F489124
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 459 | 2106 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10001013|Ga0157369_100010132 |
| Length | 378 |
| Sequence | LNQPSLRLPLFNVGVIPAFQSRPIFKEFVLMSVTLSRWLPGLVLSAALPLMAHAATETAPAEGPAYGPELQGFKYPYTLKHFAFESQGQKLQMGYMDVAANGKANGRTVVLMHGKNFCAATWDSSIKALSDAGYRVIAPDQIGFCTSSKPAHYQYSFQQLATNTQQLLKALGIQKATVLGHSTGGMLATRYALLFPEQVDQLAMVNPIGLEDWKALGVPYRTVDQWYQRELKVTAKGIRDYERTTYYDGRWKPEFDRWVDMLAGLSKGPGKTQVAWNSALIYDMIFTQPVYYEFKDLKMPTLLLIGTSDTTAIGKDLAPPEVKAKIGHYEVLGKQVAKLIPQSTPIEFPGMGHAPQMEEPEKFHQALLGWLGKTPSVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 43 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 44 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 63 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 98 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 99 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 102 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 105 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 106 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 107 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 112 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 113 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 118 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 119 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 120 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 121 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 122 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 123 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 124 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 125 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 126 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 127 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 128 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 129 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 130 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 131 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 132 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 133 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 134 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 135 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 136 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 137 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 138 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 139 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 140 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 221 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 222 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 223 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 224 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 230 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 231 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 235 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 238 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 239 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 240 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 241 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 242 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 243 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 244 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 245 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 246 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 247 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 248 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 249 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 250 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 251 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 252 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 253 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 254 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 255 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 256 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 257 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 258 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 259 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 260 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 261 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 262 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 263 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 264 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 265 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 266 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 267 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 268 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 269 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 270 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 271 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 272 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 273 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 274 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 275 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 276 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 277 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 278 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 279 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 280 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 281 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 282 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 283 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 284 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 285 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 286 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 287 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 288 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 289 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 290 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 291 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 292 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 293 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 294 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 295 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 296 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 297 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 298 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 299 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 300 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 301 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 302 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 303 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 304 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 305 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 306 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 307 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 308 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 309 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 310 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 311 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 312 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 313 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 314 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 315 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 316 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 317 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 318 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 319 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 320 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 321 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 322 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 323 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 324 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 325 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 326 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 327 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 328 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 329 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 330 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 331 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 332 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 333 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 334 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 335 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 336 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 337 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 338 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 339 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 340 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 341 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 342 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 343 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 344 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 345 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 346 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 347 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 348 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 349 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 350 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 351 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 352 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 353 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 354 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 355 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 356 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 357 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 358 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 359 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 360 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 361 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 362 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 363 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 364 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 365 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 366 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 367 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 368 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 369 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 370 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 371 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 372 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 373 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 374 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 375 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 376 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 377 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 378 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 379 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 380 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 381 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 382 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 383 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 384 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 385 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 386 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 387 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 388 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 389 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 390 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 391 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 392 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 393 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 394 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 395 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 396 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 397 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 398 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 399 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 400 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 401 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 402 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 403 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 404 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 405 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 406 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 407 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 408 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 409 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 410 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 411 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 412 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 413 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 414 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 415 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 416 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 417 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 418 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 419 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 420 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 421 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 422 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 423 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 424 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 425 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 426 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 427 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 428 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 429 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 430 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 431 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 432 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 433 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 434 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 435 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 436 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 437 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 438 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 439 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 440 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 441 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 442 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 443 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 444 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 445 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 446 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 447 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 448 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 449 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 450 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 451 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 452 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 453 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 454 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 455 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 456 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 457 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 458 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 459 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.94 |
| Metatranscriptomes | 0 |
| Isolates | 21.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.2 |
| Nodule | 2.75 |
| Rhizoplane | 6.45 |
| Rhizosphere | 68.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10001013 | 3300013105 | Bacteria | 35347 |
| 2 | MRS2a_Contig_10285 | 2124908027 | Bacteria | 1750 |
| 3 | MRS2a_Contig_7577 | 2124908027 | Bacteria | 1842 |
| 4 | SwRhRL2b_contig_1035371 | 2162886007 | Bacteria | 1109 |
| 5 | SwRhRL2b_contig_1318055 | 2162886007 | Bacteria | 1798 |
| 6 | SwRhRL2b_contig_438761 | 2162886007 | Bacteria | 3994 |
| 7 | JGI25162J39368_1000004 | 3300002737 | Bacteria | 441040 |
| 8 | JGI25162J39368_1000009 | 3300002737 | Bacteria | 389795 |
| 9 | JGI25162J39368_1000051 | 3300002737 | Bacteria | 156765 |
| 10 | JGI25154J39366_1006556 | 3300002738 | Bacteria | 1688 |
| 11 | JGI25163J39215_1000020 | 3300002771 | Bacteria | 75466 |
| 12 | JGI25163J39215_1000030 | 3300002771 | Bacteria | 65586 |
| 13 | JGI25163J39215_1000125 | 3300002771 | Bacteria | 31657 |
| 14 | JGI25164J39214_1000002 | 3300002772 | Bacteria | 406570 |
| 15 | JGI25164J39214_1000027 | 3300002772 | Bacteria | 156759 |
| 16 | JGI25164J39214_1000034 | 3300002772 | Bacteria | 139998 |
| 17 | JGI25165J46597_1000011 | 3300003214 | Bacteria | 441040 |
| 18 | JGI25165J46597_1000101 | 3300003214 | Bacteria | 156765 |
| 19 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 20 | Ga0055538_1000069 | 3300003751 | Bacteria | 95501 |
| 21 | Ga0055539_1000009 | 3300003752 | Bacteria | 406566 |
| 22 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 23 | Ga0055533_1000012 | 3300003756 | Bacteria | 406566 |
| 24 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 25 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 26 | Ga0055525_1000014 | 3300003759 | Bacteria | 406566 |
| 27 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 28 | Ga0055526_1003434 | 3300003771 | Bacteria | 10057 |
| 29 | Ga0055537_1000037 | 3300003773 | Bacteria | 95236 |
| 30 | Ga0055524_1016271 | 3300003775 | Bacteria | 2675 |
| 31 | Ga0055536_1000014 | 3300003781 | Bacteria | 240624 |
| 32 | Ga0055536_1000047 | 3300003781 | Bacteria | 117289 |
| 33 | Ga0055536_1000066 | 3300003781 | Bacteria | 97166 |
| 34 | Ga0055534_1000038 | 3300003784 | Bacteria | 105771 |
| 35 | Ga0055528_1000071 | 3300003790 | Bacteria | 78628 |
| 36 | Ga0055530_10000009 | 3300003791 | Bacteria | 174044 |
| 37 | Ga0055530_10000011 | 3300003791 | Bacteria | 170218 |
| 38 | Ga0055530_10001866 | 3300003791 | Bacteria | 14492 |
| 39 | Ga0055540_1000006 | 3300003792 | Bacteria | 372018 |
| 40 | Ga0055540_1000034 | 3300003792 | Bacteria | 170218 |
| 41 | Ga0055540_1000497 | 3300003792 | Bacteria | 30036 |
| 42 | Ga0055531_10000099 | 3300003794 | Bacteria | 93823 |
| 43 | Ga0055531_10048622 | 3300003794 | Bacteria | 1141 |
| 44 | Ga0055541_1000006 | 3300003841 | Bacteria | 406566 |
| 45 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 46 | Ga0058692_1000194 | 3300003856 | Bacteria | 36761 |
| 47 | Ga0055543_1005882 | 3300004625 | Bacteria | 3061 |
| 48 | Ga0065165_1000742 | 3300005262 | Bacteria | 45068 |
| 49 | Ga0065714_10000359 | 3300005288 | Bacteria | 5336 |
| 50 | Ga0065714_10006637 | 3300005288 | Bacteria | 4542 |
| 51 | Ga0065714_10008534 | 3300005288 | Bacteria | 2676 |
| 52 | Ga0065714_10013514 | 3300005288 | Bacteria | 2194 |
| 53 | Ga0065714_10014964 | 3300005288 | Bacteria | 2386 |
| 54 | Ga0065714_10064936 | 3300005288 | Bacteria | 15165 |
| 55 | Ga0065714_10065459 | 3300005288 | Bacteria | 9951 |
| 56 | Ga0065714_10068626 | 3300005288 | Bacteria | 4623 |
| 57 | Ga0065714_10070469 | 3300005288 | Bacteria | 3860 |
| 58 | Ga0065714_10084910 | 3300005288 | Bacteria | 2174 |
| 59 | Ga0065704_10000101 | 3300005289 | Bacteria | 59296 |
| 60 | Ga0065704_10084955 | 3300005289 | Bacteria | 3277 |
| 61 | Ga0065704_10130765 | 3300005289 | Bacteria | 1632 |
| 62 | Ga0065712_10104349 | 3300005290 | Bacteria | 1963 |
| 63 | Ga0065715_10006719 | 3300005293 | Bacteria | 5053 |
| 64 | Ga0070670_100000137 | 3300005331 | Bacteria | 68542 |
| 65 | Ga0070670_100012320 | 3300005331 | Bacteria | 7317 |
| 66 | Ga0070669_100020183 | 3300005353 | Bacteria | 4759 |
| 67 | Ga0070669_100031477 | 3300005353 | Bacteria | 3832 |
| 68 | Ga0070662_100002943 | 3300005457 | Bacteria | 10588 |
| 69 | Ga0068853_100137485 | 3300005539 | Bacteria | 2191 |
| 70 | Ga0070665_100375149 | 3300005548 | Bacteria | 1429 |
| 71 | Ga0068851_10000279 | 3300005834 | Bacteria | 23569 |
| 72 | Ga0075364_10030271 | 3300006051 | Bacteria | 3474 |
| 73 | Ga0075364_10160492 | 3300006051 | Bacteria | 1517 |
| 74 | Ga0075432_10016393 | 3300006058 | Bacteria | 2528 |
| 75 | Ga0075432_10047184 | 3300006058 | Bacteria | 1514 |
| 76 | Ga0075362_10042046 | 3300006177 | Bacteria | 2018 |
| 77 | Ga0075369_10003683 | 3300006186 | Bacteria | 5601 |
| 78 | Ga0075436_100252164 | 3300006914 | Bacteria | 1257 |
| 79 | Ga0099823_1000050 | 3300006944 | Bacteria | 57425 |
| 80 | Ga0079104_1000342 | 3300006946 | Bacteria | 56194 |
| 81 | Ga0079104_1000529 | 3300006946 | Bacteria | 40538 |
| 82 | Ga0099826_10020115 | 3300006948 | Bacteria | 5009 |
| 83 | Ga0105251_10000363 | 3300009011 | Bacteria | 44493 |
| 84 | Ga0105251_10005946 | 3300009011 | Bacteria | 7879 |
| 85 | Ga0105251_10010544 | 3300009011 | Bacteria | 5353 |
| 86 | Ga0105251_10012652 | 3300009011 | Bacteria | 4766 |
| 87 | Ga0105251_10019486 | 3300009011 | Bacteria | 3582 |
| 88 | Ga0105251_10040687 | 3300009011 | Bacteria | 2266 |
| 89 | Ga0105251_10059167 | 3300009011 | Bacteria | 1808 |
| 90 | Ga0105244_10000306 | 3300009036 | Bacteria | 47599 |
| 91 | Ga0105244_10000768 | 3300009036 | Bacteria | 27430 |
| 92 | Ga0105244_10001123 | 3300009036 | Bacteria | 22260 |
| 93 | Ga0105244_10002404 | 3300009036 | Bacteria | 14145 |
| 94 | Ga0105244_10034373 | 3300009036 | Bacteria | 2669 |
| 95 | Ga0105244_10064557 | 3300009036 | Bacteria | 1836 |
| 96 | Ga0105244_10069568 | 3300009036 | Bacteria | 1757 |
| 97 | Ga0105250_10000058 | 3300009092 | Bacteria | 111233 |
| 98 | Ga0105250_10000158 | 3300009092 | Bacteria | 58645 |
| 99 | Ga0105250_10011017 | 3300009092 | Bacteria | 3758 |
| 100 | Ga0105250_10022378 | 3300009092 | Bacteria | 2549 |
| 101 | Ga0105250_10070221 | 3300009092 | Bacteria | 1414 |
| 102 | Ga0105243_10000026 | 3300009148 | Bacteria | 191522 |
| 103 | Ga0105243_10005020 | 3300009148 | Bacteria | 10378 |
| 104 | Ga0105246_10004195 | 3300011119 | Bacteria | 8756 |
| 105 | Ga0105246_10015080 | 3300011119 | Bacteria | 4871 |
| 106 | Ga0157345_1000015 | 3300012498 | Bacteria | 48949 |
| 107 | Ga0157373_10000193 | 3300013100 | Bacteria | 50206 |
| 108 | Ga0157373_10000389 | 3300013100 | Bacteria | 35149 |
| 109 | Ga0157373_10000554 | 3300013100 | Bacteria | 29289 |
| 110 | Ga0157373_10002695 | 3300013100 | Bacteria | 13460 |
| 111 | Ga0157373_10017004 | 3300013100 | Bacteria | 5296 |
| 112 | Ga0157373_10024008 | 3300013100 | Bacteria | 4419 |
| 113 | Ga0157373_10024581 | 3300013100 | Bacteria | 4363 |
| 114 | Ga0157373_10121362 | 3300013100 | Bacteria | 1837 |
| 115 | Ga0157373_10134269 | 3300013100 | Bacteria | 1740 |
| 116 | Ga0157371_10000142 | 3300013102 | Bacteria | 103825 |
| 117 | Ga0157371_10000189 | 3300013102 | Bacteria | 91155 |
| 118 | Ga0157371_10000453 | 3300013102 | Bacteria | 50312 |
| 119 | Ga0157371_10000774 | 3300013102 | Bacteria | 36782 |
| 120 | Ga0157371_10004730 | 3300013102 | Bacteria | 11759 |
| 121 | Ga0157370_10001001 | 3300013104 | Bacteria | 35647 |
| 122 | Ga0157370_10039452 | 3300013104 | Bacteria | 4563 |
| 123 | Ga0157370_10067736 | 3300013104 | Bacteria | 3374 |
| 124 | Ga0157370_10413475 | 3300013104 | Bacteria | 1241 |
| 125 | Ga0157369_10001032 | 3300013105 | Bacteria | 35169 |
| 126 | Ga0157369_10002198 | 3300013105 | Bacteria | 23499 |
| 127 | Ga0157369_10014106 | 3300013105 | Bacteria | 9033 |
| 128 | Ga0163162_10000346 | 3300013306 | Bacteria | 42061 |
| 129 | Ga0163162_10034881 | 3300013306 | Bacteria | 5008 |
| 130 | Ga0163162_10040160 | 3300013306 | Bacteria | 4678 |
| 131 | Ga0157372_10000552 | 3300013307 | Bacteria | 41170 |
| 132 | Ga0157372_10315131 | 3300013307 | Bacteria | 1821 |
| 133 | Ga0157375_10000139 | 3300013308 | Bacteria | 72260 |
| 134 | Ga0157375_10027530 | 3300013308 | Bacteria | 5314 |
| 135 | Ga0182008_10000202 | 3300014497 | Bacteria | 46777 |
| 136 | Ga0182008_10000634 | 3300014497 | Bacteria | 25737 |
| 137 | Ga0182008_10001612 | 3300014497 | Bacteria | 14969 |
| 138 | Ga0182008_10004565 | 3300014497 | Bacteria | 8062 |
| 139 | Ga0182008_10005936 | 3300014497 | Bacteria | 6890 |
| 140 | Ga0182008_10014218 | 3300014497 | Bacteria | 4172 |
| 141 | Ga0182008_10083405 | 3300014497 | Bacteria | 1574 |
| 142 | Ga0182006_1000107 | 3300015261 | Bacteria | 89971 |
| 143 | Ga0182006_1000191 | 3300015261 | Bacteria | 63183 |
| 144 | Ga0182006_1001077 | 3300015261 | Bacteria | 17523 |
| 145 | Ga0182006_1004277 | 3300015261 | Bacteria | 7067 |
| 146 | Ga0182006_1024280 | 3300015261 | Bacteria | 2501 |
| 147 | Ga0182006_1027416 | 3300015261 | Bacteria | 2325 |
| 148 | Ga0182007_10000087 | 3300015262 | Bacteria | 68528 |
| 149 | Ga0182007_10001331 | 3300015262 | Bacteria | 13323 |
| 150 | Ga0182007_10013512 | 3300015262 | Bacteria | 3111 |
| 151 | Ga0182005_1000092 | 3300015265 | Bacteria | 67804 |
| 152 | Ga0182005_1002968 | 3300015265 | Bacteria | 5875 |
| 153 | Ga0182005_1004607 | 3300015265 | Bacteria | 4425 |
| 154 | Ga0163161_10000774 | 3300017792 | Bacteria | 25156 |
| 155 | Ga0163161_10002089 | 3300017792 | Bacteria | 14476 |
| 156 | Ga0163161_10013254 | 3300017792 | Bacteria | 5731 |
| 157 | Ga0163161_10014653 | 3300017792 | Bacteria | 5459 |
| 158 | Ga0163161_10014928 | 3300017792 | Bacteria | 5410 |
| 159 | Ga0163161_10015205 | 3300017792 | Bacteria | 5361 |
| 160 | Ga0163161_10039616 | 3300017792 | Bacteria | 3383 |
| 161 | Ga0163161_10324587 | 3300017792 | Bacteria | 1218 |
| 162 | Ga0213872_10002446 | 3300021361 | Bacteria | 10919 |
| 163 | Ga0209435_101275 | 3300025206 | Bacteria | 3307 |
| 164 | Ga0209760_100014 | 3300025207 | Bacteria | 177898 |
| 165 | Ga0209760_100083 | 3300025207 | Bacteria | 75839 |
| 166 | Ga0209760_100112 | 3300025207 | Bacteria | 57692 |
| 167 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 168 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 169 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 170 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 171 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 172 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 173 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 174 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 175 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 176 | Ga0209563_100858 | 3300025230 | Bacteria | 9034 |
| 177 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 178 | Ga0207427_100011 | 3300025231 | Bacteria | 640076 |
| 179 | Ga0207427_100020 | 3300025231 | Bacteria | 507515 |
| 180 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 181 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 182 | Ga0209437_100025 | 3300025233 | Bacteria | 561333 |
| 183 | Ga0209437_112575 | 3300025233 | Bacteria | 1231 |
| 184 | Ga0209258_100520 | 3300025242 | Bacteria | 37049 |
| 185 | Ga0209646_1000330 | 3300025246 | Bacteria | 35848 |
| 186 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 187 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 188 | Ga0209759_1001790 | 3300025256 | Bacteria | 10896 |
| 189 | Ga0209759_1003192 | 3300025256 | Bacteria | 6652 |
| 190 | Ga0209129_1000021 | 3300025258 | Bacteria | 445018 |
| 191 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 192 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 193 | Ga0209233_1002946 | 3300025261 | Bacteria | 6079 |
| 194 | Ga0209565_1000055 | 3300025263 | Bacteria | 201184 |
| 195 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 196 | Ga0209130_1000410 | 3300025284 | Bacteria | 46711 |
| 197 | Ga0209675_1000052 | 3300025291 | Bacteria | 201332 |
| 198 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 199 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 200 | Ga0209676_1000158 | 3300025292 | Bacteria | 162469 |
| 201 | Ga0209676_1000701 | 3300025292 | Bacteria | 46848 |
| 202 | Ga0209676_1001658 | 3300025292 | Bacteria | 19431 |
| 203 | Ga0209676_1011141 | 3300025292 | Bacteria | 3658 |
| 204 | Ga0209564_1000271 | 3300025295 | Bacteria | 108422 |
| 205 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 206 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 207 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 208 | Ga0209050_1001033 | 3300025298 | Bacteria | 34536 |
| 209 | Ga0209256_1000100 | 3300025299 | Bacteria | 201246 |
| 210 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 211 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 212 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 213 | Ga0209051_1019166 | 3300025303 | Bacteria | 2997 |
| 214 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 215 | Ga0209257_1002548 | 3300025304 | Bacteria | 17822 |
| 216 | Ga0207656_10003008 | 3300025321 | Bacteria | 5765 |
| 217 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 218 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 219 | Ga0207696_1000341 | 3300025711 | Bacteria | 48397 |
| 220 | Ga0207696_1000724 | 3300025711 | Bacteria | 22166 |
| 221 | Ga0207696_1008317 | 3300025711 | Bacteria | 3983 |
| 222 | Ga0207696_1015799 | 3300025711 | Bacteria | 2545 |
| 223 | Ga0207696_1016485 | 3300025711 | Bacteria | 2470 |
| 224 | Ga0207696_1017254 | 3300025711 | Bacteria | 2395 |
| 225 | Ga0207655_1000037 | 3300025728 | Bacteria | 354473 |
| 226 | Ga0207655_1000100 | 3300025728 | Bacteria | 186348 |
| 227 | Ga0207655_1000216 | 3300025728 | Bacteria | 99551 |
| 228 | Ga0207655_1000295 | 3300025728 | Bacteria | 75367 |
| 229 | Ga0207655_1001009 | 3300025728 | Bacteria | 28644 |
| 230 | Ga0207655_1001701 | 3300025728 | Bacteria | 19364 |
| 231 | Ga0207655_1005105 | 3300025728 | Bacteria | 9058 |
| 232 | Ga0207655_1005731 | 3300025728 | Bacteria | 8380 |
| 233 | Ga0207655_1008165 | 3300025728 | Bacteria | 6688 |
| 234 | Ga0207655_1008427 | 3300025728 | Bacteria | 6543 |
| 235 | Ga0207655_1009521 | 3300025728 | Bacteria | 6020 |
| 236 | Ga0207655_1038219 | 3300025728 | Bacteria | 2102 |
| 237 | Ga0207713_1000275 | 3300025735 | Bacteria | 61536 |
| 238 | Ga0207713_1000523 | 3300025735 | Bacteria | 38601 |
| 239 | Ga0207713_1001048 | 3300025735 | Bacteria | 23980 |
| 240 | Ga0207713_1001142 | 3300025735 | Bacteria | 22493 |
| 241 | Ga0207713_1004080 | 3300025735 | Bacteria | 9624 |
| 242 | Ga0207713_1004709 | 3300025735 | Bacteria | 8783 |
| 243 | Ga0207713_1013843 | 3300025735 | Bacteria | 4224 |
| 244 | Ga0207713_1015518 | 3300025735 | Bacteria | 3905 |
| 245 | Ga0207713_1019867 | 3300025735 | Bacteria | 3272 |
| 246 | Ga0207713_1033382 | 3300025735 | Bacteria | 2248 |
| 247 | Ga0207681_10018175 | 3300025923 | Bacteria | 4427 |
| 248 | Ga0207650_10000277 | 3300025925 | Bacteria | 53407 |
| 249 | Ga0207650_10000417 | 3300025925 | Bacteria | 37805 |
| 250 | Ga0207706_10005575 | 3300025933 | Bacteria | 11731 |
| 251 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 252 | Ga0207709_10013627 | 3300025935 | Bacteria | 4485 |
| 253 | Ga0207639_10042682 | 3300026041 | Bacteria | 3400 |
| 254 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 255 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 256 | Ga0209281_1000055 | 3300027111 | Bacteria | 308297 |
| 257 | Ga0209281_1006000 | 3300027111 | Bacteria | 3240 |
| 258 | Ga0209281_1006551 | 3300027111 | Bacteria | 3027 |
| 259 | Ga0209389_1000053 | 3300027296 | Bacteria | 108874 |
| 260 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 261 | Ga0209371_1000057 | 3300027312 | Bacteria | 238850 |
| 262 | Ga0209983_1015314 | 3300027665 | Bacteria | 1581 |
| 263 | Ga0209282_1019007 | 3300027666 | Bacteria | 4358 |
| 264 | Ga0207428_10036305 | 3300027907 | Bacteria | 4021 |
| 265 | Ga0207428_10232957 | 3300027907 | Bacteria | 1378 |
| 266 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 267 | Ga0307511_10069245 | 3300030521 | Bacteria | 2596 |
| 268 | Ga0314311_1250267 | 3300030733 | Bacteria | 2515 |
| 269 | Ga0316178_1161518 | 3300030735 | Bacteria | 4491 |
| 270 | Ga0316181_1107887 | 3300030744 | Bacteria | 1776 |
| 271 | Ga0307408_100002612 | 3300031548 | Bacteria | 12540 |
| 272 | Ga0307408_100004910 | 3300031548 | Bacteria | 9005 |
| 273 | Ga0307408_100015589 | 3300031548 | Bacteria | 5061 |
| 274 | Ga0307408_100033598 | 3300031548 | Bacteria | 3585 |
| 275 | Ga0307408_100127550 | 3300031548 | Bacteria | 1980 |
| 276 | Ga0307405_10000024 | 3300031731 | Bacteria | 127508 |
| 277 | Ga0307405_10017957 | 3300031731 | Bacteria | 3893 |
| 278 | Ga0307405_10039836 | 3300031731 | Bacteria | 2843 |
| 279 | Ga0307413_10155217 | 3300031824 | Bacteria | 1600 |
| 280 | Ga0307406_10008953 | 3300031901 | Bacteria | 5596 |
| 281 | Ga0307406_10078051 | 3300031901 | Bacteria | 2192 |
| 282 | Ga0307407_10052412 | 3300031903 | Bacteria | 2343 |
| 283 | Ga0307412_10000420 | 3300031911 | Bacteria | 25925 |
| 284 | Ga0307412_10000977 | 3300031911 | Bacteria | 16334 |
| 285 | Ga0307412_10002210 | 3300031911 | Bacteria | 10796 |
| 286 | Ga0307412_10029562 | 3300031911 | Bacteria | 3440 |
| 287 | Ga0307409_100132999 | 3300031995 | Bacteria | 2129 |
| 288 | Ga0307416_100315494 | 3300032002 | Bacteria | 1562 |
| 289 | Ga0307414_10007352 | 3300032004 | Bacteria | 6189 |
| 290 | Ga0307414_10020648 | 3300032004 | Bacteria | 4110 |
| 291 | Ga0307414_10047567 | 3300032004 | Bacteria | 2953 |
| 292 | Ga0307411_10020754 | 3300032005 | Bacteria | 3829 |
| 293 | Ga0307411_10042053 | 3300032005 | Bacteria | 2912 |
| 294 | Ga0237819_00679 | 3300038705 | Bacteria | 11069 |
| 295 | Ga0436361_1164300 | 3300039447 | Bacteria | 33594 |
| 296 | Ga0436363_0550752 | 3300039450 | Bacteria | 1771 |
| 297 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 298 | Ga0439438_000033 | 3300041405 | Bacteria | 69839 |
| 299 | Ga0439438_000098 | 3300041405 | Bacteria | 40067 |
| 300 | Ga0439438_000229 | 3300041405 | Bacteria | 25432 |
| 301 | Ga0439438_005252 | 3300041405 | Bacteria | 4798 |
| 302 | Ga0439438_006969 | 3300041405 | Bacteria | 3918 |
| 303 | Ga0439438_009473 | 3300041405 | Bacteria | 3149 |
| 304 | Ga0439438_010985 | 3300041405 | Bacteria | 2840 |
| 305 | Ga0439447_000096 | 3300041407 | Bacteria | 30692 |
| 306 | Ga0439447_002880 | 3300041407 | Bacteria | 6162 |
| 307 | Ga0439447_002905 | 3300041407 | Bacteria | 6134 |
| 308 | Ga0439447_003234 | 3300041407 | Bacteria | 5797 |
| 309 | Ga0439447_004419 | 3300041407 | Bacteria | 4837 |
| 310 | Ga0439447_015540 | 3300041407 | Bacteria | 2110 |
| 311 | Ga0439447_038503 | 3300041407 | Bacteria | 1174 |
| 312 | Ga0439466_0000088 | 3300041411 | Bacteria | 36080 |
| 313 | Ga0439466_0000694 | 3300041411 | Bacteria | 12693 |
| 314 | Ga0439466_0007811 | 3300041411 | Bacteria | 4040 |
| 315 | Ga0439466_0025096 | 3300041411 | Bacteria | 2083 |
| 316 | Ga0439432_000016 | 3300042006 | Bacteria | 63199 |
| 317 | Ga0439432_003575 | 3300042006 | Bacteria | 5752 |
| 318 | Ga0439432_003654 | 3300042006 | Bacteria | 5685 |
| 319 | Ga0439432_005547 | 3300042006 | Bacteria | 4539 |
| 320 | Ga0439432_011629 | 3300042006 | Bacteria | 3031 |
| 321 | Ga0439432_044888 | 3300042006 | Bacteria | 1391 |
| 322 | Ga0439451_001487 | 3300042009 | Bacteria | 4630 |
| 323 | Ga0439452_000087 | 3300042010 | Bacteria | 79439 |
| 324 | Ga0439452_000146 | 3300042010 | Bacteria | 52810 |
| 325 | Ga0439452_000230 | 3300042010 | Bacteria | 38856 |
| 326 | Ga0439452_004286 | 3300042010 | Bacteria | 4820 |
| 327 | Ga0439452_004556 | 3300042010 | Bacteria | 4619 |
| 328 | Ga0439452_006943 | 3300042010 | Bacteria | 3504 |
| 329 | Ga0439456_002982 | 3300042013 | Bacteria | 3421 |
| 330 | Ga0439456_005831 | 3300042013 | Bacteria | 2505 |
| 331 | Ga0439463_017432 | 3300042016 | Bacteria | 1780 |
| 332 | Ga0450911_000063 | 3300042115 | Bacteria | 43941 |
| 333 | Ga0450911_000527 | 3300042115 | Bacteria | 12079 |
| 334 | Ga0450911_000821 | 3300042115 | Bacteria | 8543 |
| 335 | Ga0450903_001116 | 3300042138 | Bacteria | 5085 |
| 336 | Ga0450903_003945 | 3300042138 | Bacteria | 2548 |
| 337 | Ga0450903_007909 | 3300042138 | Bacteria | 1743 |
| 338 | Ga0450906_006927 | 3300042145 | Bacteria | 2262 |
| 339 | Ga0450907_000060 | 3300042146 | Bacteria | 43254 |
| 340 | Ga0450907_000517 | 3300042146 | Bacteria | 10572 |
| 341 | Ga0450910_002884 | 3300042147 | Bacteria | 2265 |
| 342 | Ga0439446_0000912 | 3300042156 | Bacteria | 6375 |
| 343 | Ga0450908_000342 | 3300042184 | Bacteria | 9075 |
| 344 | Ga0450909_000988 | 3300042185 | Bacteria | 3899 |
| 345 | Ga0439460_0001278 | 3300042461 | Bacteria | 5905 |
| 346 | Ga0439460_0034047 | 3300042461 | Bacteria | 1466 |
| 347 | Ga0450901_000455 | 3300042533 | Bacteria | 4867 |
| 348 | Ga0439440_0001314 | 3300042993 | Bacteria | 4518 |
| 349 | Ga0439440_0003826 | 3300042993 | Bacteria | 2927 |
| 350 | Ga0495617_000065 | 3300046452 | Bacteria | 95225 |
| 351 | Ga0495617_000404 | 3300046452 | Bacteria | 23924 |
| 352 | Ga0495617_003279 | 3300046452 | Bacteria | 6135 |
| 353 | Ga0495617_007277 | 3300046452 | Bacteria | 3848 |
| 354 | Ga0495617_022527 | 3300046452 | Bacteria | 2130 |
| 355 | Ga0495617_043230 | 3300046452 | Bacteria | 1504 |
| 356 | Ga0495627_000138 | 3300046453 | Bacteria | 87371 |
| 357 | Ga0495627_000314 | 3300046453 | Bacteria | 47603 |
| 358 | Ga0495627_000491 | 3300046453 | Bacteria | 33157 |
| 359 | Ga0495627_005853 | 3300046453 | Bacteria | 4891 |
| 360 | Ga0495603_0001067 | 3300046455 | Bacteria | 15902 |
| 361 | Ga0495603_0021707 | 3300046455 | Bacteria | 3888 |
| 362 | Ga0495590_0003634 | 3300046457 | Bacteria | 6281 |
| 363 | Ga0495590_0015020 | 3300046457 | Bacteria | 2818 |
| 364 | Ga0495591_000044 | 3300046458 | Bacteria | 145782 |
| 365 | Ga0495591_000060 | 3300046458 | Bacteria | 129321 |
| 366 | Ga0495591_000155 | 3300046458 | Bacteria | 72717 |
| 367 | Ga0495591_000249 | 3300046458 | Bacteria | 52047 |
| 368 | Ga0495591_000714 | 3300046458 | Bacteria | 24092 |
| 369 | Ga0495591_000778 | 3300046458 | Bacteria | 22788 |
| 370 | Ga0495591_011900 | 3300046458 | Bacteria | 3267 |
| 371 | Ga0495591_012065 | 3300046458 | Bacteria | 3237 |
| 372 | Ga0495591_017448 | 3300046458 | Bacteria | 2464 |
| 373 | Ga0495591_017449 | 3300046458 | Bacteria | 2464 |
| 374 | Ga0495638_0000652 | 3300046460 | Bacteria | 38000 |
| 375 | Ga0495638_0000848 | 3300046460 | Bacteria | 31868 |
| 376 | Ga0495638_0001873 | 3300046460 | Bacteria | 18187 |
| 377 | Ga0495638_0016060 | 3300046460 | Bacteria | 5018 |
| 378 | Ga0495638_0043243 | 3300046460 | Bacteria | 2842 |
| 379 | Ga0495638_0123241 | 3300046460 | Bacteria | 1529 |
| 380 | Ga0495653_0000485 | 3300046463 | Bacteria | 30827 |
| 381 | Ga0495650_0000034 | 3300046471 | Bacteria | 410132 |
| 382 | Ga0495650_0000101 | 3300046471 | Bacteria | 212903 |
| 383 | Ga0495650_0000148 | 3300046471 | Bacteria | 159533 |
| 384 | Ga0495650_0001653 | 3300046471 | Bacteria | 20605 |
| 385 | Ga0495650_0001901 | 3300046471 | Bacteria | 18519 |
| 386 | Ga0495650_0009820 | 3300046471 | Bacteria | 5404 |
| 387 | Ga0495650_0020487 | 3300046471 | Bacteria | 3223 |
| 388 | Ga0495650_0030844 | 3300046471 | Bacteria | 2421 |
| 389 | Ga0495650_0053562 | 3300046471 | Bacteria | 1651 |
| 390 | Ga0495605_0000207 | 3300046474 | Bacteria | 72272 |
| 391 | Ga0495605_0000511 | 3300046474 | Bacteria | 33206 |
| 392 | Ga0495605_0007972 | 3300046474 | Bacteria | 5995 |
| 393 | Ga0495605_0015874 | 3300046474 | Bacteria | 4087 |
| 394 | Ga0495605_0017707 | 3300046474 | Bacteria | 3832 |
| 395 | Ga0495605_0051147 | 3300046474 | Bacteria | 2012 |
| 396 | Ga0495639_0000016 | 3300046475 | Bacteria | 76516 |
| 397 | Ga0495639_0012751 | 3300046475 | Bacteria | 3626 |
| 398 | Ga0495639_0074064 | 3300046475 | Bacteria | 1577 |
| 399 | Ga0495584_0000441 | 3300046491 | Bacteria | 28608 |
| 400 | Ga0495584_0000465 | 3300046491 | Bacteria | 27886 |
| 401 | Ga0495584_0001147 | 3300046491 | Bacteria | 16367 |
| 402 | Ga0495584_0005210 | 3300046491 | Bacteria | 6899 |
| 403 | Ga0495584_0007510 | 3300046491 | Bacteria | 5683 |
| 404 | Ga0495584_0013316 | 3300046491 | Bacteria | 4199 |
| 405 | Ga0495584_0013634 | 3300046491 | Bacteria | 4146 |
| 406 | Ga0495584_0024045 | 3300046491 | Bacteria | 3088 |
| 407 | Ga0495584_0060315 | 3300046491 | Bacteria | 1907 |
| 408 | Ga0495584_0067672 | 3300046491 | Bacteria | 1794 |
| 409 | Ga0495585_0000219 | 3300046492 | Bacteria | 59369 |
| 410 | Ga0495585_0000300 | 3300046492 | Bacteria | 49530 |
| 411 | Ga0495585_0000324 | 3300046492 | Bacteria | 47026 |
| 412 | Ga0495585_0000453 | 3300046492 | Bacteria | 39201 |
| 413 | Ga0495585_0018419 | 3300046492 | Bacteria | 4027 |
| 414 | Ga0495585_0019542 | 3300046492 | Bacteria | 3906 |
| 415 | Ga0495594_0014629 | 3300046499 | Bacteria | 4114 |
| 416 | Ga0495594_0016529 | 3300046499 | Bacteria | 3888 |
| 417 | Ga0495596_0000083 | 3300046500 | Bacteria | 65056 |
| 418 | Ga0495607_0000014 | 3300046501 | Bacteria | 186627 |
| 419 | Ga0495607_0000033 | 3300046501 | Bacteria | 149382 |
| 420 | Ga0495607_0000420 | 3300046501 | Bacteria | 43292 |
| 421 | Ga0495607_0002053 | 3300046501 | Bacteria | 16840 |
| 422 | Ga0495607_0004569 | 3300046501 | Bacteria | 10148 |
| 423 | Ga0495607_0006684 | 3300046501 | Bacteria | 8079 |
| 424 | Ga0495607_0010116 | 3300046501 | Bacteria | 6351 |
| 425 | Ga0495607_0017213 | 3300046501 | Bacteria | 4647 |
| 426 | Ga0495607_0019814 | 3300046501 | Bacteria | 4266 |
| 427 | Ga0495607_0070788 | 3300046501 | Bacteria | 1947 |
| 428 | Ga0495583_0000131 | 3300046506 | Bacteria | 125393 |
| 429 | Ga0495583_0000576 | 3300046506 | Bacteria | 50529 |
| 430 | Ga0495583_0000787 | 3300046506 | Bacteria | 39542 |
| 431 | Ga0495583_0001029 | 3300046506 | Bacteria | 31649 |
| 432 | Ga0495583_0004901 | 3300046506 | Bacteria | 9313 |
| 433 | Ga0495583_0009453 | 3300046506 | Bacteria | 5820 |
| 434 | Ga0495606_0000047 | 3300046507 | Bacteria | 207892 |
| 435 | Ga0495606_0000741 | 3300046507 | Bacteria | 50451 |
| 436 | Ga0495606_0001042 | 3300046507 | Bacteria | 40090 |
| 437 | Ga0495606_0001398 | 3300046507 | Bacteria | 32519 |
| 438 | Ga0495606_0001589 | 3300046507 | Bacteria | 29686 |
| 439 | Ga0495606_0003380 | 3300046507 | Bacteria | 16978 |
| 440 | Ga0495606_0004412 | 3300046507 | Bacteria | 14076 |
| 441 | Ga0495606_0005516 | 3300046507 | Bacteria | 12087 |
| 442 | Ga0495606_0006178 | 3300046507 | Bacteria | 11149 |
| 443 | Ga0495606_0018799 | 3300046507 | Bacteria | 5169 |
| 444 | Ga0495610_0000437 | 3300046512 | Bacteria | 42948 |
| 445 | Ga0495610_0000548 | 3300046512 | Bacteria | 37624 |
| 446 | Ga0495610_0000842 | 3300046512 | Bacteria | 28591 |
| 447 | Ga0495610_0001034 | 3300046512 | Bacteria | 25559 |
| 448 | Ga0495610_0003325 | 3300046512 | Bacteria | 12622 |
| 449 | Ga0495610_0003948 | 3300046512 | Bacteria | 11234 |
| 450 | Ga0495610_0004690 | 3300046512 | Bacteria | 9990 |
| 451 | Ga0495610_0008720 | 3300046512 | Bacteria | 6519 |
| 452 | Ga0495610_0008758 | 3300046512 | Bacteria | 6498 |
| 453 | Ga0495610_0041012 | 3300046512 | Bacteria | 2327 |
| 454 | Ga0495616_0000104 | 3300046513 | Bacteria | 72819 |
| 455 | Ga0495616_0000130 | 3300046513 | Bacteria | 65741 |
| 456 | Ga0495616_0001613 | 3300046513 | Bacteria | 15447 |
| 457 | Ga0495616_0002523 | 3300046513 | Bacteria | 12106 |
| 458 | Ga0495616_0006448 | 3300046513 | Bacteria | 7094 |
| 459 | Ga0495616_0020427 | 3300046513 | Bacteria | 3602 |
| 460 | Ga0495616_0028172 | 3300046513 | Bacteria | 2975 |
| 461 | Ga0495620_0000035 | 3300046515 | Bacteria | 115562 |
| 462 | Ga0495620_0000194 | 3300046515 | Bacteria | 46643 |
| 463 | Ga0495620_0003905 | 3300046515 | Bacteria | 8503 |
| 464 | Ga0495620_0018992 | 3300046515 | Bacteria | 3394 |
| 465 | Ga0495620_0032766 | 3300046515 | Bacteria | 2364 |
| 466 | Ga0495630_0111553 | 3300046517 | Bacteria | 2071 |
| 467 | Ga0495630_0151996 | 3300046517 | Bacteria | 1761 |
| 468 | Ga0495631_0000014 | 3300046518 | Bacteria | 109076 |
| 469 | Ga0495631_0001497 | 3300046518 | Bacteria | 14091 |
| 470 | Ga0495631_0038333 | 3300046518 | Bacteria | 2131 |
| 471 | Ga0495631_0067273 | 3300046518 | Bacteria | 1550 |
| 472 | Ga0495631_0096206 | 3300046518 | Bacteria | 1274 |
| 473 | Ga0495632_0000150 | 3300046519 | Bacteria | 72066 |
| 474 | Ga0495632_0000301 | 3300046519 | Bacteria | 47824 |
| 475 | Ga0495632_0001602 | 3300046519 | Bacteria | 18635 |
| 476 | Ga0495632_0003208 | 3300046519 | Bacteria | 11766 |
| 477 | Ga0495632_0010603 | 3300046519 | Bacteria | 5440 |
| 478 | Ga0495632_0011368 | 3300046519 | Bacteria | 5197 |
| 479 | Ga0495632_0011409 | 3300046519 | Bacteria | 5184 |
| 480 | Ga0495632_0017970 | 3300046519 | Bacteria | 3889 |
| 481 | Ga0495632_0018789 | 3300046519 | Bacteria | 3783 |
| 482 | Ga0495632_0102659 | 3300046519 | Bacteria | 1347 |
| 483 | Ga0495637_0000092 | 3300046520 | Bacteria | 70294 |
| 484 | Ga0495637_0000159 | 3300046520 | Bacteria | 51658 |
| 485 | Ga0495637_0000294 | 3300046520 | Bacteria | 38681 |
| 486 | Ga0495637_0000463 | 3300046520 | Bacteria | 29650 |
| 487 | Ga0495637_0000587 | 3300046520 | Bacteria | 25937 |
| 488 | Ga0495637_0000993 | 3300046520 | Bacteria | 17932 |
| 489 | Ga0495637_0001466 | 3300046520 | Bacteria | 13873 |
| 490 | Ga0495637_0002062 | 3300046520 | Bacteria | 11299 |
| 491 | Ga0495637_0004894 | 3300046520 | Bacteria | 6895 |
| 492 | Ga0495637_0006633 | 3300046520 | Bacteria | 5794 |
| 493 | Ga0495637_0007517 | 3300046520 | Bacteria | 5394 |
| 494 | Ga0495637_0010314 | 3300046520 | Bacteria | 4525 |
| 495 | Ga0495637_0012614 | 3300046520 | Bacteria | 4035 |
| 496 | Ga0495643_0000095 | 3300046522 | Bacteria | 148901 |
| 497 | Ga0495643_0000558 | 3300046522 | Bacteria | 46114 |
| 498 | Ga0495643_0000678 | 3300046522 | Bacteria | 39829 |
| 499 | Ga0495643_0002270 | 3300046522 | Bacteria | 15540 |
| 500 | Ga0495643_0002735 | 3300046522 | Bacteria | 13571 |
| 501 | Ga0495643_0003529 | 3300046522 | Bacteria | 11369 |
| 502 | Ga0495643_0015637 | 3300046522 | Bacteria | 4478 |
| 503 | Ga0495643_0047142 | 3300046522 | Bacteria | 2334 |
| 504 | Ga0495644_0000064 | 3300046523 | Bacteria | 51920 |
| 505 | Ga0495644_0000407 | 3300046523 | Bacteria | 19287 |
| 506 | Ga0495644_0001153 | 3300046523 | Bacteria | 10843 |
| 507 | Ga0495644_0009208 | 3300046523 | Bacteria | 3804 |
| 508 | Ga0495648_0000342 | 3300046524 | Bacteria | 51508 |
| 509 | Ga0495648_0000548 | 3300046524 | Bacteria | 40373 |
| 510 | Ga0495648_0001160 | 3300046524 | Bacteria | 26647 |
| 511 | Ga0495648_0005156 | 3300046524 | Bacteria | 10930 |
| 512 | Ga0495648_0005707 | 3300046524 | Bacteria | 10283 |
| 513 | Ga0495648_0009500 | 3300046524 | Bacteria | 7519 |
| 514 | Ga0495648_0015361 | 3300046524 | Bacteria | 5560 |
| 515 | Ga0495648_0021377 | 3300046524 | Bacteria | 4481 |
| 516 | Ga0495648_0022715 | 3300046524 | Bacteria | 4310 |
| 517 | Ga0495648_0027993 | 3300046524 | Bacteria | 3762 |
| 518 | Ga0495648_0093342 | 3300046524 | Bacteria | 1678 |
| 519 | Ga0495666_0008658 | 3300046526 | Bacteria | 5096 |
| 520 | Ga0495666_0023330 | 3300046526 | Bacteria | 3059 |
| 521 | Ga0495642_0000031 | 3300046528 | Bacteria | 87570 |
| 522 | Ga0495642_0001781 | 3300046528 | Bacteria | 9292 |
| 523 | Ga0495654_0000059 | 3300046530 | Bacteria | 137056 |
| 524 | Ga0495654_0000271 | 3300046530 | Bacteria | 47108 |
| 525 | Ga0495654_0000606 | 3300046530 | Bacteria | 28502 |
| 526 | Ga0495654_0000745 | 3300046530 | Bacteria | 25274 |
| 527 | Ga0495654_0001268 | 3300046530 | Bacteria | 17763 |
| 528 | Ga0495654_0001997 | 3300046530 | Bacteria | 13433 |
| 529 | Ga0495654_0002415 | 3300046530 | Bacteria | 12042 |
| 530 | Ga0495654_0004079 | 3300046530 | Bacteria | 8766 |
| 531 | Ga0495654_0008134 | 3300046530 | Bacteria | 5810 |
| 532 | Ga0495654_0016375 | 3300046530 | Bacteria | 3922 |
| 533 | Ga0495654_0028108 | 3300046530 | Bacteria | 2877 |
| 534 | Ga0495654_0036684 | 3300046530 | Bacteria | 2462 |
| 535 | Ga0495654_0056685 | 3300046530 | Bacteria | 1893 |
| 536 | Ga0495586_0074616 | 3300046535 | Bacteria | 1856 |
| 537 | Ga0495587_0009511 | 3300046536 | Bacteria | 6226 |
| 538 | Ga0495609_0000016 | 3300046538 | Bacteria | 312882 |
| 539 | Ga0495609_0000212 | 3300046538 | Bacteria | 57886 |
| 540 | Ga0495609_0001331 | 3300046538 | Bacteria | 16773 |
| 541 | Ga0495609_0008558 | 3300046538 | Bacteria | 5005 |
| 542 | Ga0495609_0051377 | 3300046538 | Bacteria | 1835 |
| 543 | Ga0495597_0000008 | 3300046542 | Bacteria | 232976 |
| 544 | Ga0495597_0000166 | 3300046542 | Bacteria | 58474 |
| 545 | Ga0495597_0003038 | 3300046542 | Bacteria | 10113 |
| 546 | Ga0495597_0007746 | 3300046542 | Bacteria | 5427 |
| 547 | Ga0495597_0010482 | 3300046542 | Bacteria | 4529 |
| 548 | Ga0495597_0026724 | 3300046542 | Bacteria | 2651 |
| 549 | Ga0495597_0055900 | 3300046542 | Bacteria | 1729 |
| 550 | Ga0495597_0083696 | 3300046542 | Bacteria | 1362 |
| 551 | Ga0495597_0084384 | 3300046542 | Bacteria | 1354 |
| 552 | Ga0495645_0143239 | 3300046543 | Bacteria | 1666 |
| 553 | Ga0495622_0000070 | 3300046557 | Bacteria | 89579 |
| 554 | Ga0495622_0000219 | 3300046557 | Bacteria | 45417 |
| 555 | Ga0495622_0001332 | 3300046557 | Bacteria | 12628 |
| 556 | Ga0495622_0002268 | 3300046557 | Bacteria | 9351 |
| 557 | Ga0495622_0006459 | 3300046557 | Bacteria | 5438 |
| 558 | Ga0495622_0025799 | 3300046557 | Bacteria | 2745 |
| 559 | Ga0495633_0007125 | 3300046558 | Bacteria | 6494 |
| 560 | Ga0495633_0008891 | 3300046558 | Bacteria | 5601 |
| 561 | Ga0495656_0001351 | 3300046615 | Bacteria | 8004 |
| 562 | Ga0495668_0000035 | 3300046616 | Bacteria | 240241 |
| 563 | Ga0495668_0000635 | 3300046616 | Bacteria | 42189 |
| 564 | Ga0495668_0007323 | 3300046616 | Bacteria | 7074 |
| 565 | Ga0495668_0066353 | 3300046616 | Bacteria | 1986 |
| 566 | Ga0495634_0000290 | 3300046642 | Bacteria | 48107 |
| 567 | Ga0495611_0000012 | 3300046648 | Bacteria | 131579 |
| 568 | Ga0495611_0003167 | 3300046648 | Bacteria | 7291 |
| 569 | Ga0495625_0000016 | 3300046660 | Bacteria | 311353 |
| 570 | Ga0495625_0000383 | 3300046660 | Bacteria | 67584 |
| 571 | Ga0495625_0001793 | 3300046660 | Bacteria | 24664 |
| 572 | Ga0495625_0002516 | 3300046660 | Bacteria | 19731 |
| 573 | Ga0495625_0002680 | 3300046660 | Bacteria | 18942 |
| 574 | Ga0495625_0008756 | 3300046660 | Bacteria | 8577 |
| 575 | Ga0495625_0025304 | 3300046660 | Bacteria | 4502 |
| 576 | Ga0495625_0079960 | 3300046660 | Bacteria | 2278 |
| 577 | Ga0495635_0005892 | 3300046663 | Bacteria | 8544 |
| 578 | Ga0495659_0000056 | 3300046664 | Bacteria | 49485 |
| 579 | Ga0495659_0020198 | 3300046664 | Bacteria | 2235 |
| 580 | Ga0495661_0000001 | 3300046665 | Bacteria | 898372 |
| 581 | Ga0495661_0000168 | 3300046665 | Bacteria | 77948 |
| 582 | Ga0495661_0000313 | 3300046665 | Bacteria | 54614 |
| 583 | Ga0495661_0002496 | 3300046665 | Bacteria | 14152 |
| 584 | Ga0495661_0004657 | 3300046665 | Bacteria | 9856 |
| 585 | Ga0495661_0018031 | 3300046665 | Bacteria | 4649 |
| 586 | Ga0495661_0147495 | 3300046665 | Bacteria | 1273 |
| 587 | Ga0495588_0003662 | 3300046674 | Bacteria | 6723 |
| 588 | Ga0495588_0005431 | 3300046674 | Bacteria | 5672 |
| 589 | Ga0495623_0011063 | 3300046679 | Bacteria | 5837 |
| 590 | Ga0495646_0020643 | 3300046680 | Bacteria | 4168 |
| 591 | Ga0495646_0035831 | 3300046680 | Bacteria | 3075 |
| 592 | Ga0495669_0010500 | 3300046684 | Bacteria | 3915 |
| 593 | Ga0495669_0037048 | 3300046684 | Bacteria | 2158 |
| 594 | Ga0495624_0000016 | 3300046690 | Bacteria | 106958 |
| 595 | Ga0495670_0000234 | 3300046691 | Bacteria | 25392 |
| 596 | Ga0495670_0000242 | 3300046691 | Bacteria | 25244 |
| 597 | Ga0495670_0000386 | 3300046691 | Bacteria | 21052 |
| 598 | Ga0495670_0000814 | 3300046691 | Bacteria | 15032 |
| 599 | Ga0495670_0006576 | 3300046691 | Bacteria | 5714 |
| 600 | Ga0495670_0012087 | 3300046691 | Bacteria | 4247 |
| 601 | Ga0495671_0000654 | 3300046692 | Bacteria | 25150 |
| 602 | Ga0495671_0007786 | 3300046692 | Bacteria | 6067 |
| 603 | Ga0495671_0007938 | 3300046692 | Bacteria | 6004 |
| 604 | Ga0495671_0011422 | 3300046692 | Bacteria | 4887 |
| 605 | Ga0495671_0014634 | 3300046692 | Bacteria | 4216 |
| 606 | Ga0495671_0060509 | 3300046692 | Bacteria | 1869 |
| 607 | Ga0495671_0065829 | 3300046692 | Bacteria | 1783 |
| 608 | Ga0495671_0099525 | 3300046692 | Bacteria | 1421 |
| 609 | Ga0495671_0111249 | 3300046692 | Bacteria | 1337 |
| 610 | Ga0495649_0000485 | 3300046694 | Bacteria | 34144 |
| 611 | Ga0495649_0001028 | 3300046694 | Bacteria | 21892 |
| 612 | Ga0495649_0001165 | 3300046694 | Bacteria | 20422 |
| 613 | Ga0495649_0001809 | 3300046694 | Bacteria | 15717 |
| 614 | Ga0495649_0002111 | 3300046694 | Bacteria | 14267 |
| 615 | Ga0495649_0005307 | 3300046694 | Bacteria | 8226 |
| 616 | Ga0495649_0007885 | 3300046694 | Bacteria | 6443 |
| 617 | Ga0495649_0008167 | 3300046694 | Bacteria | 6311 |
| 618 | Ga0495649_0008219 | 3300046694 | Bacteria | 6288 |
| 619 | Ga0495649_0025906 | 3300046694 | Bacteria | 3265 |
| 620 | Ga0495649_0028459 | 3300046694 | Bacteria | 3097 |
| 621 | Ga0495649_0031233 | 3300046694 | Bacteria | 2937 |
| 622 | Ga0495649_0043996 | 3300046694 | Bacteria | 2437 |
| 623 | Ga0495649_0122507 | 3300046694 | Bacteria | 1374 |
| 624 | Ga0495589_0000303 | 3300046794 | Bacteria | 39290 |
| 625 | Ga0495589_0000674 | 3300046794 | Bacteria | 22355 |
| 626 | Ga0495589_0001176 | 3300046794 | Bacteria | 15598 |
| 627 | Ga0495589_0001506 | 3300046794 | Bacteria | 13411 |
| 628 | Ga0495589_0001919 | 3300046794 | Bacteria | 11780 |
| 629 | Ga0495589_0002121 | 3300046794 | Bacteria | 11197 |
| 630 | Ga0495589_0062189 | 3300046794 | Bacteria | 1831 |
| 631 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 632 | Ga0495660_0000020 | 3300046810 | Bacteria | 304768 |
| 633 | Ga0495660_0000152 | 3300046810 | Bacteria | 74914 |
| 634 | Ga0495660_0000320 | 3300046810 | Bacteria | 42697 |
| 635 | Ga0495660_0000519 | 3300046810 | Bacteria | 31670 |
| 636 | Ga0495660_0001873 | 3300046810 | Bacteria | 13810 |
| 637 | Ga0495660_0005371 | 3300046810 | Bacteria | 7673 |
| 638 | Ga0495660_0006192 | 3300046810 | Bacteria | 7101 |
| 639 | Ga0495660_0017311 | 3300046810 | Bacteria | 4150 |
| 640 | Ga0495660_0024047 | 3300046810 | Bacteria | 3471 |
| 641 | Ga0495660_0026407 | 3300046810 | Bacteria | 3292 |
| 642 | Ga0495660_0029585 | 3300046810 | Bacteria | 3089 |
| 643 | Ga0495660_0033747 | 3300046810 | Bacteria | 2867 |
| 644 | Ga0495660_0035880 | 3300046810 | Bacteria | 2767 |
| 645 | Ga0495660_0054109 | 3300046810 | Bacteria | 2175 |
| 646 | Ga0495660_0054146 | 3300046810 | Bacteria | 2174 |
| 647 | Ga0495660_0064008 | 3300046810 | Bacteria | 1966 |
| 648 | Ga0495581_0000599 | 3300047315 | Bacteria | 18849 |
| 649 | Ga0495581_0064300 | 3300047315 | Bacteria | 2119 |
| 650 | Ga0495604_0019884 | 3300047317 | Bacteria | 5371 |
| 651 | Ga0495604_0075018 | 3300047317 | Bacteria | 2547 |
| 652 | Ga0495636_0001115 | 3300047318 | Bacteria | 10111 |
| 653 | Ga0495636_0019755 | 3300047318 | Bacteria | 2710 |
| 654 | Ga0495672_0000011 | 3300047320 | Bacteria | 535362 |
| 655 | Ga0495672_0000283 | 3300047320 | Bacteria | 70623 |
| 656 | Ga0495672_0000393 | 3300047320 | Bacteria | 53595 |
| 657 | Ga0495672_0000434 | 3300047320 | Bacteria | 50042 |
| 658 | Ga0495672_0000586 | 3300047320 | Bacteria | 41100 |
| 659 | Ga0495672_0003354 | 3300047320 | Bacteria | 13794 |
| 660 | Ga0495672_0007223 | 3300047320 | Bacteria | 8382 |
| 661 | Ga0495672_0014069 | 3300047320 | Bacteria | 5494 |
| 662 | Ga0495672_0042721 | 3300047320 | Bacteria | 2731 |
| 663 | Ga0495672_0057354 | 3300047320 | Bacteria | 2262 |
| 664 | Ga0495672_0065162 | 3300047320 | Bacteria | 2083 |
| 665 | Ga0495672_0080252 | 3300047320 | Bacteria | 1820 |
| 666 | Ga0495676_0000001 | 3300047321 | Bacteria | 624167 |
| 667 | Ga0495676_0000297 | 3300047321 | Bacteria | 40253 |
| 668 | Ga0495680_0105999 | 3300047322 | Bacteria | 2089 |
| 669 | Ga0495683_0000057 | 3300047323 | Bacteria | 118509 |
| 670 | Ga0495683_0000284 | 3300047323 | Bacteria | 43810 |
| 671 | Ga0495683_0010203 | 3300047323 | Bacteria | 4974 |
| 672 | Ga0495683_0014211 | 3300047323 | Bacteria | 4147 |
| 673 | Ga0495683_0040101 | 3300047323 | Bacteria | 2366 |
| 674 | Ga0495683_0046685 | 3300047323 | Bacteria | 2173 |
| 675 | Ga0495683_0057932 | 3300047323 | Bacteria | 1924 |
| 676 | Ga0495687_000951 | 3300047443 | Bacteria | 29800 |
| 677 | Ga0495687_002123 | 3300047443 | Bacteria | 16602 |
| 678 | Ga0495675_0015734 | 3300047444 | Bacteria | 4783 |
| 679 | Ga0495677_0000669 | 3300047445 | Bacteria | 13860 |
| 680 | Ga0495679_000042 | 3300047446 | Bacteria | 143151 |
| 681 | Ga0495679_000883 | 3300047446 | Bacteria | 18805 |
| 682 | Ga0495679_001280 | 3300047446 | Bacteria | 14771 |
| 683 | Ga0495679_002230 | 3300047446 | Bacteria | 10075 |
| 684 | Ga0495679_005328 | 3300047446 | Bacteria | 5718 |
| 685 | Ga0495679_006058 | 3300047446 | Bacteria | 5279 |
| 686 | Ga0495685_002753 | 3300047447 | Bacteria | 5543 |
| 687 | Ga0495673_0000020 | 3300047469 | Bacteria | 548327 |
| 688 | Ga0495673_0000234 | 3300047469 | Bacteria | 80453 |
| 689 | Ga0495673_0000672 | 3300047469 | Bacteria | 33703 |
| 690 | Ga0495673_0000699 | 3300047469 | Bacteria | 32795 |
| 691 | Ga0495673_0000717 | 3300047469 | Bacteria | 32108 |
| 692 | Ga0495673_0000829 | 3300047469 | Bacteria | 28864 |
| 693 | Ga0495673_0000891 | 3300047469 | Bacteria | 27479 |
| 694 | Ga0495673_0001685 | 3300047469 | Bacteria | 16967 |
| 695 | Ga0495673_0001917 | 3300047469 | Bacteria | 15510 |
| 696 | Ga0495673_0009026 | 3300047469 | Bacteria | 5542 |
| 697 | Ga0495673_0017359 | 3300047469 | Bacteria | 3658 |
| 698 | Ga0495673_0028037 | 3300047469 | Bacteria | 2671 |
| 699 | Ga0495673_0029661 | 3300047469 | Bacteria | 2579 |
| 700 | Ga0495681_0000031 | 3300047470 | Bacteria | 128177 |
| 701 | Ga0495681_0000383 | 3300047470 | Bacteria | 34538 |
| 702 | Ga0495681_0001036 | 3300047470 | Bacteria | 21248 |
| 703 | Ga0495681_0001225 | 3300047470 | Bacteria | 19539 |
| 704 | Ga0495681_0002320 | 3300047470 | Bacteria | 13677 |
| 705 | Ga0495681_0006227 | 3300047470 | Bacteria | 7866 |
| 706 | Ga0495681_0008411 | 3300047470 | Bacteria | 6475 |
| 707 | Ga0495681_0008942 | 3300047470 | Bacteria | 6219 |
| 708 | Ga0495681_0011462 | 3300047470 | Bacteria | 5276 |
| 709 | Ga0495681_0016076 | 3300047470 | Bacteria | 4212 |
| 710 | Ga0495681_0032445 | 3300047470 | Bacteria | 2629 |
| 711 | Ga0495686_0001144 | 3300047472 | Bacteria | 31199 |
| 712 | Ga0495686_0002045 | 3300047472 | Bacteria | 19859 |
| 713 | Ga0495686_0002569 | 3300047472 | Bacteria | 16905 |
| 714 | Ga0495686_0002613 | 3300047472 | Bacteria | 16699 |
| 715 | Ga0495686_0008842 | 3300047472 | Bacteria | 7332 |
| 716 | Ga0495686_0011068 | 3300047472 | Bacteria | 6379 |
| 717 | Ga0495686_0012750 | 3300047472 | Bacteria | 5866 |
| 718 | Ga0495686_0201788 | 3300047472 | Bacteria | 1141 |
| 719 | Ga0495593_0001268 | 3300047673 | Bacteria | 14814 |
| 720 | Ga0495593_0022678 | 3300047673 | Bacteria | 3494 |
| 721 | Ga0495593_0038459 | 3300047673 | Bacteria | 2584 |
| 722 | Ga0495626_0000002 | 3300048091 | Bacteria | 436012 |
| 723 | Ga0495626_0000077 | 3300048091 | Bacteria | 130910 |
| 724 | Ga0495626_0000268 | 3300048091 | Bacteria | 58845 |
| 725 | Ga0495626_0000332 | 3300048091 | Bacteria | 50010 |
| 726 | Ga0495626_0000449 | 3300048091 | Bacteria | 41933 |
| 727 | Ga0495626_0000513 | 3300048091 | Bacteria | 38809 |
| 728 | Ga0495626_0002500 | 3300048091 | Bacteria | 12690 |
| 729 | Ga0495626_0003737 | 3300048091 | Bacteria | 9607 |
| 730 | Ga0495626_0004807 | 3300048091 | Bacteria | 8147 |
| 731 | Ga0496102_0000394 | 3300048905 | Bacteria | 50983 |
| 732 | Ga0496104_0001252 | 3300048907 | Bacteria | 21890 |
| 733 | Ga0496105_0110455 | 3300048908 | Bacteria | 2269 |
| 734 | Ga0496108_0112556 | 3300048911 | Bacteria | 2329 |
| 735 | Ga0496110_0059246 | 3300048913 | Bacteria | 3374 |
| 736 | Ga0496112_0133637 | 3300048915 | Bacteria | 2451 |
| 737 | Ga0496114_0006030 | 3300048917 | Bacteria | 9537 |
| 738 | Ga0496114_0007811 | 3300048917 | Bacteria | 8463 |
| 739 | Ga0496114_0055514 | 3300048917 | Bacteria | 3303 |
| 740 | Ga0496114_0065873 | 3300048917 | Bacteria | 3036 |
| 741 | Ga0496115_0045606 | 3300048918 | Bacteria | 3500 |
| 742 | Ga0496116_0000038 | 3300048919 | Bacteria | 370217 |
| 743 | Ga0496116_0000162 | 3300048919 | Bacteria | 135528 |
| 744 | Ga0496116_0000250 | 3300048919 | Bacteria | 96353 |
| 745 | Ga0496116_0000744 | 3300048919 | Bacteria | 41592 |
| 746 | Ga0496116_0003719 | 3300048919 | Bacteria | 14917 |
| 747 | Ga0496116_0011307 | 3300048919 | Bacteria | 7405 |
| 748 | Ga0496116_0014877 | 3300048919 | Bacteria | 6180 |
| 749 | Ga0496117_0000158 | 3300048920 | Bacteria | 144464 |
| 750 | Ga0496117_0003060 | 3300048920 | Bacteria | 20034 |
| 751 | Ga0496117_0004846 | 3300048920 | Bacteria | 14542 |
| 752 | Ga0496117_0004969 | 3300048920 | Bacteria | 14265 |
| 753 | Ga0496117_0009448 | 3300048920 | Bacteria | 9073 |
| 754 | Ga0496117_0009688 | 3300048920 | Bacteria | 8907 |
| 755 | Ga0496118_0015897 | 3300048921 | Bacteria | 6937 |
| 756 | Ga0496118_0030811 | 3300048921 | Bacteria | 4464 |
| 757 | Ga0496118_0033352 | 3300048921 | Bacteria | 4225 |
| 758 | Ga0496118_0034128 | 3300048921 | Bacteria | 4158 |
| 759 | Ga0496118_0056194 | 3300048921 | Bacteria | 2961 |
| 760 | Ga0496118_0062218 | 3300048921 | Bacteria | 2757 |
| 761 | Ga0496118_0175446 | 3300048921 | Bacteria | 1302 |
| 762 | Ga0496119_0000381 | 3300048922 | Bacteria | 61103 |
| 763 | Ga0496119_0001130 | 3300048922 | Bacteria | 33638 |
| 764 | Ga0496119_0002052 | 3300048922 | Bacteria | 22792 |
| 765 | Ga0496119_0003407 | 3300048922 | Bacteria | 16517 |
| 766 | Ga0496119_0005201 | 3300048922 | Bacteria | 12572 |
| 767 | Ga0496119_0006701 | 3300048922 | Bacteria | 10588 |
| 768 | Ga0496119_0017556 | 3300048922 | Bacteria | 5376 |
| 769 | Ga0496120_0000092 | 3300048923 | Bacteria | 148990 |
| 770 | Ga0496120_0000210 | 3300048923 | Bacteria | 100008 |
| 771 | Ga0496120_0003330 | 3300048923 | Bacteria | 14765 |
| 772 | Ga0496120_0010867 | 3300048923 | Bacteria | 6302 |
| 773 | Ga0496120_0031145 | 3300048923 | Bacteria | 3234 |
| 774 | Ga0496121_0000117 | 3300048924 | Bacteria | 176263 |
| 775 | Ga0496121_0041739 | 3300048924 | Bacteria | 4005 |
| 776 | Ga0496121_0057634 | 3300048924 | Bacteria | 3218 |
| 777 | Ga0496121_0060889 | 3300048924 | Bacteria | 3102 |
| 778 | Ga0496121_0127435 | 3300048924 | Bacteria | 1911 |
| 779 | Ga0496121_0159759 | 3300048924 | Bacteria | 1649 |
| 780 | Ga0496122_0000007 | 3300048925 | Bacteria | 606493 |
| 781 | Ga0496122_0000540 | 3300048925 | Bacteria | 78333 |
| 782 | Ga0496122_0001075 | 3300048925 | Bacteria | 47418 |
| 783 | Ga0496122_0070419 | 3300048925 | Bacteria | 2498 |
| 784 | Ga0496123_0000004 | 3300048926 | Bacteria | 777230 |
| 785 | Ga0496123_0000319 | 3300048926 | Bacteria | 91891 |
| 786 | Ga0496123_0001278 | 3300048926 | Bacteria | 35952 |
| 787 | Ga0496123_0011945 | 3300048926 | Bacteria | 7454 |
| 788 | Ga0496123_0025543 | 3300048926 | Bacteria | 4451 |
| 789 | Ga0496124_0000025 | 3300048927 | Bacteria | 405471 |
| 790 | Ga0496124_0000647 | 3300048927 | Bacteria | 57453 |
| 791 | Ga0496124_0008507 | 3300048927 | Bacteria | 10719 |
| 792 | Ga0496124_0015485 | 3300048927 | Bacteria | 7307 |
| 793 | Ga0496124_0017213 | 3300048927 | Bacteria | 6821 |
| 794 | Ga0496124_0049046 | 3300048927 | Bacteria | 3603 |
| 795 | Ga0496124_0053648 | 3300048927 | Bacteria | 3415 |
| 796 | Ga0496124_0096716 | 3300048927 | Bacteria | 2398 |
| 797 | Ga0496124_0197799 | 3300048927 | Bacteria | 1531 |
| 798 | Ga0496125_0000013 | 3300048928 | Bacteria | 628761 |
| 799 | Ga0496125_0000274 | 3300048928 | Bacteria | 104123 |
| 800 | Ga0496125_0025923 | 3300048928 | Bacteria | 5356 |
| 801 | Ga0496125_0027837 | 3300048928 | Bacteria | 5115 |
| 802 | Ga0496125_0028049 | 3300048928 | Bacteria | 5091 |
| 803 | Ga0496125_0028106 | 3300048928 | Bacteria | 5085 |
| 804 | Ga0496125_0058394 | 3300048928 | Bacteria | 3116 |
| 805 | Ga0496125_0059388 | 3300048928 | Bacteria | 3081 |
| 806 | Ga0496125_0083687 | 3300048928 | Bacteria | 2426 |
| 807 | Ga0496126_0001920 | 3300048929 | Bacteria | 29815 |
| 808 | Ga0496126_0002710 | 3300048929 | Bacteria | 23401 |
| 809 | Ga0496126_0015538 | 3300048929 | Bacteria | 7649 |
| 810 | Ga0496126_0045494 | 3300048929 | Bacteria | 4033 |
| 811 | Ga0496126_0262256 | 3300048929 | Bacteria | 1436 |
| 812 | Ga0495678_000008 | 3300049459 | Bacteria | 445926 |
| 813 | Ga0495678_000822 | 3300049459 | Bacteria | 27821 |
| 814 | Ga0495678_000965 | 3300049459 | Bacteria | 24815 |
| 815 | Ga0495678_001509 | 3300049459 | Bacteria | 18118 |
| 816 | Ga0495678_003986 | 3300049459 | Bacteria | 8825 |
| 817 | Ga0495678_006156 | 3300049459 | Bacteria | 6437 |
| 818 | Ga0495678_007056 | 3300049459 | Bacteria | 5883 |
| 819 | Ga0495678_023935 | 3300049459 | Bacteria | 2645 |
| 820 | Ga0495678_031290 | 3300049459 | Bacteria | 2220 |
| 821 | Ga0495678_065534 | 3300049459 | Bacteria | 1347 |
| 822 | Ga0495682_0000005 | 3300049460 | Bacteria | 360387 |
| 823 | Ga0495682_0001187 | 3300049460 | Bacteria | 14817 |
| 824 | Ga0495682_0012601 | 3300049460 | Bacteria | 3238 |
| 825 | Ga0495682_0031317 | 3300049460 | Bacteria | 1965 |
| 826 | Ga0501034_0000200 | 3300049571 | Bacteria | 113556 |
| 827 | Ga0501222_000102 | 3300049662 | Bacteria | 20962 |
| 828 | Ga0501226_000209 | 3300049853 | Bacteria | 9271 |
| 829 | nmdc:mga00v17_75319_c1 | 3300050491 | Bacteria | 2098 |
| 830 | Ga0500621_000014 | 3300053126 | Bacteria | 126576 |
| 831 | Ga0500634_0000963 | 3300053161 | Bacteria | 10390 |
| 832 | 2508852360 | 2508501071 | Bacteria | 5454741 |
| 833 | 2511255638 | 2511231004 | Bacteria | 6669789 |
| 834 | 2511266061 | 2511231006 | Bacteria | 6794709 |
| 835 | 2511280255 | 2511231008 | Bacteria | 6624100 |
| 836 | 2511291640 | 2511231010 | Bacteria | 6373152 |
| 837 | 2511296800 | 2511231011 | Bacteria | 6149768 |
| 838 | 2511299665 | 2511231012 | Bacteria | 6738011 |
| 839 | 2511316589 | 2511231014 | Bacteria | 6462302 |
| 840 | 2511318259 | 2511231015 | Bacteria | 6598026 |
| 841 | 2511326964 | 2511231016 | Bacteria | 6704427 |
| 842 | 2511339460 | 2511231018 | Bacteria | 6436256 |
| 843 | 2511342277 | 2511231019 | Bacteria | 6520662 |
| 844 | 2511352495 | 2511231020 | Bacteria | 6115223 |
| 845 | 2511359527 | 2511231021 | Bacteria | 7302637 |
| 846 | 2511361646 | 2511231022 | Bacteria | 6719296 |
| 847 | 2511366846 | 2511231023 | Bacteria | 6808468 |
| 848 | 2511376075 | 2511231024 | Bacteria | 5835885 |
| 849 | 2511415471 | 2511231031 | Bacteria | 6558529 |
| 850 | 2511824777 | 2511231156 | Bacteria | 6845832 |
| 851 | 2512323733 | 2512047018 | Bacteria | 6663241 |
| 852 | 2555669878 | 2554235341 | Bacteria | 6867980 |
| 853 | 2583792009 | 2582580891 | Bacteria | 6800976 |
| 854 | 2585828590 | 2585427591 | Bacteria | 5482980 |
| 855 | 2585834306 | 2585427592 | Bacteria | 5370892 |
| 856 | 2597857960 | 2597489887 | Bacteria | 6666321 |
| 857 | 2597864178 | 2597489888 | Bacteria | 6179543 |
| 858 | 2597869680 | 2597489889 | Bacteria | 6297495 |
| 859 | 2599359455 | 2599185161 | Bacteria | 6960462 |
| 860 | 2599365024 | 2599185162 | Bacteria | 6957254 |
| 861 | 2599372149 | 2599185163 | Bacteria | 6995158 |
| 862 | 2599391007 | 2599185166 | Bacteria | 6959206 |
| 863 | 2599398491 | 2599185167 | Bacteria | 6353609 |
| 864 | 2599403192 | 2599185168 | Bacteria | 6997636 |
| 865 | 2599450540 | 2599185179 | Bacteria | 6611171 |
| 866 | 2599465711 | 2599185182 | Bacteria | 6883168 |
| 867 | 2599484987 | 2599185185 | Bacteria | 6652270 |
| 868 | 2599500530 | 2599185188 | Bacteria | 6164180 |
| 869 | 2599507183 | 2599185189 | Bacteria | 5862825 |
| 870 | 2599512977 | 2599185190 | Bacteria | 6285678 |
| 871 | 2599521655 | 2599185191 | Bacteria | 6297582 |
| 872 | 2599612375 | 2599185212 | Bacteria | 6765997 |
| 873 | 2599802622 | 2599185257 | Bacteria | 6492581 |
| 874 | 2599880416 | 2599185288 | Bacteria | 6666191 |
| 875 | 2599891654 | 2599185290 | Bacteria | 6289611 |
| 876 | 2599898815 | 2599185291 | Bacteria | 6775623 |
| 877 | 2599932213 | 2599185300 | Bacteria | 6062622 |
| 878 | 2599944263 | 2599185302 | Bacteria | 5954930 |
| 879 | 2599946900 | 2599185303 | Bacteria | 6512725 |
| 880 | 2599954735 | 2599185304 | Bacteria | 5951361 |
| 881 | 2599959801 | 2599185305 | Bacteria | 6748700 |
| 882 | 2599967460 | 2599185306 | Bacteria | 6637356 |
| 883 | 2599977011 | 2599185308 | Bacteria | 6621546 |
| 884 | 2599985677 | 2599185309 | Bacteria | 5969593 |
| 885 | 2599991525 | 2599185310 | Bacteria | 6014457 |
| 886 | 2599993645 | 2599185311 | Bacteria | 6354990 |
| 887 | 2600002526 | 2599185312 | Bacteria | 5912071 |
| 888 | 2600011261 | 2599185314 | Bacteria | 6621749 |
| 889 | 2600016309 | 2599185315 | Bacteria | 6771107 |
| 890 | 2600024615 | 2599185316 | Bacteria | 6320029 |
| 891 | 2600031633 | 2599185317 | Bacteria | 6435722 |
| 892 | 2600034987 | 2599185318 | Bacteria | 6961590 |
| 893 | 2600040630 | 2599185319 | Bacteria | 6637840 |
| 894 | 2600050168 | 2599185320 | Bacteria | 5963263 |
| 895 | 2600051515 | 2599185321 | Bacteria | 6764560 |
| 896 | 2600059242 | 2599185322 | Bacteria | 6763055 |
| 897 | 2600062967 | 2599185323 | Bacteria | 6688755 |
| 898 | 2600072585 | 2599185324 | Bacteria | 6590677 |
| 899 | 2600079310 | 2599185325 | Bacteria | 6324919 |
| 900 | 2600361384 | 2600254930 | Bacteria | 6431253 |
| 901 | 2600366530 | 2600254931 | Bacteria | 6734225 |
| 902 | 2601533550 | 2600255256 | Bacteria | 5597742 |
| 903 | 2601539798 | 2600255257 | Bacteria | 5597196 |
| 904 | 2601692019 | 2600255296 | Bacteria | 5784754 |
| 905 | 2601758147 | 2600255310 | Bacteria | 5600903 |
| 906 | 2601763601 | 2600255311 | Bacteria | 5598766 |
| 907 | 2601799575 | 2600255318 | Bacteria | 6383414 |
| 908 | 2603637478 | 2602042046 | Bacteria | 5483348 |
| 909 | 2606078191 | 2603880185 | Bacteria | 6379190 |
| 910 | 2606130299 | 2603880199 | Bacteria | 6377649 |
| 911 | 2621300030 | 2619619299 | Bacteria | 6649820 |
| 912 | 2624480603 | 2623620443 | Bacteria | 6427864 |
| 913 | 2624492497 | 2623620446 | Bacteria | 6500345 |
| 914 | 2643844560 | 2643221565 | Bacteria | 6216018 |
| 915 | 2643873910 | 2643221571 | Bacteria | 6228673 |
| 916 | 2643954301 | 2643221589 | Bacteria | 6250934 |
| 917 | 2644023110 | 2643221602 | Bacteria | 6249926 |
| 918 | 2644185224 | 2643221633 | Bacteria | 6733554 |
| 919 | 2644284332 | 2643221650 | Bacteria | 7029547 |
| 920 | 2644620407 | 2643221713 | Bacteria | 6554480 |
| 921 | 2652547826 | 2651869719 | Bacteria | 6047974 |
| 922 | 2671091755 | 2667528170 | Bacteria | 6786960 |
| 923 | 2671095306 | 2667528171 | Bacteria | 6900659 |
| 924 | 2671108858 | 2667528173 | Bacteria | 5375747 |
| 925 | 2671126605 | 2667528176 | Bacteria | 6724917 |
| 926 | 2671769759 | 2671180172 | Bacteria | 6495783 |
| 927 | 2677896231 | 2675903420 | Bacteria | 6247433 |
| 928 | 2678265495 | 2675903515 | Bacteria | 6580491 |
| 929 | 2715751527 | 2713897148 | Bacteria | 5883533 |
| 930 | 2715756561 | 2713897149 | Bacteria | 6506249 |
| 931 | 2718634262 | 2718217725 | Bacteria | 5758958 |
| 932 | 2723248880 | 2721755607 | Bacteria | 5841722 |
| 933 | 2738670032 | 2738541265 | Bacteria | 6594665 |
| 934 | 2738748425 | 2738541282 | Bacteria | 6593925 |
| 935 | 2738806639 | 2738541294 | Bacteria | 6925949 |
| 936 | 2738857467 | 2738541303 | Bacteria | 6591772 |
| 937 | 2738893999 | 2738541309 | Bacteria | 6926455 |
| 938 | 2739199437 | 2738543004 | Bacteria | 6381073 |
| 939 | 2739289885 | 2738543020 | Bacteria | 5718238 |
| 940 | 2739295197 | 2738543021 | Bacteria | 5718241 |
| 941 | 2739311969 | 2738543025 | Bacteria | 6600348 |
| 942 | 2743737427 | 2740892503 | Bacteria | 6855563 |
| 943 | 2745005946 | 2744054620 | Bacteria | 6551379 |
| 944 | 2772438938 | 2772190666 | Bacteria | 5117644 |
| 945 | 2774120435 | 2773857670 | Bacteria | 6407454 |
| 946 | 2774133623 | 2773857673 | Bacteria | 6513460 |
| 947 | 2784264622 | 2784132063 | Bacteria | 6262788 |
| 948 | 2784312908 | 2784132072 | Bacteria | 6596533 |
| 949 | 2794597391 | 2791355520 | Bacteria | 5948615 |
| 950 | 2808853787 | 2808606361 | Bacteria | 6136259 |
| 951 | 2808922139 | 2808606376 | Bacteria | 6248667 |
| 952 | 2808929702 | 2808606377 | Bacteria | 6646337 |
| 953 | 2808933590 | 2808606378 | Bacteria | 6177535 |
| 954 | 2808944878 | 2808606380 | Bacteria | 6248705 |
| 955 | 2808951719 | 2808606381 | Bacteria | 6646461 |
| 956 | 2808956150 | 2808606382 | Bacteria | 6841132 |
| 957 | 2808962064 | 2808606383 | Bacteria | 6138645 |
| 958 | 2808979239 | 2808606385 | Bacteria | 6711065 |
| 959 | 2808994877 | 2808606388 | Bacteria | 6706662 |
| 960 | 2808997179 | 2808606389 | Bacteria | 6138126 |
| 961 | 2809214970 | 2808606445 | Bacteria | 6057339 |
| 962 | 2813728530 | 2811995292 | Bacteria | 5303342 |
| 963 | 2814696040 | 2814123068 | Bacteria | 5687681 |
| 964 | 2817491369 | 2816332298 | Bacteria | 6852809 |
| 965 | 2819658714 | 2818991456 | Bacteria | 6123676 |
| 966 | 2819701214 | 2818991464 | Bacteria | 6907494 |
| 967 | 2825651621 | 2825651385 | Bacteria | 6715909 |
| 968 | 2834033621 | 2834028612 | Bacteria | 6354979 |
| 969 | 2842827084 | 2842826826 | Bacteria | 5974129 |
| 970 | 2842834569 | 2842832357 | Bacteria | 5959113 |
| 971 | 2842839127 | 2842837860 | Bacteria | 6066181 |
| 972 | 2842848784 | 2842843487 | Bacteria | 6004777 |
| 973 | 2842859046 | 2842854478 | Bacteria | 6143501 |
| 974 | 2852614314 | 2852612431 | Bacteria | 6885235 |
| 975 | 2852661961 | 2852657418 | Bacteria | 6472974 |
| 976 | 2852667948 | 2852667396 | Bacteria | 6885555 |
| 977 | 2860344776 | 2860339153 | Bacteria | 6846989 |
| 978 | 2860870757 | 2860867994 | Bacteria | 5645326 |
| 979 | 2878032477 | 2878029506 | Bacteria | 6418441 |
| 980 | 2880233328 | 2880230671 | Bacteria | 6140320 |
| 981 | 2888368973 | 2888366609 | Bacteria | 5155009 |
| 982 | 2888378304 | 2888373701 | Bacteria | 5098052 |
| 983 | 2904475402 | 2904474040 | Bacteria | 5504324 |
| 984 | 2904524003 | 2904518522 | Bacteria | 6068986 |
| 985 | 2908449484 | 2908446538 | Bacteria | 6829095 |
| 986 | 2908449485 | 2908446538 | Bacteria | 6829095 |
| 987 | 2913039515 | 2913036834 | Bacteria | 6704877 |
| 988 | 2917073699 | 2917070673 | Bacteria | 6868303 |
| 989 | 2919065145 | 2919063839 | Bacteria | 6302690 |
| 990 | 2919154385 | 2919150387 | Bacteria | 5500879 |
| 991 | 2919158522 | 2919155634 | Bacteria | 4860545 |
| 992 | 2919386944 | 2919385768 | Bacteria | 5897293 |
| 993 | 2919458832 | 2919456309 | Bacteria | 6586567 |
| 994 | 2919487629 | 2919481497 | Bacteria | 6907839 |
| 995 | 2919489113 | 2919487758 | Bacteria | 5929766 |
| 996 | 2919698664 | 2919697872 | Bacteria | 6553725 |
| 997 | 2923156468 | 2923153595 | Bacteria | 6870622 |
| 998 | 2923588526 | 2923586266 | Bacteria | 6565975 |
| 999 | 2927144240 | 2927143783 | Bacteria | 5504251 |
| 1000 | 2929147680 | 2929144301 | Bacteria | 6622272 |
| 1001 | 2929192724 | 2929189879 | Bacteria | 5930554 |
| 1002 | 2931375211 | 2931369376 | Bacteria | 6847892 |
| 1003 | 2931393776 | 2931390751 | Bacteria | 6273349 |
| 1004 | 2931402294 | 2931396565 | Bacteria | 7251677 |
| 1005 | 2935357277 | 2935353572 | Unclassified | 6955622 |
| 1006 | 2937967554 | 2937967321 | Bacteria | 5094075 |
| 1007 | 2939607270 | 2939602548 | Bacteria | 4950493 |
| 1008 | 2939638998 | 2939636861 | Bacteria | 6297853 |
| 1009 | 2945933313 | 2945928738 | Bacteria | 6053221 |
| 1010 | 2945963206 | 2945961074 | Bacteria | 7342064 |
| 1011 | 2946009530 | 2946006987 | Bacteria | 6705746 |
| 1012 | 2946030772 | 2946027586 | Bacteria | 6049274 |
| 1013 | 2947237976 | 2947233263 | Bacteria | 6439278 |
| 1014 | 2969307348 | 2969304461 | Bacteria | 6601805 |
| 1015 | 2974290995 | 2974289157 | Bacteria | 6080362 |
| 1016 | 2984289595 | 2984286254 | Bacteria | 6702062 |
| 1017 | 2988728798 | 2988728565 | Bacteria | 6124362 |
| 1018 | 2998142824 | 2998139840 | Bacteria | 6073514 |
| 1019 | 3000377185 | 3000376612 | Bacteria | 4705565 |
| 1020 | 3007395834 | 3007395558 | Bacteria | 6755444 |
| 1021 | 3007421898 | 3007419365 | Bacteria | 7026924 |
| 1022 | 3007514497 | 3007511990 | Bacteria | 6481491 |
| 1023 | 3007614303 | 3007614139 | Bacteria | 6053559 |
| 1024 | 3007624005 | 3007619802 | Bacteria | 6411688 |
| 1025 | 3007719225 | 3007718800 | Bacteria | 5971527 |
| 1026 | 3007856846 | 3007855910 | Bacteria | 5637581 |
| 1027 | 3007862157 | 3007861166 | Bacteria | 6045338 |
| 1028 | 3007868918 | 3007866637 | Bacteria | 5899198 |
| 1029 | 640937871 | 640753048 | Bacteria | 5495657 |
| 1030 | 8004597417 | 8004592986 | Bacteria | 5122074 |
| 1031 | 8015395634 | 8015394850 | Bacteria | 5064660 |
| 1032 | 8015690661 | 8015687852 | Bacteria | 6613826 |
| 1033 | 8019778868 | 8019775933 | Bacteria | 6858656 |
| 1034 | 8029997968 | 8029995093 | Bacteria | 5990776 |
| 1035 | 8052496389 | 8052494512 | Bacteria | 5765634 |
| 1036 | 8054288670 | 8054285046 | Bacteria | 6919322 |
| 1037 | 8054352419 | 8054347763 | Bacteria | 5901107 |
| 1038 | 8054506501 | 8054503363 | Bacteria | 6101651 |
| 1039 | 8054932192 | 8054929484 | Bacteria | 5599761 |
| 1040 | 8055773796 | 8055770955 | Bacteria | 6827675 |
| 1041 | 8055821266 | 8055817908 | Bacteria | 6609162 |
| 1042 | 8056119554 | 8056115690 | Bacteria | 5527654 |
| 1043 | 8056128690 | 8056125926 | Bacteria | 6228218 |
| 1044 | 8056134914 | 8056131705 | Bacteria | 6107031 |
| 1045 | 8056141096 | 8056137416 | Bacteria | 6147080 |
| 1046 | 8056145791 | 8056143049 | Bacteria | 6307666 |
| 1047 | 8056150761 | 8056148874 | Bacteria | 6479865 |
| 1048 | 8056157780 | 8056155041 | Bacteria | 6486948 |
| 1049 | 8056165907 | 8056161164 | Bacteria | 6106669 |
| 1050 | 8056168376 | 8056166840 | Bacteria | 5820959 |
| 1051 | 8056174080 | 8056172158 | Bacteria | 6133900 |
| 1052 | 8056178391 | 8056177738 | Bacteria | 6748268 |
| 1053 | 8056574555 | 8056569372 | Bacteria | 5997322 |
| 1054 | Ga0157369_10001013 | |||
| 1055 | MRS2a_Contig_10285 | |||
| 1056 | MRS2a_Contig_7577 | |||
| 1057 | SwRhRL2b_contig_1035371 | |||
| 1058 | SwRhRL2b_contig_1318055 | |||
| 1059 | SwRhRL2b_contig_438761 | |||
| 1060 | JGI25162J39368_1000004 | |||
| 1061 | JGI25162J39368_1000009 | |||
| 1062 | JGI25162J39368_1000051 | |||
| 1063 | JGI25154J39366_1006556 | |||
| 1064 | JGI25163J39215_1000020 | |||
| 1065 | JGI25163J39215_1000030 | |||
| 1066 | JGI25163J39215_1000125 | |||
| 1067 | JGI25164J39214_1000002 | |||
| 1068 | JGI25164J39214_1000027 | |||
| 1069 | JGI25164J39214_1000034 | |||
| 1070 | JGI25165J46597_1000011 | |||
| 1071 | JGI25165J46597_1000101 | |||
| 1072 | Ga0055538_1000007 | |||
| 1073 | Ga0055538_1000069 | |||
| 1074 | Ga0055539_1000009 | |||
| 1075 | Ga0055539_1000011 | |||
| 1076 | Ga0055533_1000012 | |||
| 1077 | Ga0055533_1000014 | |||
| 1078 | Ga0055532_1000009 | |||
| 1079 | Ga0055525_1000014 | |||
| 1080 | Ga0055525_1000016 | |||
| 1081 | Ga0055526_1003434 | |||
| 1082 | Ga0055537_1000037 | |||
| 1083 | Ga0055524_1016271 | |||
| 1084 | Ga0055536_1000014 | |||
| 1085 | Ga0055536_1000047 | |||
| 1086 | Ga0055536_1000066 | |||
| 1087 | Ga0055534_1000038 | |||
| 1088 | Ga0055528_1000071 | |||
| 1089 | Ga0055530_10000009 | |||
| 1090 | Ga0055530_10000011 | |||
| 1091 | Ga0055530_10001866 | |||
| 1092 | Ga0055540_1000006 | |||
| 1093 | Ga0055540_1000034 | |||
| 1094 | Ga0055540_1000497 | |||
| 1095 | Ga0055531_10000099 | |||
| 1096 | Ga0055531_10048622 | |||
| 1097 | Ga0055541_1000006 | |||
| 1098 | Ga0055541_1000008 | |||
| 1099 | Ga0058692_1000194 | |||
| 1100 | Ga0055543_1005882 | |||
| 1101 | Ga0065165_1000742 | |||
| 1102 | Ga0065714_10000359 | |||
| 1103 | Ga0065714_10006637 | |||
| 1104 | Ga0065714_10008534 | |||
| 1105 | Ga0065714_10013514 | |||
| 1106 | Ga0065714_10014964 | |||
| 1107 | Ga0065714_10064936 | |||
| 1108 | Ga0065714_10065459 | |||
| 1109 | Ga0065714_10068626 | |||
| 1110 | Ga0065714_10070469 | |||
| 1111 | Ga0065714_10084910 | |||
| 1112 | Ga0065704_10000101 | |||
| 1113 | Ga0065704_10084955 | |||
| 1114 | Ga0065704_10130765 | |||
| 1115 | Ga0065712_10104349 | |||
| 1116 | Ga0065715_10006719 | |||
| 1117 | Ga0070670_100000137 | |||
| 1118 | Ga0070670_100012320 | |||
| 1119 | Ga0070669_100020183 | |||
| 1120 | Ga0070669_100031477 | |||
| 1121 | Ga0070662_100002943 | |||
| 1122 | Ga0068853_100137485 | |||
| 1123 | Ga0070665_100375149 | |||
| 1124 | Ga0068851_10000279 | |||
| 1125 | Ga0075364_10030271 | |||
| 1126 | Ga0075364_10160492 | |||
| 1127 | Ga0075432_10016393 | |||
| 1128 | Ga0075432_10047184 | |||
| 1129 | Ga0075362_10042046 | |||
| 1130 | Ga0075369_10003683 | |||
| 1131 | Ga0075436_100252164 | |||
| 1132 | Ga0099823_1000050 | |||
| 1133 | Ga0079104_1000342 | |||
| 1134 | Ga0079104_1000529 | |||
| 1135 | Ga0099826_10020115 | |||
| 1136 | Ga0105251_10000363 | |||
| 1137 | Ga0105251_10005946 | |||
| 1138 | Ga0105251_10010544 | |||
| 1139 | Ga0105251_10012652 | |||
| 1140 | Ga0105251_10019486 | |||
| 1141 | Ga0105251_10040687 | |||
| 1142 | Ga0105251_10059167 | |||
| 1143 | Ga0105244_10000306 | |||
| 1144 | Ga0105244_10000768 | |||
| 1145 | Ga0105244_10001123 | |||
| 1146 | Ga0105244_10002404 | |||
| 1147 | Ga0105244_10034373 | |||
| 1148 | Ga0105244_10064557 | |||
| 1149 | Ga0105244_10069568 | |||
| 1150 | Ga0105250_10000058 | |||
| 1151 | Ga0105250_10000158 | |||
| 1152 | Ga0105250_10011017 | |||
| 1153 | Ga0105250_10022378 | |||
| 1154 | Ga0105250_10070221 | |||
| 1155 | Ga0105243_10000026 | |||
| 1156 | Ga0105243_10005020 | |||
| 1157 | Ga0105246_10004195 | |||
| 1158 | Ga0105246_10015080 | |||
| 1159 | Ga0157345_1000015 | |||
| 1160 | Ga0157373_10000193 | |||
| 1161 | Ga0157373_10000389 | |||
| 1162 | Ga0157373_10000554 | |||
| 1163 | Ga0157373_10002695 | |||
| 1164 | Ga0157373_10017004 | |||
| 1165 | Ga0157373_10024008 | |||
| 1166 | Ga0157373_10024581 | |||
| 1167 | Ga0157373_10121362 | |||
| 1168 | Ga0157373_10134269 | |||
| 1169 | Ga0157371_10000142 | |||
| 1170 | Ga0157371_10000189 | |||
| 1171 | Ga0157371_10000453 | |||
| 1172 | Ga0157371_10000774 | |||
| 1173 | Ga0157371_10004730 | |||
| 1174 | Ga0157370_10001001 | |||
| 1175 | Ga0157370_10039452 | |||
| 1176 | Ga0157370_10067736 | |||
| 1177 | Ga0157370_10413475 | |||
| 1178 | Ga0157369_10001032 | |||
| 1179 | Ga0157369_10002198 | |||
| 1180 | Ga0157369_10014106 | |||
| 1181 | Ga0163162_10000346 | |||
| 1182 | Ga0163162_10034881 | |||
| 1183 | Ga0163162_10040160 | |||
| 1184 | Ga0157372_10000552 | |||
| 1185 | Ga0157372_10315131 | |||
| 1186 | Ga0157375_10000139 | |||
| 1187 | Ga0157375_10027530 | |||
| 1188 | Ga0182008_10000202 | |||
| 1189 | Ga0182008_10000634 | |||
| 1190 | Ga0182008_10001612 | |||
| 1191 | Ga0182008_10004565 | |||
| 1192 | Ga0182008_10005936 | |||
| 1193 | Ga0182008_10014218 | |||
| 1194 | Ga0182008_10083405 | |||
| 1195 | Ga0182006_1000107 | |||
| 1196 | Ga0182006_1000191 | |||
| 1197 | Ga0182006_1001077 | |||
| 1198 | Ga0182006_1004277 | |||
| 1199 | Ga0182006_1024280 | |||
| 1200 | Ga0182006_1027416 | |||
| 1201 | Ga0182007_10000087 | |||
| 1202 | Ga0182007_10001331 | |||
| 1203 | Ga0182007_10013512 | |||
| 1204 | Ga0182005_1000092 | |||
| 1205 | Ga0182005_1002968 | |||
| 1206 | Ga0182005_1004607 | |||
| 1207 | Ga0163161_10000774 | |||
| 1208 | Ga0163161_10002089 | |||
| 1209 | Ga0163161_10013254 | |||
| 1210 | Ga0163161_10014653 | |||
| 1211 | Ga0163161_10014928 | |||
| 1212 | Ga0163161_10015205 | |||
| 1213 | Ga0163161_10039616 | |||
| 1214 | Ga0163161_10324587 | |||
| 1215 | Ga0213872_10002446 | |||
| 1216 | Ga0209435_101275 | |||
| 1217 | Ga0209760_100014 | |||
| 1218 | Ga0209760_100083 | |||
| 1219 | Ga0209760_100112 | |||
| 1220 | Ga0209784_100001 | |||
| 1221 | Ga0209784_100023 | |||
| 1222 | Ga0209566_100001 | |||
| 1223 | Ga0209566_100019 | |||
| 1224 | Ga0209674_100002 | |||
| 1225 | Ga0209674_100034 | |||
| 1226 | Ga0209147_100027 | |||
| 1227 | Ga0209563_100002 | |||
| 1228 | Ga0209563_100037 | |||
| 1229 | Ga0209563_100858 | |||
| 1230 | Ga0207427_100003 | |||
| 1231 | Ga0207427_100011 | |||
| 1232 | Ga0207427_100020 | |||
| 1233 | Ga0209437_100001 | |||
| 1234 | Ga0209437_100002 | |||
| 1235 | Ga0209437_100025 | |||
| 1236 | Ga0209437_112575 | |||
| 1237 | Ga0209258_100520 | |||
| 1238 | Ga0209646_1000330 | |||
| 1239 | Ga0209677_100002 | |||
| 1240 | Ga0209677_100021 | |||
| 1241 | Ga0209759_1001790 | |||
| 1242 | Ga0209759_1003192 | |||
| 1243 | Ga0209129_1000021 | |||
| 1244 | Ga0209233_1000004 | |||
| 1245 | Ga0209233_1000012 | |||
| 1246 | Ga0209233_1002946 | |||
| 1247 | Ga0209565_1000055 | |||
| 1248 | Ga0209673_1000040 | |||
| 1249 | Ga0209130_1000410 | |||
| 1250 | Ga0209675_1000052 | |||
| 1251 | Ga0209676_1000002 | |||
| 1252 | Ga0209676_1000003 | |||
| 1253 | Ga0209676_1000158 | |||
| 1254 | Ga0209676_1000701 | |||
| 1255 | Ga0209676_1001658 | |||
| 1256 | Ga0209676_1011141 | |||
| 1257 | Ga0209564_1000271 | |||
| 1258 | Ga0209050_1000004 | |||
| 1259 | Ga0209050_1000006 | |||
| 1260 | Ga0209050_1000013 | |||
| 1261 | Ga0209050_1001033 | |||
| 1262 | Ga0209256_1000100 | |||
| 1263 | Ga0209051_1000001 | |||
| 1264 | Ga0209051_1000006 | |||
| 1265 | Ga0209051_1000007 | |||
| 1266 | Ga0209051_1019166 | |||
| 1267 | Ga0209257_1000029 | |||
| 1268 | Ga0209257_1002548 | |||
| 1269 | Ga0207656_10003008 | |||
| 1270 | Ga0207696_1000002 | |||
| 1271 | Ga0207696_1000017 | |||
| 1272 | Ga0207696_1000341 | |||
| 1273 | Ga0207696_1000724 | |||
| 1274 | Ga0207696_1008317 | |||
| 1275 | Ga0207696_1015799 | |||
| 1276 | Ga0207696_1016485 | |||
| 1277 | Ga0207696_1017254 | |||
| 1278 | Ga0207655_1000037 | |||
| 1279 | Ga0207655_1000100 | |||
| 1280 | Ga0207655_1000216 | |||
| 1281 | Ga0207655_1000295 | |||
| 1282 | Ga0207655_1001009 | |||
| 1283 | Ga0207655_1001701 | |||
| 1284 | Ga0207655_1005105 | |||
| 1285 | Ga0207655_1005731 | |||
| 1286 | Ga0207655_1008165 | |||
| 1287 | Ga0207655_1008427 | |||
| 1288 | Ga0207655_1009521 | |||
| 1289 | Ga0207655_1038219 | |||
| 1290 | Ga0207713_1000275 | |||
| 1291 | Ga0207713_1000523 | |||
| 1292 | Ga0207713_1001048 | |||
| 1293 | Ga0207713_1001142 | |||
| 1294 | Ga0207713_1004080 | |||
| 1295 | Ga0207713_1004709 | |||
| 1296 | Ga0207713_1013843 | |||
| 1297 | Ga0207713_1015518 | |||
| 1298 | Ga0207713_1019867 | |||
| 1299 | Ga0207713_1033382 | |||
| 1300 | Ga0207681_10018175 | |||
| 1301 | Ga0207650_10000277 | |||
| 1302 | Ga0207650_10000417 | |||
| 1303 | Ga0207706_10005575 | |||
| 1304 | Ga0207709_10000004 | |||
| 1305 | Ga0207709_10013627 | |||
| 1306 | Ga0207639_10042682 | |||
| 1307 | Ga0209281_1000003 | |||
| 1308 | Ga0209281_1000009 | |||
| 1309 | Ga0209281_1000055 | |||
| 1310 | Ga0209281_1006000 | |||
| 1311 | Ga0209281_1006551 | |||
| 1312 | Ga0209389_1000053 | |||
| 1313 | Ga0209371_1000002 | |||
| 1314 | Ga0209371_1000057 | |||
| 1315 | Ga0209983_1015314 | |||
| 1316 | Ga0209282_1019007 | |||
| 1317 | Ga0207428_10036305 | |||
| 1318 | Ga0207428_10232957 | |||
| 1319 | Ga0268256_1000002 | |||
| 1320 | Ga0307511_10069245 | |||
| 1321 | Ga0314311_1250267 | |||
| 1322 | Ga0316178_1161518 | |||
| 1323 | Ga0316181_1107887 | |||
| 1324 | Ga0307408_100002612 | |||
| 1325 | Ga0307408_100004910 | |||
| 1326 | Ga0307408_100015589 | |||
| 1327 | Ga0307408_100033598 | |||
| 1328 | Ga0307408_100127550 | |||
| 1329 | Ga0307405_10000024 | |||
| 1330 | Ga0307405_10017957 | |||
| 1331 | Ga0307405_10039836 | |||
| 1332 | Ga0307413_10155217 | |||
| 1333 | Ga0307406_10008953 | |||
| 1334 | Ga0307406_10078051 | |||
| 1335 | Ga0307407_10052412 | |||
| 1336 | Ga0307412_10000420 | |||
| 1337 | Ga0307412_10000977 | |||
| 1338 | Ga0307412_10002210 | |||
| 1339 | Ga0307412_10029562 | |||
| 1340 | Ga0307409_100132999 | |||
| 1341 | Ga0307416_100315494 | |||
| 1342 | Ga0307414_10007352 | |||
| 1343 | Ga0307414_10020648 | |||
| 1344 | Ga0307414_10047567 | |||
| 1345 | Ga0307411_10020754 | |||
| 1346 | Ga0307411_10042053 | |||
| 1347 | Ga0237819_00679 | |||
| 1348 | Ga0436361_1164300 | |||
| 1349 | Ga0436363_0550752 | |||
| 1350 | Ga0439438_000001 | |||
| 1351 | Ga0439438_000033 | |||
| 1352 | Ga0439438_000098 | |||
| 1353 | Ga0439438_000229 | |||
| 1354 | Ga0439438_005252 | |||
| 1355 | Ga0439438_006969 | |||
| 1356 | Ga0439438_009473 | |||
| 1357 | Ga0439438_010985 | |||
| 1358 | Ga0439447_000096 | |||
| 1359 | Ga0439447_002880 | |||
| 1360 | Ga0439447_002905 | |||
| 1361 | Ga0439447_003234 | |||
| 1362 | Ga0439447_004419 | |||
| 1363 | Ga0439447_015540 | |||
| 1364 | Ga0439447_038503 | |||
| 1365 | Ga0439466_0000088 | |||
| 1366 | Ga0439466_0000694 | |||
| 1367 | Ga0439466_0007811 | |||
| 1368 | Ga0439466_0025096 | |||
| 1369 | Ga0439432_000016 | |||
| 1370 | Ga0439432_003575 | |||
| 1371 | Ga0439432_003654 | |||
| 1372 | Ga0439432_005547 | |||
| 1373 | Ga0439432_011629 | |||
| 1374 | Ga0439432_044888 | |||
| 1375 | Ga0439451_001487 | |||
| 1376 | Ga0439452_000087 | |||
| 1377 | Ga0439452_000146 | |||
| 1378 | Ga0439452_000230 | |||
| 1379 | Ga0439452_004286 | |||
| 1380 | Ga0439452_004556 | |||
| 1381 | Ga0439452_006943 | |||
| 1382 | Ga0439456_002982 | |||
| 1383 | Ga0439456_005831 | |||
| 1384 | Ga0439463_017432 | |||
| 1385 | Ga0450911_000063 | |||
| 1386 | Ga0450911_000527 | |||
| 1387 | Ga0450911_000821 | |||
| 1388 | Ga0450903_001116 | |||
| 1389 | Ga0450903_003945 | |||
| 1390 | Ga0450903_007909 | |||
| 1391 | Ga0450906_006927 | |||
| 1392 | Ga0450907_000060 | |||
| 1393 | Ga0450907_000517 | |||
| 1394 | Ga0450910_002884 | |||
| 1395 | Ga0439446_0000912 | |||
| 1396 | Ga0450908_000342 | |||
| 1397 | Ga0450909_000988 | |||
| 1398 | Ga0439460_0001278 | |||
| 1399 | Ga0439460_0034047 | |||
| 1400 | Ga0450901_000455 | |||
| 1401 | Ga0439440_0001314 | |||
| 1402 | Ga0439440_0003826 | |||
| 1403 | Ga0495617_000065 | |||
| 1404 | Ga0495617_000404 | |||
| 1405 | Ga0495617_003279 | |||
| 1406 | Ga0495617_007277 | |||
| 1407 | Ga0495617_022527 | |||
| 1408 | Ga0495617_043230 | |||
| 1409 | Ga0495627_000138 | |||
| 1410 | Ga0495627_000314 | |||
| 1411 | Ga0495627_000491 | |||
| 1412 | Ga0495627_005853 | |||
| 1413 | Ga0495603_0001067 | |||
| 1414 | Ga0495603_0021707 | |||
| 1415 | Ga0495590_0003634 | |||
| 1416 | Ga0495590_0015020 | |||
| 1417 | Ga0495591_000044 | |||
| 1418 | Ga0495591_000060 | |||
| 1419 | Ga0495591_000155 | |||
| 1420 | Ga0495591_000249 | |||
| 1421 | Ga0495591_000714 | |||
| 1422 | Ga0495591_000778 | |||
| 1423 | Ga0495591_011900 | |||
| 1424 | Ga0495591_012065 | |||
| 1425 | Ga0495591_017448 | |||
| 1426 | Ga0495591_017449 | |||
| 1427 | Ga0495638_0000652 | |||
| 1428 | Ga0495638_0000848 | |||
| 1429 | Ga0495638_0001873 | |||
| 1430 | Ga0495638_0016060 | |||
| 1431 | Ga0495638_0043243 | |||
| 1432 | Ga0495638_0123241 | |||
| 1433 | Ga0495653_0000485 | |||
| 1434 | Ga0495650_0000034 | |||
| 1435 | Ga0495650_0000101 | |||
| 1436 | Ga0495650_0000148 | |||
| 1437 | Ga0495650_0001653 | |||
| 1438 | Ga0495650_0001901 | |||
| 1439 | Ga0495650_0009820 | |||
| 1440 | Ga0495650_0020487 | |||
| 1441 | Ga0495650_0030844 | |||
| 1442 | Ga0495650_0053562 | |||
| 1443 | Ga0495605_0000207 | |||
| 1444 | Ga0495605_0000511 | |||
| 1445 | Ga0495605_0007972 | |||
| 1446 | Ga0495605_0015874 | |||
| 1447 | Ga0495605_0017707 | |||
| 1448 | Ga0495605_0051147 | |||
| 1449 | Ga0495639_0000016 | |||
| 1450 | Ga0495639_0012751 | |||
| 1451 | Ga0495639_0074064 | |||
| 1452 | Ga0495584_0000441 | |||
| 1453 | Ga0495584_0000465 | |||
| 1454 | Ga0495584_0001147 | |||
| 1455 | Ga0495584_0005210 | |||
| 1456 | Ga0495584_0007510 | |||
| 1457 | Ga0495584_0013316 | |||
| 1458 | Ga0495584_0013634 | |||
| 1459 | Ga0495584_0024045 | |||
| 1460 | Ga0495584_0060315 | |||
| 1461 | Ga0495584_0067672 | |||
| 1462 | Ga0495585_0000219 | |||
| 1463 | Ga0495585_0000300 | |||
| 1464 | Ga0495585_0000324 | |||
| 1465 | Ga0495585_0000453 | |||
| 1466 | Ga0495585_0018419 | |||
| 1467 | Ga0495585_0019542 | |||
| 1468 | Ga0495594_0014629 | |||
| 1469 | Ga0495594_0016529 | |||
| 1470 | Ga0495596_0000083 | |||
| 1471 | Ga0495607_0000014 | |||
| 1472 | Ga0495607_0000033 | |||
| 1473 | Ga0495607_0000420 | |||
| 1474 | Ga0495607_0002053 | |||
| 1475 | Ga0495607_0004569 | |||
| 1476 | Ga0495607_0006684 | |||
| 1477 | Ga0495607_0010116 | |||
| 1478 | Ga0495607_0017213 | |||
| 1479 | Ga0495607_0019814 | |||
| 1480 | Ga0495607_0070788 | |||
| 1481 | Ga0495583_0000131 | |||
| 1482 | Ga0495583_0000576 | |||
| 1483 | Ga0495583_0000787 | |||
| 1484 | Ga0495583_0001029 | |||
| 1485 | Ga0495583_0004901 | |||
| 1486 | Ga0495583_0009453 | |||
| 1487 | Ga0495606_0000047 | |||
| 1488 | Ga0495606_0000741 | |||
| 1489 | Ga0495606_0001042 | |||
| 1490 | Ga0495606_0001398 | |||
| 1491 | Ga0495606_0001589 | |||
| 1492 | Ga0495606_0003380 | |||
| 1493 | Ga0495606_0004412 | |||
| 1494 | Ga0495606_0005516 | |||
| 1495 | Ga0495606_0006178 | |||
| 1496 | Ga0495606_0018799 | |||
| 1497 | Ga0495610_0000437 | |||
| 1498 | Ga0495610_0000548 | |||
| 1499 | Ga0495610_0000842 | |||
| 1500 | Ga0495610_0001034 | |||
| 1501 | Ga0495610_0003325 | |||
| 1502 | Ga0495610_0003948 | |||
| 1503 | Ga0495610_0004690 | |||
| 1504 | Ga0495610_0008720 | |||
| 1505 | Ga0495610_0008758 | |||
| 1506 | Ga0495610_0041012 | |||
| 1507 | Ga0495616_0000104 | |||
| 1508 | Ga0495616_0000130 | |||
| 1509 | Ga0495616_0001613 | |||
| 1510 | Ga0495616_0002523 | |||
| 1511 | Ga0495616_0006448 | |||
| 1512 | Ga0495616_0020427 | |||
| 1513 | Ga0495616_0028172 | |||
| 1514 | Ga0495620_0000035 | |||
| 1515 | Ga0495620_0000194 | |||
| 1516 | Ga0495620_0003905 | |||
| 1517 | Ga0495620_0018992 | |||
| 1518 | Ga0495620_0032766 | |||
| 1519 | Ga0495630_0111553 | |||
| 1520 | Ga0495630_0151996 | |||
| 1521 | Ga0495631_0000014 | |||
| 1522 | Ga0495631_0001497 | |||
| 1523 | Ga0495631_0038333 | |||
| 1524 | Ga0495631_0067273 | |||
| 1525 | Ga0495631_0096206 | |||
| 1526 | Ga0495632_0000150 | |||
| 1527 | Ga0495632_0000301 | |||
| 1528 | Ga0495632_0001602 | |||
| 1529 | Ga0495632_0003208 | |||
| 1530 | Ga0495632_0010603 | |||
| 1531 | Ga0495632_0011368 | |||
| 1532 | Ga0495632_0011409 | |||
| 1533 | Ga0495632_0017970 | |||
| 1534 | Ga0495632_0018789 | |||
| 1535 | Ga0495632_0102659 | |||
| 1536 | Ga0495637_0000092 | |||
| 1537 | Ga0495637_0000159 | |||
| 1538 | Ga0495637_0000294 | |||
| 1539 | Ga0495637_0000463 | |||
| 1540 | Ga0495637_0000587 | |||
| 1541 | Ga0495637_0000993 | |||
| 1542 | Ga0495637_0001466 | |||
| 1543 | Ga0495637_0002062 | |||
| 1544 | Ga0495637_0004894 | |||
| 1545 | Ga0495637_0006633 | |||
| 1546 | Ga0495637_0007517 | |||
| 1547 | Ga0495637_0010314 | |||
| 1548 | Ga0495637_0012614 | |||
| 1549 | Ga0495643_0000095 | |||
| 1550 | Ga0495643_0000558 | |||
| 1551 | Ga0495643_0000678 | |||
| 1552 | Ga0495643_0002270 | |||
| 1553 | Ga0495643_0002735 | |||
| 1554 | Ga0495643_0003529 | |||
| 1555 | Ga0495643_0015637 | |||
| 1556 | Ga0495643_0047142 | |||
| 1557 | Ga0495644_0000064 | |||
| 1558 | Ga0495644_0000407 | |||
| 1559 | Ga0495644_0001153 | |||
| 1560 | Ga0495644_0009208 | |||
| 1561 | Ga0495648_0000342 | |||
| 1562 | Ga0495648_0000548 | |||
| 1563 | Ga0495648_0001160 | |||
| 1564 | Ga0495648_0005156 | |||
| 1565 | Ga0495648_0005707 | |||
| 1566 | Ga0495648_0009500 | |||
| 1567 | Ga0495648_0015361 | |||
| 1568 | Ga0495648_0021377 | |||
| 1569 | Ga0495648_0022715 | |||
| 1570 | Ga0495648_0027993 | |||
| 1571 | Ga0495648_0093342 | |||
| 1572 | Ga0495666_0008658 | |||
| 1573 | Ga0495666_0023330 | |||
| 1574 | Ga0495642_0000031 | |||
| 1575 | Ga0495642_0001781 | |||
| 1576 | Ga0495654_0000059 | |||
| 1577 | Ga0495654_0000271 | |||
| 1578 | Ga0495654_0000606 | |||
| 1579 | Ga0495654_0000745 | |||
| 1580 | Ga0495654_0001268 | |||
| 1581 | Ga0495654_0001997 | |||
| 1582 | Ga0495654_0002415 | |||
| 1583 | Ga0495654_0004079 | |||
| 1584 | Ga0495654_0008134 | |||
| 1585 | Ga0495654_0016375 | |||
| 1586 | Ga0495654_0028108 | |||
| 1587 | Ga0495654_0036684 | |||
| 1588 | Ga0495654_0056685 | |||
| 1589 | Ga0495586_0074616 | |||
| 1590 | Ga0495587_0009511 | |||
| 1591 | Ga0495609_0000016 | |||
| 1592 | Ga0495609_0000212 | |||
| 1593 | Ga0495609_0001331 | |||
| 1594 | Ga0495609_0008558 | |||
| 1595 | Ga0495609_0051377 | |||
| 1596 | Ga0495597_0000008 | |||
| 1597 | Ga0495597_0000166 | |||
| 1598 | Ga0495597_0003038 | |||
| 1599 | Ga0495597_0007746 | |||
| 1600 | Ga0495597_0010482 | |||
| 1601 | Ga0495597_0026724 | |||
| 1602 | Ga0495597_0055900 | |||
| 1603 | Ga0495597_0083696 | |||
| 1604 | Ga0495597_0084384 | |||
| 1605 | Ga0495645_0143239 | |||
| 1606 | Ga0495622_0000070 | |||
| 1607 | Ga0495622_0000219 | |||
| 1608 | Ga0495622_0001332 | |||
| 1609 | Ga0495622_0002268 | |||
| 1610 | Ga0495622_0006459 | |||
| 1611 | Ga0495622_0025799 | |||
| 1612 | Ga0495633_0007125 | |||
| 1613 | Ga0495633_0008891 | |||
| 1614 | Ga0495656_0001351 | |||
| 1615 | Ga0495668_0000035 | |||
| 1616 | Ga0495668_0000635 | |||
| 1617 | Ga0495668_0007323 | |||
| 1618 | Ga0495668_0066353 | |||
| 1619 | Ga0495634_0000290 | |||
| 1620 | Ga0495611_0000012 | |||
| 1621 | Ga0495611_0003167 | |||
| 1622 | Ga0495625_0000016 | |||
| 1623 | Ga0495625_0000383 | |||
| 1624 | Ga0495625_0001793 | |||
| 1625 | Ga0495625_0002516 | |||
| 1626 | Ga0495625_0002680 | |||
| 1627 | Ga0495625_0008756 | |||
| 1628 | Ga0495625_0025304 | |||
| 1629 | Ga0495625_0079960 | |||
| 1630 | Ga0495635_0005892 | |||
| 1631 | Ga0495659_0000056 | |||
| 1632 | Ga0495659_0020198 | |||
| 1633 | Ga0495661_0000001 | |||
| 1634 | Ga0495661_0000168 | |||
| 1635 | Ga0495661_0000313 | |||
| 1636 | Ga0495661_0002496 | |||
| 1637 | Ga0495661_0004657 | |||
| 1638 | Ga0495661_0018031 | |||
| 1639 | Ga0495661_0147495 | |||
| 1640 | Ga0495588_0003662 | |||
| 1641 | Ga0495588_0005431 | |||
| 1642 | Ga0495623_0011063 | |||
| 1643 | Ga0495646_0020643 | |||
| 1644 | Ga0495646_0035831 | |||
| 1645 | Ga0495669_0010500 | |||
| 1646 | Ga0495669_0037048 | |||
| 1647 | Ga0495624_0000016 | |||
| 1648 | Ga0495670_0000234 | |||
| 1649 | Ga0495670_0000242 | |||
| 1650 | Ga0495670_0000386 | |||
| 1651 | Ga0495670_0000814 | |||
| 1652 | Ga0495670_0006576 | |||
| 1653 | Ga0495670_0012087 | |||
| 1654 | Ga0495671_0000654 | |||
| 1655 | Ga0495671_0007786 | |||
| 1656 | Ga0495671_0007938 | |||
| 1657 | Ga0495671_0011422 | |||
| 1658 | Ga0495671_0014634 | |||
| 1659 | Ga0495671_0060509 | |||
| 1660 | Ga0495671_0065829 | |||
| 1661 | Ga0495671_0099525 | |||
| 1662 | Ga0495671_0111249 | |||
| 1663 | Ga0495649_0000485 | |||
| 1664 | Ga0495649_0001028 | |||
| 1665 | Ga0495649_0001165 | |||
| 1666 | Ga0495649_0001809 | |||
| 1667 | Ga0495649_0002111 | |||
| 1668 | Ga0495649_0005307 | |||
| 1669 | Ga0495649_0007885 | |||
| 1670 | Ga0495649_0008167 | |||
| 1671 | Ga0495649_0008219 | |||
| 1672 | Ga0495649_0025906 | |||
| 1673 | Ga0495649_0028459 | |||
| 1674 | Ga0495649_0031233 | |||
| 1675 | Ga0495649_0043996 | |||
| 1676 | Ga0495649_0122507 | |||
| 1677 | Ga0495589_0000303 | |||
| 1678 | Ga0495589_0000674 | |||
| 1679 | Ga0495589_0001176 | |||
| 1680 | Ga0495589_0001506 | |||
| 1681 | Ga0495589_0001919 | |||
| 1682 | Ga0495589_0002121 | |||
| 1683 | Ga0495589_0062189 | |||
| 1684 | Ga0495660_0000004 | |||
| 1685 | Ga0495660_0000020 | |||
| 1686 | Ga0495660_0000152 | |||
| 1687 | Ga0495660_0000320 | |||
| 1688 | Ga0495660_0000519 | |||
| 1689 | Ga0495660_0001873 | |||
| 1690 | Ga0495660_0005371 | |||
| 1691 | Ga0495660_0006192 | |||
| 1692 | Ga0495660_0017311 | |||
| 1693 | Ga0495660_0024047 | |||
| 1694 | Ga0495660_0026407 | |||
| 1695 | Ga0495660_0029585 | |||
| 1696 | Ga0495660_0033747 | |||
| 1697 | Ga0495660_0035880 | |||
| 1698 | Ga0495660_0054109 | |||
| 1699 | Ga0495660_0054146 | |||
| 1700 | Ga0495660_0064008 | |||
| 1701 | Ga0495581_0000599 | |||
| 1702 | Ga0495581_0064300 | |||
| 1703 | Ga0495604_0019884 | |||
| 1704 | Ga0495604_0075018 | |||
| 1705 | Ga0495636_0001115 | |||
| 1706 | Ga0495636_0019755 | |||
| 1707 | Ga0495672_0000011 | |||
| 1708 | Ga0495672_0000283 | |||
| 1709 | Ga0495672_0000393 | |||
| 1710 | Ga0495672_0000434 | |||
| 1711 | Ga0495672_0000586 | |||
| 1712 | Ga0495672_0003354 | |||
| 1713 | Ga0495672_0007223 | |||
| 1714 | Ga0495672_0014069 | |||
| 1715 | Ga0495672_0042721 | |||
| 1716 | Ga0495672_0057354 | |||
| 1717 | Ga0495672_0065162 | |||
| 1718 | Ga0495672_0080252 | |||
| 1719 | Ga0495676_0000001 | |||
| 1720 | Ga0495676_0000297 | |||
| 1721 | Ga0495680_0105999 | |||
| 1722 | Ga0495683_0000057 | |||
| 1723 | Ga0495683_0000284 | |||
| 1724 | Ga0495683_0010203 | |||
| 1725 | Ga0495683_0014211 | |||
| 1726 | Ga0495683_0040101 | |||
| 1727 | Ga0495683_0046685 | |||
| 1728 | Ga0495683_0057932 | |||
| 1729 | Ga0495687_000951 | |||
| 1730 | Ga0495687_002123 | |||
| 1731 | Ga0495675_0015734 | |||
| 1732 | Ga0495677_0000669 | |||
| 1733 | Ga0495679_000042 | |||
| 1734 | Ga0495679_000883 | |||
| 1735 | Ga0495679_001280 | |||
| 1736 | Ga0495679_002230 | |||
| 1737 | Ga0495679_005328 | |||
| 1738 | Ga0495679_006058 | |||
| 1739 | Ga0495685_002753 | |||
| 1740 | Ga0495673_0000020 | |||
| 1741 | Ga0495673_0000234 | |||
| 1742 | Ga0495673_0000672 | |||
| 1743 | Ga0495673_0000699 | |||
| 1744 | Ga0495673_0000717 | |||
| 1745 | Ga0495673_0000829 | |||
| 1746 | Ga0495673_0000891 | |||
| 1747 | Ga0495673_0001685 | |||
| 1748 | Ga0495673_0001917 | |||
| 1749 | Ga0495673_0009026 | |||
| 1750 | Ga0495673_0017359 | |||
| 1751 | Ga0495673_0028037 | |||
| 1752 | Ga0495673_0029661 | |||
| 1753 | Ga0495681_0000031 | |||
| 1754 | Ga0495681_0000383 | |||
| 1755 | Ga0495681_0001036 | |||
| 1756 | Ga0495681_0001225 | |||
| 1757 | Ga0495681_0002320 | |||
| 1758 | Ga0495681_0006227 | |||
| 1759 | Ga0495681_0008411 | |||
| 1760 | Ga0495681_0008942 | |||
| 1761 | Ga0495681_0011462 | |||
| 1762 | Ga0495681_0016076 | |||
| 1763 | Ga0495681_0032445 | |||
| 1764 | Ga0495686_0001144 | |||
| 1765 | Ga0495686_0002045 | |||
| 1766 | Ga0495686_0002569 | |||
| 1767 | Ga0495686_0002613 | |||
| 1768 | Ga0495686_0008842 | |||
| 1769 | Ga0495686_0011068 | |||
| 1770 | Ga0495686_0012750 | |||
| 1771 | Ga0495686_0201788 | |||
| 1772 | Ga0495593_0001268 | |||
| 1773 | Ga0495593_0022678 | |||
| 1774 | Ga0495593_0038459 | |||
| 1775 | Ga0495626_0000002 | |||
| 1776 | Ga0495626_0000077 | |||
| 1777 | Ga0495626_0000268 | |||
| 1778 | Ga0495626_0000332 | |||
| 1779 | Ga0495626_0000449 | |||
| 1780 | Ga0495626_0000513 | |||
| 1781 | Ga0495626_0002500 | |||
| 1782 | Ga0495626_0003737 | |||
| 1783 | Ga0495626_0004807 | |||
| 1784 | Ga0496102_0000394 | |||
| 1785 | Ga0496104_0001252 | |||
| 1786 | Ga0496105_0110455 | |||
| 1787 | Ga0496108_0112556 | |||
| 1788 | Ga0496110_0059246 | |||
| 1789 | Ga0496112_0133637 | |||
| 1790 | Ga0496114_0006030 | |||
| 1791 | Ga0496114_0007811 | |||
| 1792 | Ga0496114_0055514 | |||
| 1793 | Ga0496114_0065873 | |||
| 1794 | Ga0496115_0045606 | |||
| 1795 | Ga0496116_0000038 | |||
| 1796 | Ga0496116_0000162 | |||
| 1797 | Ga0496116_0000250 | |||
| 1798 | Ga0496116_0000744 | |||
| 1799 | Ga0496116_0003719 | |||
| 1800 | Ga0496116_0011307 | |||
| 1801 | Ga0496116_0014877 | |||
| 1802 | Ga0496117_0000158 | |||
| 1803 | Ga0496117_0003060 | |||
| 1804 | Ga0496117_0004846 | |||
| 1805 | Ga0496117_0004969 | |||
| 1806 | Ga0496117_0009448 | |||
| 1807 | Ga0496117_0009688 | |||
| 1808 | Ga0496118_0015897 | |||
| 1809 | Ga0496118_0030811 | |||
| 1810 | Ga0496118_0033352 | |||
| 1811 | Ga0496118_0034128 | |||
| 1812 | Ga0496118_0056194 | |||
| 1813 | Ga0496118_0062218 | |||
| 1814 | Ga0496118_0175446 | |||
| 1815 | Ga0496119_0000381 | |||
| 1816 | Ga0496119_0001130 | |||
| 1817 | Ga0496119_0002052 | |||
| 1818 | Ga0496119_0003407 | |||
| 1819 | Ga0496119_0005201 | |||
| 1820 | Ga0496119_0006701 | |||
| 1821 | Ga0496119_0017556 | |||
| 1822 | Ga0496120_0000092 | |||
| 1823 | Ga0496120_0000210 | |||
| 1824 | Ga0496120_0003330 | |||
| 1825 | Ga0496120_0010867 | |||
| 1826 | Ga0496120_0031145 | |||
| 1827 | Ga0496121_0000117 | |||
| 1828 | Ga0496121_0041739 | |||
| 1829 | Ga0496121_0057634 | |||
| 1830 | Ga0496121_0060889 | |||
| 1831 | Ga0496121_0127435 | |||
| 1832 | Ga0496121_0159759 | |||
| 1833 | Ga0496122_0000007 | |||
| 1834 | Ga0496122_0000540 | |||
| 1835 | Ga0496122_0001075 | |||
| 1836 | Ga0496122_0070419 | |||
| 1837 | Ga0496123_0000004 | |||
| 1838 | Ga0496123_0000319 | |||
| 1839 | Ga0496123_0001278 | |||
| 1840 | Ga0496123_0011945 | |||
| 1841 | Ga0496123_0025543 | |||
| 1842 | Ga0496124_0000025 | |||
| 1843 | Ga0496124_0000647 | |||
| 1844 | Ga0496124_0008507 | |||
| 1845 | Ga0496124_0015485 | |||
| 1846 | Ga0496124_0017213 | |||
| 1847 | Ga0496124_0049046 | |||
| 1848 | Ga0496124_0053648 | |||
| 1849 | Ga0496124_0096716 | |||
| 1850 | Ga0496124_0197799 | |||
| 1851 | Ga0496125_0000013 | |||
| 1852 | Ga0496125_0000274 | |||
| 1853 | Ga0496125_0025923 | |||
| 1854 | Ga0496125_0027837 | |||
| 1855 | Ga0496125_0028049 | |||
| 1856 | Ga0496125_0028106 | |||
| 1857 | Ga0496125_0058394 | |||
| 1858 | Ga0496125_0059388 | |||
| 1859 | Ga0496125_0083687 | |||
| 1860 | Ga0496126_0001920 | |||
| 1861 | Ga0496126_0002710 | |||
| 1862 | Ga0496126_0015538 | |||
| 1863 | Ga0496126_0045494 | |||
| 1864 | Ga0496126_0262256 | |||
| 1865 | Ga0495678_000008 | |||
| 1866 | Ga0495678_000822 | |||
| 1867 | Ga0495678_000965 | |||
| 1868 | Ga0495678_001509 | |||
| 1869 | Ga0495678_003986 | |||
| 1870 | Ga0495678_006156 | |||
| 1871 | Ga0495678_007056 | |||
| 1872 | Ga0495678_023935 | |||
| 1873 | Ga0495678_031290 | |||
| 1874 | Ga0495678_065534 | |||
| 1875 | Ga0495682_0000005 | |||
| 1876 | Ga0495682_0001187 | |||
| 1877 | Ga0495682_0012601 | |||
| 1878 | Ga0495682_0031317 | |||
| 1879 | Ga0501034_0000200 | |||
| 1880 | Ga0501222_000102 | |||
| 1881 | Ga0501226_000209 | |||
| 1882 | nmdc:mga00v17_75319_c1 | |||
| 1883 | Ga0500621_000014 | |||
| 1884 | Ga0500634_0000963 | |||
| 1885 | 2508852360 | |||
| 1886 | 2511255638 | |||
| 1887 | 2511266061 | |||
| 1888 | 2511280255 | |||
| 1889 | 2511291640 | |||
| 1890 | 2511296800 | |||
| 1891 | 2511299665 | |||
| 1892 | 2511316589 | |||
| 1893 | 2511318259 | |||
| 1894 | 2511326964 | |||
| 1895 | 2511339460 | |||
| 1896 | 2511342277 | |||
| 1897 | 2511352495 | |||
| 1898 | 2511359527 | |||
| 1899 | 2511361646 | |||
| 1900 | 2511366846 | |||
| 1901 | 2511376075 | |||
| 1902 | 2511415471 | |||
| 1903 | 2511824777 | |||
| 1904 | 2512323733 | |||
| 1905 | 2555669878 | |||
| 1906 | 2583792009 | |||
| 1907 | 2585828590 | |||
| 1908 | 2585834306 | |||
| 1909 | 2597857960 | |||
| 1910 | 2597864178 | |||
| 1911 | 2597869680 | |||
| 1912 | 2599359455 | |||
| 1913 | 2599365024 | |||
| 1914 | 2599372149 | |||
| 1915 | 2599391007 | |||
| 1916 | 2599398491 | |||
| 1917 | 2599403192 | |||
| 1918 | 2599450540 | |||
| 1919 | 2599465711 | |||
| 1920 | 2599484987 | |||
| 1921 | 2599500530 | |||
| 1922 | 2599507183 | |||
| 1923 | 2599512977 | |||
| 1924 | 2599521655 | |||
| 1925 | 2599612375 | |||
| 1926 | 2599802622 | |||
| 1927 | 2599880416 | |||
| 1928 | 2599891654 | |||
| 1929 | 2599898815 | |||
| 1930 | 2599932213 | |||
| 1931 | 2599944263 | |||
| 1932 | 2599946900 | |||
| 1933 | 2599954735 | |||
| 1934 | 2599959801 | |||
| 1935 | 2599967460 | |||
| 1936 | 2599977011 | |||
| 1937 | 2599985677 | |||
| 1938 | 2599991525 | |||
| 1939 | 2599993645 | |||
| 1940 | 2600002526 | |||
| 1941 | 2600011261 | |||
| 1942 | 2600016309 | |||
| 1943 | 2600024615 | |||
| 1944 | 2600031633 | |||
| 1945 | 2600034987 | |||
| 1946 | 2600040630 | |||
| 1947 | 2600050168 | |||
| 1948 | 2600051515 | |||
| 1949 | 2600059242 | |||
| 1950 | 2600062967 | |||
| 1951 | 2600072585 | |||
| 1952 | 2600079310 | |||
| 1953 | 2600361384 | |||
| 1954 | 2600366530 | |||
| 1955 | 2601533550 | |||
| 1956 | 2601539798 | |||
| 1957 | 2601692019 | |||
| 1958 | 2601758147 | |||
| 1959 | 2601763601 | |||
| 1960 | 2601799575 | |||
| 1961 | 2603637478 | |||
| 1962 | 2606078191 | |||
| 1963 | 2606130299 | |||
| 1964 | 2621300030 | |||
| 1965 | 2624480603 | |||
| 1966 | 2624492497 | |||
| 1967 | 2643844560 | |||
| 1968 | 2643873910 | |||
| 1969 | 2643954301 | |||
| 1970 | 2644023110 | |||
| 1971 | 2644185224 | |||
| 1972 | 2644284332 | |||
| 1973 | 2644620407 | |||
| 1974 | 2652547826 | |||
| 1975 | 2671091755 | |||
| 1976 | 2671095306 | |||
| 1977 | 2671108858 | |||
| 1978 | 2671126605 | |||
| 1979 | 2671769759 | |||
| 1980 | 2677896231 | |||
| 1981 | 2678265495 | |||
| 1982 | 2715751527 | |||
| 1983 | 2715756561 | |||
| 1984 | 2718634262 | |||
| 1985 | 2723248880 | |||
| 1986 | 2738670032 | |||
| 1987 | 2738748425 | |||
| 1988 | 2738806639 | |||
| 1989 | 2738857467 | |||
| 1990 | 2738893999 | |||
| 1991 | 2739199437 | |||
| 1992 | 2739289885 | |||
| 1993 | 2739295197 | |||
| 1994 | 2739311969 | |||
| 1995 | 2743737427 | |||
| 1996 | 2745005946 | |||
| 1997 | 2772438938 | |||
| 1998 | 2774120435 | |||
| 1999 | 2774133623 | |||
| 2000 | 2784264622 | |||
| 2001 | 2784312908 | |||
| 2002 | 2794597391 | |||
| 2003 | 2808853787 | |||
| 2004 | 2808922139 | |||
| 2005 | 2808929702 | |||
| 2006 | 2808933590 | |||
| 2007 | 2808944878 | |||
| 2008 | 2808951719 | |||
| 2009 | 2808956150 | |||
| 2010 | 2808962064 | |||
| 2011 | 2808979239 | |||
| 2012 | 2808994877 | |||
| 2013 | 2808997179 | |||
| 2014 | 2809214970 | |||
| 2015 | 2813728530 | |||
| 2016 | 2814696040 | |||
| 2017 | 2817491369 | |||
| 2018 | 2819658714 | |||
| 2019 | 2819701214 | |||
| 2020 | 2825651621 | |||
| 2021 | 2834033621 | |||
| 2022 | 2842827084 | |||
| 2023 | 2842834569 | |||
| 2024 | 2842839127 | |||
| 2025 | 2842848784 | |||
| 2026 | 2842859046 | |||
| 2027 | 2852614314 | |||
| 2028 | 2852661961 | |||
| 2029 | 2852667948 | |||
| 2030 | 2860344776 | |||
| 2031 | 2860870757 | |||
| 2032 | 2878032477 | |||
| 2033 | 2880233328 | |||
| 2034 | 2888368973 | |||
| 2035 | 2888378304 | |||
| 2036 | 2904475402 | |||
| 2037 | 2904524003 | |||
| 2038 | 2908449484 | |||
| 2039 | 2908449485 | |||
| 2040 | 2913039515 | |||
| 2041 | 2917073699 | |||
| 2042 | 2919065145 | |||
| 2043 | 2919154385 | |||
| 2044 | 2919158522 | |||
| 2045 | 2919386944 | |||
| 2046 | 2919458832 | |||
| 2047 | 2919487629 | |||
| 2048 | 2919489113 | |||
| 2049 | 2919698664 | |||
| 2050 | 2923156468 | |||
| 2051 | 2923588526 | |||
| 2052 | 2927144240 | |||
| 2053 | 2929147680 | |||
| 2054 | 2929192724 | |||
| 2055 | 2931375211 | |||
| 2056 | 2931393776 | |||
| 2057 | 2931402294 | |||
| 2058 | 2935357277 | |||
| 2059 | 2937967554 | |||
| 2060 | 2939607270 | |||
| 2061 | 2939638998 | |||
| 2062 | 2945933313 | |||
| 2063 | 2945963206 | |||
| 2064 | 2946009530 | |||
| 2065 | 2946030772 | |||
| 2066 | 2947237976 | |||
| 2067 | 2969307348 | |||
| 2068 | 2974290995 | |||
| 2069 | 2984289595 | |||
| 2070 | 2988728798 | |||
| 2071 | 2998142824 | |||
| 2072 | 3000377185 | |||
| 2073 | 3007395834 | |||
| 2074 | 3007421898 | |||
| 2075 | 3007514497 | |||
| 2076 | 3007614303 | |||
| 2077 | 3007624005 | |||
| 2078 | 3007719225 | |||
| 2079 | 3007856846 | |||
| 2080 | 3007862157 | |||
| 2081 | 3007868918 | |||
| 2082 | 640937871 | |||
| 2083 | 8004597417 | |||
| 2084 | 8015395634 | |||
| 2085 | 8015690661 | |||
| 2086 | 8019778868 | |||
| 2087 | 8029997968 | |||
| 2088 | 8052496389 | |||
| 2089 | 8054288670 | |||
| 2090 | 8054352419 | |||
| 2091 | 8054506501 | |||
| 2092 | 8054932192 | |||
| 2093 | 8055773796 | |||
| 2094 | 8055821266 | |||
| 2095 | 8056119554 | |||
| 2096 | 8056128690 | |||
| 2097 | 8056134914 | |||
| 2098 | 8056141096 | |||
| 2099 | 8056145791 | |||
| 2100 | 8056150761 | |||
| 2101 | 8056157780 | |||
| 2102 | 8056165907 | |||
| 2103 | 8056168376 | |||
| 2104 | 8056174080 | |||
| 2105 | 8056178391 | |||
| 2106 | 8056574555 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f0j-assembly1.cif.gz_A | crystal structure of a probable hydrolytic enzyme (pa3053) from pseudomonas aeruginosa pao1 at 1.50 a resolution | 0.9952 | 32 | 338 |
| 4f0j-assembly1.cif.gz_A | crystal structure of a probable hydrolytic enzyme (pa3053) from pseudomonas aeruginosa pao1 at 1.50 a resolution | 0.973 | 32 | 338 |
| 5h3h-assembly1.cif.gz_A | esterase (eaest) from exiguobacterium antarcticum | 0.8573 | 49 | 341 |
| 5h3h-assembly1.cif.gz_A | esterase (eaest) from exiguobacterium antarcticum | 0.8514 | 49 | 341 |
| 3ia2-assembly2.cif.gz_D | pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog | 0.8389 | 51 | 341 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f0jA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9925 | 32 | 338 | 3.40.50.1820 |
| 4f0jA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9698 | 32 | 338 | 3.40.50.1820 |
| af_F4JRA6_1_133_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.861 | 76 | 176 | 3.40.50.1820 |
| 5h3hA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8573 | 49 | 341 | 3.40.50.1820 |
| af_A0A1D6K8I4_16_172_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8517 | 46 | 177 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6VXP1-F1-model_v4 | deleted | 0.9717 | 64 | 336 |
|
| AF-A0A544ZSX5-F1-model_v4 | deleted | 0.9626 | 28 | 341 |
|
| AF-A0A4Q3U6Y0-F1-model_v4 | Alpha/beta hydrolase | 0.9566 | 157 | 341 |
GO:0016787
|
| AF-A0A395R9Q1-F1-model_v4 | Alpha/beta hydrolase | 0.9502 | 5 | 344 |
GO:0016787
|
| AF-A0A395R9Q1-F1-model_v4 | Alpha/beta hydrolase | 0.9445 | 5 | 344 |
GO:0016787
|