F489120
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 423 | 1054 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1078915|JGI24736J21556_10789151 |
| Length | 54 |
| Sequence | MPKGNRSIISLECPVCKRRNYSTTKNRRKSQDKLELSKFCPWCRKHTDHKEGKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 138 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 139 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 157 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 250 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 263 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 270 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 273 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 274 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 275 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 278 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 279 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 280 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 281 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 282 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 283 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 284 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 285 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 286 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 287 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 288 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 289 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 290 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 291 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 292 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 293 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 294 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 295 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 296 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 297 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 298 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 299 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 304 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 305 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 342 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 376 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 401 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 405 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 407 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.02 |
| Metatranscriptomes | 3.98 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 0 |
| Rhizoplane | 2.18 |
| Rhizosphere | 95.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004572 | 3300000549 | Bacteria | 1794 |
| 2 | JGI24736J21556_1078915 | 3300001904 | Bacteria | 516 |
| 3 | JGI24752J21851_1019788 | 3300001976 | Bacteria | 878 |
| 4 | JGI24746J21847_1003481 | 3300001977 | Bacteria | 2482 |
| 5 | JGI24747J21853_1004504 | 3300001978 | Bacteria | 1253 |
| 6 | JGI24737J22298_10015109 | 3300001990 | Bacteria | 2499 |
| 7 | JGI24743J22301_10001659 | 3300001991 | Bacteria | 3160 |
| 8 | JGI24750J21931_1010309 | 3300002070 | Bacteria | 1216 |
| 9 | JGI24750J21931_1013551 | 3300002070 | Bacteria | 1090 |
| 10 | JGI24745J21846_1012438 | 3300002073 | Bacteria | 977 |
| 11 | JGI24748J21848_1011226 | 3300002074 | Bacteria | 1055 |
| 12 | JGI24738J21930_10034985 | 3300002075 | Bacteria | 1023 |
| 13 | JGI24749J21850_1001134 | 3300002076 | Bacteria | 3786 |
| 14 | JGI24744J21845_10024765 | 3300002077 | Bacteria | 1173 |
| 15 | JGI24035J26624_1010268 | 3300002126 | Bacteria | 929 |
| 16 | JGI24033J26618_1030436 | 3300002155 | Bacteria | 724 |
| 17 | JGI24742J22300_10046791 | 3300002244 | Bacteria | 778 |
| 18 | JGI24742J22300_10123144 | 3300002244 | Bacteria | 513 |
| 19 | JGI24751J29686_10001570 | 3300002459 | Bacteria | 4720 |
| 20 | rootL2_10015190 | 3300003322 | Bacteria | 3006 |
| 21 | JGI25404J52841_10008784 | 3300003659 | Bacteria | 2158 |
| 22 | Ga0058859_10031327 | 3300004798 | Bacteria | 1149 |
| 23 | Ga0058859_11679412 | 3300004798 | Bacteria | 719 |
| 24 | Ga0058859_11795058 | 3300004798 | Bacteria | 749 |
| 25 | Ga0058860_12109938 | 3300004801 | Bacteria | 1732 |
| 26 | Ga0058860_12218590 | 3300004801 | Bacteria | 675 |
| 27 | Ga0058862_12775106 | 3300004803 | Bacteria | 812 |
| 28 | Ga0058862_12857261 | 3300004803 | Bacteria | 1309 |
| 29 | Ga0065704_10004364 | 3300005289 | Bacteria | 3418 |
| 30 | Ga0065704_10040355 | 3300005289 | Bacteria | 1016 |
| 31 | Ga0065704_10332004 | 3300005289 | Bacteria | 836 |
| 32 | Ga0065712_10003180 | 3300005290 | Bacteria | 5260 |
| 33 | Ga0065712_10031979 | 3300005290 | Bacteria | 1120 |
| 34 | Ga0065712_10051647 | 3300005290 | Bacteria | 749 |
| 35 | Ga0065712_10086694 | 3300005290 | Bacteria | 2621 |
| 36 | Ga0065715_10053782 | 3300005293 | Bacteria | 1130 |
| 37 | Ga0065715_10225253 | 3300005293 | Bacteria | 1255 |
| 38 | Ga0065715_10345118 | 3300005293 | Bacteria | 950 |
| 39 | Ga0065715_10453518 | 3300005293 | Bacteria | 823 |
| 40 | Ga0065715_10552740 | 3300005293 | Bacteria | 731 |
| 41 | Ga0065715_10656145 | 3300005293 | Bacteria | 676 |
| 42 | Ga0065715_10695372 | 3300005293 | Bacteria | 656 |
| 43 | Ga0065715_10919226 | 3300005293 | Bacteria | 563 |
| 44 | Ga0065707_10002895 | 3300005295 | Bacteria | 5630 |
| 45 | Ga0065707_10027870 | 3300005295 | Bacteria | 1477 |
| 46 | Ga0065707_10604539 | 3300005295 | Bacteria | 688 |
| 47 | Ga0065707_10741998 | 3300005295 | Bacteria | 622 |
| 48 | Ga0065707_10902817 | 3300005295 | Bacteria | 566 |
| 49 | Ga0065707_10976468 | 3300005295 | Bacteria | 531 |
| 50 | Ga0065707_11098298 | 3300005295 | Bacteria | 516 |
| 51 | Ga0070658_10005024 | 3300005327 | Bacteria | 10769 |
| 52 | Ga0070658_11939020 | 3300005327 | Bacteria | 509 |
| 53 | Ga0070676_10002393 | 3300005328 | Bacteria | 9604 |
| 54 | Ga0070676_10491550 | 3300005328 | Bacteria | 870 |
| 55 | Ga0070676_10595526 | 3300005328 | Bacteria | 797 |
| 56 | Ga0070676_10647349 | 3300005328 | Bacteria | 767 |
| 57 | Ga0070676_10680290 | 3300005328 | Bacteria | 750 |
| 58 | Ga0070676_10684122 | 3300005328 | Bacteria | 748 |
| 59 | Ga0070683_100000094 | 3300005329 | Bacteria | 58242 |
| 60 | Ga0070683_100001323 | 3300005329 | Bacteria | 18858 |
| 61 | Ga0070683_100036179 | 3300005329 | Bacteria | 4516 |
| 62 | Ga0070683_101580343 | 3300005329 | Bacteria | 631 |
| 63 | Ga0070683_101628540 | 3300005329 | Bacteria | 621 |
| 64 | Ga0070690_100000500 | 3300005330 | Bacteria | 19616 |
| 65 | Ga0070690_100776090 | 3300005330 | Bacteria | 742 |
| 66 | Ga0070690_101047610 | 3300005330 | Bacteria | 645 |
| 67 | Ga0070690_101051337 | 3300005330 | Bacteria | 644 |
| 68 | Ga0070690_101378213 | 3300005330 | Bacteria | 567 |
| 69 | Ga0070670_100004270 | 3300005331 | Bacteria | 11957 |
| 70 | Ga0070670_100016953 | 3300005331 | Bacteria | 6253 |
| 71 | Ga0070670_100260887 | 3300005331 | Bacteria | 1510 |
| 72 | Ga0070670_101031600 | 3300005331 | Bacteria | 749 |
| 73 | Ga0070670_101130782 | 3300005331 | Bacteria | 715 |
| 74 | Ga0070670_101931683 | 3300005331 | Bacteria | 544 |
| 75 | Ga0070670_102046394 | 3300005331 | Bacteria | 528 |
| 76 | Ga0070677_10000073 | 3300005333 | Bacteria | 31761 |
| 77 | Ga0070677_10248660 | 3300005333 | Bacteria | 881 |
| 78 | Ga0070677_10494885 | 3300005333 | Bacteria | 662 |
| 79 | Ga0068869_100012627 | 3300005334 | Bacteria | 5586 |
| 80 | Ga0068869_100587407 | 3300005334 | Bacteria | 939 |
| 81 | Ga0070666_10000730 | 3300005335 | Bacteria | 19913 |
| 82 | Ga0070666_10039674 | 3300005335 | Bacteria | 3139 |
| 83 | Ga0070680_100149467 | 3300005336 | Bacteria | 1961 |
| 84 | Ga0070680_100376351 | 3300005336 | Bacteria | 1209 |
| 85 | Ga0070680_100697413 | 3300005336 | Bacteria | 873 |
| 86 | Ga0070682_100194809 | 3300005337 | Bacteria | 1425 |
| 87 | Ga0070682_100419657 | 3300005337 | Bacteria | 1017 |
| 88 | Ga0070682_101669821 | 3300005337 | Bacteria | 553 |
| 89 | Ga0068868_100125900 | 3300005338 | Bacteria | 2093 |
| 90 | Ga0068868_100814076 | 3300005338 | Bacteria | 844 |
| 91 | Ga0068868_100984944 | 3300005338 | Bacteria | 770 |
| 92 | Ga0068868_101229391 | 3300005338 | Bacteria | 694 |
| 93 | Ga0068868_102026188 | 3300005338 | Bacteria | 547 |
| 94 | Ga0070660_100000181 | 3300005339 | Bacteria | 41585 |
| 95 | Ga0070660_100379575 | 3300005339 | Bacteria | 1167 |
| 96 | Ga0070689_100000949 | 3300005340 | Bacteria | 18052 |
| 97 | Ga0070689_100041204 | 3300005340 | Bacteria | 3544 |
| 98 | Ga0070689_100109280 | 3300005340 | Bacteria | 2198 |
| 99 | Ga0070691_10020695 | 3300005341 | Bacteria | 3040 |
| 100 | Ga0070691_10450638 | 3300005341 | Bacteria | 735 |
| 101 | Ga0070691_10939951 | 3300005341 | Bacteria | 536 |
| 102 | Ga0070687_100000024 | 3300005343 | Bacteria | 47595 |
| 103 | Ga0070687_100208653 | 3300005343 | Bacteria | 1188 |
| 104 | Ga0070687_100482813 | 3300005343 | Bacteria | 831 |
| 105 | Ga0070687_100892946 | 3300005343 | Bacteria | 637 |
| 106 | Ga0070661_100006519 | 3300005344 | Bacteria | 8054 |
| 107 | Ga0070661_100078230 | 3300005344 | Bacteria | 2439 |
| 108 | Ga0070661_100252775 | 3300005344 | Bacteria | 1361 |
| 109 | Ga0070661_101822398 | 3300005344 | Bacteria | 517 |
| 110 | Ga0070692_10005628 | 3300005345 | Bacteria | 5370 |
| 111 | Ga0070692_10053554 | 3300005345 | Bacteria | 2104 |
| 112 | Ga0070668_100000448 | 3300005347 | Bacteria | 27291 |
| 113 | Ga0070668_100068776 | 3300005347 | Bacteria | 2753 |
| 114 | Ga0070668_100348544 | 3300005347 | Bacteria | 1253 |
| 115 | Ga0070668_101024720 | 3300005347 | Bacteria | 743 |
| 116 | Ga0070668_101188794 | 3300005347 | Bacteria | 691 |
| 117 | Ga0070668_101417960 | 3300005347 | Bacteria | 634 |
| 118 | Ga0070668_102289010 | 3300005347 | Bacteria | 500 |
| 119 | Ga0070669_100001019 | 3300005353 | Bacteria | 20404 |
| 120 | Ga0070669_100166876 | 3300005353 | Bacteria | 1714 |
| 121 | Ga0070669_100222261 | 3300005353 | Bacteria | 1493 |
| 122 | Ga0070669_100449834 | 3300005353 | Bacteria | 1061 |
| 123 | Ga0070669_101667002 | 3300005353 | Bacteria | 555 |
| 124 | Ga0070675_100001940 | 3300005354 | Bacteria | 15307 |
| 125 | Ga0070675_100118030 | 3300005354 | Bacteria | 2252 |
| 126 | Ga0070675_100210042 | 3300005354 | Bacteria | 1692 |
| 127 | Ga0070675_100293359 | 3300005354 | Bacteria | 1431 |
| 128 | Ga0070675_100310247 | 3300005354 | Bacteria | 1392 |
| 129 | Ga0070675_100478685 | 3300005354 | Bacteria | 1119 |
| 130 | Ga0070675_101538363 | 3300005354 | Bacteria | 614 |
| 131 | Ga0070675_101727039 | 3300005354 | Bacteria | 577 |
| 132 | Ga0070675_101977356 | 3300005354 | Bacteria | 538 |
| 133 | Ga0070671_100004331 | 3300005355 | Bacteria | 11229 |
| 134 | Ga0070671_100013832 | 3300005355 | Bacteria | 6512 |
| 135 | Ga0070671_100222326 | 3300005355 | Bacteria | 1602 |
| 136 | Ga0070671_100319994 | 3300005355 | Bacteria | 1322 |
| 137 | Ga0070671_100348479 | 3300005355 | Bacteria | 1264 |
| 138 | Ga0070671_100639326 | 3300005355 | Bacteria | 921 |
| 139 | Ga0070674_100000350 | 3300005356 | Bacteria | 22871 |
| 140 | Ga0070674_100011938 | 3300005356 | Bacteria | 5312 |
| 141 | Ga0070674_100404224 | 3300005356 | Bacteria | 1116 |
| 142 | Ga0070674_100445341 | 3300005356 | Bacteria | 1068 |
| 143 | Ga0070674_100457466 | 3300005356 | Bacteria | 1055 |
| 144 | Ga0070674_100771977 | 3300005356 | Bacteria | 828 |
| 145 | Ga0070674_101383746 | 3300005356 | Bacteria | 630 |
| 146 | Ga0070673_100001346 | 3300005364 | Bacteria | 14336 |
| 147 | Ga0070673_100076042 | 3300005364 | Bacteria | 2710 |
| 148 | Ga0070673_100174521 | 3300005364 | Bacteria | 1836 |
| 149 | Ga0070673_101406459 | 3300005364 | Bacteria | 657 |
| 150 | Ga0070673_101415377 | 3300005364 | Bacteria | 654 |
| 151 | Ga0070673_102062034 | 3300005364 | Bacteria | 542 |
| 152 | Ga0070673_102324411 | 3300005364 | Bacteria | 510 |
| 153 | Ga0070688_100001135 | 3300005365 | Bacteria | 13337 |
| 154 | Ga0070688_100222985 | 3300005365 | Bacteria | 1329 |
| 155 | Ga0070688_101416895 | 3300005365 | Bacteria | 563 |
| 156 | Ga0070659_100000114 | 3300005366 | Bacteria | 59686 |
| 157 | Ga0070659_100451301 | 3300005366 | Bacteria | 1091 |
| 158 | Ga0070659_100605689 | 3300005366 | Bacteria | 942 |
| 159 | Ga0070667_100011084 | 3300005367 | Bacteria | 7458 |
| 160 | Ga0070667_100397655 | 3300005367 | Bacteria | 1254 |
| 161 | Ga0070667_100855240 | 3300005367 | Bacteria | 846 |
| 162 | Ga0070667_101332600 | 3300005367 | Bacteria | 673 |
| 163 | Ga0070667_101699404 | 3300005367 | Bacteria | 594 |
| 164 | Ga0070709_11210828 | 3300005434 | Bacteria | 607 |
| 165 | Ga0070714_101686849 | 3300005435 | Bacteria | 619 |
| 166 | Ga0070710_10868430 | 3300005437 | Bacteria | 649 |
| 167 | Ga0070701_10081817 | 3300005438 | Bacteria | 1750 |
| 168 | Ga0070701_10220990 | 3300005438 | Bacteria | 1130 |
| 169 | Ga0070701_10566287 | 3300005438 | Bacteria | 747 |
| 170 | Ga0070701_10848837 | 3300005438 | Bacteria | 627 |
| 171 | Ga0070711_100149287 | 3300005439 | Bacteria | 1761 |
| 172 | Ga0070711_101361141 | 3300005439 | Bacteria | 617 |
| 173 | Ga0070705_100005491 | 3300005440 | Bacteria | 6180 |
| 174 | Ga0070705_100105034 | 3300005440 | Bacteria | 1793 |
| 175 | Ga0070705_100157732 | 3300005440 | Bacteria | 1513 |
| 176 | Ga0070705_101585444 | 3300005440 | Bacteria | 551 |
| 177 | Ga0070705_101718673 | 3300005440 | Bacteria | 530 |
| 178 | Ga0070700_100028912 | 3300005441 | Bacteria | 3302 |
| 179 | Ga0070700_100773277 | 3300005441 | Bacteria | 771 |
| 180 | Ga0070700_101755166 | 3300005441 | Bacteria | 533 |
| 181 | Ga0070694_100576539 | 3300005444 | Bacteria | 904 |
| 182 | Ga0070694_100716209 | 3300005444 | Bacteria | 815 |
| 183 | Ga0070708_101447076 | 3300005445 | Bacteria | 641 |
| 184 | Ga0070663_100000874 | 3300005455 | Bacteria | 16393 |
| 185 | Ga0070663_100359031 | 3300005455 | Bacteria | 1181 |
| 186 | Ga0070663_100743866 | 3300005455 | Bacteria | 837 |
| 187 | Ga0070663_101672599 | 3300005455 | Bacteria | 569 |
| 188 | Ga0070678_100017053 | 3300005456 | Bacteria | 4664 |
| 189 | Ga0070678_100150458 | 3300005456 | Bacteria | 1874 |
| 190 | Ga0070678_100328891 | 3300005456 | Bacteria | 1307 |
| 191 | Ga0070678_100428434 | 3300005456 | Bacteria | 1155 |
| 192 | Ga0070678_101203545 | 3300005456 | Bacteria | 702 |
| 193 | Ga0070678_101325008 | 3300005456 | Bacteria | 670 |
| 194 | Ga0070662_100000254 | 3300005457 | Bacteria | 31552 |
| 195 | Ga0070662_100160245 | 3300005457 | Bacteria | 1759 |
| 196 | Ga0070662_100285152 | 3300005457 | Bacteria | 1337 |
| 197 | Ga0070662_100432249 | 3300005457 | Bacteria | 1091 |
| 198 | Ga0070681_10188493 | 3300005458 | Bacteria | 1982 |
| 199 | Ga0068867_100001968 | 3300005459 | Bacteria | 14326 |
| 200 | Ga0068867_100230883 | 3300005459 | Bacteria | 1496 |
| 201 | Ga0068867_102344089 | 3300005459 | Bacteria | 508 |
| 202 | Ga0070685_10000248 | 3300005466 | Bacteria | 35336 |
| 203 | Ga0070685_11325340 | 3300005466 | Bacteria | 550 |
| 204 | Ga0070706_100402100 | 3300005467 | Bacteria | 1275 |
| 205 | Ga0070706_100996574 | 3300005467 | Bacteria | 773 |
| 206 | Ga0070706_101450878 | 3300005467 | Bacteria | 628 |
| 207 | Ga0070707_100857225 | 3300005468 | Bacteria | 873 |
| 208 | Ga0070707_101604448 | 3300005468 | Bacteria | 617 |
| 209 | Ga0070698_100545640 | 3300005471 | Bacteria | 1099 |
| 210 | Ga0070698_100647762 | 3300005471 | Bacteria | 998 |
| 211 | Ga0070698_100758412 | 3300005471 | Bacteria | 914 |
| 212 | Ga0070698_101000005 | 3300005471 | Bacteria | 783 |
| 213 | Ga0070698_101386398 | 3300005471 | Bacteria | 654 |
| 214 | Ga0070699_100022962 | 3300005518 | Bacteria | 5373 |
| 215 | Ga0070699_100157512 | 3300005518 | Bacteria | 2010 |
| 216 | Ga0070699_101208046 | 3300005518 | Bacteria | 694 |
| 217 | Ga0070699_101258879 | 3300005518 | Bacteria | 678 |
| 218 | Ga0070679_100047014 | 3300005530 | Bacteria | 4303 |
| 219 | Ga0070679_100145145 | 3300005530 | Bacteria | 2351 |
| 220 | Ga0070679_101616621 | 3300005530 | Bacteria | 596 |
| 221 | Ga0070684_101395598 | 3300005535 | Bacteria | 660 |
| 222 | Ga0070697_100017739 | 3300005536 | Bacteria | 5607 |
| 223 | Ga0070697_100185598 | 3300005536 | Bacteria | 1763 |
| 224 | Ga0070697_100237925 | 3300005536 | Bacteria | 1554 |
| 225 | Ga0070697_100363324 | 3300005536 | Bacteria | 1251 |
| 226 | Ga0070697_100382838 | 3300005536 | Bacteria | 1219 |
| 227 | Ga0070697_101178657 | 3300005536 | Bacteria | 683 |
| 228 | Ga0070697_102008942 | 3300005536 | Bacteria | 518 |
| 229 | Ga0070697_102047032 | 3300005536 | Bacteria | 512 |
| 230 | Ga0068853_100001786 | 3300005539 | Bacteria | 15823 |
| 231 | Ga0068853_100795112 | 3300005539 | Bacteria | 906 |
| 232 | Ga0068853_100874452 | 3300005539 | Bacteria | 863 |
| 233 | Ga0070672_100001452 | 3300005543 | Bacteria | 14678 |
| 234 | Ga0070672_100482531 | 3300005543 | Bacteria | 1070 |
| 235 | Ga0070672_100504860 | 3300005543 | Bacteria | 1046 |
| 236 | Ga0070672_100591520 | 3300005543 | Bacteria | 966 |
| 237 | Ga0070672_100624797 | 3300005543 | Bacteria | 940 |
| 238 | Ga0070672_100860402 | 3300005543 | Bacteria | 800 |
| 239 | Ga0070672_100967376 | 3300005543 | Bacteria | 753 |
| 240 | Ga0070672_101298966 | 3300005543 | Bacteria | 650 |
| 241 | Ga0070672_101719387 | 3300005543 | Bacteria | 563 |
| 242 | Ga0070686_100000328 | 3300005544 | Bacteria | 31173 |
| 243 | Ga0070686_100488886 | 3300005544 | Bacteria | 953 |
| 244 | Ga0070695_100084673 | 3300005545 | Bacteria | 2104 |
| 245 | Ga0070695_100225615 | 3300005545 | Bacteria | 1352 |
| 246 | Ga0070695_100264406 | 3300005545 | Bacteria | 1258 |
| 247 | Ga0070695_100409840 | 3300005545 | Bacteria | 1030 |
| 248 | Ga0070695_100861656 | 3300005545 | Bacteria | 729 |
| 249 | Ga0070695_101132041 | 3300005545 | Bacteria | 642 |
| 250 | Ga0070696_100265354 | 3300005546 | Bacteria | 1303 |
| 251 | Ga0070696_100736174 | 3300005546 | Bacteria | 807 |
| 252 | Ga0070696_101885441 | 3300005546 | Bacteria | 518 |
| 253 | Ga0070693_100010528 | 3300005547 | Bacteria | 4636 |
| 254 | Ga0070693_100019888 | 3300005547 | Bacteria | 3531 |
| 255 | Ga0070665_100010583 | 3300005548 | Bacteria | 9339 |
| 256 | Ga0070665_100094954 | 3300005548 | Bacteria | 2986 |
| 257 | Ga0070665_101664565 | 3300005548 | Bacteria | 646 |
| 258 | Ga0070665_102548169 | 3300005548 | Bacteria | 513 |
| 259 | Ga0070665_102594652 | 3300005548 | Bacteria | 507 |
| 260 | Ga0070704_100066182 | 3300005549 | Bacteria | 2605 |
| 261 | Ga0070704_100116336 | 3300005549 | Bacteria | 2044 |
| 262 | Ga0070704_100529830 | 3300005549 | Bacteria | 1026 |
| 263 | Ga0070704_100564894 | 3300005549 | Bacteria | 996 |
| 264 | Ga0070704_100831770 | 3300005549 | Bacteria | 827 |
| 265 | Ga0070704_101162770 | 3300005549 | Bacteria | 703 |
| 266 | Ga0068855_100006422 | 3300005563 | Bacteria | 14313 |
| 267 | Ga0070664_100000479 | 3300005564 | Bacteria | 30222 |
| 268 | Ga0070664_100053438 | 3300005564 | Bacteria | 3424 |
| 269 | Ga0070664_100145251 | 3300005564 | Bacteria | 2091 |
| 270 | Ga0070664_100221069 | 3300005564 | Bacteria | 1694 |
| 271 | Ga0070664_100324039 | 3300005564 | Bacteria | 1397 |
| 272 | Ga0070664_101470377 | 3300005564 | Bacteria | 644 |
| 273 | Ga0070664_101582707 | 3300005564 | Bacteria | 621 |
| 274 | Ga0070664_101725164 | 3300005564 | Bacteria | 594 |
| 275 | Ga0068857_100092103 | 3300005577 | Bacteria | 2714 |
| 276 | Ga0068857_100252079 | 3300005577 | Bacteria | 1618 |
| 277 | Ga0068857_100525451 | 3300005577 | Bacteria | 1112 |
| 278 | Ga0068857_101448132 | 3300005577 | Bacteria | 669 |
| 279 | Ga0068857_101734987 | 3300005577 | Bacteria | 611 |
| 280 | Ga0068854_100000012 | 3300005578 | Bacteria | 167969 |
| 281 | Ga0068854_100421747 | 3300005578 | Bacteria | 1108 |
| 282 | Ga0068856_100009855 | 3300005614 | Bacteria | 9275 |
| 283 | Ga0068856_100408964 | 3300005614 | Bacteria | 1376 |
| 284 | Ga0070702_100798555 | 3300005615 | Bacteria | 729 |
| 285 | Ga0070702_101400910 | 3300005615 | Bacteria | 571 |
| 286 | Ga0070702_101444887 | 3300005615 | Bacteria | 564 |
| 287 | Ga0068852_100000438 | 3300005616 | Bacteria | 27633 |
| 288 | Ga0068852_101346269 | 3300005616 | Bacteria | 736 |
| 289 | Ga0068859_100001092 | 3300005617 | Bacteria | 27670 |
| 290 | Ga0068859_100039272 | 3300005617 | Bacteria | 4748 |
| 291 | Ga0068859_100138831 | 3300005617 | Bacteria | 2504 |
| 292 | Ga0068859_100200996 | 3300005617 | Bacteria | 2078 |
| 293 | Ga0068859_100381046 | 3300005617 | Bacteria | 1506 |
| 294 | Ga0068859_100683477 | 3300005617 | Bacteria | 1118 |
| 295 | Ga0068859_100777959 | 3300005617 | Bacteria | 1045 |
| 296 | Ga0068859_101466948 | 3300005617 | Bacteria | 753 |
| 297 | Ga0068859_101995864 | 3300005617 | Bacteria | 641 |
| 298 | Ga0068859_103024518 | 3300005617 | Bacteria | 513 |
| 299 | Ga0068864_100003452 | 3300005618 | Bacteria | 13060 |
| 300 | Ga0068864_101039382 | 3300005618 | Bacteria | 813 |
| 301 | Ga0068864_101310556 | 3300005618 | Bacteria | 725 |
| 302 | Ga0068864_101754632 | 3300005618 | Bacteria | 626 |
| 303 | Ga0068866_10000117 | 3300005718 | Bacteria | 34561 |
| 304 | Ga0068866_10117443 | 3300005718 | Bacteria | 1494 |
| 305 | Ga0068866_10302363 | 3300005718 | Bacteria | 999 |
| 306 | Ga0068866_10328422 | 3300005718 | Bacteria | 965 |
| 307 | Ga0068861_100000082 | 3300005719 | Bacteria | 45733 |
| 308 | Ga0068861_100257033 | 3300005719 | Bacteria | 1493 |
| 309 | Ga0068861_100270266 | 3300005719 | Bacteria | 1459 |
| 310 | Ga0068861_101375880 | 3300005719 | Bacteria | 689 |
| 311 | Ga0068861_101744180 | 3300005719 | Bacteria | 616 |
| 312 | Ga0068861_102284504 | 3300005719 | Bacteria | 543 |
| 313 | Ga0068861_102712449 | 3300005719 | Bacteria | 500 |
| 314 | Ga0068851_10000775 | 3300005834 | Bacteria | 13747 |
| 315 | Ga0068851_10163626 | 3300005834 | Bacteria | 1224 |
| 316 | Ga0068870_10000643 | 3300005840 | Bacteria | 13325 |
| 317 | Ga0068870_10200553 | 3300005840 | Bacteria | 1209 |
| 318 | Ga0068870_10209859 | 3300005840 | Bacteria | 1186 |
| 319 | Ga0068870_10412482 | 3300005840 | Bacteria | 882 |
| 320 | Ga0068870_11065030 | 3300005840 | Bacteria | 580 |
| 321 | Ga0068863_100053675 | 3300005841 | Bacteria | 3820 |
| 322 | Ga0068863_100153808 | 3300005841 | Bacteria | 2201 |
| 323 | Ga0068863_100160112 | 3300005841 | Bacteria | 2156 |
| 324 | Ga0068863_100862685 | 3300005841 | Bacteria | 904 |
| 325 | Ga0068863_100954509 | 3300005841 | Bacteria | 859 |
| 326 | Ga0068863_101007866 | 3300005841 | Bacteria | 836 |
| 327 | Ga0068863_101786294 | 3300005841 | Bacteria | 625 |
| 328 | Ga0068863_102587286 | 3300005841 | Bacteria | 516 |
| 329 | Ga0068858_100008887 | 3300005842 | Bacteria | 9632 |
| 330 | Ga0068858_100055604 | 3300005842 | Bacteria | 3658 |
| 331 | Ga0068858_100276704 | 3300005842 | Bacteria | 1598 |
| 332 | Ga0068858_100424644 | 3300005842 | Bacteria | 1278 |
| 333 | Ga0068858_100740245 | 3300005842 | Bacteria | 957 |
| 334 | Ga0068858_100803785 | 3300005842 | Bacteria | 918 |
| 335 | Ga0068858_101417176 | 3300005842 | Bacteria | 685 |
| 336 | Ga0068858_101621266 | 3300005842 | Bacteria | 639 |
| 337 | Ga0068858_101741107 | 3300005842 | Bacteria | 615 |
| 338 | Ga0068860_100005800 | 3300005843 | Bacteria | 12434 |
| 339 | Ga0068860_100087378 | 3300005843 | Bacteria | 2968 |
| 340 | Ga0068860_100234785 | 3300005843 | Bacteria | 1782 |
| 341 | Ga0068860_100239764 | 3300005843 | Bacteria | 1763 |
| 342 | Ga0068860_102175836 | 3300005843 | Bacteria | 576 |
| 343 | Ga0068860_102213821 | 3300005843 | Bacteria | 571 |
| 344 | Ga0068862_100004232 | 3300005844 | Bacteria | 12159 |
| 345 | Ga0068862_100559879 | 3300005844 | Bacteria | 1093 |
| 346 | Ga0068862_100988725 | 3300005844 | Bacteria | 831 |
| 347 | Ga0068862_101429418 | 3300005844 | Bacteria | 695 |
| 348 | Ga0068862_102738881 | 3300005844 | Bacteria | 505 |
| 349 | Ga0081455_10843341 | 3300005937 | Bacteria | 573 |
| 350 | Ga0081538_10128689 | 3300005981 | Bacteria | 1196 |
| 351 | Ga0081540_1000029 | 3300005983 | Bacteria | 150173 |
| 352 | Ga0081540_1056204 | 3300005983 | Bacteria | 1912 |
| 353 | Ga0081540_1142334 | 3300005983 | Bacteria | 960 |
| 354 | Ga0075365_10018282 | 3300006038 | Bacteria | 4308 |
| 355 | Ga0075364_11063440 | 3300006051 | Bacteria | 550 |
| 356 | Ga0070715_10542746 | 3300006163 | Bacteria | 673 |
| 357 | Ga0070716_100952370 | 3300006173 | Bacteria | 676 |
| 358 | Ga0070716_101296152 | 3300006173 | Bacteria | 589 |
| 359 | Ga0070712_100223757 | 3300006175 | Bacteria | 1491 |
| 360 | Ga0070712_100559918 | 3300006175 | Bacteria | 964 |
| 361 | Ga0075362_10210142 | 3300006177 | Bacteria | 949 |
| 362 | Ga0075367_10084871 | 3300006178 | Bacteria | 1921 |
| 363 | Ga0075366_10940781 | 3300006195 | Bacteria | 539 |
| 364 | Ga0097621_100003466 | 3300006237 | Bacteria | 10878 |
| 365 | Ga0097621_100376089 | 3300006237 | Bacteria | 1268 |
| 366 | Ga0097621_102275822 | 3300006237 | Bacteria | 518 |
| 367 | Ga0075370_10708837 | 3300006353 | Bacteria | 612 |
| 368 | Ga0068871_100202666 | 3300006358 | Bacteria | 1713 |
| 369 | Ga0068871_100573959 | 3300006358 | Bacteria | 1023 |
| 370 | Ga0068871_100758126 | 3300006358 | Bacteria | 892 |
| 371 | Ga0068871_100964830 | 3300006358 | Bacteria | 793 |
| 372 | Ga0068871_101055072 | 3300006358 | Bacteria | 759 |
| 373 | Ga0075428_100000017 | 3300006844 | Bacteria | 147833 |
| 374 | Ga0075428_100122904 | 3300006844 | Bacteria | 2825 |
| 375 | Ga0075428_100355670 | 3300006844 | Bacteria | 1571 |
| 376 | Ga0075428_100535412 | 3300006844 | Bacteria | 1252 |
| 377 | Ga0075428_100653282 | 3300006844 | Bacteria | 1121 |
| 378 | Ga0075428_101016031 | 3300006844 | Bacteria | 877 |
| 379 | Ga0075428_101262432 | 3300006844 | Bacteria | 777 |
| 380 | Ga0075428_101585530 | 3300006844 | Bacteria | 685 |
| 381 | Ga0075431_100454296 | 3300006847 | Bacteria | 1276 |
| 382 | Ga0075431_100870242 | 3300006847 | Bacteria | 872 |
| 383 | Ga0075431_101270423 | 3300006847 | Bacteria | 698 |
| 384 | Ga0075431_101677678 | 3300006847 | Bacteria | 592 |
| 385 | Ga0075431_101800493 | 3300006847 | Bacteria | 568 |
| 386 | Ga0075431_102020647 | 3300006847 | Bacteria | 531 |
| 387 | Ga0075433_10080040 | 3300006852 | Bacteria | 2879 |
| 388 | Ga0075433_10387441 | 3300006852 | Bacteria | 1234 |
| 389 | Ga0075433_10854000 | 3300006852 | Bacteria | 795 |
| 390 | Ga0075433_11062040 | 3300006852 | Bacteria | 705 |
| 391 | Ga0075434_100062039 | 3300006871 | Bacteria | 3720 |
| 392 | Ga0075434_100081239 | 3300006871 | Bacteria | 3238 |
| 393 | Ga0075434_100480998 | 3300006871 | Bacteria | 1263 |
| 394 | Ga0075434_101113613 | 3300006871 | Bacteria | 803 |
| 395 | Ga0075434_101652856 | 3300006871 | Bacteria | 649 |
| 396 | Ga0075429_100218567 | 3300006880 | Bacteria | 1669 |
| 397 | Ga0075429_100569260 | 3300006880 | Bacteria | 993 |
| 398 | Ga0075429_100955460 | 3300006880 | Bacteria | 749 |
| 399 | Ga0075429_101397996 | 3300006880 | Bacteria | 609 |
| 400 | Ga0075429_101951224 | 3300006880 | Bacteria | 508 |
| 401 | Ga0068865_100001281 | 3300006881 | Bacteria | 14624 |
| 402 | Ga0068865_100789144 | 3300006881 | Bacteria | 818 |
| 403 | Ga0068865_101512768 | 3300006881 | Bacteria | 602 |
| 404 | Ga0075436_100041067 | 3300006914 | Bacteria | 3192 |
| 405 | Ga0075436_100497311 | 3300006914 | Bacteria | 892 |
| 406 | Ga0097620_100001091 | 3300006931 | Bacteria | 27670 |
| 407 | Ga0097620_100039275 | 3300006931 | Bacteria | 4748 |
| 408 | Ga0097620_100138842 | 3300006931 | Bacteria | 2504 |
| 409 | Ga0097620_100200999 | 3300006931 | Bacteria | 2078 |
| 410 | Ga0097620_100381001 | 3300006931 | Bacteria | 1506 |
| 411 | Ga0097620_100683432 | 3300006931 | Bacteria | 1118 |
| 412 | Ga0097620_100777969 | 3300006931 | Bacteria | 1045 |
| 413 | Ga0097620_101466850 | 3300006931 | Bacteria | 753 |
| 414 | Ga0097620_101995948 | 3300006931 | Bacteria | 641 |
| 415 | Ga0097620_103024717 | 3300006931 | Bacteria | 513 |
| 416 | Ga0075435_100139306 | 3300007076 | Bacteria | 2035 |
| 417 | Ga0075435_100167535 | 3300007076 | Bacteria | 1853 |
| 418 | Ga0075435_100679141 | 3300007076 | Bacteria | 895 |
| 419 | Ga0075435_101255482 | 3300007076 | Bacteria | 648 |
| 420 | Ga0075435_101527835 | 3300007076 | Bacteria | 585 |
| 421 | Ga0099794_10439460 | 3300007265 | Bacteria | 683 |
| 422 | Ga0105251_10631004 | 3300009011 | Bacteria | 511 |
| 423 | Ga0105244_10475922 | 3300009036 | Bacteria | 575 |
| 424 | Ga0105240_12001730 | 3300009093 | Bacteria | 602 |
| 425 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 426 | Ga0111539_10042697 | 3300009094 | Bacteria | 5443 |
| 427 | Ga0111539_10044169 | 3300009094 | Bacteria | 5339 |
| 428 | Ga0111539_10270295 | 3300009094 | Bacteria | 1979 |
| 429 | Ga0111539_10274086 | 3300009094 | Bacteria | 1964 |
| 430 | Ga0111539_10350905 | 3300009094 | Bacteria | 1717 |
| 431 | Ga0111539_10627249 | 3300009094 | Bacteria | 1252 |
| 432 | Ga0111539_11731278 | 3300009094 | Bacteria | 725 |
| 433 | Ga0105245_10288050 | 3300009098 | Bacteria | 1608 |
| 434 | Ga0105245_11649356 | 3300009098 | Bacteria | 693 |
| 435 | Ga0105245_12592370 | 3300009098 | Bacteria | 560 |
| 436 | Ga0105247_10015895 | 3300009101 | Bacteria | 4506 |
| 437 | Ga0105247_10975541 | 3300009101 | Bacteria | 660 |
| 438 | Ga0114129_10000509 | 3300009147 | Bacteria | 47512 |
| 439 | Ga0114129_10365441 | 3300009147 | Bacteria | 1908 |
| 440 | Ga0114129_10975264 | 3300009147 | Bacteria | 1069 |
| 441 | Ga0105243_11580024 | 3300009148 | Bacteria | 682 |
| 442 | Ga0105243_12227874 | 3300009148 | Bacteria | 585 |
| 443 | Ga0105243_12901923 | 3300009148 | Bacteria | 520 |
| 444 | Ga0105242_12732161 | 3300009176 | Bacteria | 544 |
| 445 | Ga0105248_10395727 | 3300009177 | Bacteria | 1556 |
| 446 | Ga0105248_10690097 | 3300009177 | Bacteria | 1152 |
| 447 | Ga0105248_11198546 | 3300009177 | Bacteria | 858 |
| 448 | Ga0105248_11983211 | 3300009177 | Bacteria | 661 |
| 449 | Ga0105248_12070481 | 3300009177 | Bacteria | 647 |
| 450 | Ga0105248_12193160 | 3300009177 | Bacteria | 628 |
| 451 | Ga0105249_11261524 | 3300009553 | Bacteria | 810 |
| 452 | Ga0105249_12579814 | 3300009553 | Bacteria | 580 |
| 453 | Ga0105239_12397902 | 3300010375 | Bacteria | 614 |
| 454 | Ga0105246_10192241 | 3300011119 | Bacteria | 1581 |
| 455 | Ga0105246_11338443 | 3300011119 | Bacteria | 665 |
| 456 | Ga0105246_11713458 | 3300011119 | Bacteria | 598 |
| 457 | Ga0105246_12604410 | 3300011119 | Bacteria | 500 |
| 458 | Ga0157339_1031008 | 3300012505 | Bacteria | 625 |
| 459 | Ga0157324_1035544 | 3300012506 | Bacteria | 586 |
| 460 | Ga0157316_1063998 | 3300012510 | Bacteria | 539 |
| 461 | Ga0157373_11571628 | 3300013100 | Bacteria | 503 |
| 462 | Ga0157371_10585155 | 3300013102 | Bacteria | 829 |
| 463 | Ga0157370_10223927 | 3300013104 | Bacteria | 1742 |
| 464 | Ga0157378_10322335 | 3300013297 | Bacteria | 1501 |
| 465 | Ga0157378_11235082 | 3300013297 | Bacteria | 787 |
| 466 | Ga0157378_12427885 | 3300013297 | Bacteria | 576 |
| 467 | Ga0163162_11532987 | 3300013306 | Bacteria | 759 |
| 468 | Ga0163162_11547671 | 3300013306 | Bacteria | 756 |
| 469 | Ga0157372_11160058 | 3300013307 | Bacteria | 893 |
| 470 | Ga0157375_10271476 | 3300013308 | Bacteria | 1858 |
| 471 | Ga0157375_10870603 | 3300013308 | Bacteria | 1046 |
| 472 | Ga0157375_10949579 | 3300013308 | Bacteria | 1002 |
| 473 | Ga0157375_11118753 | 3300013308 | Bacteria | 922 |
| 474 | Ga0157375_11406652 | 3300013308 | Bacteria | 822 |
| 475 | Ga0157375_12140289 | 3300013308 | Bacteria | 666 |
| 476 | Ga0157375_13424004 | 3300013308 | Bacteria | 528 |
| 477 | Ga0163163_10036900 | 3300014325 | Bacteria | 4750 |
| 478 | Ga0163163_10164016 | 3300014325 | Bacteria | 2268 |
| 479 | Ga0163163_11176712 | 3300014325 | Bacteria | 829 |
| 480 | Ga0163163_11324055 | 3300014325 | Bacteria | 782 |
| 481 | Ga0163163_12213081 | 3300014325 | Bacteria | 609 |
| 482 | Ga0157380_10516509 | 3300014326 | Bacteria | 1164 |
| 483 | Ga0157380_10613105 | 3300014326 | Bacteria | 1079 |
| 484 | Ga0157380_10694493 | 3300014326 | Bacteria | 1022 |
| 485 | Ga0157380_10781362 | 3300014326 | Bacteria | 970 |
| 486 | Ga0157380_11225276 | 3300014326 | Bacteria | 795 |
| 487 | Ga0157380_11607233 | 3300014326 | Bacteria | 706 |
| 488 | Ga0157380_11688341 | 3300014326 | Bacteria | 691 |
| 489 | Ga0157380_12915429 | 3300014326 | Bacteria | 544 |
| 490 | Ga0157380_13357676 | 3300014326 | Bacteria | 512 |
| 491 | Ga0182008_10955012 | 3300014497 | Bacteria | 508 |
| 492 | Ga0157377_10428196 | 3300014745 | Bacteria | 908 |
| 493 | Ga0157377_10699403 | 3300014745 | Bacteria | 736 |
| 494 | Ga0157377_10963933 | 3300014745 | Bacteria | 643 |
| 495 | Ga0157379_10211948 | 3300014968 | Bacteria | 1754 |
| 496 | Ga0157379_10668718 | 3300014968 | Bacteria | 973 |
| 497 | Ga0157376_10307712 | 3300014969 | Bacteria | 1502 |
| 498 | Ga0157376_11144007 | 3300014969 | Bacteria | 805 |
| 499 | Ga0157376_12311194 | 3300014969 | Bacteria | 577 |
| 500 | Ga0157376_12635227 | 3300014969 | Bacteria | 543 |
| 501 | Ga0157376_12741822 | 3300014969 | Bacteria | 533 |
| 502 | Ga0157376_12850998 | 3300014969 | Bacteria | 523 |
| 503 | Ga0163161_10059207 | 3300017792 | Bacteria | 2785 |
| 504 | Ga0163161_10301685 | 3300017792 | Bacteria | 1261 |
| 505 | Ga0163161_11537248 | 3300017792 | Bacteria | 585 |
| 506 | Ga0206356_10251847 | 3300020070 | Bacteria | 697 |
| 507 | Ga0206349_1652271 | 3300020075 | Bacteria | 545 |
| 508 | Ga0206355_1138463 | 3300020076 | Bacteria | 570 |
| 509 | Ga0206355_1183705 | 3300020076 | Bacteria | 2525 |
| 510 | Ga0206352_10435916 | 3300020078 | Bacteria | 1011 |
| 511 | Ga0206350_11371603 | 3300020080 | Bacteria | 836 |
| 512 | Ga0213874_10271349 | 3300021377 | Bacteria | 631 |
| 513 | Ga0207697_10000724 | 3300025315 | Bacteria | 18757 |
| 514 | Ga0207697_10017846 | 3300025315 | Bacteria | 2914 |
| 515 | Ga0207697_10300439 | 3300025315 | Bacteria | 712 |
| 516 | Ga0207697_10329868 | 3300025315 | Bacteria | 677 |
| 517 | Ga0207656_10013340 | 3300025321 | Bacteria | 3139 |
| 518 | Ga0207682_10000142 | 3300025893 | Bacteria | 32254 |
| 519 | Ga0207642_10000304 | 3300025899 | Bacteria | 14761 |
| 520 | Ga0207710_10008608 | 3300025900 | Bacteria | 4303 |
| 521 | Ga0207710_10028970 | 3300025900 | Bacteria | 2406 |
| 522 | Ga0207688_10003488 | 3300025901 | Bacteria | 8578 |
| 523 | Ga0207680_10000437 | 3300025903 | Bacteria | 19719 |
| 524 | Ga0207680_10462487 | 3300025903 | Bacteria | 901 |
| 525 | Ga0207680_11250675 | 3300025903 | Bacteria | 529 |
| 526 | Ga0207647_10003364 | 3300025904 | Bacteria | 11995 |
| 527 | Ga0207647_10512210 | 3300025904 | Bacteria | 668 |
| 528 | Ga0207699_10883484 | 3300025906 | Bacteria | 659 |
| 529 | Ga0207645_10000238 | 3300025907 | Bacteria | 45589 |
| 530 | Ga0207645_10144050 | 3300025907 | Bacteria | 1553 |
| 531 | Ga0207645_10558522 | 3300025907 | Bacteria | 777 |
| 532 | Ga0207645_11067925 | 3300025907 | Bacteria | 545 |
| 533 | Ga0207643_10000376 | 3300025908 | Bacteria | 30007 |
| 534 | Ga0207643_10150032 | 3300025908 | Bacteria | 1397 |
| 535 | Ga0207643_10388630 | 3300025908 | Bacteria | 881 |
| 536 | Ga0207643_10517479 | 3300025908 | Bacteria | 764 |
| 537 | Ga0207643_10589447 | 3300025908 | Bacteria | 715 |
| 538 | Ga0207705_10015275 | 3300025909 | Bacteria | 5513 |
| 539 | Ga0207684_10165126 | 3300025910 | Bacteria | 1907 |
| 540 | Ga0207684_11427571 | 3300025910 | Bacteria | 566 |
| 541 | Ga0207684_11494849 | 3300025910 | Bacteria | 550 |
| 542 | Ga0207654_10012178 | 3300025911 | Bacteria | 4403 |
| 543 | Ga0207707_10007464 | 3300025912 | Bacteria | 9524 |
| 544 | Ga0207695_10105565 | 3300025913 | Bacteria | 2804 |
| 545 | Ga0207671_10001461 | 3300025914 | Bacteria | 27305 |
| 546 | Ga0207693_10451145 | 3300025915 | Bacteria | 1005 |
| 547 | Ga0207663_10047077 | 3300025916 | Bacteria | 2661 |
| 548 | Ga0207663_10662500 | 3300025916 | Bacteria | 824 |
| 549 | Ga0207660_10021664 | 3300025917 | Bacteria | 4325 |
| 550 | Ga0207660_10081516 | 3300025917 | Bacteria | 2378 |
| 551 | Ga0207660_11205196 | 3300025917 | Bacteria | 616 |
| 552 | Ga0207662_10000368 | 3300025918 | Bacteria | 20298 |
| 553 | Ga0207662_10608641 | 3300025918 | Bacteria | 761 |
| 554 | Ga0207662_10610379 | 3300025918 | Bacteria | 760 |
| 555 | Ga0207657_10000132 | 3300025919 | Bacteria | 75342 |
| 556 | Ga0207649_10027667 | 3300025920 | Bacteria | 3330 |
| 557 | Ga0207649_10156462 | 3300025920 | Bacteria | 1575 |
| 558 | Ga0207652_10050537 | 3300025921 | Bacteria | 3563 |
| 559 | Ga0207652_11173720 | 3300025921 | Bacteria | 669 |
| 560 | Ga0207646_10633209 | 3300025922 | Bacteria | 959 |
| 561 | Ga0207646_10941604 | 3300025922 | Bacteria | 765 |
| 562 | Ga0207646_10992149 | 3300025922 | Bacteria | 742 |
| 563 | Ga0207646_11119282 | 3300025922 | Bacteria | 692 |
| 564 | Ga0207681_10000518 | 3300025923 | Bacteria | 26766 |
| 565 | Ga0207681_10121335 | 3300025923 | Bacteria | 1917 |
| 566 | Ga0207681_10197675 | 3300025923 | Bacteria | 1542 |
| 567 | Ga0207681_10847259 | 3300025923 | Bacteria | 764 |
| 568 | Ga0207681_10969468 | 3300025923 | Bacteria | 713 |
| 569 | Ga0207694_10003451 | 3300025924 | Bacteria | 12562 |
| 570 | Ga0207650_10000037 | 3300025925 | Bacteria | 211825 |
| 571 | Ga0207650_10133877 | 3300025925 | Bacteria | 1942 |
| 572 | Ga0207650_10774390 | 3300025925 | Bacteria | 813 |
| 573 | Ga0207650_10976316 | 3300025925 | Bacteria | 720 |
| 574 | Ga0207650_11138991 | 3300025925 | Bacteria | 664 |
| 575 | Ga0207650_11164516 | 3300025925 | Bacteria | 656 |
| 576 | Ga0207650_11342384 | 3300025925 | Bacteria | 608 |
| 577 | Ga0207659_10000012 | 3300025926 | Bacteria | 198502 |
| 578 | Ga0207659_10167480 | 3300025926 | Bacteria | 1731 |
| 579 | Ga0207659_10658060 | 3300025926 | Bacteria | 895 |
| 580 | Ga0207659_11307753 | 3300025926 | Bacteria | 622 |
| 581 | Ga0207687_10284104 | 3300025927 | Bacteria | 1327 |
| 582 | Ga0207644_10001828 | 3300025931 | Bacteria | 13817 |
| 583 | Ga0207644_10139417 | 3300025931 | Bacteria | 1866 |
| 584 | Ga0207644_10588455 | 3300025931 | Bacteria | 923 |
| 585 | Ga0207690_10000434 | 3300025932 | Bacteria | 27237 |
| 586 | Ga0207690_10069537 | 3300025932 | Bacteria | 2422 |
| 587 | Ga0207706_10000419 | 3300025933 | Bacteria | 45590 |
| 588 | Ga0207706_10010042 | 3300025933 | Bacteria | 8675 |
| 589 | Ga0207706_10442069 | 3300025933 | Bacteria | 1125 |
| 590 | Ga0207706_11425107 | 3300025933 | Bacteria | 568 |
| 591 | Ga0207686_10012502 | 3300025934 | Bacteria | 4667 |
| 592 | Ga0207709_10011122 | 3300025935 | Bacteria | 4963 |
| 593 | Ga0207709_11321466 | 3300025935 | Bacteria | 596 |
| 594 | Ga0207670_10000026 | 3300025936 | Bacteria | 131381 |
| 595 | Ga0207669_10000981 | 3300025937 | Bacteria | 12105 |
| 596 | Ga0207669_10018866 | 3300025937 | Bacteria | 3578 |
| 597 | Ga0207669_10216296 | 3300025937 | Bacteria | 1403 |
| 598 | Ga0207669_10553544 | 3300025937 | Bacteria | 928 |
| 599 | Ga0207669_10888221 | 3300025937 | Bacteria | 744 |
| 600 | Ga0207669_11336877 | 3300025937 | Bacteria | 609 |
| 601 | Ga0207704_10001879 | 3300025938 | Bacteria | 9402 |
| 602 | Ga0207665_11581066 | 3300025939 | Bacteria | 520 |
| 603 | Ga0207691_10000101 | 3300025940 | Bacteria | 75334 |
| 604 | Ga0207691_10523510 | 3300025940 | Bacteria | 1006 |
| 605 | Ga0207711_10000026 | 3300025941 | Bacteria | 254807 |
| 606 | Ga0207711_10124922 | 3300025941 | Bacteria | 2301 |
| 607 | Ga0207711_10340827 | 3300025941 | Bacteria | 1387 |
| 608 | Ga0207689_10000999 | 3300025942 | Bacteria | 27152 |
| 609 | Ga0207689_10391452 | 3300025942 | Bacteria | 1158 |
| 610 | Ga0207689_10512904 | 3300025942 | Bacteria | 1005 |
| 611 | Ga0207661_10004428 | 3300025944 | Bacteria | 9857 |
| 612 | Ga0207661_10037912 | 3300025944 | Bacteria | 3774 |
| 613 | Ga0207661_10764113 | 3300025944 | Bacteria | 890 |
| 614 | Ga0207661_11373696 | 3300025944 | Bacteria | 648 |
| 615 | Ga0207661_11703449 | 3300025944 | Bacteria | 576 |
| 616 | Ga0207679_10000393 | 3300025945 | Bacteria | 31420 |
| 617 | Ga0207679_10001292 | 3300025945 | Bacteria | 15820 |
| 618 | Ga0207679_10007830 | 3300025945 | Bacteria | 6789 |
| 619 | Ga0207679_10319244 | 3300025945 | Bacteria | 1344 |
| 620 | Ga0207667_10005424 | 3300025949 | Bacteria | 15550 |
| 621 | Ga0207651_10000112 | 3300025960 | Bacteria | 34954 |
| 622 | Ga0207651_10063113 | 3300025960 | Bacteria | 2585 |
| 623 | Ga0207712_10002247 | 3300025961 | Bacteria | 12549 |
| 624 | Ga0207712_11389854 | 3300025961 | Bacteria | 628 |
| 625 | Ga0207668_10003548 | 3300025972 | Bacteria | 9171 |
| 626 | Ga0207668_10194260 | 3300025972 | Bacteria | 1611 |
| 627 | Ga0207668_10446977 | 3300025972 | Bacteria | 1102 |
| 628 | Ga0207640_10001473 | 3300025981 | Bacteria | 12692 |
| 629 | Ga0207658_10000036 | 3300025986 | Bacteria | 152337 |
| 630 | Ga0207658_11228910 | 3300025986 | Bacteria | 685 |
| 631 | Ga0207658_11725005 | 3300025986 | Bacteria | 572 |
| 632 | Ga0207677_10000459 | 3300026023 | Bacteria | 27353 |
| 633 | Ga0207677_10350386 | 3300026023 | Bacteria | 1237 |
| 634 | Ga0207677_10740944 | 3300026023 | Bacteria | 875 |
| 635 | Ga0207703_10003676 | 3300026035 | Bacteria | 12782 |
| 636 | Ga0207703_11240962 | 3300026035 | Bacteria | 717 |
| 637 | Ga0207703_12111535 | 3300026035 | Bacteria | 539 |
| 638 | Ga0207639_10010826 | 3300026041 | Bacteria | 6324 |
| 639 | Ga0207678_10001767 | 3300026067 | Bacteria | 19799 |
| 640 | Ga0207678_10204688 | 3300026067 | Bacteria | 1688 |
| 641 | Ga0207708_10114338 | 3300026075 | Bacteria | 2098 |
| 642 | Ga0207708_11520295 | 3300026075 | Bacteria | 588 |
| 643 | Ga0207702_10013600 | 3300026078 | Bacteria | 6757 |
| 644 | Ga0207641_10001084 | 3300026088 | Bacteria | 27391 |
| 645 | Ga0207641_10411463 | 3300026088 | Bacteria | 1300 |
| 646 | Ga0207641_10453515 | 3300026088 | Bacteria | 1240 |
| 647 | Ga0207641_10615867 | 3300026088 | Bacteria | 1064 |
| 648 | Ga0207641_11881359 | 3300026088 | Bacteria | 600 |
| 649 | Ga0207648_10000449 | 3300026089 | Bacteria | 45590 |
| 650 | Ga0207648_11947316 | 3300026089 | Bacteria | 549 |
| 651 | Ga0207676_10000726 | 3300026095 | Bacteria | 25850 |
| 652 | Ga0207676_12160258 | 3300026095 | Unclassified | 555 |
| 653 | Ga0207674_10017732 | 3300026116 | Bacteria | 7759 |
| 654 | Ga0207674_10139947 | 3300026116 | Bacteria | 2380 |
| 655 | Ga0207674_10140708 | 3300026116 | Bacteria | 2372 |
| 656 | Ga0207675_100000037 | 3300026118 | Bacteria | 93479 |
| 657 | Ga0207675_100208345 | 3300026118 | Bacteria | 1880 |
| 658 | Ga0207675_101240442 | 3300026118 | Bacteria | 766 |
| 659 | Ga0207675_101749155 | 3300026118 | Bacteria | 641 |
| 660 | Ga0207675_102051990 | 3300026118 | Bacteria | 589 |
| 661 | Ga0207683_10000506 | 3300026121 | Bacteria | 35979 |
| 662 | Ga0207683_10218366 | 3300026121 | Bacteria | 1737 |
| 663 | Ga0207683_10448030 | 3300026121 | Bacteria | 1190 |
| 664 | Ga0207683_11197926 | 3300026121 | Bacteria | 704 |
| 665 | Ga0207683_11644140 | 3300026121 | Bacteria | 592 |
| 666 | Ga0207683_12021902 | 3300026121 | Bacteria | 525 |
| 667 | Ga0207698_10001702 | 3300026142 | Bacteria | 12820 |
| 668 | Ga0209967_1032069 | 3300027364 | Bacteria | 787 |
| 669 | Ga0209984_1061099 | 3300027424 | Bacteria | 558 |
| 670 | Ga0210002_1033805 | 3300027617 | Bacteria | 856 |
| 671 | Ga0209983_1088459 | 3300027665 | Bacteria | 697 |
| 672 | Ga0209588_1229479 | 3300027671 | Bacteria | 572 |
| 673 | Ga0209971_1121391 | 3300027682 | Bacteria | 643 |
| 674 | Ga0209998_10182524 | 3300027717 | Bacteria | 546 |
| 675 | Ga0209974_10225013 | 3300027876 | Bacteria | 699 |
| 676 | Ga0209974_10242946 | 3300027876 | Bacteria | 676 |
| 677 | Ga0207428_10000004 | 3300027907 | Bacteria | 727800 |
| 678 | Ga0207428_10030983 | 3300027907 | Bacteria | 4419 |
| 679 | Ga0207428_10054932 | 3300027907 | Bacteria | 3169 |
| 680 | Ga0207428_10367852 | 3300027907 | Bacteria | 1056 |
| 681 | Ga0268266_10000156 | 3300028379 | Bacteria | 128575 |
| 682 | Ga0268266_11138777 | 3300028379 | Bacteria | 755 |
| 683 | Ga0268266_11735628 | 3300028379 | Bacteria | 599 |
| 684 | Ga0268265_10000855 | 3300028380 | Bacteria | 28534 |
| 685 | Ga0268265_10038559 | 3300028380 | Bacteria | 3515 |
| 686 | Ga0268265_10186346 | 3300028380 | Bacteria | 1788 |
| 687 | Ga0268265_11145116 | 3300028380 | Bacteria | 774 |
| 688 | Ga0268265_11223607 | 3300028380 | Bacteria | 749 |
| 689 | Ga0268265_12349821 | 3300028380 | Bacteria | 540 |
| 690 | Ga0268264_10000090 | 3300028381 | Bacteria | 234383 |
| 691 | Ga0268264_10277661 | 3300028381 | Bacteria | 1568 |
| 692 | Ga0268264_10336024 | 3300028381 | Bacteria | 1433 |
| 693 | Ga0268264_11289779 | 3300028381 | Bacteria | 740 |
| 694 | Ga0268264_11880225 | 3300028381 | Bacteria | 608 |
| 695 | Ga0265332_10200700 | 3300031238 | Bacteria | 829 |
| 696 | Ga0265331_10215794 | 3300031250 | Bacteria | 863 |
| 697 | Ga0265316_10164478 | 3300031344 | Bacteria | 1658 |
| 698 | Ga0307408_100239976 | 3300031548 | Bacteria | 1489 |
| 699 | Ga0307408_100307082 | 3300031548 | Bacteria | 1331 |
| 700 | Ga0316576_10185680 | 3300031727 | Bacteria | 1568 |
| 701 | Ga0307405_10838037 | 3300031731 | Bacteria | 773 |
| 702 | Ga0307405_11462002 | 3300031731 | Bacteria | 599 |
| 703 | Ga0307413_11382370 | 3300031824 | Bacteria | 619 |
| 704 | Ga0307406_10830787 | 3300031901 | Bacteria | 782 |
| 705 | Ga0307406_11988421 | 3300031901 | Bacteria | 519 |
| 706 | Ga0307407_10461032 | 3300031903 | Bacteria | 924 |
| 707 | Ga0307407_10632376 | 3300031903 | Bacteria | 800 |
| 708 | Ga0307407_11579761 | 3300031903 | Bacteria | 520 |
| 709 | Ga0307412_11876898 | 3300031911 | Bacteria | 552 |
| 710 | Ga0307409_100099346 | 3300031995 | Bacteria | 2410 |
| 711 | Ga0307409_101705155 | 3300031995 | Bacteria | 659 |
| 712 | Ga0307409_101915690 | 3300031995 | Bacteria | 622 |
| 713 | Ga0307409_102762325 | 3300031995 | Bacteria | 519 |
| 714 | Ga0307416_100847193 | 3300032002 | Bacteria | 1012 |
| 715 | Ga0307416_100919822 | 3300032002 | Bacteria | 975 |
| 716 | Ga0307416_101039903 | 3300032002 | Bacteria | 923 |
| 717 | Ga0307416_102243701 | 3300032002 | Bacteria | 647 |
| 718 | Ga0307411_10865099 | 3300032005 | Bacteria | 801 |
| 719 | Ga0307415_100637849 | 3300032126 | Bacteria | 953 |
| 720 | Ga0307415_100661168 | 3300032126 | Bacteria | 938 |
| 721 | Ga0316580_10230074 | 3300032139 | Bacteria | 572 |
| 722 | Ga0373958_0118957 | 3300034819 | Bacteria | 637 |
| 723 | Ga0373926_0095583 | 3300035083 | Bacteria | 1108 |
| 724 | Ga0373929_0057286 | 3300035085 | Bacteria | 905 |
| 725 | Ga0373934_0108730 | 3300035086 | Bacteria | 1124 |
| 726 | Ga0373934_0110993 | 3300035086 | Bacteria | 1112 |
| 727 | Ga0373940_0261932 | 3300035088 | Bacteria | 586 |
| 728 | Ga0373949_0263861 | 3300035090 | Bacteria | 536 |
| 729 | Ga0373923_0707967 | 3300035111 | Bacteria | 500 |
| 730 | Ga0373932_0365339 | 3300035112 | Bacteria | 552 |
| 731 | Ga0373941_0043987 | 3300035115 | Bacteria | 1392 |
| 732 | Ga0373953_0121062 | 3300035117 | Bacteria | 1111 |
| 733 | Ga0373954_0004418 | 3300035118 | Bacteria | 6051 |
| 734 | Ga0373956_0004023 | 3300035119 | Bacteria | 5906 |
| 735 | Ga0373957_0242027 | 3300035120 | Bacteria | 758 |
| 736 | Ga0373960_0257277 | 3300035121 | Bacteria | 636 |
| 737 | Ga0373960_0291862 | 3300035121 | Bacteria | 604 |
| 738 | Ga0373960_0422008 | 3300035121 | Bacteria | 518 |
| 739 | Ga0373955_0071638 | 3300035172 | Bacteria | 1939 |
| 740 | Ga0373955_0641886 | 3300035172 | Bacteria | 651 |
| 741 | Ga0373924_0175712 | 3300035410 | Bacteria | 942 |
| 742 | Ga0373935_0588040 | 3300035692 | Bacteria | 813 |
| 743 | Ga0373927_0046192 | 3300035695 | Bacteria | 2818 |
| 744 | Ga0373937_0131705 | 3300036401 | Bacteria | 2335 |
| 745 | Ga0373937_1316823 | 3300036401 | Bacteria | 670 |
| 746 | Ga0316582_0473590 | 3300036647 | Bacteria | 863 |
| 747 | Ga0400491_05839 | 3300038727 | Bacteria | 2221 |
| 748 | Ga0436365_0792880 | 3300039437 | Bacteria | 600 |
| 749 | Ga0436363_1539500 | 3300039450 | Bacteria | 1630 |
| 750 | Ga0439453_0023785 | 3300041408 | Bacteria | 1120 |
| 751 | Ga0439461_0023618 | 3300041410 | Bacteria | 1238 |
| 752 | Ga0451791_0576223 | 3300041451 | Bacteria | 786 |
| 753 | Ga0451791_0601765 | 3300041451 | Bacteria | 778 |
| 754 | Ga0451798_0553446 | 3300041458 | Bacteria | 746 |
| 755 | Ga0451837_0776061 | 3300041494 | Bacteria | 578 |
| 756 | Ga0451845_0569374 | 3300041501 | Bacteria | 669 |
| 757 | Ga0451845_0705662 | 3300041501 | Bacteria | 804 |
| 758 | Ga0451848_10600 | 3300041504 | Bacteria | 500 |
| 759 | Ga0451853_3373278 | 3300041512 | Bacteria | 1065 |
| 760 | Ga0439433_0067066 | 3300041999 | Bacteria | 861 |
| 761 | Ga0439448_0182765 | 3300042005 | Bacteria | 733 |
| 762 | Ga0439451_036312 | 3300042009 | Bacteria | 991 |
| 763 | Ga0439454_047718 | 3300042011 | Bacteria | 716 |
| 764 | Ga0439455_0028811 | 3300042012 | Bacteria | 1369 |
| 765 | Ga0439457_061005 | 3300042014 | Bacteria | 854 |
| 766 | Ga0439462_0157175 | 3300042015 | Bacteria | 640 |
| 767 | Ga0450912_022375 | 3300042116 | Bacteria | 619 |
| 768 | Ga0450920_003080 | 3300042122 | Bacteria | 2877 |
| 769 | Ga0450923_001669 | 3300042125 | Bacteria | 3012 |
| 770 | Ga0450894_000786 | 3300042131 | Bacteria | 5166 |
| 771 | Ga0450895_000378 | 3300042132 | Bacteria | 2465 |
| 772 | Ga0450895_012963 | 3300042132 | Bacteria | 729 |
| 773 | Ga0450896_009967 | 3300042133 | Bacteria | 1329 |
| 774 | Ga0450899_011216 | 3300042135 | Bacteria | 998 |
| 775 | Ga0439446_0002581 | 3300042156 | Bacteria | 4366 |
| 776 | Ga0439446_0208736 | 3300042156 | Bacteria | 662 |
| 777 | Ga0450908_020949 | 3300042184 | Bacteria | 1148 |
| 778 | Ga0439434_0002754 | 3300042435 | Bacteria | 5122 |
| 779 | Ga0439435_0014359 | 3300042436 | Bacteria | 1956 |
| 780 | Ga0439459_0029157 | 3300042438 | Bacteria | 1112 |
| 781 | Ga0439464_0225796 | 3300042439 | Bacteria | 601 |
| 782 | Ga0439460_0377211 | 3300042461 | Bacteria | 502 |
| 783 | Ga0451577_0498262 | 3300042876 | Bacteria | 1106 |
| 784 | Ga0451577_0636787 | 3300042876 | Bacteria | 967 |
| 785 | Ga0453683_0053588 | 3300044673 | Bacteria | 2524 |
| 786 | Ga0453683_0096485 | 3300044673 | Bacteria | 1855 |
| 787 | Ga0453683_0401546 | 3300044673 | Bacteria | 883 |
| 788 | Ga0453683_0634480 | 3300044673 | Bacteria | 698 |
| 789 | Ga0453684_0024329 | 3300044712 | Bacteria | 8857 |
| 790 | Ga0453684_0115797 | 3300044712 | Bacteria | 3247 |
| 791 | Ga0453684_0138714 | 3300044712 | Bacteria | 2907 |
| 792 | Ga0453684_0453090 | 3300044712 | Bacteria | 1428 |
| 793 | Ga0451576_0026098 | 3300045051 | Bacteria | 6285 |
| 794 | Ga0451576_0171103 | 3300045051 | Bacteria | 2267 |
| 795 | Ga0451576_0358412 | 3300045051 | Bacteria | 1527 |
| 796 | Ga0451576_0659526 | 3300045051 | Bacteria | 1099 |
| 797 | Ga0451576_0907465 | 3300045051 | Bacteria | 924 |
| 798 | Ga0451576_1491830 | 3300045051 | Bacteria | 702 |
| 799 | Ga0451576_2557255 | 3300045051 | Bacteria | 521 |
| 800 | Ga0495603_0275351 | 3300046455 | Bacteria | 968 |
| 801 | Ga0495629_0421594 | 3300046459 | Bacteria | 906 |
| 802 | Ga0495651_0919944 | 3300046462 | Bacteria | 534 |
| 803 | Ga0495580_0802896 | 3300046472 | Bacteria | 610 |
| 804 | Ga0495664_0938036 | 3300046477 | Bacteria | 505 |
| 805 | Ga0495630_1062220 | 3300046517 | Bacteria | 614 |
| 806 | Ga0495663_0098784 | 3300046525 | Bacteria | 959 |
| 807 | Ga0495586_0488388 | 3300046535 | Bacteria | 710 |
| 808 | Ga0495609_0309350 | 3300046538 | Bacteria | 642 |
| 809 | Ga0495668_0530353 | 3300046616 | Bacteria | 649 |
| 810 | Ga0495634_0041616 | 3300046642 | Bacteria | 3120 |
| 811 | Ga0495658_0068988 | 3300046683 | Bacteria | 2048 |
| 812 | Ga0495658_0815812 | 3300046683 | Bacteria | 597 |
| 813 | Ga0495613_0526537 | 3300046689 | Bacteria | 793 |
| 814 | Ga0495670_0416147 | 3300046691 | Bacteria | 727 |
| 815 | Ga0495636_0267158 | 3300047318 | Bacteria | 794 |
| 816 | Ga0495672_0002464 | 3300047320 | Bacteria | 17011 |
| 817 | Ga0495685_291208 | 3300047447 | Bacteria | 514 |
| 818 | Ga0495614_0199635 | 3300048089 | Bacteria | 905 |
| 819 | Ga0495626_0374905 | 3300048091 | Bacteria | 553 |
| 820 | Ga0496100_0793316 | 3300048903 | Bacteria | 742 |
| 821 | Ga0496100_1084499 | 3300048903 | Bacteria | 631 |
| 822 | Ga0496101_0574208 | 3300048904 | Bacteria | 892 |
| 823 | Ga0496102_0521311 | 3300048905 | Bacteria | 1111 |
| 824 | Ga0496103_0747079 | 3300048906 | Bacteria | 619 |
| 825 | Ga0496104_0004897 | 3300048907 | Bacteria | 11678 |
| 826 | Ga0496105_0311917 | 3300048908 | Bacteria | 1263 |
| 827 | Ga0496107_0489041 | 3300048910 | Bacteria | 913 |
| 828 | Ga0496108_0000658 | 3300048911 | Bacteria | 26635 |
| 829 | Ga0496109_0011768 | 3300048912 | Bacteria | 7529 |
| 830 | Ga0496109_0095825 | 3300048912 | Bacteria | 2748 |
| 831 | Ga0496109_0688905 | 3300048912 | Bacteria | 959 |
| 832 | Ga0496109_0881463 | 3300048912 | Bacteria | 833 |
| 833 | Ga0496110_0033880 | 3300048913 | Bacteria | 4420 |
| 834 | Ga0496110_1155401 | 3300048913 | Bacteria | 683 |
| 835 | Ga0496110_1836776 | 3300048913 | Bacteria | 516 |
| 836 | Ga0496112_0009883 | 3300048915 | Bacteria | 8625 |
| 837 | Ga0496112_0545395 | 3300048915 | Bacteria | 1094 |
| 838 | Ga0496112_0554222 | 3300048915 | Bacteria | 1083 |
| 839 | Ga0496113_1135973 | 3300048916 | Bacteria | 612 |
| 840 | Ga0496125_0751795 | 3300048928 | Bacteria | 511 |
| 841 | Ga0501306_044899 | 3300049127 | Bacteria | 695 |
| 842 | Ga0501309_015734 | 3300049129 | Bacteria | 1026 |
| 843 | Ga0501305_097530 | 3300049161 | Bacteria | 544 |
| 844 | Ga0501292_067738 | 3300049515 | Bacteria | 659 |
| 845 | Ga0501312_110697 | 3300049528 | Bacteria | 523 |
| 846 | Ga0501313_040458 | 3300049529 | Bacteria | 625 |
| 847 | Ga0501315_103948 | 3300049531 | Bacteria | 504 |
| 848 | Ga0501318_015245 | 3300049534 | Bacteria | 916 |
| 849 | Ga0501319_009823 | 3300049535 | Bacteria | 754 |
| 850 | Ga0501321_027855 | 3300049537 | Bacteria | 740 |
| 851 | Ga0501321_029343 | 3300049537 | Bacteria | 727 |
| 852 | Ga0501323_074601 | 3300049539 | Bacteria | 547 |
| 853 | Ga0501325_018991 | 3300049541 | Bacteria | 709 |
| 854 | Ga0501031_0171039 | 3300049568 | Bacteria | 1420 |
| 855 | Ga0501031_0285866 | 3300049568 | Bacteria | 1069 |
| 856 | Ga0501031_0571448 | 3300049568 | Bacteria | 728 |
| 857 | Ga0501032_0040830 | 3300049569 | Bacteria | 3152 |
| 858 | Ga0501033_0636794 | 3300049570 | Bacteria | 729 |
| 859 | Ga0501033_1096856 | 3300049570 | Bacteria | 529 |
| 860 | Ga0501034_0037393 | 3300049571 | Bacteria | 4914 |
| 861 | Ga0501034_0096601 | 3300049571 | Bacteria | 2950 |
| 862 | Ga0501034_0112215 | 3300049571 | Bacteria | 2716 |
| 863 | Ga0501036_0067215 | 3300049572 | Bacteria | 3032 |
| 864 | Ga0501036_0328612 | 3300049572 | Bacteria | 1277 |
| 865 | Ga0501036_0754311 | 3300049572 | Bacteria | 803 |
| 866 | Ga0501036_0835578 | 3300049572 | Bacteria | 757 |
| 867 | Ga0501036_1691777 | 3300049572 | Bacteria | 510 |
| 868 | Ga0501037_0120192 | 3300049573 | Bacteria | 1889 |
| 869 | Ga0501037_0287476 | 3300049573 | Bacteria | 1144 |
| 870 | Ga0501037_0429266 | 3300049573 | Bacteria | 904 |
| 871 | Ga0501037_0609759 | 3300049573 | Bacteria | 732 |
| 872 | Ga0501038_0012873 | 3300049574 | Bacteria | 7634 |
| 873 | Ga0501038_0105891 | 3300049574 | Bacteria | 2335 |
| 874 | Ga0501038_0449695 | 3300049574 | Bacteria | 991 |
| 875 | Ga0501039_0313832 | 3300049575 | Bacteria | 1232 |
| 876 | Ga0501039_0365469 | 3300049575 | Bacteria | 1133 |
| 877 | Ga0501039_1355157 | 3300049575 | Bacteria | 548 |
| 878 | Ga0501040_0006547 | 3300049576 | Bacteria | 7562 |
| 879 | Ga0501040_0876652 | 3300049576 | Bacteria | 650 |
| 880 | Ga0501040_1006733 | 3300049576 | Bacteria | 604 |
| 881 | Ga0501041_0014846 | 3300049577 | Bacteria | 4624 |
| 882 | Ga0501041_0030844 | 3300049577 | Bacteria | 3236 |
| 883 | Ga0501041_0343112 | 3300049577 | Bacteria | 943 |
| 884 | Ga0501042_0039517 | 3300049578 | Bacteria | 3353 |
| 885 | Ga0501042_0100169 | 3300049578 | Bacteria | 2083 |
| 886 | Ga0501042_0181118 | 3300049578 | Bacteria | 1520 |
| 887 | Ga0501042_0309575 | 3300049578 | Bacteria | 1141 |
| 888 | Ga0501042_0458589 | 3300049578 | Bacteria | 924 |
| 889 | Ga0501042_0500644 | 3300049578 | Bacteria | 882 |
| 890 | Ga0501042_0565847 | 3300049578 | Bacteria | 826 |
| 891 | Ga0501042_1367850 | 3300049578 | Bacteria | 516 |
| 892 | Ga0501043_0027314 | 3300049579 | Bacteria | 4481 |
| 893 | Ga0501043_0038310 | 3300049579 | Bacteria | 3769 |
| 894 | Ga0501043_0189802 | 3300049579 | Bacteria | 1598 |
| 895 | Ga0501046_0002275 | 3300049580 | Bacteria | 18106 |
| 896 | Ga0501046_0176973 | 3300049580 | Bacteria | 1597 |
| 897 | Ga0501046_0199609 | 3300049580 | Bacteria | 1489 |
| 898 | Ga0501046_0390831 | 3300049580 | Bacteria | 1006 |
| 899 | Ga0501046_1051855 | 3300049580 | Bacteria | 564 |
| 900 | Ga0501046_1140300 | 3300049580 | Bacteria | 537 |
| 901 | Ga0501047_0025147 | 3300049581 | Bacteria | 5720 |
| 902 | Ga0501047_0184413 | 3300049581 | Bacteria | 1952 |
| 903 | Ga0501047_0466493 | 3300049581 | Bacteria | 1091 |
| 904 | Ga0501048_0179363 | 3300049582 | Bacteria | 1501 |
| 905 | Ga0501048_0197876 | 3300049582 | Bacteria | 1424 |
| 906 | Ga0501048_0401275 | 3300049582 | Bacteria | 980 |
| 907 | Ga0501048_0707647 | 3300049582 | Bacteria | 723 |
| 908 | Ga0501048_1238148 | 3300049582 | Bacteria | 537 |
| 909 | Ga0501048_1357835 | 3300049582 | Bacteria | 511 |
| 910 | Ga0501067_0157007 | 3300049583 | Bacteria | 1267 |
| 911 | Ga0501068_0594834 | 3300049584 | Bacteria | 721 |
| 912 | Ga0501068_1107826 | 3300049584 | Bacteria | 524 |
| 913 | Ga0501069_0710597 | 3300049585 | Bacteria | 606 |
| 914 | Ga0501069_0944057 | 3300049585 | Bacteria | 526 |
| 915 | Ga0501071_0018416 | 3300049587 | Bacteria | 4834 |
| 916 | Ga0501071_0067056 | 3300049587 | Bacteria | 2609 |
| 917 | Ga0501071_0925038 | 3300049587 | Bacteria | 673 |
| 918 | Ga0501072_0128959 | 3300049588 | Bacteria | 2015 |
| 919 | Ga0501072_0247455 | 3300049588 | Bacteria | 1420 |
| 920 | Ga0501072_0694870 | 3300049588 | Bacteria | 800 |
| 921 | Ga0501072_0780570 | 3300049588 | Bacteria | 749 |
| 922 | Ga0501072_0800186 | 3300049588 | Bacteria | 738 |
| 923 | Ga0501072_0807251 | 3300049588 | Bacteria | 735 |
| 924 | Ga0501072_0874141 | 3300049588 | Bacteria | 703 |
| 925 | Ga0501072_1264405 | 3300049588 | Bacteria | 572 |
| 926 | Ga0501073_0233769 | 3300049589 | Bacteria | 1269 |
| 927 | Ga0501074_0150139 | 3300049590 | Bacteria | 1666 |
| 928 | Ga0501074_0185176 | 3300049590 | Bacteria | 1485 |
| 929 | Ga0501074_0374671 | 3300049590 | Bacteria | 1010 |
| 930 | Ga0501075_0544097 | 3300049591 | Bacteria | 886 |
| 931 | Ga0501075_0571092 | 3300049591 | Bacteria | 863 |
| 932 | Ga0501075_1427584 | 3300049591 | Bacteria | 524 |
| 933 | Ga0501076_0002067 | 3300049592 | Bacteria | 13745 |
| 934 | Ga0501076_0015943 | 3300049592 | Bacteria | 5687 |
| 935 | Ga0501076_0165987 | 3300049592 | Bacteria | 1799 |
| 936 | Ga0501076_0193268 | 3300049592 | Bacteria | 1661 |
| 937 | Ga0501076_0297024 | 3300049592 | Bacteria | 1324 |
| 938 | Ga0501076_0638679 | 3300049592 | Bacteria | 878 |
| 939 | Ga0501076_1207689 | 3300049592 | Bacteria | 622 |
| 940 | Ga0501076_1210229 | 3300049592 | Bacteria | 622 |
| 941 | Ga0501077_0009857 | 3300049593 | Bacteria | 5943 |
| 942 | Ga0501077_0726427 | 3300049593 | Bacteria | 638 |
| 943 | Ga0501077_0817668 | 3300049593 | Bacteria | 599 |
| 944 | Ga0501217_295153 | 3300049661 | Bacteria | 534 |
| 945 | Ga0501225_0129961 | 3300049705 | Bacteria | 754 |
| 946 | Ga0501079_0001902 | 3300049741 | Bacteria | 14973 |
| 947 | Ga0501079_0053819 | 3300049741 | Bacteria | 3105 |
| 948 | Ga0501079_0365763 | 3300049741 | Bacteria | 1130 |
| 949 | Ga0501079_0734069 | 3300049741 | Bacteria | 777 |
| 950 | Ga0501079_1005604 | 3300049741 | Bacteria | 657 |
| 951 | Ga0501079_1487773 | 3300049741 | Bacteria | 533 |
| 952 | Ga0501080_0149023 | 3300049742 | Bacteria | 2163 |
| 953 | Ga0501080_0198283 | 3300049742 | Bacteria | 1843 |
| 954 | Ga0501081_0001000 | 3300049743 | Bacteria | 16843 |
| 955 | Ga0501081_0160123 | 3300049743 | Bacteria | 1622 |
| 956 | Ga0501081_0173194 | 3300049743 | Bacteria | 1559 |
| 957 | Ga0501081_0769329 | 3300049743 | Bacteria | 724 |
| 958 | Ga0501081_0829009 | 3300049743 | Bacteria | 696 |
| 959 | Ga0501083_0046353 | 3300049744 | Bacteria | 2939 |
| 960 | Ga0501083_0163514 | 3300049744 | Bacteria | 1455 |
| 961 | Ga0501274_027122 | 3300049771 | Bacteria | 628 |
| 962 | Ga0501035_0000901 | 3300049822 | Bacteria | 31399 |
| 963 | Ga0501035_0236442 | 3300049822 | Bacteria | 1555 |
| 964 | Ga0501035_0503293 | 3300049822 | Bacteria | 997 |
| 965 | Ga0501035_0842153 | 3300049822 | Bacteria | 730 |
| 966 | Ga0501035_0842737 | 3300049822 | Bacteria | 730 |
| 967 | Ga0501044_0245704 | 3300049823 | Bacteria | 1732 |
| 968 | Ga0501045_0206499 | 3300049824 | Bacteria | 1463 |
| 969 | Ga0501045_0217869 | 3300049824 | Bacteria | 1422 |
| 970 | Ga0501045_0293769 | 3300049824 | Bacteria | 1209 |
| 971 | Ga0501045_0361671 | 3300049824 | Bacteria | 1080 |
| 972 | Ga0501045_0983307 | 3300049824 | Bacteria | 619 |
| 973 | nmdc:mga03683_183227_c1 | 3300050489 | Bacteria | 956 |
| 974 | nmdc:mga06z11_95702_c1 | 3300050494 | Bacteria | 1620 |
| 975 | nmdc:mga07m45_639155_c1 | 3300050496 | Bacteria | 613 |
| 976 | nmdc:mga05p37_117437_c1 | 3300050507 | Bacteria | 3269 |
| 977 | nmdc:mga05p37_1232308_c1 | 3300050507 | Bacteria | 770 |
| 978 | nmdc:mga05p37_174_c1 | 3300050507 | Bacteria | 62666 |
| 979 | nmdc:mga05p37_200209_c1 | 3300050507 | Bacteria | 2419 |
| 980 | nmdc:mga09592_1358389_c1 | 3300050508 | Bacteria | 582 |
| 981 | nmdc:mga09592_51946_c1 | 3300050508 | Bacteria | 3458 |
| 982 | nmdc:mga09592_708228_c1 | 3300050508 | Bacteria | 856 |
| 983 | nmdc:mga09592_926749_c1 | 3300050508 | Bacteria | 731 |
| 984 | nmdc:mga0qj67_732324_c1 | 3300050509 | Bacteria | 785 |
| 985 | nmdc:mga0qj67_797599_c1 | 3300050509 | Bacteria | 748 |
| 986 | nmdc:mga06r32_191119_c1 | 3300050510 | Bacteria | 2035 |
| 987 | nmdc:mga06r32_214748_c1 | 3300050510 | Bacteria | 1911 |
| 988 | nmdc:mga06r32_881431_c1 | 3300050510 | Bacteria | 852 |
| 989 | nmdc:mga08y16_128140_c1 | 3300050511 | Bacteria | 2640 |
| 990 | nmdc:mga08y16_1538_c1 | 3300050511 | Bacteria | 23197 |
| 991 | nmdc:mga08y16_26595_c1 | 3300050511 | Bacteria | 6100 |
| 992 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 993 | nmdc:mga08y16_3103_c1 | 3300050511 | Bacteria | 17195 |
| 994 | nmdc:mga08y16_767182_c1 | 3300050511 | Bacteria | 959 |
| 995 | nmdc:mga0n895_1015863_c1 | 3300050512 | Bacteria | 810 |
| 996 | nmdc:mga0n895_1111214_c1 | 3300050512 | Bacteria | 767 |
| 997 | nmdc:mga0n895_125267_c1 | 3300050512 | Bacteria | 2593 |
| 998 | nmdc:mga0n895_44765_c1 | 3300050512 | Bacteria | 4316 |
| 999 | nmdc:mga0n895_681698_c1 | 3300050512 | Bacteria | 1025 |
| 1000 | nmdc:mga0n895_685089_c1 | 3300050512 | Bacteria | 1022 |
| 1001 | nmdc:mga0n895_846321_c1 | 3300050512 | Bacteria | 903 |
| 1002 | nmdc:mga0rr50_1362613_c1 | 3300050513 | Bacteria | 601 |
| 1003 | nmdc:mga0rr50_330267_c1 | 3300050513 | Bacteria | 1280 |
| 1004 | nmdc:mga0rr50_52386_c1 | 3300050513 | Bacteria | 3033 |
| 1005 | nmdc:mga0rr50_827335_c1 | 3300050513 | Bacteria | 790 |
| 1006 | nmdc:mga08x19_11737_c1 | 3300050514 | Bacteria | 5276 |
| 1007 | nmdc:mga08x19_382385_c1 | 3300050514 | Bacteria | 986 |
| 1008 | nmdc:mga08x19_460310_c1 | 3300050514 | Bacteria | 896 |
| 1009 | nmdc:mga0a205_1098745_c1 | 3300050515 | Bacteria | 643 |
| 1010 | nmdc:mga0a205_183324_c1 | 3300050515 | Bacteria | 1987 |
| 1011 | nmdc:mga0a205_206237_c1 | 3300050515 | Bacteria | 1855 |
| 1012 | nmdc:mga0a205_606744_c1 | 3300050515 | Bacteria | 947 |
| 1013 | Ga0495601_0715683 | 3300053077 | Bacteria | 638 |
| 1014 | Ga0495601_0734447 | 3300053077 | Bacteria | 629 |
| 1015 | Ga0495612_0216178 | 3300053078 | Bacteria | 848 |
| 1016 | Ga0495595_0602330 | 3300053084 | Bacteria | 562 |
| 1017 | Ga0500555_074997 | 3300053103 | Bacteria | 887 |
| 1018 | Ga0500593_195985 | 3300053117 | Bacteria | 734 |
| 1019 | Ga0500652_038557 | 3300053131 | Bacteria | 1912 |
| 1020 | Ga0501084_0013715 | 3300054114 | Bacteria | 6708 |
| 1021 | Ga0501084_0028474 | 3300054114 | Bacteria | 4670 |
| 1022 | Ga0501084_0051048 | 3300054114 | Bacteria | 3461 |
| 1023 | Ga0501084_0410611 | 3300054114 | Bacteria | 1144 |
| 1024 | Ga0501084_0508714 | 3300054114 | Bacteria | 1018 |
| 1025 | Ga0501084_0979122 | 3300054114 | Bacteria | 711 |
| 1026 | Ga0501084_1116090 | 3300054114 | Bacteria | 662 |
| 1027 | Ga0590071_051739 | 3300059421 | Bacteria | 997 |
| 1028 | Ga0590075_044273 | 3300059424 | Bacteria | 1139 |
| 1029 | Ga0590077_001873 | 3300059426 | Bacteria | 4670 |
| 1030 | Ga0587084_067786 | 3300059477 | Bacteria | 668 |
| 1031 | Ga0587066_187893 | 3300059490 | Bacteria | 536 |
| 1032 | Ga0587077_053157 | 3300059493 | Bacteria | 854 |
| 1033 | Ga0587083_0101888 | 3300059505 | Bacteria | 716 |
| 1034 | Ga0587091_084709 | 3300059511 | Bacteria | 718 |
| 1035 | Ga0587092_060075 | 3300059512 | Bacteria | 709 |
| 1036 | Ga0587098_004049 | 3300059604 | Bacteria | 1357 |
| 1037 | Ga0587125_011106 | 3300059607 | Bacteria | 940 |
| 1038 | Ga0587101_025346 | 3300059623 | Bacteria | 888 |
| 1039 | Ga0587109_052056 | 3300059624 | Bacteria | 842 |
| 1040 | Ga0587062_138704 | 3300059639 | Bacteria | 506 |
| 1041 | Ga0587067_110345 | 3300059640 | Bacteria | 648 |
| 1042 | Ga0587072_017653 | 3300059643 | Bacteria | 1232 |
| 1043 | Ga0587107_091275 | 3300059652 | Bacteria | 589 |
| 1044 | Ga0587111_0047244 | 3300060346 | Bacteria | 938 |
| 1045 | Ga0587111_0227301 | 3300060346 | Bacteria | 542 |
| 1046 | Ga0501082_0001088 | 3300060353 | Bacteria | 24065 |
| 1047 | Ga0501082_0036253 | 3300060353 | Bacteria | 4249 |
| 1048 | Ga0501082_0232190 | 3300060353 | Bacteria | 1605 |
| 1049 | Ga0501082_0237293 | 3300060353 | Bacteria | 1587 |
| 1050 | Ga0530510_0024932 | 3300061734 | Bacteria | 4274 |
| 1051 | Ga0530510_0029412 | 3300061734 | Bacteria | 3943 |
| 1052 | Ga0530510_0251002 | 3300061734 | Bacteria | 1318 |
| 1053 | Ga0530510_0284775 | 3300061734 | Bacteria | 1235 |
| 1054 | Ga0530510_1039631 | 3300061734 | Bacteria | 627 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002244 | JGI24742J22300_10123144 | JGI24742J22300_101231442 | 43 |
| 2 | 3300003322 | rootL2_10015190 | rootL2_100151901 | 43 |
| 3 | 3300005293 | Ga0065715_10919226 | Ga0065715_109192262 | 43 |
| 4 | 3300005295 | Ga0065707_11098298 | Ga0065707_110982983 | 43 |
| 5 | 3300005331 | Ga0070670_101031600 | Ga0070670_1010316002 | 43 |
| 6 | 3300005333 | Ga0070677_10248660 | Ga0070677_102486602 | 43 |
| 7 | 3300005335 | Ga0070666_10039674 | Ga0070666_100396744 | 43 |
| 8 | 3300005347 | Ga0070668_101417960 | Ga0070668_1014179602 | 43 |
| 9 | 3300005353 | Ga0070669_100166876 | Ga0070669_1001668762 | 43 |
| 10 | 3300005354 | Ga0070675_101538363 | Ga0070675_1015383631 | 43 |
| 11 | 3300005356 | Ga0070674_100404224 | Ga0070674_1004042242 | 43 |
| 12 | 3300005367 | Ga0070667_100855240 | Ga0070667_1008552402 | 43 |
| 13 | 3300005456 | Ga0070678_100150458 | Ga0070678_1001504582 | 43 |
| 14 | 3300005457 | Ga0070662_100160245 | Ga0070662_1001602452 | 43 |
| 15 | 3300005459 | Ga0068867_102344089 | Ga0068867_1023440892 | 43 |
| 16 | 3300005539 | Ga0068853_100874452 | Ga0068853_1008744523 | 43 |
| 17 | 3300005564 | Ga0070664_101470377 | Ga0070664_1014703772 | 43 |
| 18 | 3300005564 | Ga0070664_101582707 | Ga0070664_1015827072 | 43 |
| 19 | 3300005577 | Ga0068857_101448132 | Ga0068857_1014481322 | 43 |
| 20 | 3300005578 | Ga0068854_100421747 | Ga0068854_1004217472 | 43 |
| 21 | 3300005616 | Ga0068852_101346269 | Ga0068852_1013462692 | 43 |
| 22 | 3300005719 | Ga0068861_100270266 | Ga0068861_1002702662 | 43 |
| 23 | 3300005842 | Ga0068858_101741107 | Ga0068858_1017411072 | 43 |
| 24 | 3300005981 | Ga0081538_10128689 | Ga0081538_101286892 | 43 |
| 25 | 3300006038 | Ga0075365_10018282 | Ga0075365_100182826 | 43 |
| 26 | 3300006195 | Ga0075366_10940781 | Ga0075366_109407812 | 43 |
| 27 | 3300006871 | Ga0075434_100081239 | Ga0075434_1000812391 | 43 |
| 28 | 3300006881 | Ga0068865_101512768 | Ga0068865_1015127682 | 43 |
| 29 | 3300013306 | Ga0163162_11547671 | Ga0163162_115476711 | 43 |
| 30 | 3300014325 | Ga0163163_11176712 | Ga0163163_111767122 | 43 |
| 31 | 3300014497 | Ga0182008_10955012 | Ga0182008_109550121 | 43 |
| 32 | 3300042011 | Ga0439454_047718 | Ga0439454_047718_552_701 | 43 |
| 33 | 3300049577 | Ga0501041_0343112 | Ga0501041_0343112_143_292 | 43 |
| 34 | 3300049578 | Ga0501042_0458589 | Ga0501042_0458589_682_831 | 43 |
| 35 | 3300049580 | Ga0501046_1051855 | Ga0501046_1051855_23_172 | 43 |
| 36 | 3300049584 | Ga0501068_1107826 | Ga0501068_1107826_354_503 | 43 |
| 37 | 3300049587 | Ga0501071_0067056 | Ga0501071_0067056_864_1013 | 43 |
| 38 | 3300049588 | Ga0501072_0780570 | Ga0501072_0780570_460_609 | 43 |
| 39 | 3300049590 | Ga0501074_0185176 | Ga0501074_0185176_456_605 | 43 |
| 40 | 3300049592 | Ga0501076_0015943 | Ga0501076_0015943_1894_2043 | 43 |
| 41 | 3300049741 | Ga0501079_0053819 | Ga0501079_0053819_668_817 | 43 |
| 42 | 3300049824 | Ga0501045_0206499 | Ga0501045_0206499_527_676 | 43 |
| 43 | 3300054114 | Ga0501084_0508714 | Ga0501084_0508714_51_200 | 43 |
| 44 | 3300060353 | Ga0501082_0237293 | Ga0501082_0237293_684_833 | 43 |
| 45 | 3300002070 | JGI24750J21931_1010309 | JGI24750J21931_10103094 | 44 |
| 46 | 3300005367 | Ga0070667_101332600 | Ga0070667_1013326001 | 44 |
| 47 | 3300005438 | Ga0070701_10220990 | Ga0070701_102209902 | 44 |
| 48 | 3300005546 | Ga0070696_100265354 | Ga0070696_1002653541 | 44 |
| 49 | 3300005549 | Ga0070704_100564894 | Ga0070704_1005648942 | 44 |
| 50 | 3300005840 | Ga0068870_10209859 | Ga0068870_102098592 | 44 |
| 51 | 3300005843 | Ga0068860_102213821 | Ga0068860_1022138212 | 44 |
| 52 | 3300009553 | Ga0105249_12579814 | Ga0105249_125798142 | 44 |
| 53 | 3300013308 | Ga0157375_13424004 | Ga0157375_134240041 | 44 |
| 54 | 3300014325 | Ga0163163_11324055 | Ga0163163_113240553 | 44 |
| 55 | 3300014326 | Ga0157380_10694493 | Ga0157380_106944931 | 44 |
| 56 | 3300014326 | Ga0157380_13357676 | Ga0157380_133576762 | 44 |
| 57 | 3300025903 | Ga0207680_10462487 | Ga0207680_104624872 | 44 |
| 58 | 3300025908 | Ga0207643_10517479 | Ga0207643_105174792 | 44 |
| 59 | 3300025923 | Ga0207681_10121335 | Ga0207681_101213352 | 44 |
| 60 | 3300025925 | Ga0207650_10774390 | Ga0207650_107743902 | 44 |
| 61 | 3300025926 | Ga0207659_11307753 | Ga0207659_113077532 | 44 |
| 62 | 3300025933 | Ga0207706_10010042 | Ga0207706_100100422 | 44 |
| 63 | 3300025937 | Ga0207669_10553544 | Ga0207669_105535442 | 44 |
| 64 | 3300025972 | Ga0207668_10446977 | Ga0207668_104469772 | 44 |
| 65 | 3300026121 | Ga0207683_10218366 | Ga0207683_102183662 | 44 |
| 66 | 3300035086 | Ga0373934_0108730 | Ga0373934_0108730_931_1080 | 44 |
| 67 | 3300046683 | Ga0495658_0815812 | Ga0495658_0815812_211_360 | 44 |
| 68 | 3300048091 | Ga0495626_0374905 | Ga0495626_0374905_382_531 | 44 |
| 69 | 3300049587 | Ga0501071_0925038 | Ga0501071_0925038_219_368 | 44 |
| 70 | 3300049588 | Ga0501072_0807251 | Ga0501072_0807251_248_397 | 44 |
| 71 | 3300049592 | Ga0501076_0638679 | Ga0501076_0638679_298_447 | 44 |
| 72 | 3300026088 | Ga0207641_10411463 | Ga0207641_104114634 | 48 |
| 73 | 3300000549 | LJQas_1004572 | LJQas_10045722 | 49 |
| 74 | 3300001904 | JGI24736J21556_1078915 | JGI24736J21556_10789151 | 49 |
| 75 | 3300001976 | JGI24752J21851_1019788 | JGI24752J21851_10197883 | 49 |
| 76 | 3300001977 | JGI24746J21847_1003481 | JGI24746J21847_10034815 | 49 |
| 77 | 3300001978 | JGI24747J21853_1004504 | JGI24747J21853_10045043 | 49 |
| 78 | 3300001990 | JGI24737J22298_10015109 | JGI24737J22298_100151095 | 49 |
| 79 | 3300001991 | JGI24743J22301_10001659 | JGI24743J22301_100016594 | 49 |
| 80 | 3300002070 | JGI24750J21931_1013551 | JGI24750J21931_10135513 | 49 |
| 81 | 3300002073 | JGI24745J21846_1012438 | JGI24745J21846_10124382 | 49 |
| 82 | 3300002074 | JGI24748J21848_1011226 | JGI24748J21848_10112263 | 49 |
| 83 | 3300002075 | JGI24738J21930_10034985 | JGI24738J21930_100349852 | 49 |
| 84 | 3300002076 | JGI24749J21850_1001134 | JGI24749J21850_10011347 | 49 |
| 85 | 3300002077 | JGI24744J21845_10024765 | JGI24744J21845_100247653 | 49 |
| 86 | 3300002126 | JGI24035J26624_1010268 | JGI24035J26624_10102682 | 49 |
| 87 | 3300002155 | JGI24033J26618_1030436 | JGI24033J26618_10304362 | 49 |
| 88 | 3300002244 | JGI24742J22300_10046791 | JGI24742J22300_100467913 | 49 |
| 89 | 3300002459 | JGI24751J29686_10001570 | JGI24751J29686_100015703 | 49 |
| 90 | 3300003659 | JGI25404J52841_10008784 | JGI25404J52841_100087843 | 49 |
| 91 | 3300004798 | Ga0058859_10031327 | Ga0058859_100313272 | 49 |
| 92 | 3300004798 | Ga0058859_11679412 | Ga0058859_116794122 | 49 |
| 93 | 3300004798 | Ga0058859_11795058 | Ga0058859_117950582 | 49 |
| 94 | 3300004801 | Ga0058860_12109938 | Ga0058860_121099384 | 49 |
| 95 | 3300004801 | Ga0058860_12218590 | Ga0058860_122185902 | 49 |
| 96 | 3300004803 | Ga0058862_12775106 | Ga0058862_127751061 | 49 |
| 97 | 3300004803 | Ga0058862_12857261 | Ga0058862_128572613 | 49 |
| 98 | 3300005289 | Ga0065704_10004364 | Ga0065704_100043648 | 49 |
| 99 | 3300005289 | Ga0065704_10040355 | Ga0065704_100403553 | 49 |
| 100 | 3300005289 | Ga0065704_10332004 | Ga0065704_103320041 | 49 |
| 101 | 3300005290 | Ga0065712_10003180 | Ga0065712_100031809 | 49 |
| 102 | 3300005290 | Ga0065712_10031979 | Ga0065712_100319792 | 49 |
| 103 | 3300005290 | Ga0065712_10051647 | Ga0065712_100516472 | 49 |
| 104 | 3300005290 | Ga0065712_10086694 | Ga0065712_100866947 | 49 |
| 105 | 3300005293 | Ga0065715_10053782 | Ga0065715_100537822 | 49 |
| 106 | 3300005293 | Ga0065715_10225253 | Ga0065715_102252532 | 49 |
| 107 | 3300005293 | Ga0065715_10345118 | Ga0065715_103451181 | 49 |
| 108 | 3300005293 | Ga0065715_10453518 | Ga0065715_104535182 | 49 |
| 109 | 3300005293 | Ga0065715_10552740 | Ga0065715_105527402 | 49 |
| 110 | 3300005293 | Ga0065715_10656145 | Ga0065715_106561452 | 49 |
| 111 | 3300005293 | Ga0065715_10695372 | Ga0065715_106953723 | 49 |
| 112 | 3300005295 | Ga0065707_10002895 | Ga0065707_100028959 | 49 |
| 113 | 3300005295 | Ga0065707_10027870 | Ga0065707_100278702 | 49 |
| 114 | 3300005295 | Ga0065707_10604539 | Ga0065707_106045393 | 49 |
| 115 | 3300005295 | Ga0065707_10741998 | Ga0065707_107419982 | 49 |
| 116 | 3300005295 | Ga0065707_10902817 | Ga0065707_109028173 | 49 |
| 117 | 3300005295 | Ga0065707_10976468 | Ga0065707_109764682 | 49 |
| 118 | 3300005327 | Ga0070658_10005024 | Ga0070658_1000502415 | 49 |
| 119 | 3300005327 | Ga0070658_11939020 | Ga0070658_119390203 | 49 |
| 120 | 3300005328 | Ga0070676_10002393 | Ga0070676_100023932 | 49 |
| 121 | 3300005328 | Ga0070676_10491550 | Ga0070676_104915503 | 49 |
| 122 | 3300005328 | Ga0070676_10595526 | Ga0070676_105955261 | 49 |
| 123 | 3300005328 | Ga0070676_10647349 | Ga0070676_106473491 | 49 |
| 124 | 3300005328 | Ga0070676_10680290 | Ga0070676_106802901 | 49 |
| 125 | 3300005328 | Ga0070676_10684122 | Ga0070676_106841223 | 49 |
| 126 | 3300005329 | Ga0070683_100000094 | Ga0070683_10000009455 | 49 |
| 127 | 3300005329 | Ga0070683_100001323 | Ga0070683_10000132313 | 49 |
| 128 | 3300005329 | Ga0070683_100036179 | Ga0070683_1000361795 | 49 |
| 129 | 3300005329 | Ga0070683_101580343 | Ga0070683_1015803431 | 49 |
| 130 | 3300005329 | Ga0070683_101628540 | Ga0070683_1016285402 | 49 |
| 131 | 3300005330 | Ga0070690_100000500 | Ga0070690_10000050015 | 49 |
| 132 | 3300005330 | Ga0070690_100776090 | Ga0070690_1007760903 | 49 |
| 133 | 3300005330 | Ga0070690_101047610 | Ga0070690_1010476102 | 49 |
| 134 | 3300005330 | Ga0070690_101051337 | Ga0070690_1010513372 | 49 |
| 135 | 3300005330 | Ga0070690_101378213 | Ga0070690_1013782133 | 49 |
| 136 | 3300005331 | Ga0070670_100004270 | Ga0070670_1000042705 | 49 |
| 137 | 3300005331 | Ga0070670_100016953 | Ga0070670_1000169535 | 49 |
| 138 | 3300005331 | Ga0070670_100260887 | Ga0070670_1002608872 | 49 |
| 139 | 3300005331 | Ga0070670_101130782 | Ga0070670_1011307822 | 49 |
| 140 | 3300005331 | Ga0070670_101931683 | Ga0070670_1019316834 | 49 |
| 141 | 3300005331 | Ga0070670_102046394 | Ga0070670_1020463942 | 49 |
| 142 | 3300005333 | Ga0070677_10000073 | Ga0070677_100000736 | 49 |
| 143 | 3300005333 | Ga0070677_10494885 | Ga0070677_104948852 | 49 |
| 144 | 3300005334 | Ga0068869_100012627 | Ga0068869_1000126277 | 49 |
| 145 | 3300005334 | Ga0068869_100587407 | Ga0068869_1005874072 | 49 |
| 146 | 3300005335 | Ga0070666_10000730 | Ga0070666_1000073010 | 49 |
| 147 | 3300005336 | Ga0070680_100149467 | Ga0070680_1001494674 | 49 |
| 148 | 3300005336 | Ga0070680_100376351 | Ga0070680_1003763511 | 49 |
| 149 | 3300005336 | Ga0070680_100697413 | Ga0070680_1006974132 | 49 |
| 150 | 3300005337 | Ga0070682_100194809 | Ga0070682_1001948092 | 49 |
| 151 | 3300005337 | Ga0070682_100419657 | Ga0070682_1004196571 | 49 |
| 152 | 3300005337 | Ga0070682_101669821 | Ga0070682_1016698211 | 49 |
| 153 | 3300005338 | Ga0068868_100125900 | Ga0068868_1001259002 | 49 |
| 154 | 3300005338 | Ga0068868_100814076 | Ga0068868_1008140761 | 49 |
| 155 | 3300005338 | Ga0068868_100984944 | Ga0068868_1009849442 | 49 |
| 156 | 3300005338 | Ga0068868_101229391 | Ga0068868_1012293912 | 49 |
| 157 | 3300005338 | Ga0068868_102026188 | Ga0068868_1020261882 | 49 |
| 158 | 3300005339 | Ga0070660_100000181 | Ga0070660_10000018119 | 49 |
| 159 | 3300005339 | Ga0070660_100379575 | Ga0070660_1003795751 | 49 |
| 160 | 3300005340 | Ga0070689_100000949 | Ga0070689_10000094911 | 49 |
| 161 | 3300005340 | Ga0070689_100041204 | Ga0070689_1000412041 | 49 |
| 162 | 3300005340 | Ga0070689_100109280 | Ga0070689_1001092805 | 49 |
| 163 | 3300005341 | Ga0070691_10020695 | Ga0070691_100206956 | 49 |
| 164 | 3300005341 | Ga0070691_10450638 | Ga0070691_104506382 | 49 |
| 165 | 3300005341 | Ga0070691_10939951 | Ga0070691_109399511 | 49 |
| 166 | 3300005343 | Ga0070687_100000024 | Ga0070687_1000000247 | 49 |
| 167 | 3300005343 | Ga0070687_100208653 | Ga0070687_1002086532 | 49 |
| 168 | 3300005343 | Ga0070687_100482813 | Ga0070687_1004828132 | 49 |
| 169 | 3300005343 | Ga0070687_100892946 | Ga0070687_1008929462 | 49 |
| 170 | 3300005344 | Ga0070661_100006519 | Ga0070661_1000065198 | 49 |
| 171 | 3300005344 | Ga0070661_100078230 | Ga0070661_1000782302 | 49 |
| 172 | 3300005344 | Ga0070661_100252775 | Ga0070661_1002527752 | 49 |
| 173 | 3300005344 | Ga0070661_101822398 | Ga0070661_1018223981 | 49 |
| 174 | 3300005345 | Ga0070692_10005628 | Ga0070692_100056287 | 49 |
| 175 | 3300005345 | Ga0070692_10053554 | Ga0070692_100535542 | 49 |
| 176 | 3300005347 | Ga0070668_100000448 | Ga0070668_10000044815 | 49 |
| 177 | 3300005347 | Ga0070668_100068776 | Ga0070668_1000687766 | 49 |
| 178 | 3300005347 | Ga0070668_100348544 | Ga0070668_1003485442 | 49 |
| 179 | 3300005347 | Ga0070668_101024720 | Ga0070668_1010247202 | 49 |
| 180 | 3300005347 | Ga0070668_101188794 | Ga0070668_1011887941 | 49 |
| 181 | 3300005347 | Ga0070668_102289010 | Ga0070668_1022890102 | 49 |
| 182 | 3300005353 | Ga0070669_100001019 | Ga0070669_10000101910 | 49 |
| 183 | 3300005353 | Ga0070669_100222261 | Ga0070669_1002222615 | 49 |
| 184 | 3300005353 | Ga0070669_100449834 | Ga0070669_1004498344 | 49 |
| 185 | 3300005353 | Ga0070669_101667002 | Ga0070669_1016670021 | 49 |
| 186 | 3300005354 | Ga0070675_100001940 | Ga0070675_1000019407 | 49 |
| 187 | 3300005354 | Ga0070675_100118030 | Ga0070675_1001180306 | 49 |
| 188 | 3300005354 | Ga0070675_100210042 | Ga0070675_1002100425 | 49 |
| 189 | 3300005354 | Ga0070675_100293359 | Ga0070675_1002933593 | 49 |
| 190 | 3300005354 | Ga0070675_100310247 | Ga0070675_1003102476 | 49 |
| 191 | 3300005354 | Ga0070675_100478685 | Ga0070675_1004786852 | 49 |
| 192 | 3300005354 | Ga0070675_101727039 | Ga0070675_1017270392 | 49 |
| 193 | 3300005354 | Ga0070675_101977356 | Ga0070675_1019773561 | 49 |
| 194 | 3300005355 | Ga0070671_100004331 | Ga0070671_1000043314 | 49 |
| 195 | 3300005355 | Ga0070671_100013832 | Ga0070671_1000138322 | 49 |
| 196 | 3300005355 | Ga0070671_100222326 | Ga0070671_1002223264 | 49 |
| 197 | 3300005355 | Ga0070671_100319994 | Ga0070671_1003199944 | 49 |
| 198 | 3300005355 | Ga0070671_100348479 | Ga0070671_1003484793 | 49 |
| 199 | 3300005355 | Ga0070671_100639326 | Ga0070671_1006393261 | 49 |
| 200 | 3300005356 | Ga0070674_100000350 | Ga0070674_10000035012 | 49 |
| 201 | 3300005356 | Ga0070674_100011938 | Ga0070674_1000119389 | 49 |
| 202 | 3300005356 | Ga0070674_100445341 | Ga0070674_1004453414 | 49 |
| 203 | 3300005356 | Ga0070674_100457466 | Ga0070674_1004574665 | 49 |
| 204 | 3300005356 | Ga0070674_100771977 | Ga0070674_1007719774 | 49 |
| 205 | 3300005356 | Ga0070674_101383746 | Ga0070674_1013837463 | 49 |
| 206 | 3300005364 | Ga0070673_100001346 | Ga0070673_10000134610 | 49 |
| 207 | 3300005364 | Ga0070673_100076042 | Ga0070673_1000760424 | 49 |
| 208 | 3300005364 | Ga0070673_100174521 | Ga0070673_1001745212 | 49 |
| 209 | 3300005364 | Ga0070673_101406459 | Ga0070673_1014064592 | 49 |
| 210 | 3300005364 | Ga0070673_101415377 | Ga0070673_1014153772 | 49 |
| 211 | 3300005364 | Ga0070673_102062034 | Ga0070673_1020620344 | 49 |
| 212 | 3300005364 | Ga0070673_102324411 | Ga0070673_1023244112 | 49 |
| 213 | 3300005365 | Ga0070688_100001135 | Ga0070688_1000011357 | 49 |
| 214 | 3300005365 | Ga0070688_100222985 | Ga0070688_1002229854 | 49 |
| 215 | 3300005365 | Ga0070688_101416895 | Ga0070688_1014168951 | 49 |
| 216 | 3300005366 | Ga0070659_100000114 | Ga0070659_10000011412 | 49 |
| 217 | 3300005366 | Ga0070659_100451301 | Ga0070659_1004513012 | 49 |
| 218 | 3300005366 | Ga0070659_100605689 | Ga0070659_1006056894 | 49 |
| 219 | 3300005367 | Ga0070667_100011084 | Ga0070667_1000110846 | 49 |
| 220 | 3300005367 | Ga0070667_100397655 | Ga0070667_1003976553 | 49 |
| 221 | 3300005367 | Ga0070667_101699404 | Ga0070667_1016994041 | 49 |
| 222 | 3300005434 | Ga0070709_11210828 | Ga0070709_112108281 | 49 |
| 223 | 3300005435 | Ga0070714_101686849 | Ga0070714_1016868492 | 49 |
| 224 | 3300005437 | Ga0070710_10868430 | Ga0070710_108684302 | 49 |
| 225 | 3300005438 | Ga0070701_10081817 | Ga0070701_100818172 | 49 |
| 226 | 3300005438 | Ga0070701_10566287 | Ga0070701_105662871 | 49 |
| 227 | 3300005438 | Ga0070701_10848837 | Ga0070701_108488372 | 49 |
| 228 | 3300005439 | Ga0070711_100149287 | Ga0070711_1001492872 | 49 |
| 229 | 3300005439 | Ga0070711_101361141 | Ga0070711_1013611412 | 49 |
| 230 | 3300005440 | Ga0070705_100005491 | Ga0070705_1000054918 | 49 |
| 231 | 3300005440 | Ga0070705_100105034 | Ga0070705_1001050344 | 49 |
| 232 | 3300005440 | Ga0070705_100157732 | Ga0070705_1001577322 | 49 |
| 233 | 3300005440 | Ga0070705_101585444 | Ga0070705_1015854442 | 49 |
| 234 | 3300005440 | Ga0070705_101718673 | Ga0070705_1017186734 | 49 |
| 235 | 3300005441 | Ga0070700_100028912 | Ga0070700_1000289128 | 49 |
| 236 | 3300005441 | Ga0070700_100773277 | Ga0070700_1007732771 | 49 |
| 237 | 3300005441 | Ga0070700_101755166 | Ga0070700_1017551662 | 49 |
| 238 | 3300005444 | Ga0070694_100576539 | Ga0070694_1005765393 | 49 |
| 239 | 3300005444 | Ga0070694_100716209 | Ga0070694_1007162093 | 49 |
| 240 | 3300005445 | Ga0070708_101447076 | Ga0070708_1014470762 | 49 |
| 241 | 3300005455 | Ga0070663_100000874 | Ga0070663_1000008747 | 49 |
| 242 | 3300005455 | Ga0070663_100359031 | Ga0070663_1003590312 | 49 |
| 243 | 3300005455 | Ga0070663_100743866 | Ga0070663_1007438664 | 49 |
| 244 | 3300005455 | Ga0070663_101672599 | Ga0070663_1016725992 | 49 |
| 245 | 3300005456 | Ga0070678_100017053 | Ga0070678_1000170537 | 49 |
| 246 | 3300005456 | Ga0070678_100328891 | Ga0070678_1003288912 | 49 |
| 247 | 3300005456 | Ga0070678_100428434 | Ga0070678_1004284342 | 49 |
| 248 | 3300005456 | Ga0070678_101203545 | Ga0070678_1012035451 | 49 |
| 249 | 3300005456 | Ga0070678_101325008 | Ga0070678_1013250082 | 49 |
| 250 | 3300005457 | Ga0070662_100000254 | Ga0070662_10000025416 | 49 |
| 251 | 3300005457 | Ga0070662_100285152 | Ga0070662_1002851524 | 49 |
| 252 | 3300005457 | Ga0070662_100432249 | Ga0070662_1004322492 | 49 |
| 253 | 3300005458 | Ga0070681_10188493 | Ga0070681_101884933 | 49 |
| 254 | 3300005459 | Ga0068867_100001968 | Ga0068867_10000196811 | 49 |
| 255 | 3300005459 | Ga0068867_100230883 | Ga0068867_1002308832 | 49 |
| 256 | 3300005466 | Ga0070685_10000248 | Ga0070685_1000024810 | 49 |
| 257 | 3300005466 | Ga0070685_11325340 | Ga0070685_113253402 | 49 |
| 258 | 3300005467 | Ga0070706_100402100 | Ga0070706_1004021002 | 49 |
| 259 | 3300005467 | Ga0070706_100996574 | Ga0070706_1009965743 | 49 |
| 260 | 3300005467 | Ga0070706_101450878 | Ga0070706_1014508781 | 49 |
| 261 | 3300005468 | Ga0070707_100857225 | Ga0070707_1008572253 | 49 |
| 262 | 3300005468 | Ga0070707_101604448 | Ga0070707_1016044483 | 49 |
| 263 | 3300005471 | Ga0070698_100545640 | Ga0070698_1005456404 | 49 |
| 264 | 3300005471 | Ga0070698_100647762 | Ga0070698_1006477621 | 49 |
| 265 | 3300005471 | Ga0070698_100758412 | Ga0070698_1007584123 | 49 |
| 266 | 3300005471 | Ga0070698_101000005 | Ga0070698_1010000055 | 49 |
| 267 | 3300005471 | Ga0070698_101386398 | Ga0070698_1013863982 | 49 |
| 268 | 3300005518 | Ga0070699_100022962 | Ga0070699_10002296210 | 49 |
| 269 | 3300005518 | Ga0070699_100157512 | Ga0070699_1001575122 | 49 |
| 270 | 3300005518 | Ga0070699_101208046 | Ga0070699_1012080462 | 49 |
| 271 | 3300005518 | Ga0070699_101258879 | Ga0070699_1012588792 | 49 |
| 272 | 3300005530 | Ga0070679_100047014 | Ga0070679_1000470143 | 49 |
| 273 | 3300005530 | Ga0070679_100145145 | Ga0070679_1001451454 | 49 |
| 274 | 3300005530 | Ga0070679_101616621 | Ga0070679_1016166212 | 49 |
| 275 | 3300005535 | Ga0070684_101395598 | Ga0070684_1013955983 | 49 |
| 276 | 3300005536 | Ga0070697_100017739 | Ga0070697_1000177399 | 49 |
| 277 | 3300005536 | Ga0070697_100185598 | Ga0070697_1001855982 | 49 |
| 278 | 3300005536 | Ga0070697_100237925 | Ga0070697_1002379252 | 49 |
| 279 | 3300005536 | Ga0070697_100363324 | Ga0070697_1003633242 | 49 |
| 280 | 3300005536 | Ga0070697_100382838 | Ga0070697_1003828381 | 49 |
| 281 | 3300005536 | Ga0070697_101178657 | Ga0070697_1011786572 | 49 |
| 282 | 3300005536 | Ga0070697_102008942 | Ga0070697_1020089423 | 49 |
| 283 | 3300005536 | Ga0070697_102047032 | Ga0070697_1020470322 | 49 |
| 284 | 3300005539 | Ga0068853_100001786 | Ga0068853_10000178616 | 49 |
| 285 | 3300005539 | Ga0068853_100795112 | Ga0068853_1007951122 | 49 |
| 286 | 3300005543 | Ga0070672_100001452 | Ga0070672_10000145211 | 49 |
| 287 | 3300005543 | Ga0070672_100482531 | Ga0070672_1004825312 | 49 |
| 288 | 3300005543 | Ga0070672_100504860 | Ga0070672_1005048604 | 49 |
| 289 | 3300005543 | Ga0070672_100591520 | Ga0070672_1005915202 | 49 |
| 290 | 3300005543 | Ga0070672_100624797 | Ga0070672_1006247974 | 49 |
| 291 | 3300005543 | Ga0070672_100860402 | Ga0070672_1008604021 | 49 |
| 292 | 3300005543 | Ga0070672_100967376 | Ga0070672_1009673763 | 49 |
| 293 | 3300005543 | Ga0070672_101298966 | Ga0070672_1012989663 | 49 |
| 294 | 3300005543 | Ga0070672_101719387 | Ga0070672_1017193871 | 49 |
| 295 | 3300005544 | Ga0070686_100000328 | Ga0070686_10000032816 | 49 |
| 296 | 3300005544 | Ga0070686_100488886 | Ga0070686_1004888861 | 49 |
| 297 | 3300005545 | Ga0070695_100084673 | Ga0070695_1000846732 | 49 |
| 298 | 3300005545 | Ga0070695_100225615 | Ga0070695_1002256153 | 49 |
| 299 | 3300005545 | Ga0070695_100264406 | Ga0070695_1002644062 | 49 |
| 300 | 3300005545 | Ga0070695_100409840 | Ga0070695_1004098402 | 49 |
| 301 | 3300005545 | Ga0070695_100861656 | Ga0070695_1008616561 | 49 |
| 302 | 3300005545 | Ga0070695_101132041 | Ga0070695_1011320412 | 49 |
| 303 | 3300005546 | Ga0070696_100736174 | Ga0070696_1007361742 | 49 |
| 304 | 3300005546 | Ga0070696_101885441 | Ga0070696_1018854411 | 49 |
| 305 | 3300005547 | Ga0070693_100010528 | Ga0070693_1000105282 | 49 |
| 306 | 3300005547 | Ga0070693_100019888 | Ga0070693_1000198882 | 49 |
| 307 | 3300005548 | Ga0070665_100010583 | Ga0070665_10001058311 | 49 |
| 308 | 3300005548 | Ga0070665_100094954 | Ga0070665_1000949547 | 49 |
| 309 | 3300005548 | Ga0070665_101664565 | Ga0070665_1016645652 | 49 |
| 310 | 3300005548 | Ga0070665_102548169 | Ga0070665_1025481692 | 49 |
| 311 | 3300005548 | Ga0070665_102594652 | Ga0070665_1025946521 | 49 |
| 312 | 3300005549 | Ga0070704_100066182 | Ga0070704_1000661826 | 49 |
| 313 | 3300005549 | Ga0070704_100116336 | Ga0070704_1001163362 | 49 |
| 314 | 3300005549 | Ga0070704_100529830 | Ga0070704_1005298304 | 49 |
| 315 | 3300005549 | Ga0070704_100831770 | Ga0070704_1008317702 | 49 |
| 316 | 3300005549 | Ga0070704_101162770 | Ga0070704_1011627701 | 49 |
| 317 | 3300005563 | Ga0068855_100006422 | Ga0068855_10000642211 | 49 |
| 318 | 3300005564 | Ga0070664_100000479 | Ga0070664_10000047932 | 49 |
| 319 | 3300005564 | Ga0070664_100053438 | Ga0070664_1000534385 | 49 |
| 320 | 3300005564 | Ga0070664_100145251 | Ga0070664_1001452516 | 49 |
| 321 | 3300005564 | Ga0070664_100221069 | Ga0070664_1002210692 | 49 |
| 322 | 3300005564 | Ga0070664_100324039 | Ga0070664_1003240392 | 49 |
| 323 | 3300005564 | Ga0070664_101725164 | Ga0070664_1017251642 | 49 |
| 324 | 3300005577 | Ga0068857_100092103 | Ga0068857_1000921032 | 49 |
| 325 | 3300005577 | Ga0068857_100252079 | Ga0068857_1002520792 | 49 |
| 326 | 3300005577 | Ga0068857_100525451 | Ga0068857_1005254514 | 49 |
| 327 | 3300005577 | Ga0068857_101734987 | Ga0068857_1017349872 | 49 |
| 328 | 3300005578 | Ga0068854_100000012 | Ga0068854_10000001251 | 49 |
| 329 | 3300005614 | Ga0068856_100009855 | Ga0068856_10000985511 | 49 |
| 330 | 3300005614 | Ga0068856_100408964 | Ga0068856_1004089641 | 49 |
| 331 | 3300005615 | Ga0070702_100798555 | Ga0070702_1007985552 | 49 |
| 332 | 3300005615 | Ga0070702_101400910 | Ga0070702_1014009101 | 49 |
| 333 | 3300005615 | Ga0070702_101444887 | Ga0070702_1014448872 | 49 |
| 334 | 3300005616 | Ga0068852_100000438 | Ga0068852_10000043813 | 49 |
| 335 | 3300005617 | Ga0068859_100001092 | Ga0068859_10000109215 | 49 |
| 336 | 3300005617 | Ga0068859_100039272 | Ga0068859_1000392728 | 49 |
| 337 | 3300005617 | Ga0068859_100138831 | Ga0068859_1001388312 | 49 |
| 338 | 3300005617 | Ga0068859_100200996 | Ga0068859_1002009964 | 49 |
| 339 | 3300005617 | Ga0068859_100381046 | Ga0068859_1003810465 | 49 |
| 340 | 3300005617 | Ga0068859_100683477 | Ga0068859_1006834772 | 49 |
| 341 | 3300005617 | Ga0068859_100777959 | Ga0068859_1007779592 | 49 |
| 342 | 3300005617 | Ga0068859_101466948 | Ga0068859_1014669481 | 49 |
| 343 | 3300005617 | Ga0068859_101995864 | Ga0068859_1019958642 | 49 |
| 344 | 3300005617 | Ga0068859_103024518 | Ga0068859_1030245182 | 49 |
| 345 | 3300005618 | Ga0068864_100003452 | Ga0068864_1000034527 | 49 |
| 346 | 3300005618 | Ga0068864_101039382 | Ga0068864_1010393822 | 49 |
| 347 | 3300005618 | Ga0068864_101310556 | Ga0068864_1013105562 | 49 |
| 348 | 3300005618 | Ga0068864_101754632 | Ga0068864_1017546321 | 49 |
| 349 | 3300005718 | Ga0068866_10000117 | Ga0068866_1000011723 | 49 |
| 350 | 3300005718 | Ga0068866_10117443 | Ga0068866_101174432 | 49 |
| 351 | 3300005718 | Ga0068866_10302363 | Ga0068866_103023633 | 49 |
| 352 | 3300005718 | Ga0068866_10328422 | Ga0068866_103284223 | 49 |
| 353 | 3300005719 | Ga0068861_100000082 | Ga0068861_10000008214 | 49 |
| 354 | 3300005719 | Ga0068861_100257033 | Ga0068861_1002570333 | 49 |
| 355 | 3300005719 | Ga0068861_101375880 | Ga0068861_1013758802 | 49 |
| 356 | 3300005719 | Ga0068861_101744180 | Ga0068861_1017441802 | 49 |
| 357 | 3300005719 | Ga0068861_102284504 | Ga0068861_1022845041 | 49 |
| 358 | 3300005719 | Ga0068861_102712449 | Ga0068861_1027124492 | 49 |
| 359 | 3300005834 | Ga0068851_10000775 | Ga0068851_100007757 | 49 |
| 360 | 3300005834 | Ga0068851_10163626 | Ga0068851_101636264 | 49 |
| 361 | 3300005840 | Ga0068870_10000643 | Ga0068870_1000064314 | 49 |
| 362 | 3300005840 | Ga0068870_10200553 | Ga0068870_102005534 | 49 |
| 363 | 3300005840 | Ga0068870_10412482 | Ga0068870_104124823 | 49 |
| 364 | 3300005840 | Ga0068870_11065030 | Ga0068870_110650303 | 49 |
| 365 | 3300005841 | Ga0068863_100053675 | Ga0068863_1000536752 | 49 |
| 366 | 3300005841 | Ga0068863_100153808 | Ga0068863_1001538084 | 49 |
| 367 | 3300005841 | Ga0068863_100160112 | Ga0068863_1001601122 | 49 |
| 368 | 3300005841 | Ga0068863_100862685 | Ga0068863_1008626854 | 49 |
| 369 | 3300005841 | Ga0068863_100954509 | Ga0068863_1009545093 | 49 |
| 370 | 3300005841 | Ga0068863_101007866 | Ga0068863_1010078662 | 49 |
| 371 | 3300005841 | Ga0068863_101786294 | Ga0068863_1017862941 | 49 |
| 372 | 3300005841 | Ga0068863_102587286 | Ga0068863_1025872862 | 49 |
| 373 | 3300005842 | Ga0068858_100008887 | Ga0068858_10000888711 | 49 |
| 374 | 3300005842 | Ga0068858_100055604 | Ga0068858_1000556042 | 49 |
| 375 | 3300005842 | Ga0068858_100276704 | Ga0068858_1002767046 | 49 |
| 376 | 3300005842 | Ga0068858_100424644 | Ga0068858_1004246444 | 49 |
| 377 | 3300005842 | Ga0068858_100740245 | Ga0068858_1007402454 | 49 |
| 378 | 3300005842 | Ga0068858_100803785 | Ga0068858_1008037852 | 49 |
| 379 | 3300005842 | Ga0068858_101417176 | Ga0068858_1014171762 | 49 |
| 380 | 3300005842 | Ga0068858_101621266 | Ga0068858_1016212662 | 49 |
| 381 | 3300005843 | Ga0068860_100005800 | Ga0068860_10000580015 | 49 |
| 382 | 3300005843 | Ga0068860_100087378 | Ga0068860_1000873785 | 49 |
| 383 | 3300005843 | Ga0068860_100234785 | Ga0068860_1002347854 | 49 |
| 384 | 3300005843 | Ga0068860_100239764 | Ga0068860_1002397642 | 49 |
| 385 | 3300005843 | Ga0068860_102175836 | Ga0068860_1021758361 | 49 |
| 386 | 3300005844 | Ga0068862_100004232 | Ga0068862_1000042326 | 49 |
| 387 | 3300005844 | Ga0068862_100559879 | Ga0068862_1005598792 | 49 |
| 388 | 3300005844 | Ga0068862_100988725 | Ga0068862_1009887253 | 49 |
| 389 | 3300005844 | Ga0068862_101429418 | Ga0068862_1014294183 | 49 |
| 390 | 3300005844 | Ga0068862_102738881 | Ga0068862_1027388812 | 49 |
| 391 | 3300005937 | Ga0081455_10843341 | Ga0081455_108433413 | 49 |
| 392 | 3300005983 | Ga0081540_1000029 | Ga0081540_1000029116 | 49 |
| 393 | 3300005983 | Ga0081540_1056204 | Ga0081540_10562044 | 49 |
| 394 | 3300005983 | Ga0081540_1142334 | Ga0081540_11423345 | 49 |
| 395 | 3300006051 | Ga0075364_11063440 | Ga0075364_110634401 | 49 |
| 396 | 3300006163 | Ga0070715_10542746 | Ga0070715_105427464 | 49 |
| 397 | 3300006173 | Ga0070716_100952370 | Ga0070716_1009523703 | 49 |
| 398 | 3300006173 | Ga0070716_101296152 | Ga0070716_1012961522 | 49 |
| 399 | 3300006175 | Ga0070712_100223757 | Ga0070712_1002237572 | 49 |
| 400 | 3300006175 | Ga0070712_100559918 | Ga0070712_1005599182 | 49 |
| 401 | 3300006177 | Ga0075362_10210142 | Ga0075362_102101422 | 49 |
| 402 | 3300006178 | Ga0075367_10084871 | Ga0075367_100848712 | 49 |
| 403 | 3300006237 | Ga0097621_100003466 | Ga0097621_10000346614 | 49 |
| 404 | 3300006237 | Ga0097621_100376089 | Ga0097621_1003760892 | 49 |
| 405 | 3300006237 | Ga0097621_102275822 | Ga0097621_1022758221 | 49 |
| 406 | 3300006353 | Ga0075370_10708837 | Ga0075370_107088372 | 49 |
| 407 | 3300006358 | Ga0068871_100202666 | Ga0068871_1002026664 | 49 |
| 408 | 3300006358 | Ga0068871_100573959 | Ga0068871_1005739591 | 49 |
| 409 | 3300006358 | Ga0068871_100758126 | Ga0068871_1007581262 | 49 |
| 410 | 3300006358 | Ga0068871_100964830 | Ga0068871_1009648302 | 49 |
| 411 | 3300006358 | Ga0068871_101055072 | Ga0068871_1010550722 | 49 |
| 412 | 3300006844 | Ga0075428_100000017 | Ga0075428_1000000179 | 49 |
| 413 | 3300006844 | Ga0075428_100122904 | Ga0075428_1001229044 | 49 |
| 414 | 3300006844 | Ga0075428_100355670 | Ga0075428_1003556701 | 49 |
| 415 | 3300006844 | Ga0075428_100535412 | Ga0075428_1005354122 | 49 |
| 416 | 3300006844 | Ga0075428_100653282 | Ga0075428_1006532821 | 49 |
| 417 | 3300006844 | Ga0075428_101016031 | Ga0075428_1010160313 | 49 |
| 418 | 3300006844 | Ga0075428_101262432 | Ga0075428_1012624322 | 49 |
| 419 | 3300006844 | Ga0075428_101585530 | Ga0075428_1015855302 | 49 |
| 420 | 3300006847 | Ga0075431_100454296 | Ga0075431_1004542966 | 49 |
| 421 | 3300006847 | Ga0075431_100870242 | Ga0075431_1008702422 | 49 |
| 422 | 3300006847 | Ga0075431_101270423 | Ga0075431_1012704231 | 49 |
| 423 | 3300006847 | Ga0075431_101677678 | Ga0075431_1016776782 | 49 |
| 424 | 3300006847 | Ga0075431_101800493 | Ga0075431_1018004932 | 49 |
| 425 | 3300006847 | Ga0075431_102020647 | Ga0075431_1020206473 | 49 |
| 426 | 3300006852 | Ga0075433_10080040 | Ga0075433_100800406 | 49 |
| 427 | 3300006852 | Ga0075433_10387441 | Ga0075433_103874411 | 49 |
| 428 | 3300006852 | Ga0075433_10854000 | Ga0075433_108540006 | 49 |
| 429 | 3300006852 | Ga0075433_11062040 | Ga0075433_110620402 | 49 |
| 430 | 3300006871 | Ga0075434_100062039 | Ga0075434_1000620396 | 49 |
| 431 | 3300006871 | Ga0075434_100480998 | Ga0075434_1004809983 | 49 |
| 432 | 3300006871 | Ga0075434_101113613 | Ga0075434_1011136131 | 49 |
| 433 | 3300006871 | Ga0075434_101652856 | Ga0075434_1016528561 | 49 |
| 434 | 3300006880 | Ga0075429_100218567 | Ga0075429_1002185675 | 49 |
| 435 | 3300006880 | Ga0075429_100569260 | Ga0075429_1005692604 | 49 |
| 436 | 3300006880 | Ga0075429_100955460 | Ga0075429_1009554604 | 49 |
| 437 | 3300006880 | Ga0075429_101397996 | Ga0075429_1013979962 | 49 |
| 438 | 3300006880 | Ga0075429_101951224 | Ga0075429_1019512242 | 49 |
| 439 | 3300006881 | Ga0068865_100001281 | Ga0068865_1000012817 | 49 |
| 440 | 3300006881 | Ga0068865_100789144 | Ga0068865_1007891441 | 49 |
| 441 | 3300006914 | Ga0075436_100041067 | Ga0075436_1000410675 | 49 |
| 442 | 3300006914 | Ga0075436_100497311 | Ga0075436_1004973114 | 49 |
| 443 | 3300006931 | Ga0097620_100001091 | Ga0097620_10000109115 | 49 |
| 444 | 3300006931 | Ga0097620_100039275 | Ga0097620_1000392755 | 49 |
| 445 | 3300006931 | Ga0097620_100138842 | Ga0097620_1001388422 | 49 |
| 446 | 3300006931 | Ga0097620_100200999 | Ga0097620_1002009994 | 49 |
| 447 | 3300006931 | Ga0097620_100381001 | Ga0097620_1003810015 | 49 |
| 448 | 3300006931 | Ga0097620_100683432 | Ga0097620_1006834322 | 49 |
| 449 | 3300006931 | Ga0097620_100777969 | Ga0097620_1007779692 | 49 |
| 450 | 3300006931 | Ga0097620_101466850 | Ga0097620_1014668501 | 49 |
| 451 | 3300006931 | Ga0097620_101995948 | Ga0097620_1019959482 | 49 |
| 452 | 3300006931 | Ga0097620_103024717 | Ga0097620_1030247172 | 49 |
| 453 | 3300007076 | Ga0075435_100139306 | Ga0075435_1001393062 | 49 |
| 454 | 3300007076 | Ga0075435_100167535 | Ga0075435_1001675354 | 49 |
| 455 | 3300007076 | Ga0075435_100679141 | Ga0075435_1006791411 | 49 |
| 456 | 3300007076 | Ga0075435_101255482 | Ga0075435_1012554822 | 49 |
| 457 | 3300007076 | Ga0075435_101527835 | Ga0075435_1015278353 | 49 |
| 458 | 3300007265 | Ga0099794_10439460 | Ga0099794_104394601 | 49 |
| 459 | 3300009011 | Ga0105251_10631004 | Ga0105251_106310042 | 49 |
| 460 | 3300009036 | Ga0105244_10475922 | Ga0105244_104759222 | 49 |
| 461 | 3300009093 | Ga0105240_12001730 | Ga0105240_120017302 | 49 |
| 462 | 3300009094 | Ga0111539_10000002 | Ga0111539_10000002429 | 49 |
| 463 | 3300009094 | Ga0111539_10042697 | Ga0111539_100426974 | 49 |
| 464 | 3300009094 | Ga0111539_10044169 | Ga0111539_100441694 | 49 |
| 465 | 3300009094 | Ga0111539_10270295 | Ga0111539_102702954 | 49 |
| 466 | 3300009094 | Ga0111539_10274086 | Ga0111539_102740862 | 49 |
| 467 | 3300009094 | Ga0111539_10350905 | Ga0111539_103509051 | 49 |
| 468 | 3300009094 | Ga0111539_10627249 | Ga0111539_106272492 | 49 |
| 469 | 3300009094 | Ga0111539_11731278 | Ga0111539_117312783 | 49 |
| 470 | 3300009098 | Ga0105245_10288050 | Ga0105245_102880504 | 49 |
| 471 | 3300009098 | Ga0105245_11649356 | Ga0105245_116493562 | 49 |
| 472 | 3300009098 | Ga0105245_12592370 | Ga0105245_125923702 | 49 |
| 473 | 3300009101 | Ga0105247_10015895 | Ga0105247_100158955 | 49 |
| 474 | 3300009101 | Ga0105247_10975541 | Ga0105247_109755411 | 49 |
| 475 | 3300009147 | Ga0114129_10000509 | Ga0114129_1000050949 | 49 |
| 476 | 3300009147 | Ga0114129_10365441 | Ga0114129_103654416 | 49 |
| 477 | 3300009147 | Ga0114129_10975264 | Ga0114129_109752642 | 49 |
| 478 | 3300009148 | Ga0105243_11580024 | Ga0105243_115800241 | 49 |
| 479 | 3300009148 | Ga0105243_12227874 | Ga0105243_122278741 | 49 |
| 480 | 3300009148 | Ga0105243_12901923 | Ga0105243_129019232 | 49 |
| 481 | 3300009176 | Ga0105242_12732161 | Ga0105242_127321612 | 49 |
| 482 | 3300009177 | Ga0105248_10395727 | Ga0105248_103957274 | 49 |
| 483 | 3300009177 | Ga0105248_10690097 | Ga0105248_106900973 | 49 |
| 484 | 3300009177 | Ga0105248_11198546 | Ga0105248_111985462 | 49 |
| 485 | 3300009177 | Ga0105248_11983211 | Ga0105248_119832112 | 49 |
| 486 | 3300009177 | Ga0105248_12070481 | Ga0105248_120704813 | 49 |
| 487 | 3300009177 | Ga0105248_12193160 | Ga0105248_121931602 | 49 |
| 488 | 3300009553 | Ga0105249_11261524 | Ga0105249_112615241 | 49 |
| 489 | 3300010375 | Ga0105239_12397902 | Ga0105239_123979022 | 49 |
| 490 | 3300011119 | Ga0105246_10192241 | Ga0105246_101922414 | 49 |
| 491 | 3300011119 | Ga0105246_11338443 | Ga0105246_113384432 | 49 |
| 492 | 3300011119 | Ga0105246_11713458 | Ga0105246_117134582 | 49 |
| 493 | 3300011119 | Ga0105246_12604410 | Ga0105246_126044102 | 49 |
| 494 | 3300012505 | Ga0157339_1031008 | Ga0157339_10310081 | 49 |
| 495 | 3300012506 | Ga0157324_1035544 | Ga0157324_10355442 | 49 |
| 496 | 3300012510 | Ga0157316_1063998 | Ga0157316_10639982 | 49 |
| 497 | 3300013100 | Ga0157373_11571628 | Ga0157373_115716283 | 49 |
| 498 | 3300013102 | Ga0157371_10585155 | Ga0157371_105851554 | 49 |
| 499 | 3300013104 | Ga0157370_10223927 | Ga0157370_102239272 | 49 |
| 500 | 3300013297 | Ga0157378_10322335 | Ga0157378_103223354 | 49 |
| 501 | 3300013297 | Ga0157378_11235082 | Ga0157378_112350823 | 49 |
| 502 | 3300013297 | Ga0157378_12427885 | Ga0157378_124278851 | 49 |
| 503 | 3300013306 | Ga0163162_11532987 | Ga0163162_115329872 | 49 |
| 504 | 3300013307 | Ga0157372_11160058 | Ga0157372_111600582 | 49 |
| 505 | 3300013308 | Ga0157375_10271476 | Ga0157375_102714765 | 49 |
| 506 | 3300013308 | Ga0157375_10870603 | Ga0157375_108706032 | 49 |
| 507 | 3300013308 | Ga0157375_10949579 | Ga0157375_109495793 | 49 |
| 508 | 3300013308 | Ga0157375_11118753 | Ga0157375_111187532 | 49 |
| 509 | 3300013308 | Ga0157375_11406652 | Ga0157375_114066522 | 49 |
| 510 | 3300013308 | Ga0157375_12140289 | Ga0157375_121402895 | 49 |
| 511 | 3300014325 | Ga0163163_10036900 | Ga0163163_100369006 | 49 |
| 512 | 3300014325 | Ga0163163_10164016 | Ga0163163_101640166 | 49 |
| 513 | 3300014325 | Ga0163163_12213081 | Ga0163163_122130813 | 49 |
| 514 | 3300014326 | Ga0157380_10516509 | Ga0157380_105165094 | 49 |
| 515 | 3300014326 | Ga0157380_10613105 | Ga0157380_106131054 | 49 |
| 516 | 3300014326 | Ga0157380_10781362 | Ga0157380_107813622 | 49 |
| 517 | 3300014326 | Ga0157380_11225276 | Ga0157380_112252762 | 49 |
| 518 | 3300014326 | Ga0157380_11607233 | Ga0157380_116072332 | 49 |
| 519 | 3300014326 | Ga0157380_11688341 | Ga0157380_116883412 | 49 |
| 520 | 3300014326 | Ga0157380_12915429 | Ga0157380_129154291 | 49 |
| 521 | 3300014745 | Ga0157377_10428196 | Ga0157377_104281964 | 49 |
| 522 | 3300014745 | Ga0157377_10699403 | Ga0157377_106994033 | 49 |
| 523 | 3300014745 | Ga0157377_10963933 | Ga0157377_109639332 | 49 |
| 524 | 3300014968 | Ga0157379_10211948 | Ga0157379_102119482 | 49 |
| 525 | 3300014968 | Ga0157379_10668718 | Ga0157379_106687183 | 49 |
| 526 | 3300014969 | Ga0157376_10307712 | Ga0157376_103077122 | 49 |
| 527 | 3300014969 | Ga0157376_11144007 | Ga0157376_111440072 | 49 |
| 528 | 3300014969 | Ga0157376_12311194 | Ga0157376_123111942 | 49 |
| 529 | 3300014969 | Ga0157376_12635227 | Ga0157376_126352273 | 49 |
| 530 | 3300014969 | Ga0157376_12741822 | Ga0157376_127418222 | 49 |
| 531 | 3300014969 | Ga0157376_12850998 | Ga0157376_128509981 | 49 |
| 532 | 3300017792 | Ga0163161_10059207 | Ga0163161_100592076 | 49 |
| 533 | 3300017792 | Ga0163161_10301685 | Ga0163161_103016852 | 49 |
| 534 | 3300017792 | Ga0163161_11537248 | Ga0163161_115372482 | 49 |
| 535 | 3300020070 | Ga0206356_10251847 | Ga0206356_102518471 | 49 |
| 536 | 3300020075 | Ga0206349_1652271 | Ga0206349_16522712 | 49 |
| 537 | 3300020076 | Ga0206355_1138463 | Ga0206355_11384633 | 49 |
| 538 | 3300020076 | Ga0206355_1183705 | Ga0206355_11837052 | 49 |
| 539 | 3300020078 | Ga0206352_10435916 | Ga0206352_104359164 | 49 |
| 540 | 3300020080 | Ga0206350_11371603 | Ga0206350_113716031 | 49 |
| 541 | 3300021377 | Ga0213874_10271349 | Ga0213874_102713492 | 49 |
| 542 | 3300025315 | Ga0207697_10000724 | Ga0207697_1000072412 | 49 |
| 543 | 3300025315 | Ga0207697_10017846 | Ga0207697_100178462 | 49 |
| 544 | 3300025315 | Ga0207697_10300439 | Ga0207697_103004392 | 49 |
| 545 | 3300025315 | Ga0207697_10329868 | Ga0207697_103298681 | 49 |
| 546 | 3300025321 | Ga0207656_10013340 | Ga0207656_100133403 | 49 |
| 547 | 3300025893 | Ga0207682_10000142 | Ga0207682_100001427 | 49 |
| 548 | 3300025899 | Ga0207642_10000304 | Ga0207642_1000030416 | 49 |
| 549 | 3300025900 | Ga0207710_10008608 | Ga0207710_100086086 | 49 |
| 550 | 3300025900 | Ga0207710_10028970 | Ga0207710_100289701 | 49 |
| 551 | 3300025901 | Ga0207688_10003488 | Ga0207688_100034888 | 49 |
| 552 | 3300025903 | Ga0207680_10000437 | Ga0207680_1000043721 | 49 |
| 553 | 3300025903 | Ga0207680_11250675 | Ga0207680_112506752 | 49 |
| 554 | 3300025904 | Ga0207647_10003364 | Ga0207647_100033647 | 49 |
| 555 | 3300025904 | Ga0207647_10512210 | Ga0207647_105122103 | 49 |
| 556 | 3300025906 | Ga0207699_10883484 | Ga0207699_108834843 | 49 |
| 557 | 3300025907 | Ga0207645_10000238 | Ga0207645_1000023814 | 49 |
| 558 | 3300025907 | Ga0207645_10144050 | Ga0207645_101440506 | 49 |
| 559 | 3300025907 | Ga0207645_10558522 | Ga0207645_105585222 | 49 |
| 560 | 3300025907 | Ga0207645_11067925 | Ga0207645_110679253 | 49 |
| 561 | 3300025908 | Ga0207643_10000376 | Ga0207643_1000037613 | 49 |
| 562 | 3300025908 | Ga0207643_10150032 | Ga0207643_101500324 | 49 |
| 563 | 3300025908 | Ga0207643_10388630 | Ga0207643_103886301 | 49 |
| 564 | 3300025908 | Ga0207643_10589447 | Ga0207643_105894472 | 49 |
| 565 | 3300025909 | Ga0207705_10015275 | Ga0207705_100152757 | 49 |
| 566 | 3300025910 | Ga0207684_10165126 | Ga0207684_101651263 | 49 |
| 567 | 3300025910 | Ga0207684_11427571 | Ga0207684_114275712 | 49 |
| 568 | 3300025910 | Ga0207684_11494849 | Ga0207684_114948492 | 49 |
| 569 | 3300025911 | Ga0207654_10012178 | Ga0207654_100121782 | 49 |
| 570 | 3300025912 | Ga0207707_10007464 | Ga0207707_100074649 | 49 |
| 571 | 3300025913 | Ga0207695_10105565 | Ga0207695_101055652 | 49 |
| 572 | 3300025914 | Ga0207671_10001461 | Ga0207671_1000146114 | 49 |
| 573 | 3300025915 | Ga0207693_10451145 | Ga0207693_104511452 | 49 |
| 574 | 3300025916 | Ga0207663_10047077 | Ga0207663_100470776 | 49 |
| 575 | 3300025916 | Ga0207663_10662500 | Ga0207663_106625002 | 49 |
| 576 | 3300025917 | Ga0207660_10021664 | Ga0207660_100216648 | 49 |
| 577 | 3300025917 | Ga0207660_10081516 | Ga0207660_100815162 | 49 |
| 578 | 3300025917 | Ga0207660_11205196 | Ga0207660_112051962 | 49 |
| 579 | 3300025918 | Ga0207662_10000368 | Ga0207662_100003687 | 49 |
| 580 | 3300025918 | Ga0207662_10608641 | Ga0207662_106086412 | 49 |
| 581 | 3300025918 | Ga0207662_10610379 | Ga0207662_106103792 | 49 |
| 582 | 3300025919 | Ga0207657_10000132 | Ga0207657_1000013256 | 49 |
| 583 | 3300025920 | Ga0207649_10027667 | Ga0207649_100276675 | 49 |
| 584 | 3300025920 | Ga0207649_10156462 | Ga0207649_101564622 | 49 |
| 585 | 3300025921 | Ga0207652_10050537 | Ga0207652_100505375 | 49 |
| 586 | 3300025921 | Ga0207652_11173720 | Ga0207652_111737202 | 49 |
| 587 | 3300025922 | Ga0207646_10633209 | Ga0207646_106332092 | 49 |
| 588 | 3300025922 | Ga0207646_10941604 | Ga0207646_109416042 | 49 |
| 589 | 3300025922 | Ga0207646_10992149 | Ga0207646_109921493 | 49 |
| 590 | 3300025922 | Ga0207646_11119282 | Ga0207646_111192824 | 49 |
| 591 | 3300025923 | Ga0207681_10000518 | Ga0207681_1000051811 | 49 |
| 592 | 3300025923 | Ga0207681_10197675 | Ga0207681_101976752 | 49 |
| 593 | 3300025923 | Ga0207681_10847259 | Ga0207681_108472592 | 49 |
| 594 | 3300025923 | Ga0207681_10969468 | Ga0207681_109694684 | 49 |
| 595 | 3300025924 | Ga0207694_10003451 | Ga0207694_1000345113 | 49 |
| 596 | 3300025925 | Ga0207650_10000037 | Ga0207650_10000037133 | 49 |
| 597 | 3300025925 | Ga0207650_10133877 | Ga0207650_101338774 | 49 |
| 598 | 3300025925 | Ga0207650_10976316 | Ga0207650_109763162 | 49 |
| 599 | 3300025925 | Ga0207650_11138991 | Ga0207650_111389914 | 49 |
| 600 | 3300025925 | Ga0207650_11164516 | Ga0207650_111645162 | 49 |
| 601 | 3300025925 | Ga0207650_11342384 | Ga0207650_113423844 | 49 |
| 602 | 3300025926 | Ga0207659_10000012 | Ga0207659_10000012132 | 49 |
| 603 | 3300025926 | Ga0207659_10167480 | Ga0207659_101674805 | 49 |
| 604 | 3300025926 | Ga0207659_10658060 | Ga0207659_106580604 | 49 |
| 605 | 3300025927 | Ga0207687_10284104 | Ga0207687_102841042 | 49 |
| 606 | 3300025931 | Ga0207644_10001828 | Ga0207644_1000182815 | 49 |
| 607 | 3300025931 | Ga0207644_10139417 | Ga0207644_101394174 | 49 |
| 608 | 3300025931 | Ga0207644_10588455 | Ga0207644_105884553 | 49 |
| 609 | 3300025932 | Ga0207690_10000434 | Ga0207690_1000043415 | 49 |
| 610 | 3300025932 | Ga0207690_10069537 | Ga0207690_100695376 | 49 |
| 611 | 3300025933 | Ga0207706_10000419 | Ga0207706_1000041928 | 49 |
| 612 | 3300025933 | Ga0207706_10442069 | Ga0207706_104420692 | 49 |
| 613 | 3300025933 | Ga0207706_11425107 | Ga0207706_114251072 | 49 |
| 614 | 3300025934 | Ga0207686_10012502 | Ga0207686_100125022 | 49 |
| 615 | 3300025935 | Ga0207709_10011122 | Ga0207709_100111229 | 49 |
| 616 | 3300025935 | Ga0207709_11321466 | Ga0207709_113214661 | 49 |
| 617 | 3300025936 | Ga0207670_10000026 | Ga0207670_10000026123 | 49 |
| 618 | 3300025937 | Ga0207669_10000981 | Ga0207669_1000098115 | 49 |
| 619 | 3300025937 | Ga0207669_10018866 | Ga0207669_100188665 | 49 |
| 620 | 3300025937 | Ga0207669_10216296 | Ga0207669_102162962 | 49 |
| 621 | 3300025937 | Ga0207669_10888221 | Ga0207669_108882212 | 49 |
| 622 | 3300025937 | Ga0207669_11336877 | Ga0207669_113368771 | 49 |
| 623 | 3300025938 | Ga0207704_10001879 | Ga0207704_100018797 | 49 |
| 624 | 3300025939 | Ga0207665_11581066 | Ga0207665_115810662 | 49 |
| 625 | 3300025940 | Ga0207691_10000101 | Ga0207691_1000010156 | 49 |
| 626 | 3300025940 | Ga0207691_10523510 | Ga0207691_105235106 | 49 |
| 627 | 3300025941 | Ga0207711_10000026 | Ga0207711_10000026102 | 49 |
| 628 | 3300025941 | Ga0207711_10124922 | Ga0207711_101249224 | 49 |
| 629 | 3300025941 | Ga0207711_10340827 | Ga0207711_103408272 | 49 |
| 630 | 3300025942 | Ga0207689_10000999 | Ga0207689_1000099914 | 49 |
| 631 | 3300025942 | Ga0207689_10391452 | Ga0207689_103914522 | 49 |
| 632 | 3300025942 | Ga0207689_10512904 | Ga0207689_105129041 | 49 |
| 633 | 3300025944 | Ga0207661_10004428 | Ga0207661_100044286 | 49 |
| 634 | 3300025944 | Ga0207661_10037912 | Ga0207661_100379126 | 49 |
| 635 | 3300025944 | Ga0207661_10764113 | Ga0207661_107641133 | 49 |
| 636 | 3300025944 | Ga0207661_11373696 | Ga0207661_113736963 | 49 |
| 637 | 3300025944 | Ga0207661_11703449 | Ga0207661_117034491 | 49 |
| 638 | 3300025945 | Ga0207679_10000393 | Ga0207679_100003935 | 49 |
| 639 | 3300025945 | Ga0207679_10001292 | Ga0207679_100012925 | 49 |
| 640 | 3300025945 | Ga0207679_10007830 | Ga0207679_100078309 | 49 |
| 641 | 3300025945 | Ga0207679_10319244 | Ga0207679_103192442 | 49 |
| 642 | 3300025949 | Ga0207667_10005424 | Ga0207667_100054247 | 49 |
| 643 | 3300025960 | Ga0207651_10000112 | Ga0207651_1000011215 | 49 |
| 644 | 3300025960 | Ga0207651_10063113 | Ga0207651_100631136 | 49 |
| 645 | 3300025961 | Ga0207712_10002247 | Ga0207712_100022477 | 49 |
| 646 | 3300025961 | Ga0207712_11389854 | Ga0207712_113898542 | 49 |
| 647 | 3300025972 | Ga0207668_10003548 | Ga0207668_1000354811 | 49 |
| 648 | 3300025972 | Ga0207668_10194260 | Ga0207668_101942602 | 49 |
| 649 | 3300025981 | Ga0207640_10001473 | Ga0207640_100014737 | 49 |
| 650 | 3300025986 | Ga0207658_10000036 | Ga0207658_10000036124 | 49 |
| 651 | 3300025986 | Ga0207658_11228910 | Ga0207658_112289102 | 49 |
| 652 | 3300025986 | Ga0207658_11725005 | Ga0207658_117250052 | 49 |
| 653 | 3300026023 | Ga0207677_10000459 | Ga0207677_1000045914 | 49 |
| 654 | 3300026023 | Ga0207677_10350386 | Ga0207677_103503863 | 49 |
| 655 | 3300026023 | Ga0207677_10740944 | Ga0207677_107409442 | 49 |
| 656 | 3300026035 | Ga0207703_10003676 | Ga0207703_1000367615 | 49 |
| 657 | 3300026035 | Ga0207703_11240962 | Ga0207703_112409622 | 49 |
| 658 | 3300026035 | Ga0207703_12111535 | Ga0207703_121115352 | 49 |
| 659 | 3300026041 | Ga0207639_10010826 | Ga0207639_100108268 | 49 |
| 660 | 3300026067 | Ga0207678_10001767 | Ga0207678_1000176713 | 49 |
| 661 | 3300026067 | Ga0207678_10204688 | Ga0207678_102046884 | 49 |
| 662 | 3300026075 | Ga0207708_10114338 | Ga0207708_101143386 | 49 |
| 663 | 3300026075 | Ga0207708_11520295 | Ga0207708_115202951 | 49 |
| 664 | 3300026078 | Ga0207702_10013600 | Ga0207702_1001360010 | 49 |
| 665 | 3300026088 | Ga0207641_10001084 | Ga0207641_1000108414 | 49 |
| 666 | 3300026088 | Ga0207641_10453515 | Ga0207641_104535152 | 49 |
| 667 | 3300026088 | Ga0207641_10615867 | Ga0207641_106158673 | 49 |
| 668 | 3300026088 | Ga0207641_11881359 | Ga0207641_118813591 | 49 |
| 669 | 3300026089 | Ga0207648_10000449 | Ga0207648_1000044914 | 49 |
| 670 | 3300026089 | Ga0207648_11947316 | Ga0207648_119473163 | 49 |
| 671 | 3300026095 | Ga0207676_10000726 | Ga0207676_1000072622 | 49 |
| 672 | 3300026095 | Ga0207676_12160258 | Ga0207676_121602583 | 49 |
| 673 | 3300026116 | Ga0207674_10017732 | Ga0207674_100177328 | 49 |
| 674 | 3300026116 | Ga0207674_10139947 | Ga0207674_101399472 | 49 |
| 675 | 3300026116 | Ga0207674_10140708 | Ga0207674_101407085 | 49 |
| 676 | 3300026118 | Ga0207675_100000037 | Ga0207675_10000003728 | 49 |
| 677 | 3300026118 | Ga0207675_100208345 | Ga0207675_1002083456 | 49 |
| 678 | 3300026118 | Ga0207675_101240442 | Ga0207675_1012404422 | 49 |
| 679 | 3300026118 | Ga0207675_101749155 | Ga0207675_1017491552 | 49 |
| 680 | 3300026118 | Ga0207675_102051990 | Ga0207675_1020519902 | 49 |
| 681 | 3300026121 | Ga0207683_10000506 | Ga0207683_1000050611 | 49 |
| 682 | 3300026121 | Ga0207683_10448030 | Ga0207683_104480302 | 49 |
| 683 | 3300026121 | Ga0207683_11197926 | Ga0207683_111979262 | 49 |
| 684 | 3300026121 | Ga0207683_11644140 | Ga0207683_116441401 | 49 |
| 685 | 3300026121 | Ga0207683_12021902 | Ga0207683_120219021 | 49 |
| 686 | 3300026142 | Ga0207698_10001702 | Ga0207698_100017027 | 49 |
| 687 | 3300027364 | Ga0209967_1032069 | Ga0209967_10320692 | 49 |
| 688 | 3300027424 | Ga0209984_1061099 | Ga0209984_10610992 | 49 |
| 689 | 3300027617 | Ga0210002_1033805 | Ga0210002_10338052 | 49 |
| 690 | 3300027665 | Ga0209983_1088459 | Ga0209983_10884591 | 49 |
| 691 | 3300027671 | Ga0209588_1229479 | Ga0209588_12294792 | 49 |
| 692 | 3300027682 | Ga0209971_1121391 | Ga0209971_11213911 | 49 |
| 693 | 3300027717 | Ga0209998_10182524 | Ga0209998_101825242 | 49 |
| 694 | 3300027876 | Ga0209974_10225013 | Ga0209974_102250132 | 49 |
| 695 | 3300027876 | Ga0209974_10242946 | Ga0209974_102429462 | 49 |
| 696 | 3300027907 | Ga0207428_10000004 | Ga0207428_10000004227 | 49 |
| 697 | 3300027907 | Ga0207428_10030983 | Ga0207428_100309838 | 49 |
| 698 | 3300027907 | Ga0207428_10054932 | Ga0207428_100549326 | 49 |
| 699 | 3300027907 | Ga0207428_10367852 | Ga0207428_103678524 | 49 |
| 700 | 3300028379 | Ga0268266_10000156 | Ga0268266_1000015616 | 49 |
| 701 | 3300028379 | Ga0268266_11138777 | Ga0268266_111387772 | 49 |
| 702 | 3300028379 | Ga0268266_11735628 | Ga0268266_117356281 | 49 |
| 703 | 3300028380 | Ga0268265_10000855 | Ga0268265_1000085514 | 49 |
| 704 | 3300028380 | Ga0268265_10038559 | Ga0268265_100385598 | 49 |
| 705 | 3300028380 | Ga0268265_10186346 | Ga0268265_101863463 | 49 |
| 706 | 3300028380 | Ga0268265_11145116 | Ga0268265_111451162 | 49 |
| 707 | 3300028380 | Ga0268265_11223607 | Ga0268265_112236072 | 49 |
| 708 | 3300028380 | Ga0268265_12349821 | Ga0268265_123498212 | 49 |
| 709 | 3300028381 | Ga0268264_10000090 | Ga0268264_10000090158 | 49 |
| 710 | 3300028381 | Ga0268264_10277661 | Ga0268264_102776612 | 49 |
| 711 | 3300028381 | Ga0268264_10336024 | Ga0268264_103360242 | 49 |
| 712 | 3300028381 | Ga0268264_11289779 | Ga0268264_112897791 | 49 |
| 713 | 3300028381 | Ga0268264_11880225 | Ga0268264_118802252 | 49 |
| 714 | 3300031238 | Ga0265332_10200700 | Ga0265332_102007002 | 49 |
| 715 | 3300031250 | Ga0265331_10215794 | Ga0265331_102157943 | 49 |
| 716 | 3300031344 | Ga0265316_10164478 | Ga0265316_101644784 | 49 |
| 717 | 3300031548 | Ga0307408_100239976 | Ga0307408_1002399762 | 49 |
| 718 | 3300031548 | Ga0307408_100307082 | Ga0307408_1003070822 | 49 |
| 719 | 3300031727 | Ga0316576_10185680 | Ga0316576_101856802 | 49 |
| 720 | 3300031731 | Ga0307405_10838037 | Ga0307405_108380372 | 49 |
| 721 | 3300031731 | Ga0307405_11462002 | Ga0307405_114620022 | 49 |
| 722 | 3300031824 | Ga0307413_11382370 | Ga0307413_113823703 | 49 |
| 723 | 3300031901 | Ga0307406_10830787 | Ga0307406_108307873 | 49 |
| 724 | 3300031901 | Ga0307406_11988421 | Ga0307406_119884211 | 49 |
| 725 | 3300031903 | Ga0307407_10461032 | Ga0307407_104610324 | 49 |
| 726 | 3300031903 | Ga0307407_10632376 | Ga0307407_106323763 | 49 |
| 727 | 3300031903 | Ga0307407_11579761 | Ga0307407_115797612 | 49 |
| 728 | 3300031911 | Ga0307412_11876898 | Ga0307412_118768982 | 49 |
| 729 | 3300031995 | Ga0307409_100099346 | Ga0307409_1000993464 | 49 |
| 730 | 3300031995 | Ga0307409_101705155 | Ga0307409_1017051552 | 49 |
| 731 | 3300031995 | Ga0307409_101915690 | Ga0307409_1019156902 | 49 |
| 732 | 3300031995 | Ga0307409_102762325 | Ga0307409_1027623251 | 49 |
| 733 | 3300032002 | Ga0307416_100847193 | Ga0307416_1008471931 | 49 |
| 734 | 3300032002 | Ga0307416_100919822 | Ga0307416_1009198222 | 49 |
| 735 | 3300032002 | Ga0307416_101039903 | Ga0307416_1010399031 | 49 |
| 736 | 3300032002 | Ga0307416_102243701 | Ga0307416_1022437012 | 49 |
| 737 | 3300032005 | Ga0307411_10865099 | Ga0307411_108650993 | 49 |
| 738 | 3300032126 | Ga0307415_100637849 | Ga0307415_1006378492 | 49 |
| 739 | 3300032126 | Ga0307415_100661168 | Ga0307415_1006611681 | 49 |
| 740 | 3300032139 | Ga0316580_10230074 | Ga0316580_102300742 | 49 |
| 741 | 3300034819 | Ga0373958_0118957 | Ga0373958_0118957_35_184 | 49 |
| 742 | 3300035083 | Ga0373926_0095583 | Ga0373926_0095583_237_389 | 49 |
| 743 | 3300035085 | Ga0373929_0057286 | Ga0373929_0057286_243_392 | 49 |
| 744 | 3300035086 | Ga0373934_0110993 | Ga0373934_0110993_739_891 | 49 |
| 745 | 3300035088 | Ga0373940_0261932 | Ga0373940_0261932_69_218 | 49 |
| 746 | 3300035090 | Ga0373949_0263861 | Ga0373949_0263861_112_276 | 49 |
| 747 | 3300035111 | Ga0373923_0707967 | Ga0373923_0707967_104_256 | 49 |
| 748 | 3300035112 | Ga0373932_0365339 | Ga0373932_0365339_327_479 | 49 |
| 749 | 3300035115 | Ga0373941_0043987 | Ga0373941_0043987_518_682 | 49 |
| 750 | 3300035117 | Ga0373953_0121062 | Ga0373953_0121062_830_982 | 49 |
| 751 | 3300035118 | Ga0373954_0004418 | Ga0373954_0004418_972_1124 | 49 |
| 752 | 3300035119 | Ga0373956_0004023 | Ga0373956_0004023_3605_3757 | 49 |
| 753 | 3300035120 | Ga0373957_0242027 | Ga0373957_0242027_92_244 | 49 |
| 754 | 3300035121 | Ga0373960_0257277 | Ga0373960_0257277_190_354 | 49 |
| 755 | 3300035121 | Ga0373960_0291862 | Ga0373960_0291862_394_558 | 49 |
| 756 | 3300035121 | Ga0373960_0422008 | Ga0373960_0422008_103_252 | 49 |
| 757 | 3300035172 | Ga0373955_0071638 | Ga0373955_0071638_675_827 | 49 |
| 758 | 3300035172 | Ga0373955_0641886 | Ga0373955_0641886_145_294 | 49 |
| 759 | 3300035410 | Ga0373924_0175712 | Ga0373924_0175712_490_642 | 49 |
| 760 | 3300035692 | Ga0373935_0588040 | Ga0373935_0588040_75_227 | 49 |
| 761 | 3300035695 | Ga0373927_0046192 | Ga0373927_0046192_744_896 | 49 |
| 762 | 3300036401 | Ga0373937_0131705 | Ga0373937_0131705_957_1109 | 49 |
| 763 | 3300036401 | Ga0373937_1316823 | Ga0373937_1316823_166_315 | 49 |
| 764 | 3300036647 | Ga0316582_0473590 | Ga0316582_0473590_296_445 | 49 |
| 765 | 3300038727 | Ga0400491_05839 | Ga0400491_05839_1208_1372 | 49 |
| 766 | 3300039437 | Ga0436365_0792880 | Ga0436365_0792880_405_554 | 49 |
| 767 | 3300039450 | Ga0436363_1539500 | Ga0436363_1539500_799_963 | 49 |
| 768 | 3300041408 | Ga0439453_0023785 | Ga0439453_0023785_92_241 | 49 |
| 769 | 3300041410 | Ga0439461_0023618 | Ga0439461_0023618_97_246 | 49 |
| 770 | 3300041451 | Ga0451791_0576223 | Ga0451791_0576223_473_622 | 49 |
| 771 | 3300041451 | Ga0451791_0601765 | Ga0451791_0601765_457_606 | 49 |
| 772 | 3300041458 | Ga0451798_0553446 | Ga0451798_0553446_435_584 | 49 |
| 773 | 3300041494 | Ga0451837_0776061 | Ga0451837_0776061_254_403 | 49 |
| 774 | 3300041501 | Ga0451845_0569374 | Ga0451845_0569374_52_201 | 49 |
| 775 | 3300041501 | Ga0451845_0705662 | Ga0451845_0705662_455_604 | 49 |
| 776 | 3300041504 | Ga0451848_10600 | Ga0451848_10600_211_360 | 49 |
| 777 | 3300041512 | Ga0451853_3373278 | Ga0451853_3373278_474_623 | 49 |
| 778 | 3300041999 | Ga0439433_0067066 | Ga0439433_0067066_301_450 | 49 |
| 779 | 3300042005 | Ga0439448_0182765 | Ga0439448_0182765_232_396 | 49 |
| 780 | 3300042009 | Ga0439451_036312 | Ga0439451_036312_437_586 | 49 |
| 781 | 3300042012 | Ga0439455_0028811 | Ga0439455_0028811_340_504 | 49 |
| 782 | 3300042014 | Ga0439457_061005 | Ga0439457_061005_659_808 | 49 |
| 783 | 3300042015 | Ga0439462_0157175 | Ga0439462_0157175_324_473 | 49 |
| 784 | 3300042116 | Ga0450912_022375 | Ga0450912_022375_220_369 | 49 |
| 785 | 3300042122 | Ga0450920_003080 | Ga0450920_003080_1742_1891 | 49 |
| 786 | 3300042125 | Ga0450923_001669 | Ga0450923_001669_2106_2255 | 49 |
| 787 | 3300042131 | Ga0450894_000786 | Ga0450894_000786_4621_4770 | 49 |
| 788 | 3300042132 | Ga0450895_000378 | Ga0450895_000378_902_1051 | 49 |
| 789 | 3300042132 | Ga0450895_012963 | Ga0450895_012963_177_326 | 49 |
| 790 | 3300042133 | Ga0450896_009967 | Ga0450896_009967_637_786 | 49 |
| 791 | 3300042135 | Ga0450899_011216 | Ga0450899_011216_451_600 | 49 |
| 792 | 3300042156 | Ga0439446_0002581 | Ga0439446_0002581_1568_1717 | 49 |
| 793 | 3300042156 | Ga0439446_0208736 | Ga0439446_0208736_494_643 | 49 |
| 794 | 3300042184 | Ga0450908_020949 | Ga0450908_020949_599_748 | 49 |
| 795 | 3300042435 | Ga0439434_0002754 | Ga0439434_0002754_1771_1920 | 49 |
| 796 | 3300042436 | Ga0439435_0014359 | Ga0439435_0014359_1335_1484 | 49 |
| 797 | 3300042438 | Ga0439459_0029157 | Ga0439459_0029157_922_1086 | 49 |
| 798 | 3300042439 | Ga0439464_0225796 | Ga0439464_0225796_281_445 | 49 |
| 799 | 3300042461 | Ga0439460_0377211 | Ga0439460_0377211_116_265 | 49 |
| 800 | 3300042876 | Ga0451577_0498262 | Ga0451577_0498262_83_232 | 49 |
| 801 | 3300042876 | Ga0451577_0636787 | Ga0451577_0636787_679_828 | 49 |
| 802 | 3300044673 | Ga0453683_0053588 | Ga0453683_0053588_1562_1720 | 49 |
| 803 | 3300044673 | Ga0453683_0096485 | Ga0453683_0096485_495_653 | 49 |
| 804 | 3300044673 | Ga0453683_0401546 | Ga0453683_0401546_127_285 | 49 |
| 805 | 3300044673 | Ga0453683_0634480 | Ga0453683_0634480_463_612 | 49 |
| 806 | 3300044712 | Ga0453684_0024329 | Ga0453684_0024329_8485_8634 | 49 |
| 807 | 3300044712 | Ga0453684_0115797 | Ga0453684_0115797_1527_1685 | 49 |
| 808 | 3300044712 | Ga0453684_0138714 | Ga0453684_0138714_2386_2544 | 49 |
| 809 | 3300044712 | Ga0453684_0453090 | Ga0453684_0453090_268_432 | 49 |
| 810 | 3300045051 | Ga0451576_0026098 | Ga0451576_0026098_147_296 | 49 |
| 811 | 3300045051 | Ga0451576_0171103 | Ga0451576_0171103_1457_1615 | 49 |
| 812 | 3300045051 | Ga0451576_0358412 | Ga0451576_0358412_394_558 | 49 |
| 813 | 3300045051 | Ga0451576_0659526 | Ga0451576_0659526_925_1083 | 49 |
| 814 | 3300045051 | Ga0451576_0907465 | Ga0451576_0907465_649_813 | 49 |
| 815 | 3300045051 | Ga0451576_1491830 | Ga0451576_1491830_28_186 | 49 |
| 816 | 3300045051 | Ga0451576_2557255 | Ga0451576_2557255_190_339 | 49 |
| 817 | 3300046455 | Ga0495603_0275351 | Ga0495603_0275351_556_705 | 49 |
| 818 | 3300046459 | Ga0495629_0421594 | Ga0495629_0421594_174_338 | 49 |
| 819 | 3300046462 | Ga0495651_0919944 | Ga0495651_0919944_304_456 | 49 |
| 820 | 3300046472 | Ga0495580_0802896 | Ga0495580_0802896_121_273 | 49 |
| 821 | 3300046477 | Ga0495664_0938036 | Ga0495664_0938036_170_319 | 49 |
| 822 | 3300046517 | Ga0495630_1062220 | Ga0495630_1062220_227_376 | 49 |
| 823 | 3300046525 | Ga0495663_0098784 | Ga0495663_0098784_271_435 | 49 |
| 824 | 3300046535 | Ga0495586_0488388 | Ga0495586_0488388_392_541 | 49 |
| 825 | 3300046538 | Ga0495609_0309350 | Ga0495609_0309350_400_549 | 49 |
| 826 | 3300046616 | Ga0495668_0530353 | Ga0495668_0530353_166_315 | 49 |
| 827 | 3300046642 | Ga0495634_0041616 | Ga0495634_0041616_1951_2100 | 49 |
| 828 | 3300046683 | Ga0495658_0068988 | Ga0495658_0068988_1065_1217 | 49 |
| 829 | 3300046689 | Ga0495613_0526537 | Ga0495613_0526537_580_732 | 49 |
| 830 | 3300046691 | Ga0495670_0416147 | Ga0495670_0416147_17_181 | 49 |
| 831 | 3300047318 | Ga0495636_0267158 | Ga0495636_0267158_361_525 | 49 |
| 832 | 3300047320 | Ga0495672_0002464 | Ga0495672_0002464_6339_6488 | 49 |
| 833 | 3300047447 | Ga0495685_291208 | Ga0495685_291208_83_247 | 49 |
| 834 | 3300048089 | Ga0495614_0199635 | Ga0495614_0199635_371_535 | 49 |
| 835 | 3300048903 | Ga0496100_0793316 | Ga0496100_0793316_138_287 | 49 |
| 836 | 3300048903 | Ga0496100_1084499 | Ga0496100_1084499_346_510 | 49 |
| 837 | 3300048904 | Ga0496101_0574208 | Ga0496101_0574208_90_239 | 49 |
| 838 | 3300048905 | Ga0496102_0521311 | Ga0496102_0521311_949_1098 | 49 |
| 839 | 3300048906 | Ga0496103_0747079 | Ga0496103_0747079_315_464 | 49 |
| 840 | 3300048907 | Ga0496104_0004897 | Ga0496104_0004897_7321_7470 | 49 |
| 841 | 3300048908 | Ga0496105_0311917 | Ga0496105_0311917_402_551 | 49 |
| 842 | 3300048910 | Ga0496107_0489041 | Ga0496107_0489041_694_843 | 49 |
| 843 | 3300048911 | Ga0496108_0000658 | Ga0496108_0000658_1431_1580 | 49 |
| 844 | 3300048912 | Ga0496109_0011768 | Ga0496109_0011768_2906_3055 | 49 |
| 845 | 3300048912 | Ga0496109_0095825 | Ga0496109_0095825_23_187 | 49 |
| 846 | 3300048912 | Ga0496109_0688905 | Ga0496109_0688905_181_339 | 49 |
| 847 | 3300048912 | Ga0496109_0881463 | Ga0496109_0881463_275_439 | 49 |
| 848 | 3300048913 | Ga0496110_0033880 | Ga0496110_0033880_3301_3450 | 49 |
| 849 | 3300048913 | Ga0496110_1155401 | Ga0496110_1155401_39_197 | 49 |
| 850 | 3300048913 | Ga0496110_1836776 | Ga0496110_1836776_257_406 | 49 |
| 851 | 3300048915 | Ga0496112_0009883 | Ga0496112_0009883_5643_5792 | 49 |
| 852 | 3300048915 | Ga0496112_0545395 | Ga0496112_0545395_49_198 | 49 |
| 853 | 3300048915 | Ga0496112_0554222 | Ga0496112_0554222_61_210 | 49 |
| 854 | 3300048916 | Ga0496113_1135973 | Ga0496113_1135973_262_411 | 49 |
| 855 | 3300048928 | Ga0496125_0751795 | Ga0496125_0751795_160_324 | 49 |
| 856 | 3300049127 | Ga0501306_044899 | Ga0501306_044899_180_344 | 49 |
| 857 | 3300049129 | Ga0501309_015734 | Ga0501309_015734_687_851 | 49 |
| 858 | 3300049161 | Ga0501305_097530 | Ga0501305_097530_163_312 | 49 |
| 859 | 3300049515 | Ga0501292_067738 | Ga0501292_067738_258_422 | 49 |
| 860 | 3300049528 | Ga0501312_110697 | Ga0501312_110697_192_356 | 49 |
| 861 | 3300049529 | Ga0501313_040458 | Ga0501313_040458_171_335 | 49 |
| 862 | 3300049531 | Ga0501315_103948 | Ga0501315_103948_169_333 | 49 |
| 863 | 3300049534 | Ga0501318_015245 | Ga0501318_015245_577_741 | 49 |
| 864 | 3300049535 | Ga0501319_009823 | Ga0501319_009823_539_703 | 49 |
| 865 | 3300049537 | Ga0501321_027855 | Ga0501321_027855_442_606 | 49 |
| 866 | 3300049537 | Ga0501321_029343 | Ga0501321_029343_170_334 | 49 |
| 867 | 3300049539 | Ga0501323_074601 | Ga0501323_074601_211_375 | 49 |
| 868 | 3300049541 | Ga0501325_018991 | Ga0501325_018991_111_275 | 49 |
| 869 | 3300049568 | Ga0501031_0171039 | Ga0501031_0171039_839_997 | 49 |
| 870 | 3300049568 | Ga0501031_0285866 | Ga0501031_0285866_620_769 | 49 |
| 871 | 3300049568 | Ga0501031_0571448 | Ga0501031_0571448_560_709 | 49 |
| 872 | 3300049569 | Ga0501032_0040830 | Ga0501032_0040830_747_896 | 49 |
| 873 | 3300049570 | Ga0501033_0636794 | Ga0501033_0636794_270_419 | 49 |
| 874 | 3300049570 | Ga0501033_1096856 | Ga0501033_1096856_342_491 | 49 |
| 875 | 3300049571 | Ga0501034_0037393 | Ga0501034_0037393_1148_1297 | 49 |
| 876 | 3300049571 | Ga0501034_0096601 | Ga0501034_0096601_968_1117 | 49 |
| 877 | 3300049571 | Ga0501034_0112215 | Ga0501034_0112215_1401_1550 | 49 |
| 878 | 3300049572 | Ga0501036_0067215 | Ga0501036_0067215_1098_1247 | 49 |
| 879 | 3300049572 | Ga0501036_0328612 | Ga0501036_0328612_134_283 | 49 |
| 880 | 3300049572 | Ga0501036_0754311 | Ga0501036_0754311_91_240 | 49 |
| 881 | 3300049572 | Ga0501036_0835578 | Ga0501036_0835578_128_277 | 49 |
| 882 | 3300049572 | Ga0501036_1691777 | Ga0501036_1691777_296_454 | 49 |
| 883 | 3300049573 | Ga0501037_0120192 | Ga0501037_0120192_593_742 | 49 |
| 884 | 3300049573 | Ga0501037_0287476 | Ga0501037_0287476_206_355 | 49 |
| 885 | 3300049573 | Ga0501037_0429266 | Ga0501037_0429266_334_483 | 49 |
| 886 | 3300049573 | Ga0501037_0609759 | Ga0501037_0609759_303_452 | 49 |
| 887 | 3300049574 | Ga0501038_0012873 | Ga0501038_0012873_203_352 | 49 |
| 888 | 3300049574 | Ga0501038_0105891 | Ga0501038_0105891_1128_1277 | 49 |
| 889 | 3300049574 | Ga0501038_0449695 | Ga0501038_0449695_340_498 | 49 |
| 890 | 3300049575 | Ga0501039_0313832 | Ga0501039_0313832_725_874 | 49 |
| 891 | 3300049575 | Ga0501039_0365469 | Ga0501039_0365469_735_884 | 49 |
| 892 | 3300049575 | Ga0501039_1355157 | Ga0501039_1355157_92_250 | 49 |
| 893 | 3300049576 | Ga0501040_0006547 | Ga0501040_0006547_1645_1794 | 49 |
| 894 | 3300049576 | Ga0501040_0876652 | Ga0501040_0876652_396_554 | 49 |
| 895 | 3300049576 | Ga0501040_1006733 | Ga0501040_1006733_412_561 | 49 |
| 896 | 3300049577 | Ga0501041_0014846 | Ga0501041_0014846_596_745 | 49 |
| 897 | 3300049577 | Ga0501041_0030844 | Ga0501041_0030844_178_327 | 49 |
| 898 | 3300049578 | Ga0501042_0039517 | Ga0501042_0039517_131_280 | 49 |
| 899 | 3300049578 | Ga0501042_0100169 | Ga0501042_0100169_157_306 | 49 |
| 900 | 3300049578 | Ga0501042_0181118 | Ga0501042_0181118_878_1036 | 49 |
| 901 | 3300049578 | Ga0501042_0309575 | Ga0501042_0309575_966_1115 | 49 |
| 902 | 3300049578 | Ga0501042_0500644 | Ga0501042_0500644_310_459 | 49 |
| 903 | 3300049578 | Ga0501042_0565847 | Ga0501042_0565847_248_397 | 49 |
| 904 | 3300049578 | Ga0501042_1367850 | Ga0501042_1367850_247_405 | 49 |
| 905 | 3300049579 | Ga0501043_0027314 | Ga0501043_0027314_3185_3334 | 49 |
| 906 | 3300049579 | Ga0501043_0038310 | Ga0501043_0038310_851_1000 | 49 |
| 907 | 3300049579 | Ga0501043_0189802 | Ga0501043_0189802_773_922 | 49 |
| 908 | 3300049580 | Ga0501046_0002275 | Ga0501046_0002275_3034_3183 | 49 |
| 909 | 3300049580 | Ga0501046_0176973 | Ga0501046_0176973_282_431 | 49 |
| 910 | 3300049580 | Ga0501046_0199609 | Ga0501046_0199609_277_435 | 49 |
| 911 | 3300049580 | Ga0501046_0390831 | Ga0501046_0390831_718_867 | 49 |
| 912 | 3300049580 | Ga0501046_1140300 | Ga0501046_1140300_230_379 | 49 |
| 913 | 3300049581 | Ga0501047_0025147 | Ga0501047_0025147_3623_3772 | 49 |
| 914 | 3300049581 | Ga0501047_0184413 | Ga0501047_0184413_1522_1671 | 49 |
| 915 | 3300049581 | Ga0501047_0466493 | Ga0501047_0466493_533_697 | 49 |
| 916 | 3300049582 | Ga0501048_0179363 | Ga0501048_0179363_1041_1190 | 49 |
| 917 | 3300049582 | Ga0501048_0197876 | Ga0501048_0197876_1176_1325 | 49 |
| 918 | 3300049582 | Ga0501048_0401275 | Ga0501048_0401275_96_254 | 49 |
| 919 | 3300049582 | Ga0501048_0707647 | Ga0501048_0707647_91_240 | 49 |
| 920 | 3300049582 | Ga0501048_1238148 | Ga0501048_1238148_133_282 | 49 |
| 921 | 3300049582 | Ga0501048_1357835 | Ga0501048_1357835_205_354 | 49 |
| 922 | 3300049583 | Ga0501067_0157007 | Ga0501067_0157007_815_964 | 49 |
| 923 | 3300049584 | Ga0501068_0594834 | Ga0501068_0594834_187_345 | 49 |
| 924 | 3300049585 | Ga0501069_0710597 | Ga0501069_0710597_442_591 | 49 |
| 925 | 3300049585 | Ga0501069_0944057 | Ga0501069_0944057_318_467 | 49 |
| 926 | 3300049587 | Ga0501071_0018416 | Ga0501071_0018416_751_900 | 49 |
| 927 | 3300049588 | Ga0501072_0128959 | Ga0501072_0128959_350_499 | 49 |
| 928 | 3300049588 | Ga0501072_0247455 | Ga0501072_0247455_85_234 | 49 |
| 929 | 3300049588 | Ga0501072_0694870 | Ga0501072_0694870_169_318 | 49 |
| 930 | 3300049588 | Ga0501072_0800186 | Ga0501072_0800186_485_634 | 49 |
| 931 | 3300049588 | Ga0501072_0874141 | Ga0501072_0874141_169_327 | 49 |
| 932 | 3300049588 | Ga0501072_1264405 | Ga0501072_1264405_80_229 | 49 |
| 933 | 3300049589 | Ga0501073_0233769 | Ga0501073_0233769_881_1030 | 49 |
| 934 | 3300049590 | Ga0501074_0150139 | Ga0501074_0150139_255_404 | 49 |
| 935 | 3300049590 | Ga0501074_0374671 | Ga0501074_0374671_575_733 | 49 |
| 936 | 3300049591 | Ga0501075_0544097 | Ga0501075_0544097_632_781 | 49 |
| 937 | 3300049591 | Ga0501075_0571092 | Ga0501075_0571092_528_677 | 49 |
| 938 | 3300049591 | Ga0501075_1427584 | Ga0501075_1427584_78_227 | 49 |
| 939 | 3300049592 | Ga0501076_0002067 | Ga0501076_0002067_4290_4439 | 49 |
| 940 | 3300049592 | Ga0501076_0165987 | Ga0501076_0165987_525_674 | 49 |
| 941 | 3300049592 | Ga0501076_0193268 | Ga0501076_0193268_1029_1178 | 49 |
| 942 | 3300049592 | Ga0501076_0297024 | Ga0501076_0297024_1030_1179 | 49 |
| 943 | 3300049592 | Ga0501076_1207689 | Ga0501076_1207689_378_527 | 49 |
| 944 | 3300049592 | Ga0501076_1210229 | Ga0501076_1210229_168_326 | 49 |
| 945 | 3300049593 | Ga0501077_0009857 | Ga0501077_0009857_5608_5757 | 49 |
| 946 | 3300049593 | Ga0501077_0726427 | Ga0501077_0726427_236_385 | 49 |
| 947 | 3300049593 | Ga0501077_0817668 | Ga0501077_0817668_127_276 | 49 |
| 948 | 3300049661 | Ga0501217_295153 | Ga0501217_295153_89_238 | 49 |
| 949 | 3300049705 | Ga0501225_0129961 | Ga0501225_0129961_333_482 | 49 |
| 950 | 3300049741 | Ga0501079_0001902 | Ga0501079_0001902_12076_12225 | 49 |
| 951 | 3300049741 | Ga0501079_0365763 | Ga0501079_0365763_868_1017 | 49 |
| 952 | 3300049741 | Ga0501079_0734069 | Ga0501079_0734069_139_288 | 49 |
| 953 | 3300049741 | Ga0501079_1005604 | Ga0501079_1005604_120_278 | 49 |
| 954 | 3300049741 | Ga0501079_1487773 | Ga0501079_1487773_151_300 | 49 |
| 955 | 3300049742 | Ga0501080_0149023 | Ga0501080_0149023_1738_1887 | 49 |
| 956 | 3300049742 | Ga0501080_0198283 | Ga0501080_0198283_1520_1669 | 49 |
| 957 | 3300049743 | Ga0501081_0001000 | Ga0501081_0001000_1111_1260 | 49 |
| 958 | 3300049743 | Ga0501081_0160123 | Ga0501081_0160123_1277_1426 | 49 |
| 959 | 3300049743 | Ga0501081_0173194 | Ga0501081_0173194_616_765 | 49 |
| 960 | 3300049743 | Ga0501081_0769329 | Ga0501081_0769329_416_565 | 49 |
| 961 | 3300049743 | Ga0501081_0829009 | Ga0501081_0829009_88_237 | 49 |
| 962 | 3300049744 | Ga0501083_0046353 | Ga0501083_0046353_1643_1792 | 49 |
| 963 | 3300049744 | Ga0501083_0163514 | Ga0501083_0163514_159_308 | 49 |
| 964 | 3300049771 | Ga0501274_027122 | Ga0501274_027122_278_442 | 49 |
| 965 | 3300049822 | Ga0501035_0000901 | Ga0501035_0000901_31019_31183 | 49 |
| 966 | 3300049822 | Ga0501035_0236442 | Ga0501035_0236442_881_1030 | 49 |
| 967 | 3300049822 | Ga0501035_0503293 | Ga0501035_0503293_156_305 | 49 |
| 968 | 3300049822 | Ga0501035_0842153 | Ga0501035_0842153_272_430 | 49 |
| 969 | 3300049822 | Ga0501035_0842737 | Ga0501035_0842737_449_607 | 49 |
| 970 | 3300049823 | Ga0501044_0245704 | Ga0501044_0245704_417_566 | 49 |
| 971 | 3300049824 | Ga0501045_0217869 | Ga0501045_0217869_955_1104 | 49 |
| 972 | 3300049824 | Ga0501045_0293769 | Ga0501045_0293769_83_232 | 49 |
| 973 | 3300049824 | Ga0501045_0361671 | Ga0501045_0361671_911_1060 | 49 |
| 974 | 3300049824 | Ga0501045_0983307 | Ga0501045_0983307_448_597 | 49 |
| 975 | 3300050489 | nmdc:mga03683_183227_c1 | nmdc:mga03683_183227_c1_676_825 | 49 |
| 976 | 3300050494 | nmdc:mga06z11_95702_c1 | nmdc:mga06z11_95702_c1_373_522 | 49 |
| 977 | 3300050496 | nmdc:mga07m45_639155_c1 | nmdc:mga07m45_639155_c1_322_471 | 49 |
| 978 | 3300050507 | nmdc:mga05p37_117437_c1 | nmdc:mga05p37_117437_c1_2991_3140 | 49 |
| 979 | 3300050507 | nmdc:mga05p37_1232308_c1 | nmdc:mga05p37_1232308_c1_291_443 | 49 |
| 980 | 3300050507 | nmdc:mga05p37_174_c1 | nmdc:mga05p37_174_c1_41691_41840 | 49 |
| 981 | 3300050507 | nmdc:mga05p37_200209_c1 | nmdc:mga05p37_200209_c1_38_187 | 49 |
| 982 | 3300050508 | nmdc:mga09592_1358389_c1 | nmdc:mga09592_1358389_c1_280_432 | 49 |
| 983 | 3300050508 | nmdc:mga09592_51946_c1 | nmdc:mga09592_51946_c1_204_362 | 49 |
| 984 | 3300050508 | nmdc:mga09592_708228_c1 | nmdc:mga09592_708228_c1_349_498 | 49 |
| 985 | 3300050508 | nmdc:mga09592_926749_c1 | nmdc:mga09592_926749_c1_90_242 | 49 |
| 986 | 3300050509 | nmdc:mga0qj67_732324_c1 | nmdc:mga0qj67_732324_c1_326_478 | 49 |
| 987 | 3300050509 | nmdc:mga0qj67_797599_c1 | nmdc:mga0qj67_797599_c1_387_545 | 49 |
| 988 | 3300050510 | nmdc:mga06r32_191119_c1 | nmdc:mga06r32_191119_c1_1509_1658 | 49 |
| 989 | 3300050510 | nmdc:mga06r32_214748_c1 | nmdc:mga06r32_214748_c1_305_454 | 49 |
| 990 | 3300050510 | nmdc:mga06r32_881431_c1 | nmdc:mga06r32_881431_c1_217_369 | 49 |
| 991 | 3300050511 | nmdc:mga08y16_128140_c1 | nmdc:mga08y16_128140_c1_2186_2338 | 49 |
| 992 | 3300050511 | nmdc:mga08y16_1538_c1 | nmdc:mga08y16_1538_c1_21409_21558 | 49 |
| 993 | 3300050511 | nmdc:mga08y16_26595_c1 | nmdc:mga08y16_26595_c1_450_599 | 49 |
| 994 | 3300050511 | nmdc:mga08y16_2_c1 | nmdc:mga08y16_2_c1_484120_484269 | 49 |
| 995 | 3300050511 | nmdc:mga08y16_3103_c1 | nmdc:mga08y16_3103_c1_9923_10075 | 49 |
| 996 | 3300050511 | nmdc:mga08y16_767182_c1 | nmdc:mga08y16_767182_c1_103_252 | 49 |
| 997 | 3300050512 | nmdc:mga0n895_1015863_c1 | nmdc:mga0n895_1015863_c1_521_670 | 49 |
| 998 | 3300050512 | nmdc:mga0n895_1111214_c1 | nmdc:mga0n895_1111214_c1_272_421 | 49 |
| 999 | 3300050512 | nmdc:mga0n895_125267_c1 | nmdc:mga0n895_125267_c1_1991_2140 | 49 |
| 1000 | 3300050512 | nmdc:mga0n895_44765_c1 | nmdc:mga0n895_44765_c1_4008_4160 | 49 |
| 1001 | 3300050512 | nmdc:mga0n895_681698_c1 | nmdc:mga0n895_681698_c1_775_924 | 49 |
| 1002 | 3300050512 | nmdc:mga0n895_685089_c1 | nmdc:mga0n895_685089_c1_461_625 | 49 |
| 1003 | 3300050512 | nmdc:mga0n895_846321_c1 | nmdc:mga0n895_846321_c1_661_810 | 49 |
| 1004 | 3300050513 | nmdc:mga0rr50_1362613_c1 | nmdc:mga0rr50_1362613_c1_113_262 | 49 |
| 1005 | 3300050513 | nmdc:mga0rr50_330267_c1 | nmdc:mga0rr50_330267_c1_52_216 | 49 |
| 1006 | 3300050513 | nmdc:mga0rr50_52386_c1 | nmdc:mga0rr50_52386_c1_1229_1378 | 49 |
| 1007 | 3300050513 | nmdc:mga0rr50_827335_c1 | nmdc:mga0rr50_827335_c1_427_579 | 49 |
| 1008 | 3300050514 | nmdc:mga08x19_11737_c1 | nmdc:mga08x19_11737_c1_3301_3453 | 49 |
| 1009 | 3300050514 | nmdc:mga08x19_382385_c1 | nmdc:mga08x19_382385_c1_94_246 | 49 |
| 1010 | 3300050514 | nmdc:mga08x19_460310_c1 | nmdc:mga08x19_460310_c1_379_531 | 49 |
| 1011 | 3300050515 | nmdc:mga0a205_1098745_c1 | nmdc:mga0a205_1098745_c1_392_544 | 49 |
| 1012 | 3300050515 | nmdc:mga0a205_183324_c1 | nmdc:mga0a205_183324_c1_274_423 | 49 |
| 1013 | 3300050515 | nmdc:mga0a205_206237_c1 | nmdc:mga0a205_206237_c1_489_638 | 49 |
| 1014 | 3300050515 | nmdc:mga0a205_606744_c1 | nmdc:mga0a205_606744_c1_32_181 | 49 |
| 1015 | 3300053077 | Ga0495601_0715683 | Ga0495601_0715683_439_588 | 49 |
| 1016 | 3300053077 | Ga0495601_0734447 | Ga0495601_0734447_192_341 | 49 |
| 1017 | 3300053078 | Ga0495612_0216178 | Ga0495612_0216178_549_701 | 49 |
| 1018 | 3300053084 | Ga0495595_0602330 | Ga0495595_0602330_158_310 | 49 |
| 1019 | 3300053103 | Ga0500555_074997 | Ga0500555_074997_474_623 | 49 |
| 1020 | 3300053117 | Ga0500593_195985 | Ga0500593_195985_319_468 | 49 |
| 1021 | 3300053131 | Ga0500652_038557 | Ga0500652_038557_528_677 | 49 |
| 1022 | 3300054114 | Ga0501084_0013715 | Ga0501084_0013715_5130_5279 | 49 |
| 1023 | 3300054114 | Ga0501084_0028474 | Ga0501084_0028474_3284_3433 | 49 |
| 1024 | 3300054114 | Ga0501084_0051048 | Ga0501084_0051048_3277_3426 | 49 |
| 1025 | 3300054114 | Ga0501084_0410611 | Ga0501084_0410611_681_830 | 49 |
| 1026 | 3300054114 | Ga0501084_0979122 | Ga0501084_0979122_438_587 | 49 |
| 1027 | 3300054114 | Ga0501084_1116090 | Ga0501084_1116090_97_246 | 49 |
| 1028 | 3300059421 | Ga0590071_051739 | Ga0590071_051739_456_608 | 49 |
| 1029 | 3300059424 | Ga0590075_044273 | Ga0590075_044273_539_691 | 49 |
| 1030 | 3300059426 | Ga0590077_001873 | Ga0590077_001873_2176_2328 | 49 |
| 1031 | 3300059477 | Ga0587084_067786 | Ga0587084_067786_369_533 | 49 |
| 1032 | 3300059490 | Ga0587066_187893 | Ga0587066_187893_85_234 | 49 |
| 1033 | 3300059493 | Ga0587077_053157 | Ga0587077_053157_554_718 | 49 |
| 1034 | 3300059505 | Ga0587083_0101888 | Ga0587083_0101888_379_543 | 49 |
| 1035 | 3300059511 | Ga0587091_084709 | Ga0587091_084709_303_452 | 49 |
| 1036 | 3300059512 | Ga0587092_060075 | Ga0587092_060075_223_375 | 49 |
| 1037 | 3300059604 | Ga0587098_004049 | Ga0587098_004049_655_804 | 49 |
| 1038 | 3300059607 | Ga0587125_011106 | Ga0587125_011106_216_380 | 49 |
| 1039 | 3300059623 | Ga0587101_025346 | Ga0587101_025346_550_714 | 49 |
| 1040 | 3300059624 | Ga0587109_052056 | Ga0587109_052056_359_511 | 49 |
| 1041 | 3300059639 | Ga0587062_138704 | Ga0587062_138704_168_332 | 49 |
| 1042 | 3300059640 | Ga0587067_110345 | Ga0587067_110345_165_317 | 49 |
| 1043 | 3300059643 | Ga0587072_017653 | Ga0587072_017653_635_784 | 49 |
| 1044 | 3300059652 | Ga0587107_091275 | Ga0587107_091275_107_256 | 49 |
| 1045 | 3300060346 | Ga0587111_0047244 | Ga0587111_0047244_635_799 | 49 |
| 1046 | 3300060346 | Ga0587111_0227301 | Ga0587111_0227301_346_495 | 49 |
| 1047 | 3300060353 | Ga0501082_0001088 | Ga0501082_0001088_18059_18208 | 49 |
| 1048 | 3300060353 | Ga0501082_0036253 | Ga0501082_0036253_3243_3392 | 49 |
| 1049 | 3300060353 | Ga0501082_0232190 | Ga0501082_0232190_785_934 | 49 |
| 1050 | 3300061734 | Ga0530510_0024932 | Ga0530510_0024932_3648_3797 | 49 |
| 1051 | 3300061734 | Ga0530510_0029412 | Ga0530510_0029412_3544_3702 | 49 |
| 1052 | 3300061734 | Ga0530510_0251002 | Ga0530510_0251002_791_949 | 49 |
| 1053 | 3300061734 | Ga0530510_0284775 | Ga0530510_0284775_1008_1157 | 49 |
| 1054 | 3300061734 | Ga0530510_1039631 | Ga0530510_1039631_38_187 | 49 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7y41-assembly1.cif.gz_c | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.9774 | 2 | 48 |
| 5hcr-assembly2.cif.gz_26 | crystal structure of antimicrobial peptide oncocin 10wt bound to the thermus thermophilus 70s ribosome | 0.9768 | 2 | 49 |
| 7o5b-assembly1.cif.gz_1 | cryo-em structure of a bacillus subtilis mifm-stalled ribosome-nascent chain complex with (p)ppgpp-srp bound | 0.9757 | 1 | 48 |
| 8a63-assembly1.cif.gz_6 | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.9729 | 3 | 48 |
| 8cvj-assembly2.cif.gz_26 | crystal structure of the thermus thermophilus 70s ribosome in complex with mrna, aminoacylated a-site phe-nh-trnaphe, peptidyl p-site fmseac-nh-trnamet, and deacylated e-site trnaphe at 2.40a resolution | 0.9715 | 2 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qcn600 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.9753 | 2 | 49 | 2.20.28.120 |
| 6dddO00 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.9682 | 3 | 46 | 2.20.28.120 |
| 6ddgO00 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.9474 | 1 | 46 | 2.20.28.120 |
| 4qcn600 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.9375 | 2 | 49 | 2.20.28.120 |
| 5v7q100 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.9318 | 1 | 48 | 2.20.28.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6SZ80-F1-model_v4 | Large ribosomal subunit protein bL33 | 1.013 | 1 | 49 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C2J698-F1-model_v4 | Large ribosomal subunit protein bL33 | 1.01 | 2 | 49 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7Z9Z8P0-F1-model_v4 | Large ribosomal subunit protein bL33 | 1.009 | 2 | 49 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3A6N8G8-F1-model_v4 | Large ribosomal subunit protein bL33 | 1.008 | 1 | 49 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-S7T5Z9-F1-model_v4 | Large ribosomal subunit protein bL33 | 1.008 | 2 | 49 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar