0070670_100260887 Ga0070670_1002608872 49
139 3300005331 Ga0070670_101130782 Ga0070670_1011307822 49
140 3300005331 Ga0070670_101931683 Ga0070670_1019316834 49
141 3300005331 Ga0070670_102046394 Ga0070670_1020463942 49
142 3300005333 Ga0070677_10000073 Ga0070677_100000736 49
143 3300005333 Ga0070677_10494885 Ga0070677_104948852 49
144 3300005334 Ga0068869_100012627 Ga0068869_1000126277 49
145 3300005334 Ga0068869_100587407 Ga0068869_1005874072 49
146 3300005335 Ga0070666_10000730 Ga0070666_1000073010 49
147 3300005336 Ga0070680_100149467 Ga0070680_1001494674 49
148 3300005336 Ga0070680_100376351 Ga0070680_1003763511 49
149 3300005336 Ga0070680_100697413 Ga0070680_1006974132 49
150 3300005337 Ga0070682_100194809 Ga0070682_1001948092 49
151 3300005337 Ga0070682_100419657 Ga0070682_1004196571 49
152 3300005337 Ga0070682_101669821 Ga0070682_1016698211 49
153 3300005338 Ga0068868_100125900 Ga0068868_1001259002 49
154 3300005338 Ga0068868_100814076 Ga0068868_1008140761 49
155 3300005338 Ga0068868_100984944 Ga0068868_1009849442 49
156 3300005338 Ga0068868_101229391 Ga0068868_1012293912 49
157 3300005338 Ga0068868_102026188 Ga0068868_1020261882 49
158 3300005339 Ga0070660_100000181 Ga0070660_10000018119 49
159 3300005339 Ga0070660_100379575 Ga0070660_1003795751 49
160 3300005340 Ga0070689_100000949 Ga0070689_10000094911 49
161 3300005340 Ga0070689_100041204 Ga0070689_1000412041 49
162 3300005340 Ga0070689_100109280 Ga0070689_1001092805 49
163 3300005341 Ga0070691_10020695 Ga0070691_100206956 49
164 3300005341 Ga0070691_10450638 Ga0070691_104506382 49
165 3300005341 Ga0070691_10939951 Ga0070691_109399511 49
166 3300005343 Ga0070687_100000024 Ga0070687_1000000247 49
167 3300005343 Ga0070687_100208653 Ga0070687_1002086532 49
168 3300005343 Ga0070687_100482813 Ga0070687_1004828132 49
169 3300005343 Ga0070687_100892946 Ga0070687_1008929462 49
170 3300005344 Ga0070661_100006519 Ga0070661_1000065198 49
171 3300005344 Ga0070661_100078230 Ga0070661_1000782302 49
172 3300005344 Ga0070661_100252775 Ga0070661_1002527752 49
173 3300005344 Ga0070661_101822398 Ga0070661_1018223981 49
174 3300005345 Ga0070692_10005628 Ga0070692_100056287 49
175 3300005345 Ga0070692_10053554 Ga0070692_100535542 49
176 3300005347 Ga0070668_100000448 Ga0070668_10000044815 49
177 3300005347 Ga0070668_100068776 Ga0070668_1000687766 49
178 3300005347 Ga0070668_100348544 Ga0070668_1003485442 49
179 3300005347 Ga0070668_101024720 Ga0070668_1010247202 49
180 3300005347 Ga0070668_101188794 Ga0070668_1011887941 49
181 3300005347 Ga0070668_102289010 Ga0070668_1022890102 49
182 3300005353 Ga0070669_100001019 Ga0070669_10000101910 49
183 3300005353 Ga0070669_100222261 Ga0070669_1002222615 49
184 3300005353 Ga0070669_100449834 Ga0070669_1004498344 49
185 3300005353 Ga0070669_101667002 Ga0070669_1016670021 49
186 3300005354 Ga0070675_100001940 Ga0070675_1000019407 49
187 3300005354 Ga0070675_100118030 Ga0070675_1001180306 49
188 3300005354 Ga0070675_100210042 Ga0070675_1002100425 49
189 3300005354 Ga0070675_100293359 Ga0070675_1002933593 49
190 3300005354 Ga0070675_100310247 Ga0070675_1003102476 49
191 3300005354 Ga0070675_100478685 Ga0070675_1004786852 49
192 3300005354 Ga0070675_101727039 Ga0070675_1017270392 49
193 3300005354 Ga0070675_101977356 Ga0070675_1019773561 49
194 3300005355 Ga0070671_100004331 Ga0070671_1000043314 49
195 3300005355 Ga0070671_100013832 Ga0070671_1000138322 49
196 3300005355 Ga0070671_100222326 Ga0070671_1002223264 49
197 3300005355 Ga0070671_100319994 Ga0070671_1003199944 49
198 3300005355 Ga0070671_100348479 Ga0070671_1003484793 49
199 3300005355 Ga0070671_100639326 Ga0070671_1006393261 49
200 3300005356 Ga0070674_100000350 Ga0070674_10000035012 49
201 3300005356 Ga0070674_100011938 Ga0070674_1000119389 49
202 3300005356 Ga0070674_100445341 Ga0070674_1004453414 49
203 3300005356 Ga0070674_100457466 Ga0070674_1004574665 49
204 3300005356 Ga0070674_100771977 Ga0070674_1007719774 49
205 3300005356 Ga0070674_101383746 Ga0070674_1013837463 49
206 3300005364 Ga0070673_100001346 Ga0070673_10000134610 49
207 3300005364 Ga0070673_100076042 Ga0070673_1000760424 49
208 3300005364 Ga0070673_100174521 Ga0070673_1001745212 49
209 3300005364 Ga0070673_101406459 Ga0070673_1014064592 49
210 3300005364 Ga0070673_101415377 Ga0070673_1014153772 49
211 3300005364 Ga0070673_102062034 Ga0070673_1020620344 49
212 3300005364 Ga0070673_102324411 Ga0070673_1023244112 49
213 3300005365 Ga0070688_100001135 Ga0070688_1000011357 49
214 3300005365 Ga0070688_100222985 Ga0070688_1002229854 49
215 3300005365 Ga0070688_101416895 Ga0070688_1014168951 49
216 3300005366 Ga0070659_100000114 Ga0070659_10000011412 49
217 3300005366 Ga0070659_100451301 Ga0070659_1004513012 49
218 3300005366 Ga0070659_100605689 Ga0070659_1006056894 49
219 3300005367 Ga0070667_100011084 Ga0070667_1000110846 49
220 3300005367 Ga0070667_100397655 Ga0070667_1003976553 49
221 3300005367 Ga0070667_101699404 Ga0070667_1016994041 49
222 3300005434 Ga0070709_11210828 Ga0070709_112108281 49
223 3300005435 Ga0070714_101686849 Ga0070714_1016868492 49
224 3300005437 Ga0070710_10868430 Ga0070710_108684302 49
225 3300005438 Ga0070701_10081817 Ga0070701_100818172 49
226 3300005438 Ga0070701_10566287 Ga0070701_105662871 49
227 3300005438 Ga0070701_10848837 Ga0070701_108488372 49
228 3300005439 Ga0070711_100149287 Ga0070711_1001492872 49
229 3300005439 Ga0070711_101361141 Ga0070711_1013611412 49
230 3300005440 Ga0070705_100005491 Ga0070705_1000054918 49
231 3300005440 Ga0070705_100105034 Ga0070705_1001050344 49
232 3300005440 Ga0070705_100157732 Ga0070705_1001577322 49
233 3300005440 Ga0070705_101585444 Ga0070705_1015854442 49
234 3300005440 Ga0070705_101718673 Ga0070705_1017186734 49
235 3300005441 Ga0070700_100028912 Ga0070700_1000289128 49
236 3300005441 Ga0070700_100773277 Ga0070700_1007732771 49
237 3300005441 Ga0070700_101755166 Ga0070700_1017551662 49
238 3300005444 Ga0070694_100576539 Ga0070694_1005765393 49
239 3300005444 Ga0070694_100716209 Ga0070694_1007162093 49
240 3300005445 Ga0070708_101447076 Ga0070708_1014470762 49
241 3300005455 Ga0070663_100000874 Ga0070663_1000008747 49
242 3300005455 Ga0070663_100359031 Ga0070663_1003590312 49
243 3300005455 Ga0070663_100743866 Ga0070663_1007438664 49
244 3300005455 Ga0070663_101672599 Ga0070663_1016725992 49
245 3300005456 Ga0070678_100017053 Ga0070678_1000170537 49
246 3300005456 Ga0070678_100328891 Ga0070678_1003288912 49
247 3300005456 Ga0070678_100428434 Ga0070678_1004284342 49
248 3300005456 Ga0070678_101203545 Ga0070678_1012035451 49
249 3300005456 Ga0070678_101325008 Ga0070678_1013250082 49
250 3300005457 Ga0070662_100000254 Ga0070662_10000025416 49
251 3300005457 Ga0070662_100285152 Ga0070662_1002851524 49
252 3300005457 Ga0070662_100432249 Ga0070662_1004322492 49
253 3300005458 Ga0070681_10188493 Ga0070681_101884933 49
254 3300005459 Ga0068867_100001968 Ga0068867_10000196811 49
255 3300005459 Ga0068867_100230883 Ga0068867_1002308832 49
256 3300005466 Ga0070685_10000248 Ga0070685_1000024810 49
257 3300005466 Ga0070685_11325340 Ga0070685_113253402 49
258 3300005467 Ga0070706_100402100 Ga0070706_1004021002 49
259 3300005467 Ga0070706_100996574 Ga0070706_1009965743 49
260 3300005467 Ga0070706_101450878 Ga0070706_1014508781 49
261 3300005468 Ga0070707_100857225 Ga0070707_1008572253 49
262 3300005468 Ga0070707_101604448 Ga0070707_1016044483 49
263 3300005471 Ga0070698_100545640 Ga0070698_1005456404 49
264 3300005471 Ga0070698_100647762 Ga0070698_1006477621 49
265 3300005471 Ga0070698_100758412 Ga0070698_1007584123 49
266 3300005471 Ga0070698_101000005 Ga0070698_1010000055 49
267 3300005471 Ga0070698_101386398 Ga0070698_1013863982 49
268 3300005518 Ga0070699_100022962 Ga0070699_10002296210 49
269 3300005518 Ga0070699_100157512 Ga0070699_1001575122 49
270 3300005518 Ga0070699_101208046 Ga0070699_1012080462 49
271 3300005518 Ga0070699_101258879 Ga0070699_1012588792 49
272 3300005530 Ga0070679_100047014 Ga0070679_1000470143 49
273 3300005530 Ga0070679_100145145 Ga0070679_1001451454 49
274 3300005530 Ga0070679_101616621 Ga0070679_1016166212 49
275 3300005535 Ga0070684_101395598 Ga0070684_1013955983 49
276 3300005536 Ga0070697_100017739 Ga0070697_1000177399 49
277 3300005536 Ga0070697_100185598 Ga0070697_1001855982 49
278 3300005536 Ga0070697_100237925 Ga0070697_1002379252 49
279 3300005536 Ga0070697_100363324 Ga0070697_1003633242 49
280 3300005536 Ga0070697_100382838 Ga0070697_1003828381 49
281 3300005536 Ga0070697_101178657 Ga0070697_1011786572 49
282 3300005536 Ga0070697_102008942 Ga0070697_1020089423 49
283 3300005536 Ga0070697_102047032 Ga0070697_1020470322 49
284 3300005539 Ga0068853_100001786 Ga0068853_10000178616 49
285 3300005539 Ga0068853_100795112 Ga0068853_1007951122 49
286 3300005543 Ga0070672_100001452 Ga0070672_10000145211 49
287 3300005543 Ga0070672_100482531 Ga0070672_1004825312 49
288 3300005543 Ga0070672_100504860 Ga0070672_1005048604 49
289 3300005543 Ga0070672_100591520 Ga0070672_1005915202 49
290 3300005543 Ga0070672_100624797 Ga0070672_1006247974 49
291 3300005543 Ga0070672_100860402 Ga0070672_1008604021 49
292 3300005543 Ga0070672_100967376 Ga0070672_1009673763 49
293 3300005543 Ga0070672_101298966 Ga0070672_1012989663 49
294 3300005543 Ga0070672_101719387 Ga0070672_1017193871 49
295 3300005544 Ga0070686_100000328 Ga0070686_10000032816 49
296 3300005544 Ga0070686_100488886 Ga0070686_1004888861 49
297 3300005545 Ga0070695_100084673 Ga0070695_1000846732 49
298 3300005545 Ga0070695_100225615 Ga0070695_1002256153 49
299 3300005545 Ga0070695_100264406 Ga0070695_1002644062 49
300 3300005545 Ga0070695_100409840 Ga0070695_1004098402 49
301 3300005545 Ga0070695_100861656 Ga0070695_1008616561 49
302 3300005545 Ga0070695_101132041 Ga0070695_1011320412 49
303 3300005546 Ga0070696_100736174 Ga0070696_1007361742 49
304 3300005546 Ga0070696_101885441 Ga0070696_1018854411 49
305 3300005547 Ga0070693_100010528 Ga0070693_1000105282 49
306 3300005547 Ga0070693_100019888 Ga0070693_1000198882 49
307 3300005548 Ga0070665_100010583 Ga0070665_10001058311 49
308 3300005548 Ga0070665_100094954 Ga0070665_1000949547 49
309 3300005548 Ga0070665_101664565 Ga0070665_1016645652 49
310 3300005548 Ga0070665_102548169 Ga0070665_1025481692 49
311 3300005548 Ga0070665_102594652 Ga0070665_1025946521 49
312 3300005549 Ga0070704_100066182 Ga0070704_1000661826 49
313 3300005549 Ga0070704_100116336 Ga0070704_1001163362 49
314 3300005549 Ga0070704_100529830 Ga0070704_1005298304 49
315 3300005549 Ga0070704_100831770 Ga0070704_1008317702 49
316 3300005549 Ga0070704_101162770 Ga0070704_1011627701 49
317 3300005563 Ga0068855_100006422 Ga0068855_10000642211 49
318 3300005564 Ga0070664_100000479 Ga0070664_10000047932 49
319 3300005564 Ga0070664_100053438 Ga0070664_1000534385 49
320 3300005564 Ga0070664_100145251 Ga0070664_1001452516 49
321 3300005564 Ga0070664_100221069 Ga0070664_1002210692 49
322 3300005564 Ga0070664_100324039 Ga0070664_1003240392 49
323 3300005564 Ga0070664_101725164 Ga0070664_1017251642 49
324 3300005577 Ga0068857_100092103 Ga0068857_1000921032 49
325 3300005577 Ga0068857_100252079 Ga0068857_1002520792 49
326 3300005577 Ga0068857_100525451 Ga0068857_1005254514 49
327 3300005577 Ga0068857_101734987 Ga0068857_1017349872 49
328 3300005578 Ga0068854_100000012 Ga0068854_10000001251 49
329 3300005614 Ga0068856_100009855 Ga0068856_10000985511 49
330 3300005614 Ga0068856_100408964 Ga0068856_1004089641 49
331 3300005615 Ga0070702_100798555 Ga0070702_1007985552 49
332 3300005615 Ga0070702_101400910 Ga0070702_1014009101 49
333 3300005615 Ga0070702_101444887 Ga0070702_1014448872 49
334 3300005616 Ga0068852_100000438 Ga0068852_10000043813 49
335 3300005617 Ga0068859_100001092 Ga0068859_10000109215 49
336 3300005617 Ga0068859_100039272 Ga0068859_1000392728 49
337 3300005617 Ga0068859_100138831 Ga0068859_1001388312 49
338 3300005617 Ga0068859_100200996 Ga0068859_1002009964 49
339 3300005617 Ga0068859_100381046 Ga0068859_1003810465 49
340 3300005617 Ga0068859_100683477 Ga0068859_1006834772 49
341 3300005617 Ga0068859_100777959 Ga0068859_1007779592 49
342 3300005617 Ga0068859_101466948 Ga0068859_1014669481 49
343 3300005617 Ga0068859_101995864 Ga0068859_1019958642 49
344 3300005617 Ga0068859_103024518 Ga0068859_1030245182 49
345 3300005618 Ga0068864_100003452 Ga0068864_1000034527 49
346 3300005618 Ga0068864_101039382 Ga0068864_1010393822 49
347 3300005618 Ga0068864_101310556 Ga0068864_1013105562 49
348 3300005618 Ga0068864_101754632 Ga0068864_1017546321 49
349 3300005718 Ga0068866_10000117 Ga0068866_1000011723 49
350 3300005718 Ga0068866_10117443 Ga0068866_101174432 49
351 3300005718 Ga0068866_10302363 Ga0068866_103023633 49
352 3300005718 Ga0068866_10328422 Ga0068866_103284223 49
353 3300005719 Ga0068861_100000082 Ga0068861_10000008214 49
354 3300005719 Ga0068861_100257033 Ga0068861_1002570333 49
355 3300005719 Ga0068861_101375880 Ga0068861_1013758802 49
356 3300005719 Ga0068861_101744180 Ga0068861_1017441802 49
357 3300005719 Ga0068861_102284504 Ga0068861_1022845041 49
358 3300005719 Ga0068861_102712449 Ga0068861_1027124492 49
359 3300005834 Ga0068851_10000775 Ga0068851_100007757 49
360 3300005834 Ga0068851_10163626 Ga0068851_101636264 49
361 3300005840 Ga0068870_10000643 Ga0068870_1000064314 49
362 3300005840 Ga0068870_10200553 Ga0068870_102005534 49
363 3300005840 Ga0068870_10412482 Ga0068870_104124823 49
364 3300005840 Ga0068870_11065030 Ga0068870_110650303 49
365 3300005841 Ga0068863_100053675 Ga0068863_1000536752 49
366 3300005841 Ga0068863_100153808 Ga0068863_1001538084 49
367 3300005841 Ga0068863_100160112 Ga0068863_1001601122 49
368 3300005841 Ga0068863_100862685 Ga0068863_1008626854 49
369 3300005841 Ga0068863_100954509 Ga0068863_1009545093 49
370 3300005841 Ga0068863_101007866 Ga0068863_1010078662 49
371 3300005841 Ga0068863_101786294 Ga0068863_1017862941 49
372 3300005841 Ga0068863_102587286 Ga0068863_1025872862 49
373 3300005842 Ga0068858_100008887 Ga0068858_10000888711 49
374 3300005842 Ga0068858_100055604 Ga0068858_1000556042 49
375 3300005842 Ga0068858_100276704 Ga0068858_1002767046 49
376 3300005842 Ga0068858_100424644 Ga0068858_1004246444 49
377 3300005842 Ga0068858_100740245 Ga0068858_1007402454 49
378 3300005842 Ga0068858_100803785 Ga0068858_1008037852 49
379 3300005842 Ga0068858_101417176 Ga0068858_1014171762 49
380 3300005842 Ga0068858_101621266 Ga0068858_1016212662 49
381 3300005843 Ga0068860_100005800 Ga0068860_10000580015 49
382 3300005843 Ga0068860_100087378 Ga0068860_1000873785 49
383 3300005843 Ga0068860_100234785 Ga0068860_1002347854 49
384 3300005843 Ga0068860_100239764 Ga0068860_1002397642 49
385 3300005843 Ga0068860_102175836 Ga0068860_1021758361 49
386 3300005844 Ga0068862_100004232 Ga0068862_1000042326 49
387 3300005844 Ga0068862_100559879 Ga0068862_1005598792 49
388 3300005844 Ga0068862_100988725 Ga0068862_1009887253 49
389 3300005844 Ga0068862_101429418 Ga0068862_1014294183 49
390 3300005844 Ga0068862_102738881 Ga0068862_1027388812 49
391 3300005937 Ga0081455_10843341 Ga0081455_108433413 49
392 3300005983 Ga0081540_1000029 Ga0081540_1000029116 49
393 3300005983 Ga0081540_1056204 Ga0081540_10562044 49
394 3300005983 Ga0081540_1142334 Ga0081540_11423345 49
395 3300006051 Ga0075364_11063440 Ga0075364_110634401 49
396 3300006163 Ga0070715_10542746 Ga0070715_105427464 49
397 3300006173 Ga0070716_100952370 Ga0070716_1009523703 49
398 3300006173 Ga0070716_101296152 Ga0070716_1012961522 49
399 3300006175 Ga0070712_100223757 Ga0070712_1002237572 49
400 3300006175 Ga0070712_100559918 Ga0070712_1005599182 49
401 3300006177 Ga0075362_10210142 Ga0075362_102101422 49
402 3300006178 Ga0075367_10084871 Ga0075367_100848712 49
403 3300006237 Ga0097621_100003466 Ga0097621_10000346614 49
404 3300006237 Ga0097621_100376089 Ga0097621_1003760892 49
405 3300006237 Ga0097621_102275822 Ga0097621_1022758221 49
406 3300006353 Ga0075370_10708837 Ga0075370_107088372 49
407 3300006358 Ga0068871_100202666 Ga0068871_1002026664 49
408 3300006358 Ga0068871_100573959 Ga0068871_1005739591 49
409 3300006358 Ga0068871_100758126 Ga0068871_1007581262 49
410 3300006358 Ga0068871_100964830 Ga0068871_1009648302 49
411 3300006358 Ga0068871_101055072 Ga0068871_1010550722 49
412 3300006844 Ga0075428_100000017 Ga0075428_1000000179 49
413 3300006844 Ga0075428_100122904 Ga0075428_1001229044 49
414 3300006844 Ga0075428_100355670 Ga0075428_1003556701 49
415 3300006844 Ga0075428_100535412 Ga0075428_1005354122 49
416 3300006844 Ga0075428_100653282 Ga0075428_1006532821 49
417 3300006844 Ga0075428_101016031 Ga0075428_1010160313 49
418 3300006844 Ga0075428_101262432 Ga0075428_1012624322 49
419 3300006844 Ga0075428_101585530 Ga0075428_1015855302 49
420 3300006847 Ga0075431_100454296 Ga0075431_1004542966 49
421 3300006847 Ga0075431_100870242 Ga0075431_1008702422 49
422 3300006847 Ga0075431_101270423 Ga0075431_1012704231 49
423 3300006847 Ga0075431_101677678 Ga0075431_1016776782 49
424 3300006847 Ga0075431_101800493 Ga0075431_1018004932 49
425 3300006847 Ga0075431_102020647 Ga0075431_1020206473 49
426 3300006852 Ga0075433_10080040 Ga0075433_100800406 49
427 3300006852 Ga0075433_10387441 Ga0075433_103874411 49
428 3300006852 Ga0075433_10854000 Ga0075433_108540006 49
429 3300006852 Ga0075433_11062040 Ga0075433_110620402 49
430 3300006871 Ga0075434_100062039 Ga0075434_1000620396 49
431 3300006871 Ga0075434_100480998 Ga0075434_1004809983 49
432 3300006871 Ga0075434_101113613 Ga0075434_1011136131 49
433 3300006871 Ga0075434_101652856 Ga0075434_1016528561 49
434 3300006880 Ga0075429_100218567 Ga0075429_1002185675 49
435 3300006880 Ga0075429_100569260 Ga0075429_1005692604 49
436 3300006880 Ga0075429_100955460 Ga0075429_1009554604 49
437 3300006880 Ga0075429_101397996 Ga0075429_1013979962 49
438 3300006880 Ga0075429_101951224 Ga0075429_1019512242 49
439 3300006881 Ga0068865_100001281 Ga0068865_1000012817 49
440 3300006881 Ga0068865_100789144 Ga0068865_1007891441 49
441 3300006914 Ga0075436_100041067 Ga0075436_1000410675 49
442 3300006914 Ga0075436_100497311 Ga0075436_1004973114 49
443 3300006931 Ga0097620_100001091 Ga0097620_10000109115 49
444 3300006931 Ga0097620_100039275 Ga0097620_1000392755 49
445 3300006931 Ga0097620_100138842 Ga0097620_1001388422 49
446 3300006931 Ga0097620_100200999 Ga0097620_1002009994 49
447 3300006931 Ga0097620_100381001 Ga0097620_1003810015 49
448 3300006931 Ga0097620_100683432 Ga0097620_1006834322 49
449 3300006931 Ga0097620_100777969 Ga0097620_1007779692 49
450 3300006931 Ga0097620_101466850 Ga0097620_1014668501 49
451 3300006931 Ga0097620_101995948 Ga0097620_1019959482 49
452 3300006931 Ga0097620_103024717 Ga0097620_1030247172 49
453 3300007076 Ga0075435_100139306 Ga0075435_1001393062 49
454 3300007076 Ga0075435_100167535 Ga0075435_1001675354 49
455 3300007076 Ga0075435_100679141 Ga0075435_1006791411 49
456 3300007076 Ga0075435_101255482 Ga0075435_1012554822 49
457 3300007076 Ga0075435_101527835 Ga0075435_1015278353 49
458 3300007265 Ga0099794_10439460 Ga0099794_104394601 49
459 3300009011 Ga0105251_10631004 Ga0105251_106310042 49
460 3300009036 Ga0105244_10475922 Ga0105244_104759222 49
461 3300009093 Ga0105240_12001730 Ga0105240_120017302 49
462 3300009094 Ga0111539_10000002 Ga0111539_10000002429 49
463 3300009094 Ga0111539_10042697 Ga0111539_100426974 49
464 3300009094 Ga0111539_10044169 Ga0111539_100441694 49
465 3300009094 Ga0111539_10270295 Ga0111539_102702954 49
466 3300009094 Ga0111539_10274086 Ga0111539_102740862 49
467 3300009094 Ga0111539_10350905 Ga0111539_103509051 49
468 3300009094 Ga0111539_10627249 Ga0111539_106272492 49
469 3300009094 Ga0111539_11731278 Ga0111539_117312783 49
470 3300009098 Ga0105245_10288050 Ga0105245_102880504 49
471 3300009098 Ga0105245_11649356 Ga0105245_116493562 49
472 3300009098 Ga0105245_12592370 Ga0105245_125923702 49
473 3300009101 Ga0105247_10015895 Ga0105247_100158955 49
474 3300009101 Ga0105247_10975541 Ga0105247_109755411 49
475 3300009147 Ga0114129_10000509 Ga0114129_1000050949 49
476 3300009147 Ga0114129_10365441 Ga0114129_103654416 49
477 3300009147 Ga0114129_10975264 Ga0114129_109752642 49
478 3300009148 Ga0105243_11580024 Ga0105243_115800241 49
479 3300009148 Ga0105243_12227874 Ga0105243_122278741 49
480 3300009148 Ga0105243_12901923 Ga0105243_129019232 49
481 3300009176 Ga0105242_12732161 Ga0105242_127321612 49
482 3300009177 Ga0105248_10395727 Ga0105248_103957274 49
483 3300009177 Ga0105248_10690097 Ga0105248_106900973 49
484 3300009177 Ga0105248_11198546 Ga0105248_111985462 49
485 3300009177 Ga0105248_11983211 Ga0105248_119832112 49
486 3300009177 Ga0105248_12070481 Ga0105248_120704813 49
487 3300009177 Ga0105248_12193160 Ga0105248_121931602 49
488 3300009553 Ga0105249_11261524 Ga0105249_112615241 49
489 3300010375 Ga0105239_12397902 Ga0105239_123979022 49
490 3300011119 Ga0105246_10192241 Ga0105246_101922414 49
491 3300011119 Ga0105246_11338443 Ga0105246_113384432 49
492 3300011119 Ga0105246_11713458 Ga0105246_117134582 49
493 3300011119 Ga0105246_12604410 Ga0105246_126044102 49
494 3300012505 Ga0157339_1031008 Ga0157339_10310081 49
495 3300012506 Ga0157324_1035544 Ga0157324_10355442 49
496 3300012510 Ga0157316_1063998 Ga0157316_10639982 49
497 3300013100 Ga0157373_11571628 Ga0157373_115716283 49
498 3300013102 Ga0157371_10585155 Ga0157371_105851554 49
499 3300013104 Ga0157370_10223927 Ga0157370_102239272 49
500 3300013297 Ga0157378_10322335 Ga0157378_103223354 49
501 3300013297 Ga0157378_11235082 Ga0157378_112350823 49
502 3300013297 Ga0157378_12427885 Ga0157378_124278851 49
503 3300013306 Ga0163162_11532987 Ga0163162_115329872 49
504 3300013307 Ga0157372_11160058 Ga0157372_111600582 49
505 3300013308 Ga0157375_10271476 Ga0157375_102714765 49
506 3300013308 Ga0157375_10870603 Ga0157375_108706032 49
507 3300013308 Ga0157375_10949579 Ga0157375_109495793 49
508 3300013308 Ga0157375_11118753 Ga0157375_111187532 49
509 3300013308 Ga0157375_11406652 Ga0157375_114066522 49
510 3300013308 Ga0157375_12140289 Ga0157375_121402895 49
511 3300014325 Ga0163163_10036900 Ga0163163_100369006 49
512 3300014325 Ga0163163_10164016 Ga0163163_101640166 49
513 3300014325 Ga0163163_12213081 Ga0163163_122130813 49
514 3300014326 Ga0157380_10516509 Ga0157380_105165094 49
515 3300014326 Ga0157380_10613105 Ga0157380_106131054 49
516 3300014326 Ga0157380_10781362 Ga0157380_107813622 49
517 3300014326 Ga0157380_11225276 Ga0157380_112252762 49
518 3300014326 Ga0157380_11607233 Ga0157380_116072332 49
519 3300014326 Ga0157380_11688341 Ga0157380_116883412 49
520 3300014326 Ga0157380_12915429 Ga0157380_129154291 49
521 3300014745 Ga0157377_10428196 Ga0157377_104281964 49
522 3300014745 Ga0157377_10699403 Ga0157377_106994033 49
523 3300014745 Ga0157377_10963933 Ga0157377_109639332 49
524 3300014968 Ga0157379_10211948 Ga0157379_102119482 49
525 3300014968 Ga0157379_10668718 Ga0157379_106687183 49
526 3300014969 Ga0157376_10307712 Ga0157376_103077122 49
527 3300014969 Ga0157376_11144007 Ga0157376_111440072 49
528 3300014969 Ga0157376_12311194 Ga0157376_123111942 49
529 3300014969 Ga0157376_12635227 Ga0157376_126352273 49
530 3300014969 Ga0157376_12741822 Ga0157376_127418222 49
531 3300014969 Ga0157376_12850998 Ga0157376_128509981 49
532 3300017792 Ga0163161_10059207 Ga0163161_100592076 49
533 3300017792 Ga0163161_10301685 Ga0163161_103016852 49
534 3300017792 Ga0163161_11537248 Ga0163161_115372482 49
535 3300020070 Ga0206356_10251847 Ga0206356_102518471 49
536 3300020075 Ga0206349_1652271 Ga0206349_16522712 49
537 3300020076 Ga0206355_1138463 Ga0206355_11384633 49
538 3300020076 Ga0206355_1183705 Ga0206355_11837052 49
539 3300020078 Ga0206352_10435916 Ga0206352_104359164 49
540 3300020080 Ga0206350_11371603 Ga0206350_113716031 49
541 3300021377 Ga0213874_10271349 Ga0213874_102713492 49
542 3300025315 Ga0207697_10000724 Ga0207697_1000072412 49
543 3300025315 Ga0207697_10017846 Ga0207697_100178462 49
544 3300025315 Ga0207697_10300439 Ga0207697_103004392 49
545 3300025315 Ga0207697_10329868 Ga0207697_103298681 49
546 3300025321 Ga0207656_10013340 Ga0207656_100133403 49
547 3300025893 Ga0207682_10000142 Ga0207682_100001427 49
548 3300025899 Ga0207642_10000304 Ga0207642_1000030416 49
549 3300025900 Ga0207710_10008608 Ga0207710_100086086 49
550 3300025900 Ga0207710_10028970 Ga0207710_100289701 49
551 3300025901 Ga0207688_10003488 Ga0207688_100034888 49
552 3300025903 Ga0207680_10000437 Ga0207680_1000043721 49
553 3300025903 Ga0207680_11250675 Ga0207680_112506752 49
554 3300025904 Ga0207647_10003364 Ga0207647_100033647 49
555 3300025904 Ga0207647_10512210 Ga0207647_105122103 49
556 3300025906 Ga0207699_10883484 Ga0207699_108834843 49
557 3300025907 Ga0207645_10000238 Ga0207645_1000023814 49
558 3300025907 Ga0207645_10144050 Ga0207645_101440506 49
559 3300025907 Ga0207645_10558522 Ga0207645_105585222 49
560 3300025907 Ga0207645_11067925 Ga0207645_110679253 49
561 3300025908 Ga0207643_10000376 Ga0207643_1000037613 49
562 3300025908 Ga0207643_10150032 Ga0207643_101500324 49
563 3300025908 Ga0207643_10388630 Ga0207643_103886301 49
564 3300025908 Ga0207643_10589447 Ga0207643_105894472 49
565 3300025909 Ga0207705_10015275 Ga0207705_100152757 49
566 3300025910 Ga0207684_10165126 Ga0207684_101651263 49
567 3300025910 Ga0207684_11427571 Ga0207684_114275712 49
568 3300025910 Ga0207684_11494849 Ga0207684_114948492 49
569 3300025911 Ga0207654_10012178 Ga0207654_100121782 49
570 3300025912 Ga0207707_10007464 Ga0207707_100074649 49
571 3300025913 Ga0207695_10105565 Ga0207695_101055652 49
572 3300025914 Ga0207671_10001461 Ga0207671_1000146114 49
573 3300025915 Ga0207693_10451145 Ga0207693_104511452 49
574 3300025916 Ga0207663_10047077 Ga0207663_100470776 49
575 3300025916 Ga0207663_10662500 Ga0207663_106625002 49
576 3300025917 Ga0207660_10021664 Ga0207660_100216648 49
577 3300025917 Ga0207660_10081516 Ga0207660_100815162 49
578 3300025917 Ga0207660_11205196 Ga0207660_112051962 49
579 3300025918 Ga0207662_10000368 Ga0207662_100003687 49
580 3300025918 Ga0207662_10608641 Ga0207662_106086412 49
581 3300025918 Ga0207662_10610379 Ga0207662_106103792 49
582 3300025919 Ga0207657_10000132 Ga0207657_1000013256 49
583 3300025920 Ga0207649_10027667 Ga0207649_100276675 49
584 3300025920 Ga0207649_10156462 Ga0207649_101564622 49
585 3300025921 Ga0207652_10050537 Ga0207652_100505375 49
586 3300025921 Ga0207652_11173720 Ga0207652_111737202 49
587 3300025922 Ga0207646_10633209 Ga0207646_106332092 49
588 3300025922 Ga0207646_10941604 Ga0207646_109416042 49
589 3300025922 Ga0207646_10992149 Ga0207646_109921493 49
590 3300025922 Ga0207646_11119282 Ga0207646_111192824 49
591 3300025923 Ga0207681_10000518 Ga0207681_1000051811 49
592 3300025923 Ga0207681_10197675 Ga0207681_101976752 49
593 3300025923 Ga0207681_10847259 Ga0207681_108472592 49
594 3300025923 Ga0207681_10969468 Ga0207681_109694684 49
595 3300025924 Ga0207694_10003451 Ga0207694_1000345113 49
596 3300025925 Ga0207650_10000037 Ga0207650_10000037133 49
597 3300025925 Ga0207650_10133877 Ga0207650_101338774 49
598 3300025925 Ga0207650_10976316 Ga0207650_109763162 49
599 3300025925 Ga0207650_11138991 Ga0207650_111389914 49
600 3300025925 Ga0207650_11164516 Ga0207650_111645162 49
601 3300025925 Ga0207650_11342384 Ga0207650_113423844 49
602 3300025926 Ga0207659_10000012 Ga0207659_10000012132 49
603 3300025926 Ga0207659_10167480 Ga0207659_101674805 49
604 3300025926 Ga0207659_10658060 Ga0207659_106580604 49
605 3300025927 Ga0207687_10284104 Ga0207687_102841042 49
606 3300025931 Ga0207644_10001828 Ga0207644_1000182815 49
607 3300025931 Ga0207644_10139417 Ga0207644_101394174 49
608 3300025931 Ga0207644_10588455 Ga0207644_105884553 49
609 3300025932 Ga0207690_10000434 Ga0207690_1000043415 49
610 3300025932 Ga0207690_10069537 Ga0207690_100695376 49
611 3300025933 Ga0207706_10000419 Ga0207706_1000041928 49
612 3300025933 Ga0207706_10442069 Ga0207706_104420692 49
613 3300025933 Ga0207706_11425107 Ga0207706_114251072 49
614 3300025934 Ga0207686_10012502 Ga0207686_100125022 49
615 3300025935 Ga0207709_10011122 Ga0207709_100111229 49
616 3300025935 Ga0207709_11321466 Ga0207709_113214661 49
617 3300025936 Ga0207670_10000026 Ga0207670_10000026123 49
618 3300025937 Ga0207669_10000981 Ga0207669_1000098115 49
619 3300025937 Ga0207669_10018866 Ga0207669_100188665 49
620 3300025937 Ga0207669_10216296 Ga0207669_102162962 49
621 3300025937 Ga0207669_10888221 Ga0207669_108882212 49
622 3300025937 Ga0207669_11336877 Ga0207669_113368771 49
623 3300025938 Ga0207704_10001879 Ga0207704_100018797 49
624 3300025939 Ga0207665_11581066 Ga0207665_115810662 49
625 3300025940 Ga0207691_10000101 Ga0207691_1000010156 49
626 3300025940 Ga0207691_10523510 Ga0207691_105235106 49
627 3300025941 Ga0207711_10000026 Ga0207711_10000026102 49
628 3300025941 Ga0207711_10124922 Ga0207711_101249224 49
629 3300025941 Ga0207711_10340827 Ga0207711_103408272 49
630 3300025942 Ga0207689_10000999 Ga0207689_1000099914 49
631 3300025942 Ga0207689_10391452 Ga0207689_103914522 49
632 3300025942 Ga0207689_10512904 Ga0207689_105129041 49
633 3300025944 Ga0207661_10004428 Ga0207661_100044286 49
634 3300025944 Ga0207661_10037912 Ga0207661_100379126 49
635 3300025944 Ga0207661_10764113 Ga0207661_107641133 49
636 3300025944 Ga0207661_11373696 Ga0207661_113736963 49
637 3300025944 Ga0207661_11703449 Ga0207661_117034491 49
638 3300025945 Ga0207679_10000393 Ga0207679_100003935 49
639 3300025945 Ga0207679_10001292 Ga0207679_100012925 49
640 3300025945 Ga0207679_10007830 Ga0207679_100078309 49
641 3300025945 Ga0207679_10319244 Ga0207679_103192442 49
642 3300025949 Ga0207667_10005424 Ga0207667_100054247 49
643 3300025960 Ga0207651_10000112 Ga0207651_1000011215 49
644 3300025960 Ga0207651_10063113 Ga0207651_100631136 49
645 3300025961 Ga0207712_10002247 Ga0207712_100022477 49
646 3300025961 Ga0207712_11389854 Ga0207712_113898542 49
647 3300025972 Ga0207668_10003548 Ga0207668_1000354811 49
648 3300025972 Ga0207668_10194260 Ga0207668_101942602 49
649 3300025981 Ga0207640_10001473 Ga0207640_100014737 49
650 3300025986 Ga0207658_10000036 Ga0207658_10000036124 49
651 3300025986 Ga0207658_11228910 Ga0207658_112289102 49
652 3300025986 Ga0207658_11725005 Ga0207658_117250052 49
653 3300026023 Ga0207677_10000459 Ga0207677_1000045914 49
654 3300026023 Ga0207677_10350386 Ga0207677_103503863 49
655 3300026023 Ga0207677_10740944 Ga0207677_107409442 49
656 3300026035 Ga0207703_10003676 Ga0207703_1000367615 49
657 3300026035 Ga0207703_11240962 Ga0207703_112409622 49
658 3300026035 Ga0207703_12111535 Ga0207703_121115352 49
659 3300026041 Ga0207639_10010826 Ga0207639_100108268 49
660 3300026067 Ga0207678_10001767 Ga0207678_1000176713 49
661 3300026067 Ga0207678_10204688 Ga0207678_102046884 49
662 3300026075 Ga0207708_10114338 Ga0207708_101143386 49
663 3300026075 Ga0207708_11520295 Ga0207708_115202951 49
664 3300026078 Ga0207702_10013600 Ga0207702_1001360010 49
665 3300026088 Ga0207641_10001084 Ga0207641_1000108414 49
666 3300026088 Ga0207641_10453515 Ga0207641_104535152 49
667 3300026088 Ga0207641_10615867 Ga0207641_106158673 49
668 3300026088 Ga0207641_11881359 Ga0207641_118813591 49
669 3300026089 Ga0207648_10000449 Ga0207648_1000044914 49
670 3300026089 Ga0207648_11947316 Ga0207648_119473163 49
671 3300026095 Ga0207676_10000726 Ga0207676_1000072622 49
672 3300026095 Ga0207676_12160258 Ga0207676_121602583 49
673 3300026116 Ga0207674_10017732 Ga0207674_100177328 49
674 3300026116 Ga0207674_10139947 Ga0207674_101399472 49
675 3300026116 Ga0207674_10140708 Ga0207674_101407085 49
676 3300026118 Ga0207675_100000037 Ga0207675_10000003728 49
677 3300026118 Ga0207675_100208345 Ga0207675_1002083456 49
678 3300026118 Ga0207675_101240442 Ga0207675_1012404422 49
679 3300026118 Ga0207675_101749155 Ga0207675_1017491552 49
680 3300026118 Ga0207675_102051990 Ga0207675_1020519902 49
681 3300026121 Ga0207683_10000506 Ga0207683_1000050611 49
682 3300026121 Ga0207683_10448030 Ga0207683_104480302 49
683 3300026121 Ga0207683_11197926 Ga0207683_111979262 49
684 3300026121 Ga0207683_11644140 Ga0207683_116441401 49
685 3300026121 Ga0207683_12021902 Ga0207683_120219021 49
686 3300026142 Ga0207698_10001702 Ga0207698_100017027 49
687 3300027364 Ga0209967_1032069 Ga0209967_10320692 49
688 3300027424 Ga0209984_1061099 Ga0209984_10610992 49
689 3300027617 Ga0210002_1033805 Ga0210002_10338052 49
690 3300027665 Ga0209983_1088459 Ga0209983_10884591 49
691 3300027671 Ga0209588_1229479 Ga0209588_12294792 49
692 3300027682 Ga0209971_1121391 Ga0209971_11213911 49
693 3300027717 Ga0209998_10182524 Ga0209998_101825242 49
694 3300027876 Ga0209974_10225013 Ga0209974_102250132 49
695 3300027876 Ga0209974_10242946 Ga0209974_102429462 49
696 3300027907 Ga0207428_10000004 Ga0207428_10000004227 49
697 3300027907 Ga0207428_10030983 Ga0207428_100309838 49
698 3300027907 Ga0207428_10054932 Ga0207428_100549326 49
699 3300027907 Ga0207428_10367852 Ga0207428_103678524 49
700 3300028379 Ga0268266_10000156 Ga0268266_1000015616 49
701 3300028379 Ga0268266_11138777 Ga0268266_111387772 49
702 3300028379 Ga0268266_11735628 Ga0268266_117356281 49
703 3300028380 Ga0268265_10000855 Ga0268265_1000085514 49
704 3300028380 Ga0268265_10038559 Ga0268265_100385598 49
705 3300028380 Ga0268265_10186346 Ga0268265_101863463 49
706 3300028380 Ga0268265_11145116 Ga0268265_111451162 49
707 3300028380 Ga0268265_11223607 Ga0268265_112236072 49
708 3300028380 Ga0268265_12349821 Ga0268265_123498212 49
709 3300028381 Ga0268264_10000090 Ga0268264_10000090158 49
710 3300028381 Ga0268264_10277661 Ga0268264_102776612 49
711 3300028381 Ga0268264_10336024 Ga0268264_103360242 49
712 3300028381 Ga0268264_11289779 Ga0268264_112897791 49
713 3300028381 Ga0268264_11880225 Ga0268264_118802252 49
714 3300031238 Ga0265332_10200700 Ga0265332_102007002 49
715 3300031250 Ga0265331_10215794 Ga0265331_102157943 49
716 3300031344 Ga0265316_10164478 Ga0265316_101644784 49
717 3300031548 Ga0307408_100239976 Ga0307408_1002399762 49
718 3300031548 Ga0307408_100307082 Ga0307408_1003070822 49
719 3300031727 Ga0316576_10185680 Ga0316576_101856802 49
720 3300031731 Ga0307405_10838037 Ga0307405_108380372 49
721 3300031731 Ga0307405_11462002 Ga0307405_114620022 49
722 3300031824 Ga0307413_11382370 Ga0307413_113823703 49
723 3300031901 Ga0307406_10830787 Ga0307406_108307873 49
724 3300031901 Ga0307406_11988421 Ga0307406_119884211 49
725 3300031903 Ga0307407_10461032 Ga0307407_104610324 49
726 3300031903 Ga0307407_10632376 Ga0307407_106323763 49
727 3300031903 Ga0307407_11579761 Ga0307407_115797612 49
728 3300031911 Ga0307412_11876898 Ga0307412_118768982 49
729 3300031995 Ga0307409_100099346 Ga0307409_1000993464 49
730 3300031995 Ga0307409_101705155 Ga0307409_1017051552 49
731 3300031995 Ga0307409_101915690 Ga0307409_1019156902 49
732 3300031995 Ga0307409_102762325 Ga0307409_1027623251 49
733 3300032002 Ga0307416_100847193 Ga0307416_1008471931 49
734 3300032002 Ga0307416_100919822 Ga0307416_1009198222 49
735 3300032002 Ga0307416_101039903 Ga0307416_1010399031 49
736 3300032002 Ga0307416_102243701 Ga0307416_1022437012 49
737 3300032005 Ga0307411_10865099 Ga0307411_108650993 49
738 3300032126 Ga0307415_100637849 Ga0307415_1006378492 49
739 3300032126 Ga0307415_100661168 Ga0307415_1006611681 49
740 3300032139 Ga0316580_10230074 Ga0316580_102300742 49
741 3300034819 Ga0373958_0118957 Ga0373958_0118957_35_184 49
742 3300035083 Ga0373926_0095583 Ga0373926_0095583_237_389 49
743 3300035085 Ga0373929_0057286 Ga0373929_0057286_243_392 49
744 3300035086 Ga0373934_0110993 Ga0373934_0110993_739_891 49
745 3300035088 Ga0373940_0261932 Ga0373940_0261932_69_218 49
746 3300035090 Ga0373949_0263861 Ga0373949_0263861_112_276 49
747 3300035111 Ga0373923_0707967 Ga0373923_0707967_104_256 49
748 3300035112 Ga0373932_0365339 Ga0373932_0365339_327_479 49
749 3300035115 Ga0373941_0043987 Ga0373941_0043987_518_682 49
750 3300035117 Ga0373953_0121062 Ga0373953_0121062_830_982 49
751 3300035118 Ga0373954_0004418 Ga0373954_0004418_972_1124 49
752 3300035119 Ga0373956_0004023 Ga0373956_0004023_3605_3757 49
753 3300035120 Ga0373957_0242027 Ga0373957_0242027_92_244 49
754 3300035121 Ga0373960_0257277 Ga0373960_0257277_190_354 49
755 3300035121 Ga0373960_0291862 Ga0373960_0291862_394_558 49
756 3300035121 Ga0373960_0422008 Ga0373960_0422008_103_252 49
757 3300035172 Ga0373955_0071638 Ga0373955_0071638_675_827 49
758 3300035172 Ga0373955_0641886 Ga0373955_0641886_145_294 49
759 3300035410 Ga0373924_0175712 Ga0373924_0175712_490_642 49
760 3300035692 Ga0373935_0588040 Ga0373935_0588040_75_227 49
761 3300035695 Ga0373927_0046192 Ga0373927_0046192_744_896 49
762 3300036401 Ga0373937_0131705 Ga0373937_0131705_957_1109 49
763 3300036401 Ga0373937_1316823 Ga0373937_1316823_166_315 49
764 3300036647 Ga0316582_0473590 Ga0316582_0473590_296_445 49
765 3300038727 Ga0400491_05839 Ga0400491_05839_1208_1372 49
766 3300039437 Ga0436365_0792880 Ga0436365_0792880_405_554 49
767 3300039450 Ga0436363_1539500 Ga0436363_1539500_799_963 49
768 3300041408 Ga0439453_0023785 Ga0439453_0023785_92_241 49
769 3300041410 Ga0439461_0023618 Ga0439461_0023618_97_246 49
770 3300041451 Ga0451791_0576223 Ga0451791_0576223_473_622 49
771 3300041451 Ga0451791_0601765 Ga0451791_0601765_457_606 49
772 3300041458 Ga0451798_0553446 Ga0451798_0553446_435_584 49
773 3300041494 Ga0451837_0776061 Ga0451837_0776061_254_403 49
774 3300041501 Ga0451845_0569374 Ga0451845_0569374_52_201 49
775 3300041501 Ga0451845_0705662 Ga0451845_0705662_455_604 49
776 3300041504 Ga0451848_10600 Ga0451848_10600_211_360 49
777 3300041512 Ga0451853_3373278 Ga0451853_3373278_474_623 49
778 3300041999 Ga0439433_0067066 Ga0439433_0067066_301_450 49
779 3300042005 Ga0439448_0182765 Ga0439448_0182765_232_396 49
780 3300042009 Ga0439451_036312 Ga0439451_036312_437_586 49
781 3300042012 Ga0439455_0028811 Ga0439455_0028811_340_504 49
782 3300042014 Ga0439457_061005 Ga0439457_061005_659_808 49
783 3300042015 Ga0439462_0157175 Ga0439462_0157175_324_473 49
784 3300042116 Ga0450912_022375 Ga0450912_022375_220_369 49
785 3300042122 Ga0450920_003080 Ga0450920_003080_1742_1891 49
786 3300042125 Ga0450923_001669 Ga0450923_001669_2106_2255 49
787 3300042131 Ga0450894_000786 Ga0450894_000786_4621_4770 49
788 3300042132 Ga0450895_000378 Ga0450895_000378_902_1051 49
789 3300042132 Ga0450895_012963 Ga0450895_012963_177_326 49
790 3300042133 Ga0450896_009967 Ga0450896_009967_637_786 49
791 3300042135 Ga0450899_011216 Ga0450899_011216_451_600 49
792 3300042156 Ga0439446_0002581 Ga0439446_0002581_1568_1717 49
793 3300042156 Ga0439446_0208736 Ga0439446_0208736_494_643 49
794 3300042184 Ga0450908_020949 Ga0450908_020949_599_748 49
795 3300042435 Ga0439434_0002754 Ga0439434_0002754_1771_1920 49
796 3300042436 Ga0439435_0014359 Ga0439435_0014359_1335_1484 49
797 3300042438 Ga0439459_0029157 Ga0439459_0029157_922_1086 49
798 3300042439 Ga0439464_0225796 Ga0439464_0225796_281_445 49
799 3300042461 Ga0439460_0377211 Ga0439460_0377211_116_265 49
800 3300042876 Ga0451577_0498262 Ga0451577_0498262_83_232 49
801 3300042876 Ga0451577_0636787 Ga0451577_0636787_679_828 49
802 3300044673 Ga0453683_0053588 Ga0453683_0053588_1562_1720 49
803 3300044673 Ga0453683_0096485 Ga0453683_0096485_495_653 49
804 3300044673 Ga0453683_0401546 Ga0453683_0401546_127_285 49
805 3300044673 Ga0453683_0634480 Ga0453683_0634480_463_612 49
806 3300044712 Ga0453684_0024329 Ga0453684_0024329_8485_8634 49
807 3300044712 Ga0453684_0115797 Ga0453684_0115797_1527_1685 49
808 3300044712 Ga0453684_0138714 Ga0453684_0138714_2386_2544 49
809 3300044712 Ga0453684_0453090 Ga0453684_0453090_268_432 49
810 3300045051 Ga0451576_0026098 Ga0451576_0026098_147_296 49
811 3300045051 Ga0451576_0171103 Ga0451576_0171103_1457_1615 49
812 3300045051 Ga0451576_0358412 Ga0451576_0358412_394_558 49
813 3300045051 Ga0451576_0659526 Ga0451576_0659526_925_1083 49
814 3300045051 Ga0451576_0907465 Ga0451576_0907465_649_813 49
815 3300045051 Ga0451576_1491830 Ga0451576_1491830_28_186 49
816 3300045051 Ga0451576_2557255 Ga0451576_2557255_190_339 49
817 3300046455 Ga0495603_0275351 Ga0495603_0275351_556_705 49
818 3300046459 Ga0495629_0421594 Ga0495629_0421594_174_338 49
819 3300046462 Ga0495651_0919944 Ga0495651_0919944_304_456 49
820 3300046472 Ga0495580_0802896 Ga0495580_0802896_121_273 49
821 3300046477 Ga0495664_0938036 Ga0495664_0938036_170_319 49
822 3300046517 Ga0495630_1062220 Ga0495630_1062220_227_376 49
823 3300046525 Ga0495663_0098784 Ga0495663_0098784_271_435 49
824 3300046535 Ga0495586_0488388 Ga0495586_0488388_392_541 49
825 3300046538 Ga0495609_0309350 Ga0495609_0309350_400_549 49
826 3300046616 Ga0495668_0530353 Ga0495668_0530353_166_315 49
827 3300046642 Ga0495634_0041616 Ga0495634_0041616_1951_2100 49
828 3300046683 Ga0495658_0068988 Ga0495658_0068988_1065_1217 49
829 3300046689 Ga0495613_0526537 Ga0495613_0526537_580_732 49
830 3300046691 Ga0495670_0416147 Ga0495670_0416147_17_181 49
831 3300047318 Ga0495636_0267158 Ga0495636_0267158_361_525 49
832 3300047320 Ga0495672_0002464 Ga0495672_0002464_6339_6488 49
833 3300047447 Ga0495685_291208 Ga0495685_291208_83_247 49
834 3300048089 Ga0495614_0199635 Ga0495614_0199635_371_535 49
835 3300048903 Ga0496100_0793316 Ga0496100_0793316_138_287 49
836 3300048903 Ga0496100_1084499 Ga0496100_1084499_346_510 49
837 3300048904 Ga0496101_0574208 Ga0496101_0574208_90_239 49
838 3300048905 Ga0496102_0521311 Ga0496102_0521311_949_1098 49
839 3300048906 Ga0496103_0747079 Ga0496103_0747079_315_464 49
840 3300048907 Ga0496104_0004897 Ga0496104_0004897_7321_7470 49
841 3300048908 Ga0496105_0311917 Ga0496105_0311917_402_551 49
842 3300048910 Ga0496107_0489041 Ga0496107_0489041_694_843 49
843 3300048911 Ga0496108_0000658 Ga0496108_0000658_1431_1580 49
844 3300048912 Ga0496109_0011768 Ga0496109_0011768_2906_3055 49
845 3300048912 Ga0496109_0095825 Ga0496109_0095825_23_187 49
846 3300048912 Ga0496109_0688905 Ga0496109_0688905_181_339 49
847 3300048912 Ga0496109_0881463 Ga0496109_0881463_275_439 49
848 3300048913 Ga0496110_0033880 Ga0496110_0033880_3301_3450 49
849 3300048913 Ga0496110_1155401 Ga0496110_1155401_39_197 49
850 3300048913 Ga0496110_1836776 Ga0496110_1836776_257_406 49
851 3300048915 Ga0496112_0009883 Ga0496112_0009883_5643_5792 49
852 3300048915 Ga0496112_0545395 Ga0496112_0545395_49_198 49
853 3300048915 Ga0496112_0554222 Ga0496112_0554222_61_210 49
854 3300048916 Ga0496113_1135973 Ga0496113_1135973_262_411 49
855 3300048928 Ga0496125_0751795 Ga0496125_0751795_160_324 49
856 3300049127 Ga0501306_044899 Ga0501306_044899_180_344 49
857 3300049129 Ga0501309_015734 Ga0501309_015734_687_851 49
858 3300049161 Ga0501305_097530 Ga0501305_097530_163_312 49
859 3300049515 Ga0501292_067738 Ga0501292_067738_258_422 49
860 3300049528 Ga0501312_110697 Ga0501312_110697_192_356 49
861 3300049529 Ga0501313_040458 Ga0501313_040458_171_335 49
862 3300049531 Ga0501315_103948 Ga0501315_103948_169_333 49
863 3300049534 Ga0501318_015245 Ga0501318_015245_577_741 49
864 3300049535 Ga0501319_009823 Ga0501319_009823_539_703 49
865 3300049537 Ga0501321_027855 Ga0501321_027855_442_606 49
866 3300049537 Ga0501321_029343 Ga0501321_029343_170_334 49
867 3300049539 Ga0501323_074601 Ga0501323_074601_211_375 49
868 3300049541 Ga0501325_018991 Ga0501325_018991_111_275 49
869 3300049568 Ga0501031_0171039 Ga0501031_0171039_839_997 49
870 3300049568 Ga0501031_0285866 Ga0501031_0285866_620_769 49
871 3300049568 Ga0501031_0571448 Ga0501031_0571448_560_709 49
872 3300049569 Ga0501032_0040830 Ga0501032_0040830_747_896 49
873 3300049570 Ga0501033_0636794 Ga0501033_0636794_270_419 49
874 3300049570 Ga0501033_1096856 Ga0501033_1096856_342_491 49
875 3300049571 Ga0501034_0037393 Ga0501034_0037393_1148_1297 49
876 3300049571 Ga0501034_0096601 Ga0501034_0096601_968_1117 49
877 3300049571 Ga0501034_0112215 Ga0501034_0112215_1401_1550 49
878 3300049572 Ga0501036_0067215 Ga0501036_0067215_1098_1247 49
879 3300049572 Ga0501036_0328612 Ga0501036_0328612_134_283 49
880 3300049572 Ga0501036_0754311 Ga0501036_0754311_91_240 49
881 3300049572 Ga0501036_0835578 Ga0501036_0835578_128_277 49
882 3300049572 Ga0501036_1691777 Ga0501036_1691777_296_454 49
883 3300049573 Ga0501037_0120192 Ga0501037_0120192_593_742 49
884 3300049573 Ga0501037_0287476 Ga0501037_0287476_206_355 49
885 3300049573 Ga0501037_0429266 Ga0501037_0429266_334_483 49
886 3300049573 Ga0501037_0609759 Ga0501037_0609759_303_452 49
887 3300049574 Ga0501038_0012873 Ga0501038_0012873_203_352 49
888 3300049574 Ga0501038_0105891 Ga0501038_0105891_1128_1277 49
889 3300049574 Ga0501038_0449695 Ga0501038_0449695_340_498 49
890 3300049575 Ga0501039_0313832 Ga0501039_0313832_725_874 49
891 3300049575 Ga0501039_0365469 Ga0501039_0365469_735_884 49
892 3300049575 Ga0501039_1355157 Ga0501039_1355157_92_250 49
893 3300049576 Ga0501040_0006547 Ga0501040_0006547_1645_1794 49
894 3300049576 Ga0501040_0876652 Ga0501040_0876652_396_554 49
895 3300049576 Ga0501040_1006733 Ga0501040_1006733_412_561 49
896 3300049577 Ga0501041_0014846 Ga0501041_0014846_596_745 49
897 3300049577 Ga0501041_0030844 Ga0501041_0030844_178_327 49
898 3300049578 Ga0501042_0039517 Ga0501042_0039517_131_280 49
899 3300049578 Ga0501042_0100169 Ga0501042_0100169_157_306 49
900 3300049578 Ga0501042_0181118 Ga0501042_0181118_878_1036 49
901 3300049578 Ga0501042_0309575 Ga0501042_0309575_966_1115 49
902 3300049578 Ga0501042_0500644 Ga0501042_0500644_310_459 49
903 3300049578 Ga0501042_0565847 Ga0501042_0565847_248_397 49
904 3300049578 Ga0501042_1367850 Ga0501042_1367850_247_405 49
905 3300049579 Ga0501043_0027314 Ga0501043_0027314_3185_3334 49
906 3300049579 Ga0501043_0038310 Ga0501043_0038310_851_1000 49
907 3300049579 Ga0501043_0189802 Ga0501043_0189802_773_922 49
908 3300049580 Ga0501046_0002275 Ga0501046_0002275_3034_3183 49
909 3300049580 Ga0501046_0176973 Ga0501046_0176973_282_431 49
910 3300049580 Ga0501046_0199609 Ga0501046_0199609_277_435 49
911 3300049580 Ga0501046_0390831 Ga0501046_0390831_718_867 49
912 3300049580 Ga0501046_1140300 Ga0501046_1140300_230_379 49
913 3300049581 Ga0501047_0025147 Ga0501047_0025147_3623_3772 49
914 3300049581 Ga0501047_0184413 Ga0501047_0184413_1522_1671 49
915 3300049581 Ga0501047_0466493 Ga0501047_0466493_533_697 49
916 3300049582 Ga0501048_0179363 Ga0501048_0179363_1041_1190 49
917 3300049582 Ga0501048_0197876 Ga0501048_0197876_1176_1325 49
918 3300049582 Ga0501048_0401275 Ga0501048_0401275_96_254 49
919 3300049582 Ga0501048_0707647 Ga0501048_0707647_91_240 49
920 3300049582 Ga0501048_1238148 Ga0501048_1238148_133_282 49
921 3300049582 Ga0501048_1357835 Ga0501048_1357835_205_354 49
922 3300049583 Ga0501067_0157007 Ga0501067_0157007_815_964 49
923 3300049584 Ga0501068_0594834 Ga0501068_0594834_187_345 49
924 3300049585 Ga0501069_0710597 Ga0501069_0710597_442_591 49
925 3300049585 Ga0501069_0944057 Ga0501069_0944057_318_467 49
926 3300049587 Ga0501071_0018416 Ga0501071_0018416_751_900 49
927 3300049588 Ga0501072_0128959 Ga0501072_0128959_350_499 49
928 3300049588 Ga0501072_0247455 Ga0501072_0247455_85_234 49
929 3300049588 Ga0501072_0694870 Ga0501072_0694870_169_318 49
930 3300049588 Ga0501072_0800186 Ga0501072_0800186_485_634 49
931 3300049588 Ga0501072_0874141 Ga0501072_0874141_169_327 49
932 3300049588 Ga0501072_1264405 Ga0501072_1264405_80_229 49
933 3300049589 Ga0501073_0233769 Ga0501073_0233769_881_1030 49
934 3300049590 Ga0501074_0150139 Ga0501074_0150139_255_404 49
935 3300049590 Ga0501074_0374671 Ga0501074_0374671_575_733 49
936 3300049591 Ga0501075_0544097 Ga0501075_0544097_632_781 49
937 3300049591 Ga0501075_0571092 Ga0501075_0571092_528_677 49
938 3300049591 Ga0501075_1427584 Ga0501075_1427584_78_227 49
939 3300049592 Ga0501076_0002067 Ga0501076_0002067_4290_4439 49
940 3300049592 Ga0501076_0165987 Ga0501076_0165987_525_674 49
941 3300049592 Ga0501076_0193268 Ga0501076_0193268_1029_1178 49
942 3300049592 Ga0501076_0297024 Ga0501076_0297024_1030_1179 49
943 3300049592 Ga0501076_1207689 Ga0501076_1207689_378_527 49
944 3300049592 Ga0501076_1210229 Ga0501076_1210229_168_326 49
945 3300049593 Ga0501077_0009857 Ga0501077_0009857_5608_5757 49
946 3300049593 Ga0501077_0726427 Ga0501077_0726427_236_385 49
947 3300049593 Ga0501077_0817668 Ga0501077_0817668_127_276 49
948 3300049661 Ga0501217_295153 Ga0501217_295153_89_238 49
949 3300049705 Ga0501225_0129961 Ga0501225_0129961_333_482 49
950 3300049741 Ga0501079_0001902 Ga0501079_0001902_12076_12225 49
951 3300049741 Ga0501079_0365763 Ga0501079_0365763_868_1017 49
952 3300049741 Ga0501079_0734069 Ga0501079_0734069_139_288 49
953 3300049741 Ga0501079_1005604 Ga0501079_1005604_120_278 49
954 3300049741 Ga0501079_1487773 Ga0501079_1487773_151_300 49
955 3300049742 Ga0501080_0149023 Ga0501080_0149023_1738_1887 49
956 3300049742 Ga0501080_0198283 Ga0501080_0198283_1520_1669 49
957 3300049743 Ga0501081_0001000 Ga0501081_0001000_1111_1260 49
958 3300049743 Ga0501081_0160123 Ga0501081_0160123_1277_1426 49
959 3300049743 Ga0501081_0173194 Ga0501081_0173194_616_765 49
960 3300049743 Ga0501081_0769329 Ga0501081_0769329_416_565 49
961 3300049743 Ga0501081_0829009 Ga0501081_0829009_88_237 49
962 3300049744 Ga0501083_0046353 Ga0501083_0046353_1643_1792 49
963 3300049744 Ga0501083_0163514 Ga0501083_0163514_159_308 49
964 3300049771 Ga0501274_027122 Ga0501274_027122_278_442 49
965 3300049822 Ga0501035_0000901 Ga0501035_0000901_31019_31183 49
966 3300049822 Ga0501035_0236442 Ga0501035_0236442_881_1030 49
967 3300049822 Ga0501035_0503293 Ga0501035_0503293_156_305 49
968 3300049822 Ga0501035_0842153 Ga0501035_0842153_272_430 49
969 3300049822 Ga0501035_0842737 Ga0501035_0842737_449_607 49
970 3300049823 Ga0501044_0245704 Ga0501044_0245704_417_566 49
971 3300049824 Ga0501045_0217869 Ga0501045_0217869_955_1104 49
972 3300049824 Ga0501045_0293769 Ga0501045_0293769_83_232 49
973 3300049824 Ga0501045_0361671 Ga0501045_0361671_911_1060 49
974 3300049824 Ga0501045_0983307 Ga0501045_0983307_448_597 49
975 3300050489 nmdc:mga03683_183227_c1 nmdc:mga03683_183227_c1_676_825 49
976 3300050494 nmdc:mga06z11_95702_c1 nmdc:mga06z11_95702_c1_373_522 49
977 3300050496 nmdc:mga07m45_639155_c1 nmdc:mga07m45_639155_c1_322_471 49
978 3300050507 nmdc:mga05p37_117437_c1 nmdc:mga05p37_117437_c1_2991_3140 49
979 3300050507 nmdc:mga05p37_1232308_c1 nmdc:mga05p37_1232308_c1_291_443 49
980 3300050507 nmdc:mga05p37_174_c1 nmdc:mga05p37_174_c1_41691_41840 49
981 3300050507 nmdc:mga05p37_200209_c1 nmdc:mga05p37_200209_c1_38_187 49
982 3300050508 nmdc:mga09592_1358389_c1 nmdc:mga09592_1358389_c1_280_432 49
983 3300050508 nmdc:mga09592_51946_c1 nmdc:mga09592_51946_c1_204_362 49
984 3300050508 nmdc:mga09592_708228_c1 nmdc:mga09592_708228_c1_349_498 49
985 3300050508 nmdc:mga09592_926749_c1 nmdc:mga09592_926749_c1_90_242 49
986 3300050509 nmdc:mga0qj67_732324_c1 nmdc:mga0qj67_732324_c1_326_478 49
987 3300050509 nmdc:mga0qj67_797599_c1 nmdc:mga0qj67_797599_c1_387_545 49
988 3300050510 nmdc:mga06r32_191119_c1 nmdc:mga06r32_191119_c1_1509_1658 49
989 3300050510 nmdc:mga06r32_214748_c1 nmdc:mga06r32_214748_c1_305_454 49
990 3300050510 nmdc:mga06r32_881431_c1 nmdc:mga06r32_881431_c1_217_369 49
991 3300050511 nmdc:mga08y16_128140_c1 nmdc:mga08y16_128140_c1_2186_2338 49
992 3300050511 nmdc:mga08y16_1538_c1 nmdc:mga08y16_1538_c1_21409_21558 49
993 3300050511 nmdc:mga08y16_26595_c1 nmdc:mga08y16_26595_c1_450_599 49
994 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_484120_484269 49
995 3300050511 nmdc:mga08y16_3103_c1 nmdc:mga08y16_3103_c1_9923_10075 49
996 3300050511 nmdc:mga08y16_767182_c1 nmdc:mga08y16_767182_c1_103_252 49
997 3300050512 nmdc:mga0n895_1015863_c1 nmdc:mga0n895_1015863_c1_521_670 49
998 3300050512 nmdc:mga0n895_1111214_c1 nmdc:mga0n895_1111214_c1_272_421 49
999 3300050512 nmdc:mga0n895_125267_c1 nmdc:mga0n895_125267_c1_1991_2140 49
1000 3300050512 nmdc:mga0n895_44765_c1 nmdc:mga0n895_44765_c1_4008_4160 49
1001 3300050512 nmdc:mga0n895_681698_c1 nmdc:mga0n895_681698_c1_775_924 49
1002 3300050512 nmdc:mga0n895_685089_c1 nmdc:mga0n895_685089_c1_461_625 49
1003 3300050512 nmdc:mga0n895_846321_c1 nmdc:mga0n895_846321_c1_661_810 49
1004 3300050513 nmdc:mga0rr50_1362613_c1 nmdc:mga0rr50_1362613_c1_113_262 49
1005 3300050513 nmdc:mga0rr50_330267_c1 nmdc:mga0rr50_330267_c1_52_216 49
1006 3300050513 nmdc:mga0rr50_52386_c1 nmdc:mga0rr50_52386_c1_1229_1378 49
1007 3300050513 nmdc:mga0rr50_827335_c1 nmdc:mga0rr50_827335_c1_427_579 49
1008 3300050514 nmdc:mga08x19_11737_c1 nmdc:mga08x19_11737_c1_3301_3453 49
1009 3300050514 nmdc:mga08x19_382385_c1 nmdc:mga08x19_382385_c1_94_246 49
1010 3300050514 nmdc:mga08x19_460310_c1 nmdc:mga08x19_460310_c1_379_531 49
1011 3300050515 nmdc:mga0a205_1098745_c1 nmdc:mga0a205_1098745_c1_392_544 49
1012 3300050515 nmdc:mga0a205_183324_c1 nmdc:mga0a205_183324_c1_274_423 49
1013 3300050515 nmdc:mga0a205_206237_c1 nmdc:mga0a205_206237_c1_489_638 49
1014 3300050515 nmdc:mga0a205_606744_c1 nmdc:mga0a205_606744_c1_32_181 49
1015 3300053077 Ga0495601_0715683 Ga0495601_0715683_439_588 49
1016 3300053077 Ga0495601_0734447 Ga0495601_0734447_192_341 49
1017 3300053078 Ga0495612_0216178 Ga0495612_0216178_549_701 49
1018 3300053084 Ga0495595_0602330 Ga0495595_0602330_158_310 49
1019 3300053103 Ga0500555_074997 Ga0500555_074997_474_623 49
1020 3300053117 Ga0500593_195985 Ga0500593_195985_319_468 49
1021 3300053131 Ga0500652_038557 Ga0500652_038557_528_677 49
1022 3300054114 Ga0501084_0013715 Ga0501084_0013715_5130_5279 49
1023 3300054114 Ga0501084_0028474 Ga0501084_0028474_3284_3433 49
1024 3300054114 Ga0501084_0051048 Ga0501084_0051048_3277_3426 49
1025 3300054114 Ga0501084_0410611 Ga0501084_0410611_681_830 49
1026 3300054114 Ga0501084_0979122 Ga0501084_0979122_438_587 49
1027 3300054114 Ga0501084_1116090 Ga0501084_1116090_97_246 49
1028 3300059421 Ga0590071_051739 Ga0590071_051739_456_608 49
1029 3300059424 Ga0590075_044273 Ga0590075_044273_539_691 49
1030 3300059426 Ga0590077_001873 Ga0590077_001873_2176_2328 49
1031 3300059477 Ga0587084_067786 Ga0587084_067786_369_533 49
1032 3300059490 Ga0587066_187893 Ga0587066_187893_85_234 49
1033 3300059493 Ga0587077_053157 Ga0587077_053157_554_718 49
1034 3300059505 Ga0587083_0101888 Ga0587083_0101888_379_543 49
1035 3300059511 Ga0587091_084709 Ga0587091_084709_303_452 49
1036 3300059512 Ga0587092_060075 Ga0587092_060075_223_375 49
1037 3300059604 Ga0587098_004049 Ga0587098_004049_655_804 49
1038 3300059607 Ga0587125_011106 Ga0587125_011106_216_380 49
1039 3300059623 Ga0587101_025346 Ga0587101_025346_550_714 49
1040 3300059624 Ga0587109_052056 Ga0587109_052056_359_511 49
1041 3300059639 Ga0587062_138704 Ga0587062_138704_168_332 49
1042 3300059640 Ga0587067_110345 Ga0587067_110345_165_317 49
1043 3300059643 Ga0587072_017653 Ga0587072_017653_635_784 49
1044 3300059652 Ga0587107_091275 Ga0587107_091275_107_256 49
1045 3300060346 Ga0587111_0047244 Ga0587111_0047244_635_799 49
1046 3300060346 Ga0587111_0227301 Ga0587111_0227301_346_495 49
1047 3300060353 Ga0501082_0001088 Ga0501082_0001088_18059_18208 49
1048 3300060353 Ga0501082_0036253 Ga0501082_0036253_3243_3392 49
1049 3300060353 Ga0501082_0232190 Ga0501082_0232190_785_934 49
1050 3300061734 Ga0530510_0024932 Ga0530510_0024932_3648_3797 49
1051 3300061734 Ga0530510_0029412 Ga0530510_0029412_3544_3702 49
1052 3300061734 Ga0530510_0251002 Ga0530510_0251002_791_949 49
1053 3300061734 Ga0530510_0284775 Ga0530510_0284775_1008_1157 49
1054 3300061734 Ga0530510_1039631 Ga0530510_1039631_38_187 49

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00471

Ribosomal_L33

Ribosomal protein L33

7

53

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y41-assembly1.cif.gz_c mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9774 2 48
5hcr-assembly2.cif.gz_26 crystal structure of antimicrobial peptide oncocin 10wt bound to the thermus thermophilus 70s ribosome 0.9768 2 49
7o5b-assembly1.cif.gz_1 cryo-em structure of a bacillus subtilis mifm-stalled ribosome-nascent chain complex with (p)ppgpp-srp bound 0.9757 1 48
8a63-assembly1.cif.gz_6 cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9729 3 48
8cvj-assembly2.cif.gz_26 crystal structure of the thermus thermophilus 70s ribosome in complex with mrna, aminoacylated a-site phe-nh-trnaphe, peptidyl p-site fmseac-nh-trnamet, and deacylated e-site trnaphe at 2.40a resolution 0.9715 2 49
ID Description Score Start End Superfamily
4qcn600 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.9753 2 49 2.20.28.120
6dddO00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.9682 3 46 2.20.28.120
6ddgO00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.9474 1 46 2.20.28.120
4qcn600 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.9375 2 49 2.20.28.120
5v7q100 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.9318 1 48 2.20.28.120
ID Description Score Start End GO Terms
AF-A0A7C6SZ80-F1-model_v4 Large ribosomal subunit protein bL33 1.013 1 49 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C2J698-F1-model_v4 Large ribosomal subunit protein bL33 1.01 2 49 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A7Z9Z8P0-F1-model_v4 Large ribosomal subunit protein bL33 1.009 2 49 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A3A6N8G8-F1-model_v4 Large ribosomal subunit protein bL33 1.008 1 49 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-S7T5Z9-F1-model_v4 Large ribosomal subunit protein bL33 1.008 2 49 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.54 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map