F489136

General Info

Members Datasets Scaffolds Average Seq Length
1054 395 2108 193

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0014347|Ga0495588_0014347_142_819
Length 225
Sequence LAEKRSCTLVQRASQAESATRSRFGEPSTKERIMSQETQAASATPRPNDMNLVWLDMEMTGLDPDNDRIIEVAVVVTDAELNILAEGPVFAIHQSDETLDKMDNWNKGTHGKSGLIDRVKASTVNEAQAEEQLIAFLKQWVPANKSPMCGNSICQDRRFMARGMPKLEAFFHYRNLDVSTLKELCRRWKPELASGFKKHQKHTALADIVESIEELRYYREHFIKL

Samples

Sample ID Description Type Environment
1 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
179 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
275 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
311 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
312 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
313 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
314 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
315 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
322 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
323 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
324 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
325 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
326 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
327 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
330 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
331 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
356 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
357 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
358 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
359 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
360 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
361 2643221556 Massilia sp. Root1485 Isolate Unclassified
362 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
363 2643221638 Duganella sp. Root336D2 Isolate Unclassified
364 2643221645 Massilia sp. Root351 Isolate Unclassified
365 2643221664 Massilia sp. Root418 Isolate Unclassified
366 2643221684 Massilia sp. Root133 Isolate Unclassified
367 2738541280 Massilia sp. GV090 Isolate Unclassified
368 2738541300 Massilia sp. GV016 Isolate Unclassified
369 2738543018 Massilia sp. GV045 Isolate Unclassified
370 2738543030 Massilia sp. GV097 Isolate Unclassified
371 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
372 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
373 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
374 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
375 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
376 2818991436 Collimonas arenae 515 Isolate Unclassified
377 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
378 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
379 2821131069 Duganella sp. 1224 Isolate Unclassified
380 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
381 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
382 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
383 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
384 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
385 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
386 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
387 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
388 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
389 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
390 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
391 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
392 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
393 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
394 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
395 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.69
Metatranscriptomes 3.42
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.78
Nodule 0.57
Rhizoplane 3.42
Rhizosphere 81.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495588_0014347 3300046674 Bacteria 3791
2 JGI25155J39150_1000363 3300002704 Bacteria 13840
3 JGI25155J39150_1000557 3300002704 Bacteria 8407
4 JGI25156J39149_1000170 3300002705 Bacteria 47634
5 JGI25156J39149_1001095 3300002705 Bacteria 12376
6 JGI25162J39368_1000026 3300002737 Bacteria 227710
7 JGI25162J39368_1010038 3300002737 Bacteria 1223
8 JGI25154J39366_1000351 3300002738 Bacteria 26227
9 JGI25154J39366_1000415 3300002738 Bacteria 22969
10 JGI25157J39369_1000170 3300002741 Bacteria 54809
11 JGI25157J39369_1000605 3300002741 Bacteria 20744
12 JGI25159J45721_1004210 3300002987 Bacteria 4850
13 JGI25159J45721_1008279 3300002987 Bacteria 2875
14 JGI25165J46597_1000031 3300003214 Bacteria 296858
15 JGI25161J50226_1001131 3300003374 Bacteria 8930
16 Ga0007417J51691_1071950 3300003544 Bacteria 1190
17 Ga0007416J51690_1059972 3300003577 Bacteria 870
18 Ga0032354_1079230 3300003693 Bacteria 1120
19 Ga0055538_1000018 3300003751 Bacteria 296858
20 Ga0055539_1000023 3300003752 Bacteria 296858
21 Ga0055533_1000031 3300003756 Bacteria 296858
22 Ga0055532_1000017 3300003758 Bacteria 306880
23 Ga0055525_1000029 3300003759 Bacteria 320663
24 Ga0055525_1000039 3300003759 Bacteria 296858
25 Ga0055542_1021560 3300003762 Bacteria 927
26 Ga0055526_1000068 3300003771 Bacteria 98723
27 Ga0055526_1001163 3300003771 Bacteria 19080
28 Ga0055526_1005093 3300003771 Bacteria 7667
29 Ga0055526_1007187 3300003771 Bacteria 5855
30 Ga0055537_1000678 3300003773 Bacteria 17886
31 Ga0055524_1000021 3300003775 Bacteria 227578
32 Ga0055524_1003016 3300003775 Bacteria 8340
33 Ga0055524_1005587 3300003775 Bacteria 5584
34 Ga0055524_1013711 3300003775 Bacteria 3043
35 Ga0055534_1000195 3300003784 Bacteria 44284
36 Ga0055534_1004625 3300003784 Bacteria 3918
37 Ga0055528_1000368 3300003790 Bacteria 36674
38 Ga0055530_10003380 3300003791 Bacteria 9123
39 Ga0055541_1000016 3300003841 Bacteria 296861
40 Ga0055543_1001470 3300004625 Bacteria 9303
41 Ga0065165_1004144 3300005262 Bacteria 9303
42 Ga0065165_1046881 3300005262 Bacteria 1251
43 Ga0070658_10447686 3300005327 Bacteria 1112
44 Ga0070670_100000017 3300005331 Bacteria 224429
45 Ga0070670_100008239 3300005331 Bacteria 8877
46 Ga0070666_10001017 3300005335 Bacteria 17184
47 Ga0070666_10403118 3300005335 Bacteria 983
48 Ga0070682_100516816 3300005337 Bacteria 928
49 Ga0070660_100000420 3300005339 Bacteria 28168
50 Ga0070660_100018151 3300005339 Bacteria 5135
51 Ga0070660_100081746 3300005339 Bacteria 2536
52 Ga0070660_100422141 3300005339 Bacteria 1104
53 Ga0070689_100111630 3300005340 Bacteria 2175
54 Ga0070661_100098624 3300005344 Bacteria 2170
55 Ga0070661_100127414 3300005344 Bacteria 1910
56 Ga0070668_100007166 3300005347 Bacteria 8265
57 Ga0070669_100028281 3300005353 Bacteria 4037
58 Ga0070669_100039493 3300005353 Bacteria 3430
59 Ga0070675_100029487 3300005354 Bacteria 4426
60 Ga0070671_100000173 3300005355 Bacteria 42660
61 Ga0070671_100099885 3300005355 Bacteria 2434
62 Ga0070673_100010734 3300005364 Bacteria 6213
63 Ga0070688_100003318 3300005365 Bacteria 8251
64 Ga0070688_100019613 3300005365 Bacteria 3920
65 Ga0070659_100115125 3300005366 Bacteria 2173
66 Ga0070659_100117647 3300005366 Bacteria 2149
67 Ga0070659_100170659 3300005366 Bacteria 1782
68 Ga0070667_100001097 3300005367 Bacteria 24823
69 Ga0070667_100003801 3300005367 Bacteria 12845
70 Ga0070663_100390729 3300005455 Bacteria 1135
71 Ga0070678_100004615 3300005456 Bacteria 7827
72 Ga0068867_100003865 3300005459 Bacteria 10535
73 Ga0070685_10000026 3300005466 Bacteria 98490
74 Ga0070685_10172828 3300005466 Bacteria 1386
75 Ga0070665_100285816 3300005548 Bacteria 1651
76 Ga0068855_100001073 3300005563 Bacteria 33944
77 Ga0068855_100018683 3300005563 Bacteria 8336
78 Ga0068855_100206715 3300005563 Bacteria 2208
79 Ga0068855_100544190 3300005563 Bacteria 1257
80 Ga0070664_100029568 3300005564 Bacteria 4568
81 Ga0070664_100057458 3300005564 Bacteria 3307
82 Ga0070664_100100244 3300005564 Bacteria 2518
83 Ga0068857_100708483 3300005577 Bacteria 957
84 Ga0068854_100006965 3300005578 Bacteria 7213
85 Ga0068856_100506920 3300005614 Bacteria 1228
86 Ga0068856_100833244 3300005614 Bacteria 942
87 Ga0068852_100220358 3300005616 Bacteria 1804
88 Ga0068852_100574624 3300005616 Bacteria 1129
89 Ga0068859_100317621 3300005617 Bacteria 1651
90 Ga0068864_100000029 3300005618 Bacteria 224429
91 Ga0068861_100127381 3300005719 Bacteria 2062
92 Ga0068851_10336586 3300005834 Bacteria 875
93 Ga0068863_100600276 3300005841 Bacteria 1089
94 Ga0068858_100133592 3300005842 Bacteria 2327
95 Ga0068860_100000228 3300005843 Bacteria 86756
96 Ga0068860_101144895 3300005843 Bacteria 798
97 Ga0068862_100069792 3300005844 Bacteria 3033
98 Ga0068862_100089363 3300005844 Bacteria 2681
99 Ga0075365_10197172 3300006038 Bacteria 1410
100 Ga0075364_10446427 3300006051 Bacteria 883
101 Ga0075367_10558457 3300006178 Bacteria 727
102 Ga0075366_10026204 3300006195 Bacteria 3414
103 Ga0097621_100441709 3300006237 Bacteria 1171
104 Ga0068871_100939794 3300006358 Bacteria 803
105 Ga0097620_100317629 3300006931 Bacteria 1651
106 Ga0079104_1008344 3300006946 Bacteria 3639
107 Ga0099826_10000041 3300006948 Bacteria 96536
108 Ga0105251_10236994 3300009011 Bacteria 822
109 Ga0105240_10009083 3300009093 Bacteria 14111
110 Ga0105240_10011970 3300009093 Bacteria 12023
111 Ga0105240_10020783 3300009093 Bacteria 8745
112 Ga0105241_10016300 3300009174 Bacteria 5446
113 Ga0105248_10006207 3300009177 Bacteria 13098
114 Ga0105237_10135525 3300009545 Bacteria 2457
115 Ga0105237_10259678 3300009545 Bacteria 1740
116 Ga0105238_10000065 3300009551 Bacteria 121196
117 Ga0105238_10150406 3300009551 Bacteria 2303
118 Ga0105238_10233962 3300009551 Bacteria 1814
119 Ga0105238_10262147 3300009551 Bacteria 1708
120 Ga0105249_10901723 3300009553 Bacteria 951
121 Ga0105239_10009136 3300010375 Bacteria 11211
122 Ga0105239_10457761 3300010375 Bacteria 1448
123 Ga0105239_11353967 3300010375 Bacteria 821
124 Ga0157373_10037009 3300013100 Bacteria 3501
125 Ga0157371_10000013 3300013102 Bacteria 352631
126 Ga0157371_10374609 3300013102 Bacteria 1039
127 Ga0157374_10014078 3300013296 Bacteria 6993
128 Ga0157378_10351285 3300013297 Bacteria 1440
129 Ga0157378_10667619 3300013297 Bacteria 1056
130 Ga0163162_10003303 3300013306 Bacteria 15434
131 Ga0163162_10609494 3300013306 Bacteria 1217
132 Ga0163163_10423409 3300014325 Bacteria 1390
133 Ga0157380_10007300 3300014326 Bacteria 7844
134 Ga0182008_10046094 3300014497 Bacteria 2167
135 Ga0182008_10057555 3300014497 Bacteria 1919
136 Ga0157379_10015472 3300014968 Bacteria 6695
137 Ga0157379_10637077 3300014968 Bacteria 997
138 Ga0182006_1016620 3300015261 Bacteria 3136
139 Ga0182006_1029100 3300015261 Bacteria 2241
140 Ga0182006_1050588 3300015261 Bacteria 1601
141 Ga0182006_1174230 3300015261 Bacteria 719
142 Ga0182007_10031167 3300015262 Bacteria 1818
143 Ga0182007_10115956 3300015262 Bacteria 894
144 Ga0182005_1003156 3300015265 Bacteria 5657
145 Ga0163161_10032386 3300017792 Bacteria 3731
146 Ga0213872_10000242 3300021361 Bacteria 48194
147 Ga0213872_10000443 3300021361 Bacteria 33899
148 Ga0213872_10001513 3300021361 Bacteria 14948
149 Ga0213872_10001692 3300021361 Bacteria 13879
150 Ga0213872_10019294 3300021361 Bacteria 3141
151 Ga0213872_10019678 3300021361 Bacteria 3109
152 Ga0213872_10044898 3300021361 Bacteria 2010
153 Ga0213872_10091690 3300021361 Bacteria 1359
154 Ga0213872_10108111 3300021361 Bacteria 1236
155 Ga0213872_10156063 3300021361 Bacteria 995
156 Ga0213876_10076148 3300021384 Bacteria 1772
157 Ga0209435_100015 3300025206 Bacteria 321177
158 Ga0209435_100161 3300025206 Bacteria 21397
159 Ga0209760_100622 3300025207 Bacteria 6046
160 Ga0209436_101543 3300025208 Bacteria 7827
161 Ga0209784_100027 3300025224 Bacteria 363933
162 Ga0209566_100027 3300025225 Bacteria 363933
163 Ga0209674_100044 3300025226 Bacteria 363933
164 Ga0209672_102164 3300025228 Bacteria 5179
165 Ga0209147_100004 3300025229 Bacteria 1371850
166 Ga0209563_100003 3300025230 Bacteria 1932942
167 Ga0209563_100048 3300025230 Bacteria 363933
168 Ga0207427_100643 3300025231 Bacteria 16924
169 Ga0209437_100045 3300025233 Bacteria 429809
170 Ga0209437_100055 3300025233 Bacteria 363933
171 Ga0209437_108693 3300025233 Bacteria 1614
172 Ga0209437_110183 3300025233 Bacteria 1444
173 Ga0209258_100226 3300025242 Bacteria 106588
174 Ga0209646_1000020 3300025246 Bacteria 462204
175 Ga0209646_1000040 3300025246 Bacteria 347867
176 Ga0209646_1000077 3300025246 Bacteria 208262
177 Ga0209026_1000034 3300025250 Bacteria 306953
178 Ga0209026_1009492 3300025250 Bacteria 1907
179 Ga0209026_1016102 3300025250 Bacteria 1215
180 Ga0209677_100028 3300025253 Bacteria 363933
181 Ga0209148_1001819 3300025254 Bacteria 8981
182 Ga0209759_1000049 3300025256 Bacteria 221692
183 Ga0209759_1000357 3300025256 Bacteria 59208
184 Ga0209233_1000070 3300025261 Bacteria 363933
185 Ga0209565_1000015 3300025263 Bacteria 494091
186 Ga0209565_1001939 3300025263 Bacteria 8132
187 Ga0209455_1000169 3300025272 Bacteria 111454
188 Ga0209455_1008089 3300025272 Bacteria 2893
189 Ga0209673_1000394 3300025273 Bacteria 78048
190 Ga0209130_1001054 3300025284 Bacteria 20900
191 Ga0209675_1000012 3300025291 Bacteria 494061
192 Ga0209675_1001711 3300025291 Bacteria 12096
193 Ga0209564_1000016 3300025295 Bacteria 613131
194 Ga0209564_1000071 3300025295 Bacteria 301332
195 Ga0209564_1000072 3300025295 Bacteria 289331
196 Ga0209564_1028688 3300025295 Bacteria 1771
197 Ga0209050_1000240 3300025298 Bacteria 118992
198 Ga0209256_1000044 3300025299 Bacteria 337264
199 Ga0209256_1000076 3300025299 Bacteria 234735
200 Ga0209256_1003100 3300025299 Bacteria 12161
201 Ga0207426_1054078 3300025302 Bacteria 1183
202 Ga0207680_10014776 3300025903 Bacteria 4055
203 Ga0207705_10017557 3300025909 Bacteria 5123
204 Ga0207654_10004697 3300025911 Bacteria 6913
205 Ga0207695_10001341 3300025913 Bacteria 41772
206 Ga0207695_10005745 3300025913 Bacteria 16337
207 Ga0207695_10438637 3300025913 Bacteria 1189
208 Ga0207671_10037277 3300025914 Bacteria 3606
209 Ga0207671_10307253 3300025914 Bacteria 1253
210 Ga0207657_10001145 3300025919 Bacteria 28192
211 Ga0207657_10024222 3300025919 Bacteria 5631
212 Ga0207657_10034425 3300025919 Bacteria 4555
213 Ga0207657_10134734 3300025919 Bacteria 2022
214 Ga0207649_10026917 3300025920 Bacteria 3369
215 Ga0207681_10022277 3300025923 Bacteria 4039
216 Ga0207681_10070592 3300025923 Bacteria 2433
217 Ga0207694_10001114 3300025924 Bacteria 23252
218 Ga0207694_10189850 3300025924 Bacteria 1669
219 Ga0207650_10000003 3300025925 Bacteria 1123235
220 Ga0207650_10004390 3300025925 Bacteria 9637
221 Ga0207644_10004443 3300025931 Bacteria 9107
222 Ga0207690_10084366 3300025932 Bacteria 2226
223 Ga0207690_10191480 3300025932 Bacteria 1547
224 Ga0207690_10819946 3300025932 Bacteria 769
225 Ga0207706_10336169 3300025933 Bacteria 1314
226 Ga0207686_10187296 3300025934 Bacteria 1472
227 Ga0207709_10112420 3300025935 Bacteria 1824
228 Ga0207711_10000472 3300025941 Bacteria 41502
229 Ga0207679_10019205 3300025945 Bacteria 4589
230 Ga0207679_10248449 3300025945 Bacteria 1511
231 Ga0207679_10267272 3300025945 Bacteria 1461
232 Ga0207667_10000078 3300025949 Bacteria 165061
233 Ga0207667_10023739 3300025949 Bacteria 6750
234 Ga0207667_10041450 3300025949 Bacteria 4896
235 Ga0207667_10217165 3300025949 Bacteria 1959
236 Ga0207667_10297414 3300025949 Bacteria 1649
237 Ga0207712_10135816 3300025961 Bacteria 1881
238 Ga0207668_10007151 3300025972 Bacteria 6628
239 Ga0207668_10118956 3300025972 Bacteria 1997
240 Ga0207640_10055935 3300025981 Bacteria 2587
241 Ga0207658_10000012 3300025986 Bacteria 224402
242 Ga0207703_10130918 3300026035 Bacteria 2166
243 Ga0207678_10312327 3300026067 Bacteria 1351
244 Ga0207678_10912544 3300026067 Bacteria 777
245 Ga0207702_10478919 3300026078 Bacteria 1211
246 Ga0207702_10885972 3300026078 Bacteria 884
247 Ga0207702_11225745 3300026078 Bacteria 744
248 Ga0207641_10025128 3300026088 Bacteria 4910
249 Ga0207648_10076849 3300026089 Bacteria 2911
250 Ga0207676_10000003 3300026095 Bacteria 1123235
251 Ga0207674_10349182 3300026116 Bacteria 1430
252 Ga0207674_10350919 3300026116 Bacteria 1426
253 Ga0207698_10158976 3300026142 Bacteria 1973
254 Ga0209282_1000001 3300027666 Bacteria 2450367
255 Ga0268266_10032903 3300028379 Bacteria 4406
256 Ga0268265_10002832 3300028380 Bacteria 12751
257 Ga0268265_10048589 3300028380 Bacteria 3186
258 Ga0268264_10000009 3300028381 Bacteria 724972
259 Ga0268264_10099773 3300028381 Bacteria 2520
260 Ga0307511_10008326 3300030521 Bacteria 10380
261 Ga0316180_1021737 3300030736 Bacteria 2639
262 Ga0316183_1190372 3300030742 Bacteria 979
263 Ga0265331_10064063 3300031250 Bacteria 1731
264 Ga0265327_10090693 3300031251 Bacteria 1491
265 Ga0265327_10165282 3300031251 Bacteria 1020
266 Ga0307509_10270648 3300031507 Bacteria 1467
267 Ga0307408_100000239 3300031548 Bacteria 57570
268 Ga0307408_100224828 3300031548 Bacteria 1533
269 Ga0307416_100005633 3300032002 Bacteria 7726
270 Ga0307414_10788244 3300032004 Bacteria 866
271 Ga0316583_10009603 3300032133 Bacteria 3485
272 Ga0373931_0114275 3300035691 Bacteria 1535
273 Ga0395899_0000128 3300037312 Bacteria 119014
274 Ga0395899_0000753 3300037312 Bacteria 32064
275 Ga0395899_0006694 3300037312 Bacteria 8931
276 Ga0395899_0010304 3300037312 Bacteria 7167
277 Ga0395899_0010704 3300037312 Bacteria 7031
278 Ga0395899_0012339 3300037312 Bacteria 6544
279 Ga0395899_0013728 3300037312 Bacteria 6193
280 Ga0395899_0055314 3300037312 Bacteria 2935
281 Ga0395899_0293240 3300037312 Bacteria 1103
282 Ga0395900_0000123 3300037418 Bacteria 133326
283 Ga0395900_0007904 3300037418 Bacteria 10955
284 Ga0395900_0008621 3300037418 Bacteria 10478
285 Ga0395900_0009260 3300037418 Bacteria 10096
286 Ga0395900_0010088 3300037418 Bacteria 9661
287 Ga0395900_0021826 3300037418 Bacteria 6546
288 Ga0395900_0035310 3300037418 Bacteria 5149
289 Ga0395900_0073035 3300037418 Bacteria 3526
290 Ga0395900_0116934 3300037418 Bacteria 2736
291 Ga0395900_0140769 3300037418 Bacteria 2470
292 Ga0395900_0209971 3300037418 Bacteria 1966
293 Ga0395900_0287131 3300037418 Bacteria 1635
294 Ga0395900_0323735 3300037418 Bacteria 1521
295 Ga0395900_0328620 3300037418 Bacteria 1507
296 Ga0395898_0004536 3300037466 Bacteria 15161
297 Ga0395898_0075038 3300037466 Bacteria 3266
298 Ga0395898_0109879 3300037466 Bacteria 2643
299 Ga0395898_0125841 3300037466 Bacteria 2455
300 Ga0395898_0257386 3300037466 Bacteria 1664
301 Ga0395898_0383923 3300037466 Bacteria 1339
302 Ga0395898_0517499 3300037466 Bacteria 1134
303 Ga0395898_0628288 3300037466 Bacteria 1016
304 Ga0395905_0000905 3300037471 Bacteria 38512
305 Ga0395905_0001709 3300037471 Bacteria 25795
306 Ga0395905_0012941 3300037471 Bacteria 8020
307 Ga0395905_0013998 3300037471 Bacteria 7674
308 Ga0395905_0020397 3300037471 Bacteria 6279
309 Ga0395905_0042482 3300037471 Bacteria 4267
310 Ga0395905_0078281 3300037471 Bacteria 3098
311 Ga0395905_0099213 3300037471 Bacteria 2735
312 Ga0395905_0128099 3300037471 Bacteria 2387
313 Ga0395905_0152274 3300037471 Bacteria 2175
314 Ga0395905_0310643 3300037471 Bacteria 1465
315 Ga0395905_0380827 3300037471 Bacteria 1305
316 Ga0395905_0392670 3300037471 Bacteria 1282
317 Ga0395905_0503627 3300037471 Bacteria 1111
318 Ga0395905_0623628 3300037471 Bacteria 980
319 Ga0395901_0000411 3300038443 Bacteria 50643
320 Ga0395901_0001908 3300038443 Bacteria 21493
321 Ga0395901_0021000 3300038443 Bacteria 6689
322 Ga0395901_0023907 3300038443 Bacteria 6267
323 Ga0395901_0278987 3300038443 Bacteria 1737
324 Ga0395901_0346430 3300038443 Bacteria 1534
325 Ga0395901_0355927 3300038443 Bacteria 1510
326 Ga0395901_0504377 3300038443 Bacteria 1231
327 Ga0395901_0796251 3300038443 Bacteria 934
328 Ga0436365_1765823 3300039437 Bacteria 5366
329 Ga0436361_0014452 3300039447 Bacteria 4411
330 Ga0436361_0032641 3300039447 Bacteria 1118
331 Ga0436361_0149158 3300039447 Bacteria 4068
332 Ga0436361_0161443 3300039447 Bacteria 5435
333 Ga0436361_0275924 3300039447 Bacteria 2979
334 Ga0436361_0458162 3300039447 Bacteria 1237
335 Ga0436361_0568983 3300039447 Bacteria 33450
336 Ga0436361_0632651 3300039447 Bacteria 49929
337 Ga0436361_0746087 3300039447 Bacteria 1617
338 Ga0436361_0830100 3300039447 Bacteria 16365
339 Ga0436361_0938544 3300039447 Bacteria 31788
340 Ga0436361_0973589 3300039447 Bacteria 2003
341 Ga0436361_1043948 3300039447 Bacteria 4310
342 Ga0436362_0115419 3300039453 Bacteria 1304
343 Ga0439448_0010043 3300042005 Bacteria 2797
344 Ga0439448_0123959 3300042005 Bacteria 888
345 Ga0439449_0013722 3300042007 Bacteria 3049
346 Ga0439450_010428 3300042008 Bacteria 1792
347 Ga0439450_018780 3300042008 Bacteria 1456
348 Ga0439455_0106565 3300042012 Bacteria 777
349 Ga0450897_013149 3300042128 Bacteria 823
350 Ga0450904_000276 3300042139 Bacteria 11138
351 Ga0439458_0022881 3300042157 Bacteria 1454
352 Ga0451577_0625920 3300042876 Bacteria 976
353 Ga0466969_0038118 3300044656 Bacteria 2420
354 Ga0466969_0080543 3300044656 Bacteria 1555
355 Ga0466972_0000087 3300044658 Bacteria 84646
356 Ga0466972_0001100 3300044658 Bacteria 12928
357 Ga0466972_0006991 3300044658 Bacteria 5660
358 Ga0466972_0097290 3300044658 Bacteria 1394
359 Ga0466965_0002700 3300044683 Bacteria 7599
360 Ga0466965_0010006 3300044683 Bacteria 4412
361 Ga0466965_0011686 3300044683 Bacteria 4118
362 Ga0466965_0065720 3300044683 Bacteria 1817
363 Ga0466965_0107579 3300044683 Bacteria 1431
364 Ga0466966_0011821 3300044684 Bacteria 5780
365 Ga0466966_0013678 3300044684 Bacteria 5369
366 Ga0466966_0068924 3300044684 Bacteria 2219
367 Ga0466966_0082220 3300044684 Bacteria 2004
368 Ga0466961_0159699 3300044693 Bacteria 1405
369 Ga0466964_0000256 3300044706 Bacteria 15366
370 Ga0466964_0199537 3300044706 Bacteria 960
371 Ga0466964_0206904 3300044706 Bacteria 945
372 Ga0453684_0000102 3300044712 Bacteria 366870
373 Ga0466971_0017407 3300044719 Bacteria 3179
374 Ga0466968_0001835 3300044735 Bacteria 7668
375 Ga0466968_0037123 3300044735 Bacteria 2043
376 Ga0466968_0117279 3300044735 Bacteria 1202
377 Ga0466970_0016339 3300044765 Bacteria 3824
378 Ga0466957_0009721 3300044842 Bacteria 5492
379 Ga0466959_0009557 3300045049 Bacteria 6899
380 Ga0466959_0011644 3300045049 Bacteria 6325
381 Ga0466959_0052704 3300045049 Bacteria 2978
382 Ga0466959_0054139 3300045049 Bacteria 2932
383 Ga0466959_0586236 3300045049 Bacteria 750
384 Ga0451576_0000171 3300045051 Bacteria 162452
385 Ga0451576_0000386 3300045051 Bacteria 102813
386 Ga0451576_0080204 3300045051 Bacteria 3396
387 Ga0451576_0724582 3300045051 Bacteria 1045
388 Ga0466958_0275718 3300045836 Bacteria 1077
389 Ga0466958_0396809 3300045836 Bacteria 890
390 Ga0466967_0005324 3300045976 Bacteria 8891
391 Ga0495617_000034 3300046452 Bacteria 147232
392 Ga0495617_002482 3300046452 Bacteria 7321
393 Ga0495617_002980 3300046452 Bacteria 6473
394 Ga0495617_008361 3300046452 Bacteria 3570
395 Ga0495627_000876 3300046453 Bacteria 21280
396 Ga0495627_024085 3300046453 Bacteria 1987
397 Ga0495592_0003280 3300046454 Bacteria 11595
398 Ga0495592_0405274 3300046454 Bacteria 863
399 Ga0495603_0033409 3300046455 Bacteria 3096
400 Ga0495603_0044124 3300046455 Bacteria 2660
401 Ga0495590_0000027 3300046457 Bacteria 158323
402 Ga0495590_0000257 3300046457 Bacteria 28989
403 Ga0495590_0006267 3300046457 Bacteria 4656
404 Ga0495590_0028084 3300046457 Bacteria 1973
405 Ga0495590_0033182 3300046457 Bacteria 1805
406 Ga0495590_0067583 3300046457 Bacteria 1252
407 Ga0495590_0085440 3300046457 Bacteria 1113
408 Ga0495591_000272 3300046458 Bacteria 48725
409 Ga0495629_0014017 3300046459 Bacteria 5777
410 Ga0495638_0000098 3300046460 Bacteria 140656
411 Ga0495638_0045252 3300046460 Bacteria 2769
412 Ga0495638_0050498 3300046460 Bacteria 2597
413 Ga0495651_0015119 3300046462 Bacteria 5965
414 Ga0495651_0058856 3300046462 Bacteria 2947
415 Ga0495653_0002089 3300046463 Bacteria 15731
416 Ga0495653_0144561 3300046463 Bacteria 1668
417 Ga0495653_0169254 3300046463 Bacteria 1509
418 Ga0495650_0000011 3300046471 Bacteria 615329
419 Ga0495650_0002150 3300046471 Bacteria 16729
420 Ga0495580_0030809 3300046472 Bacteria 3880
421 Ga0495580_0445460 3300046472 Bacteria 869
422 Ga0495582_0004649 3300046473 Bacteria 7718
423 Ga0495582_0017936 3300046473 Bacteria 3869
424 Ga0495582_0114750 3300046473 Bacteria 1514
425 Ga0495605_0000029 3300046474 Bacteria 215329
426 Ga0495605_0000042 3300046474 Bacteria 185225
427 Ga0495605_0000151 3300046474 Bacteria 89442
428 Ga0495605_0006348 3300046474 Bacteria 6815
429 Ga0495605_0007689 3300046474 Bacteria 6109
430 Ga0495605_0010229 3300046474 Bacteria 5252
431 Ga0495605_0024677 3300046474 Bacteria 3142
432 Ga0495605_0035098 3300046474 Bacteria 2536
433 Ga0495605_0044828 3300046474 Bacteria 2183
434 Ga0495605_0132566 3300046474 Bacteria 1123
435 Ga0495639_0309380 3300046475 Bacteria 789
436 Ga0495584_0000007 3300046491 Bacteria 294820
437 Ga0495584_0000122 3300046491 Bacteria 53611
438 Ga0495584_0000506 3300046491 Bacteria 26745
439 Ga0495584_0002007 3300046491 Bacteria 11695
440 Ga0495584_0002049 3300046491 Bacteria 11580
441 Ga0495584_0003276 3300046491 Bacteria 8969
442 Ga0495584_0005376 3300046491 Bacteria 6790
443 Ga0495584_0005715 3300046491 Bacteria 6566
444 Ga0495584_0006099 3300046491 Bacteria 6343
445 Ga0495584_0010896 3300046491 Bacteria 4667
446 Ga0495584_0021540 3300046491 Bacteria 3273
447 Ga0495584_0069350 3300046491 Bacteria 1771
448 Ga0495584_0110508 3300046491 Bacteria 1390
449 Ga0495584_0163756 3300046491 Bacteria 1130
450 Ga0495584_0173545 3300046491 Bacteria 1096
451 Ga0495584_0204880 3300046491 Bacteria 1002
452 Ga0495585_0000115 3300046492 Bacteria 86460
453 Ga0495585_0000421 3300046492 Bacteria 40862
454 Ga0495585_0002934 3300046492 Bacteria 11799
455 Ga0495585_0003505 3300046492 Bacteria 10583
456 Ga0495585_0010560 3300046492 Bacteria 5494
457 Ga0495585_0017306 3300046492 Bacteria 4166
458 Ga0495585_0018451 3300046492 Bacteria 4022
459 Ga0495585_0020952 3300046492 Bacteria 3756
460 Ga0495585_0024454 3300046492 Bacteria 3463
461 Ga0495585_0029130 3300046492 Bacteria 3144
462 Ga0495585_0040655 3300046492 Bacteria 2610
463 Ga0495585_0062272 3300046492 Bacteria 2049
464 Ga0495585_0098278 3300046492 Bacteria 1568
465 Ga0495585_0107344 3300046492 Bacteria 1487
466 Ga0495594_0003496 3300046499 Bacteria 8092
467 Ga0495594_0010511 3300046499 Bacteria 4800
468 Ga0495594_0010807 3300046499 Bacteria 4742
469 Ga0495594_0013150 3300046499 Bacteria 4316
470 Ga0495594_0028672 3300046499 Bacteria 3005
471 Ga0495596_0000474 3300046500 Bacteria 25448
472 Ga0495596_0000530 3300046500 Bacteria 23944
473 Ga0495596_0002008 3300046500 Bacteria 11201
474 Ga0495596_0002300 3300046500 Bacteria 10378
475 Ga0495596_0004690 3300046500 Bacteria 6612
476 Ga0495596_0014436 3300046500 Bacteria 3329
477 Ga0495596_0019973 3300046500 Bacteria 2745
478 Ga0495596_0028741 3300046500 Bacteria 2230
479 Ga0495607_0001671 3300046501 Bacteria 19192
480 Ga0495607_0001966 3300046501 Bacteria 17334
481 Ga0495607_0002476 3300046501 Bacteria 14990
482 Ga0495607_0002735 3300046501 Bacteria 14072
483 Ga0495607_0004292 3300046501 Bacteria 10526
484 Ga0495607_0017561 3300046501 Bacteria 4588
485 Ga0495607_0020165 3300046501 Bacteria 4219
486 Ga0495607_0025435 3300046501 Bacteria 3681
487 Ga0495607_0028377 3300046501 Bacteria 3453
488 Ga0495607_0051721 3300046501 Bacteria 2384
489 Ga0495607_0071761 3300046501 Bacteria 1930
490 Ga0495607_0077910 3300046501 Bacteria 1830
491 Ga0495607_0083439 3300046501 Bacteria 1750
492 Ga0495607_0225317 3300046501 Bacteria 914
493 Ga0495583_0000348 3300046506 Bacteria 73050
494 Ga0495583_0000472 3300046506 Bacteria 58906
495 Ga0495583_0000569 3300046506 Bacteria 50860
496 Ga0495583_0001444 3300046506 Bacteria 24128
497 Ga0495583_0015121 3300046506 Bacteria 4212
498 Ga0495583_0033337 3300046506 Bacteria 2477
499 Ga0495583_0034886 3300046506 Bacteria 2406
500 Ga0495583_0049226 3300046506 Bacteria 1931
501 Ga0495583_0110774 3300046506 Bacteria 1163
502 Ga0495583_0194134 3300046506 Bacteria 827
503 Ga0495606_0000084 3300046507 Bacteria 158428
504 Ga0495606_0000652 3300046507 Bacteria 54651
505 Ga0495606_0000787 3300046507 Bacteria 48504
506 Ga0495606_0001481 3300046507 Bacteria 31269
507 Ga0495606_0012677 3300046507 Bacteria 6729
508 Ga0495606_0021021 3300046507 Bacteria 4791
509 Ga0495606_0029545 3300046507 Bacteria 3845
510 Ga0495606_0031347 3300046507 Bacteria 3698
511 Ga0495606_0034767 3300046507 Bacteria 3455
512 Ga0495606_0039821 3300046507 Bacteria 3161
513 Ga0495606_0047069 3300046507 Bacteria 2846
514 Ga0495606_0106051 3300046507 Bacteria 1702
515 Ga0495606_0349720 3300046507 Bacteria 785
516 Ga0495608_0001512 3300046511 Bacteria 16556
517 Ga0495608_0013677 3300046511 Bacteria 5631
518 Ga0495610_0000473 3300046512 Bacteria 41477
519 Ga0495610_0148582 3300046512 Bacteria 1002
520 Ga0495616_0001479 3300046513 Bacteria 16296
521 Ga0495616_0001547 3300046513 Bacteria 15843
522 Ga0495616_0004099 3300046513 Bacteria 9242
523 Ga0495616_0007026 3300046513 Bacteria 6773
524 Ga0495616_0008239 3300046513 Bacteria 6186
525 Ga0495616_0010806 3300046513 Bacteria 5262
526 Ga0495616_0010992 3300046513 Bacteria 5207
527 Ga0495616_0021408 3300046513 Bacteria 3501
528 Ga0495616_0025599 3300046513 Bacteria 3150
529 Ga0495616_0030670 3300046513 Bacteria 2822
530 Ga0495616_0033463 3300046513 Bacteria 2677
531 Ga0495616_0042972 3300046513 Bacteria 2297
532 Ga0495616_0044363 3300046513 Bacteria 2255
533 Ga0495616_0057484 3300046513 Bacteria 1918
534 Ga0495616_0094410 3300046513 Bacteria 1411
535 Ga0495620_0003439 3300046515 Bacteria 9059
536 Ga0495628_0004339 3300046516 Bacteria 12585
537 Ga0495628_0018273 3300046516 Bacteria 5812
538 Ga0495628_0305552 3300046516 Bacteria 1177
539 Ga0495630_0009137 3300046517 Bacteria 7128
540 Ga0495630_0332897 3300046517 Bacteria 1161
541 Ga0495631_0000550 3300046518 Bacteria 25263
542 Ga0495631_0000810 3300046518 Bacteria 19974
543 Ga0495631_0001888 3300046518 Bacteria 12341
544 Ga0495631_0002771 3300046518 Bacteria 9721
545 Ga0495631_0005099 3300046518 Bacteria 6919
546 Ga0495631_0006258 3300046518 Bacteria 6165
547 Ga0495631_0015840 3300046518 Bacteria 3603
548 Ga0495631_0017560 3300046518 Bacteria 3381
549 Ga0495631_0272480 3300046518 Bacteria 721
550 Ga0495632_0000852 3300046519 Bacteria 26846
551 Ga0495632_0000903 3300046519 Bacteria 26010
552 Ga0495632_0001985 3300046519 Bacteria 16245
553 Ga0495632_0007957 3300046519 Bacteria 6584
554 Ga0495632_0042567 3300046519 Bacteria 2275
555 Ga0495637_0000013 3300046520 Bacteria 244837
556 Ga0495637_0008688 3300046520 Bacteria 4983
557 Ga0495637_0021577 3300046520 Bacteria 2951
558 Ga0495643_0000200 3300046522 Bacteria 93353
559 Ga0495643_0000551 3300046522 Bacteria 46367
560 Ga0495643_0002412 3300046522 Bacteria 14864
561 Ga0495643_0004464 3300046522 Bacteria 9775
562 Ga0495643_0012215 3300046522 Bacteria 5187
563 Ga0495643_0024119 3300046522 Bacteria 3453
564 Ga0495643_0025001 3300046522 Bacteria 3383
565 Ga0495643_0071122 3300046522 Bacteria 1826
566 Ga0495643_0072128 3300046522 Bacteria 1811
567 Ga0495644_0002518 3300046523 Bacteria 7308
568 Ga0495644_0004268 3300046523 Bacteria 5613
569 Ga0495644_0004891 3300046523 Bacteria 5258
570 Ga0495644_0005339 3300046523 Bacteria 5017
571 Ga0495644_0011582 3300046523 Bacteria 3394
572 Ga0495644_0015732 3300046523 Bacteria 2899
573 Ga0495644_0017413 3300046523 Bacteria 2747
574 Ga0495644_0020348 3300046523 Bacteria 2533
575 Ga0495644_0036772 3300046523 Bacteria 1847
576 Ga0495648_0000112 3300046524 Bacteria 99859
577 Ga0495648_0000169 3300046524 Bacteria 75523
578 Ga0495648_0001096 3300046524 Bacteria 27557
579 Ga0495648_0002536 3300046524 Bacteria 16749
580 Ga0495648_0007990 3300046524 Bacteria 8391
581 Ga0495648_0009310 3300046524 Bacteria 7632
582 Ga0495648_0027171 3300046524 Bacteria 3836
583 Ga0495648_0034097 3300046524 Bacteria 3318
584 Ga0495648_0051763 3300046524 Bacteria 2499
585 Ga0495648_0054917 3300046524 Bacteria 2403
586 Ga0495648_0177240 3300046524 Bacteria 1087
587 Ga0495648_0313657 3300046524 Bacteria 730
588 Ga0495663_0004796 3300046525 Bacteria 3781
589 Ga0495663_0032141 3300046525 Bacteria 1562
590 Ga0495666_0015313 3300046526 Bacteria 3818
591 Ga0495666_0049841 3300046526 Bacteria 2014
592 Ga0495642_0000050 3300046528 Bacteria 71246
593 Ga0495642_0001068 3300046528 Bacteria 12668
594 Ga0495642_0001340 3300046528 Bacteria 11027
595 Ga0495642_0001809 3300046528 Bacteria 9172
596 Ga0495642_0003687 3300046528 Bacteria 6013
597 Ga0495642_0004398 3300046528 Bacteria 5471
598 Ga0495642_0008082 3300046528 Bacteria 4025
599 Ga0495642_0021157 3300046528 Bacteria 2557
600 Ga0495642_0029202 3300046528 Bacteria 2200
601 Ga0495642_0056547 3300046528 Bacteria 1620
602 Ga0495642_0134247 3300046528 Bacteria 1066
603 Ga0495642_0186853 3300046528 Bacteria 902
604 Ga0495652_0005056 3300046529 Bacteria 12485
605 Ga0495652_0016097 3300046529 Bacteria 6689
606 Ga0495652_0019388 3300046529 Bacteria 6058
607 Ga0495652_0049462 3300046529 Bacteria 3598
608 Ga0495654_0004305 3300046530 Bacteria 8491
609 Ga0495654_0006380 3300046530 Bacteria 6706
610 Ga0495654_0008593 3300046530 Bacteria 5628
611 Ga0495654_0010005 3300046530 Bacteria 5180
612 Ga0495654_0044679 3300046530 Bacteria 2190
613 Ga0495665_0005554 3300046531 Bacteria 6794
614 Ga0495665_0035779 3300046531 Bacteria 2651
615 Ga0495665_0102901 3300046531 Bacteria 1498
616 Ga0495665_0103170 3300046531 Bacteria 1496
617 Ga0495586_0018982 3300046535 Bacteria 3659
618 Ga0495586_0019447 3300046535 Bacteria 3615
619 Ga0495587_0008756 3300046536 Bacteria 6490
620 Ga0495609_0000022 3300046538 Bacteria 279488
621 Ga0495609_0000163 3300046538 Bacteria 69578
622 Ga0495609_0001355 3300046538 Bacteria 16522
623 Ga0495609_0002267 3300046538 Bacteria 12004
624 Ga0495609_0003271 3300046538 Bacteria 9357
625 Ga0495609_0026941 3300046538 Bacteria 2628
626 Ga0495609_0031532 3300046538 Bacteria 2408
627 Ga0495609_0047144 3300046538 Bacteria 1928
628 Ga0495609_0080225 3300046538 Bacteria 1427
629 Ga0495597_0000064 3300046542 Bacteria 91446
630 Ga0495597_0000266 3300046542 Bacteria 47830
631 Ga0495597_0000566 3300046542 Bacteria 30712
632 Ga0495597_0001407 3300046542 Bacteria 17367
633 Ga0495597_0002770 3300046542 Bacteria 10797
634 Ga0495597_0006826 3300046542 Bacteria 5864
635 Ga0495597_0006959 3300046542 Bacteria 5796
636 Ga0495597_0013020 3300046542 Bacteria 3994
637 Ga0495597_0074237 3300046542 Bacteria 1460
638 Ga0495597_0240246 3300046542 Bacteria 714
639 Ga0495645_0042584 3300046543 Bacteria 3311
640 Ga0495645_0073481 3300046543 Bacteria 2463
641 Ga0495622_0000311 3300046557 Bacteria 36067
642 Ga0495622_0000707 3300046557 Bacteria 18899
643 Ga0495622_0007277 3300046557 Bacteria 5138
644 Ga0495622_0039180 3300046557 Bacteria 2207
645 Ga0495622_0039684 3300046557 Bacteria 2192
646 Ga0495622_0085890 3300046557 Bacteria 1447
647 Ga0495622_0228631 3300046557 Bacteria 822
648 Ga0495633_0001165 3300046558 Bacteria 21122
649 Ga0495633_0001850 3300046558 Bacteria 15548
650 Ga0495633_0010505 3300046558 Bacteria 5046
651 Ga0495633_0016664 3300046558 Bacteria 3781
652 Ga0495633_0018317 3300046558 Bacteria 3558
653 Ga0495633_0020708 3300046558 Bacteria 3302
654 Ga0495633_0024214 3300046558 Bacteria 3001
655 Ga0495633_0047924 3300046558 Bacteria 2018
656 Ga0495633_0086336 3300046558 Bacteria 1459
657 Ga0495633_0123951 3300046558 Bacteria 1196
658 Ga0495633_0230476 3300046558 Bacteria 847
659 Ga0495656_0001658 3300046615 Bacteria 7274
660 Ga0495656_0002958 3300046615 Bacteria 5701
661 Ga0495656_0006533 3300046615 Bacteria 4094
662 Ga0495656_0026222 3300046615 Bacteria 2318
663 Ga0495656_0100038 3300046615 Bacteria 1340
664 Ga0495656_0119591 3300046615 Bacteria 1242
665 Ga0495668_0001322 3300046616 Bacteria 24393
666 Ga0495668_0001809 3300046616 Bacteria 19467
667 Ga0495668_0002020 3300046616 Bacteria 17709
668 Ga0495668_0006891 3300046616 Bacteria 7361
669 Ga0495668_0011176 3300046616 Bacteria 5388
670 Ga0495668_0013456 3300046616 Bacteria 4823
671 Ga0495668_0029492 3300046616 Bacteria 3099
672 Ga0495668_0057478 3300046616 Bacteria 2146
673 Ga0495668_0061174 3300046616 Bacteria 2077
674 Ga0495668_0093914 3300046616 Bacteria 1642
675 Ga0495668_0395699 3300046616 Bacteria 759
676 Ga0495634_0015301 3300046642 Bacteria 5515
677 Ga0495611_0000515 3300046648 Bacteria 22974
678 Ga0495611_0003505 3300046648 Bacteria 6905
679 Ga0495611_0003835 3300046648 Bacteria 6556
680 Ga0495611_0007685 3300046648 Bacteria 4578
681 Ga0495611_0009941 3300046648 Bacteria 4027
682 Ga0495611_0010893 3300046648 Bacteria 3851
683 Ga0495611_0015786 3300046648 Bacteria 3227
684 Ga0495611_0016265 3300046648 Bacteria 3180
685 Ga0495611_0055477 3300046648 Bacteria 1792
686 Ga0495611_0056545 3300046648 Bacteria 1776
687 Ga0495611_0098122 3300046648 Bacteria 1358
688 Ga0495625_0000810 3300046660 Bacteria 43340
689 Ga0495625_0002543 3300046660 Bacteria 19615
690 Ga0495625_0005310 3300046660 Bacteria 11801
691 Ga0495625_0011709 3300046660 Bacteria 7131
692 Ga0495625_0013813 3300046660 Bacteria 6471
693 Ga0495625_0020304 3300046660 Bacteria 5131
694 Ga0495625_0061488 3300046660 Bacteria 2657
695 Ga0495625_0203186 3300046660 Bacteria 1306
696 Ga0495659_0000019 3300046664 Bacteria 74610
697 Ga0495659_0000167 3300046664 Bacteria 29514
698 Ga0495659_0001683 3300046664 Bacteria 7409
699 Ga0495659_0009447 3300046664 Bacteria 3112
700 Ga0495659_0020073 3300046664 Bacteria 2241
701 Ga0495661_0000151 3300046665 Bacteria 81275
702 Ga0495661_0000590 3300046665 Bacteria 37515
703 Ga0495661_0003517 3300046665 Bacteria 11544
704 Ga0495661_0007238 3300046665 Bacteria 7740
705 Ga0495661_0007385 3300046665 Bacteria 7657
706 Ga0495661_0012488 3300046665 Bacteria 5736
707 Ga0495661_0020506 3300046665 Bacteria 4313
708 Ga0495661_0023945 3300046665 Bacteria 3957
709 Ga0495661_0028727 3300046665 Bacteria 3556
710 Ga0495661_0039994 3300046665 Bacteria 2910
711 Ga0495661_0043396 3300046665 Bacteria 2764
712 Ga0495661_0047504 3300046665 Bacteria 2613
713 Ga0495661_0063816 3300046665 Bacteria 2176
714 Ga0495661_0165231 3300046665 Bacteria 1185
715 Ga0495661_0166458 3300046665 Bacteria 1179
716 Ga0495661_0213394 3300046665 Bacteria 1003
717 Ga0495661_0255821 3300046665 Bacteria 892
718 Ga0495588_0000086 3300046674 Bacteria 193241
719 Ga0495588_0011973 3300046674 Bacteria 4085
720 Ga0495588_0017075 3300046674 Bacteria 3518
721 Ga0495588_0032962 3300046674 Bacteria 2613
722 Ga0495588_0034728 3300046674 Bacteria 2552
723 Ga0495588_0058010 3300046674 Bacteria 2001
724 Ga0495588_0116559 3300046674 Bacteria 1407
725 Ga0495657_0058805 3300046675 Bacteria 2551
726 Ga0495599_0003514 3300046678 Bacteria 9176
727 Ga0495623_0008207 3300046679 Bacteria 6793
728 Ga0495623_0011302 3300046679 Bacteria 5776
729 Ga0495623_0035632 3300046679 Bacteria 3189
730 Ga0495623_0041958 3300046679 Bacteria 2916
731 Ga0495623_0048369 3300046679 Bacteria 2697
732 Ga0495646_0001555 3300046680 Bacteria 13656
733 Ga0495669_0000018 3300046684 Bacteria 127866
734 Ga0495669_0026346 3300046684 Bacteria 2540
735 Ga0495669_0093968 3300046684 Bacteria 1387
736 Ga0495613_0089487 3300046689 Bacteria 2230
737 Ga0495624_0033919 3300046690 Bacteria 3305
738 Ga0495624_0036132 3300046690 Bacteria 3187
739 Ga0495624_0292209 3300046690 Bacteria 983
740 Ga0495670_0000143 3300046691 Bacteria 31142
741 Ga0495670_0001120 3300046691 Bacteria 12994
742 Ga0495670_0010421 3300046691 Bacteria 4566
743 Ga0495670_0013539 3300046691 Bacteria 4011
744 Ga0495670_0035185 3300046691 Bacteria 2495
745 Ga0495670_0079714 3300046691 Bacteria 1667
746 Ga0495670_0081229 3300046691 Bacteria 1651
747 Ga0495670_0247697 3300046691 Bacteria 949
748 Ga0495671_0000658 3300046692 Bacteria 25041
749 Ga0495671_0001049 3300046692 Bacteria 19213
750 Ga0495671_0019545 3300046692 Bacteria 3578
751 Ga0495671_0031072 3300046692 Bacteria 2731
752 Ga0495671_0127303 3300046692 Bacteria 1242
753 Ga0495671_0154071 3300046692 Bacteria 1118
754 Ga0495649_0003442 3300046694 Bacteria 10671
755 Ga0495649_0009418 3300046694 Bacteria 5808
756 Ga0495649_0015222 3300046694 Bacteria 4379
757 Ga0495649_0027732 3300046694 Bacteria 3141
758 Ga0495649_0048732 3300046694 Bacteria 2302
759 Ga0495589_0000017 3300046794 Bacteria 206113
760 Ga0495589_0000513 3300046794 Bacteria 27274
761 Ga0495589_0001742 3300046794 Bacteria 12371
762 Ga0495589_0004248 3300046794 Bacteria 7661
763 Ga0495589_0011131 3300046794 Bacteria 4668
764 Ga0495589_0013061 3300046794 Bacteria 4289
765 Ga0495589_0020691 3300046794 Bacteria 3364
766 Ga0495589_0022368 3300046794 Bacteria 3226
767 Ga0495589_0043009 3300046794 Bacteria 2250
768 Ga0495589_0082237 3300046794 Bacteria 1566
769 Ga0495600_0000834 3300046809 Bacteria 16422
770 Ga0495600_0006403 3300046809 Bacteria 7166
771 Ga0495600_0131479 3300046809 Bacteria 1627
772 Ga0495660_0000067 3300046810 Bacteria 119390
773 Ga0495660_0002349 3300046810 Bacteria 12097
774 Ga0495660_0004163 3300046810 Bacteria 8799
775 Ga0495660_0007858 3300046810 Bacteria 6263
776 Ga0495660_0014127 3300046810 Bacteria 4624
777 Ga0495660_0047272 3300046810 Bacteria 2357
778 Ga0495660_0059026 3300046810 Bacteria 2064
779 Ga0495660_0063365 3300046810 Bacteria 1980
780 Ga0495660_0128657 3300046810 Bacteria 1272
781 Ga0495660_0166579 3300046810 Bacteria 1076
782 Ga0495581_0009510 3300047315 Bacteria 5625
783 Ga0495581_0018889 3300047315 Bacteria 4001
784 Ga0495581_0055668 3300047315 Bacteria 2282
785 Ga0495604_0004591 3300047317 Bacteria 10939
786 Ga0495604_0034285 3300047317 Bacteria 4016
787 Ga0495604_0246697 3300047317 Bacteria 1219
788 Ga0495604_0437459 3300047317 Bacteria 856
789 Ga0495636_0000388 3300047318 Bacteria 16592
790 Ga0495636_0003301 3300047318 Bacteria 6250
791 Ga0495636_0004667 3300047318 Bacteria 5374
792 Ga0495636_0009037 3300047318 Bacteria 3918
793 Ga0495636_0023781 3300047318 Bacteria 2482
794 Ga0495636_0061353 3300047318 Bacteria 1590
795 Ga0495636_0135464 3300047318 Bacteria 1097
796 Ga0495674_0221331 3300047319 Bacteria 1564
797 Ga0495672_0000067 3300047320 Bacteria 190335
798 Ga0495672_0000343 3300047320 Bacteria 59629
799 Ga0495672_0000718 3300047320 Bacteria 36426
800 Ga0495672_0001478 3300047320 Bacteria 23059
801 Ga0495672_0003293 3300047320 Bacteria 13969
802 Ga0495672_0004198 3300047320 Bacteria 11934
803 Ga0495672_0034084 3300047320 Bacteria 3149
804 Ga0495672_0052482 3300047320 Bacteria 2394
805 Ga0495672_0128740 3300047320 Bacteria 1334
806 Ga0495676_0000067 3300047321 Bacteria 80084
807 Ga0495676_0028953 3300047321 Bacteria 4722
808 Ga0495676_0461324 3300047321 Bacteria 837
809 Ga0495683_0000083 3300047323 Bacteria 93743
810 Ga0495683_0000348 3300047323 Bacteria 38313
811 Ga0495683_0002803 3300047323 Bacteria 10339
812 Ga0495683_0006314 3300047323 Bacteria 6481
813 Ga0495683_0019894 3300047323 Bacteria 3463
814 Ga0495683_0022607 3300047323 Bacteria 3233
815 Ga0495683_0057907 3300047323 Bacteria 1925
816 Ga0495683_0078187 3300047323 Bacteria 1616
817 Ga0495683_0079896 3300047323 Bacteria 1596
818 Ga0495687_000033 3300047443 Bacteria 263788
819 Ga0495687_000126 3300047443 Bacteria 117879
820 Ga0495687_000252 3300047443 Bacteria 72401
821 Ga0495687_000640 3300047443 Bacteria 40137
822 Ga0495687_008102 3300047443 Bacteria 6070
823 Ga0495687_010751 3300047443 Bacteria 4988
824 Ga0495687_010893 3300047443 Bacteria 4939
825 Ga0495687_022520 3300047443 Bacteria 3022
826 Ga0495675_0003787 3300047444 Bacteria 9148
827 Ga0495675_0030000 3300047444 Bacteria 3470
828 Ga0495675_0088516 3300047444 Bacteria 1944
829 Ga0495677_0000002 3300047445 Bacteria 346767
830 Ga0495677_0005091 3300047445 Bacteria 5003
831 Ga0495677_0008034 3300047445 Bacteria 3920
832 Ga0495677_0008164 3300047445 Bacteria 3888
833 Ga0495677_0014812 3300047445 Bacteria 2836
834 Ga0495677_0021668 3300047445 Bacteria 2329
835 Ga0495677_0032123 3300047445 Bacteria 1911
836 Ga0495677_0044837 3300047445 Bacteria 1621
837 Ga0495677_0051623 3300047445 Bacteria 1514
838 Ga0495677_0098020 3300047445 Bacteria 1108
839 Ga0495677_0128864 3300047445 Bacteria 968
840 Ga0495679_008082 3300047446 Bacteria 4310
841 Ga0495679_008137 3300047446 Bacteria 4292
842 Ga0495679_019799 3300047446 Bacteria 2356
843 Ga0495679_034537 3300047446 Bacteria 1608
844 Ga0495679_074564 3300047446 Bacteria 971
845 Ga0495685_000053 3300047447 Bacteria 45514
846 Ga0495685_000183 3300047447 Bacteria 20748
847 Ga0495685_001317 3300047447 Bacteria 7585
848 Ga0495685_004689 3300047447 Bacteria 4434
849 Ga0495685_016533 3300047447 Bacteria 2521
850 Ga0495673_0000265 3300047469 Bacteria 72840
851 Ga0495681_0000321 3300047470 Bacteria 38154
852 Ga0495681_0007275 3300047470 Bacteria 7112
853 Ga0495681_0016273 3300047470 Bacteria 4176
854 Ga0495681_0030372 3300047470 Bacteria 2752
855 Ga0495681_0032989 3300047470 Bacteria 2599
856 Ga0495681_0046396 3300047470 Bacteria 2072
857 Ga0495686_0000628 3300047472 Bacteria 48588
858 Ga0495686_0033337 3300047472 Bacteria 3326
859 Ga0495686_0040123 3300047472 Bacteria 2987
860 Ga0495686_0091644 3300047472 Bacteria 1844
861 Ga0495686_0129523 3300047472 Bacteria 1497
862 Ga0495686_0181975 3300047472 Bacteria 1217
863 Ga0495593_0054376 3300047673 Bacteria 2110
864 Ga0495602_0024798 3300048088 Bacteria 5814
865 Ga0495602_0104784 3300048088 Bacteria 2313
866 Ga0495602_0159563 3300048088 Bacteria 1762
867 Ga0495614_0001110 3300048089 Bacteria 11534
868 Ga0495614_0018070 3300048089 Bacteria 3056
869 Ga0495615_0001150 3300048090 Bacteria 3817
870 Ga0495615_0029638 3300048090 Bacteria 1300
871 Ga0495626_0000097 3300048091 Bacteria 113925
872 Ga0495626_0000209 3300048091 Bacteria 70145
873 Ga0495626_0000258 3300048091 Bacteria 60668
874 Ga0495626_0003284 3300048091 Bacteria 10440
875 Ga0495626_0007634 3300048091 Bacteria 5998
876 Ga0495626_0011560 3300048091 Bacteria 4666
877 Ga0495626_0016093 3300048091 Bacteria 3809
878 Ga0495626_0018518 3300048091 Bacteria 3495
879 Ga0495626_0021333 3300048091 Bacteria 3214
880 Ga0495626_0026399 3300048091 Bacteria 2831
881 Ga0495626_0044605 3300048091 Bacteria 2073
882 Ga0495626_0049911 3300048091 Bacteria 1935
883 Ga0495626_0059885 3300048091 Bacteria 1736
884 Ga0495626_0145896 3300048091 Bacteria 1000
885 Ga0496100_0052012 3300048903 Bacteria 2661
886 Ga0496100_0159307 3300048903 Bacteria 1617
887 Ga0496101_0044781 3300048904 Bacteria 3167
888 Ga0496101_0092574 3300048904 Bacteria 2251
889 Ga0496102_0000313 3300048905 Bacteria 61085
890 Ga0496102_0000487 3300048905 Bacteria 43875
891 Ga0496102_0055639 3300048905 Bacteria 3607
892 Ga0496102_0420493 3300048905 Bacteria 1255
893 Ga0496103_0091804 3300048906 Bacteria 1916
894 Ga0496103_0231148 3300048906 Bacteria 1189
895 Ga0496103_0422697 3300048906 Bacteria 855
896 Ga0496103_0443694 3300048906 Bacteria 832
897 Ga0496103_0450071 3300048906 Bacteria 826
898 Ga0496104_0848884 3300048907 Bacteria 819
899 Ga0496106_0006127 3300048909 Bacteria 8896
900 Ga0496107_0075821 3300048910 Bacteria 2448
901 Ga0496107_0293454 3300048910 Bacteria 1210
902 Ga0496108_0217414 3300048911 Bacteria 1660
903 Ga0496108_0711016 3300048911 Bacteria 871
904 Ga0496109_0068134 3300048912 Bacteria 3262
905 Ga0496109_0229028 3300048912 Bacteria 1748
906 Ga0496110_0000024 3300048913 Bacteria 74685
907 Ga0496110_0104634 3300048913 Bacteria 2539
908 Ga0496110_0570064 3300048913 Bacteria 1028
909 Ga0496111_0635735 3300048914 Bacteria 779
910 Ga0496112_0367515 3300048915 Bacteria 1380
911 Ga0496112_0755078 3300048915 Bacteria 899
912 Ga0496113_0019700 3300048916 Bacteria 4726
913 Ga0496114_0047812 3300048917 Bacteria 3558
914 Ga0496114_0067969 3300048917 Bacteria 2991
915 Ga0496114_0478533 3300048917 Bacteria 1102
916 Ga0496115_0026659 3300048918 Bacteria 4512
917 Ga0496115_0056234 3300048918 Bacteria 3162
918 Ga0496115_0082225 3300048918 Bacteria 2623
919 Ga0496115_0215720 3300048918 Bacteria 1584
920 Ga0496115_0555710 3300048918 Bacteria 917
921 Ga0496116_0026481 3300048919 Bacteria 4240
922 Ga0496118_0131119 3300048921 Bacteria 1609
923 Ga0496121_0095442 3300048924 Bacteria 2311
924 Ga0496121_0154136 3300048924 Bacteria 1687
925 Ga0496121_0514578 3300048924 Bacteria 757
926 Ga0496122_0000439 3300048925 Bacteria 87380
927 Ga0496122_0002153 3300048925 Bacteria 28900
928 Ga0496122_0004757 3300048925 Bacteria 16624
929 Ga0496122_0011837 3300048925 Bacteria 8770
930 Ga0496123_0000487 3300048926 Bacteria 69019
931 Ga0496123_0003789 3300048926 Bacteria 16558
932 Ga0496123_0022480 3300048926 Bacteria 4858
933 Ga0496124_0016901 3300048927 Bacteria 6913
934 Ga0496124_0021248 3300048927 Bacteria 5984
935 Ga0496124_0023141 3300048927 Bacteria 5680
936 Ga0496124_0045759 3300048927 Bacteria 3751
937 Ga0496124_0076458 3300048927 Bacteria 2763
938 Ga0496124_0303252 3300048927 Bacteria 1152
939 Ga0496125_0001079 3300048928 Bacteria 41999
940 Ga0496125_0003984 3300048928 Bacteria 17378
941 Ga0496125_0099527 3300048928 Bacteria 2147
942 Ga0496125_0182288 3300048928 Bacteria 1397
943 Ga0496125_0246345 3300048928 Bacteria 1131
944 Ga0496126_0060200 3300048929 Bacteria 3416
945 Ga0496126_0224826 3300048929 Bacteria 1575
946 Ga0501308_013232 3300049128 Bacteria 952
947 Ga0501304_003196 3300049160 Bacteria 1188
948 Ga0501305_039264 3300049161 Bacteria 765
949 Ga0495678_000131 3300049459 Bacteria 88620
950 Ga0495678_000355 3300049459 Bacteria 47179
951 Ga0495678_001074 3300049459 Bacteria 23088
952 Ga0495678_003680 3300049459 Bacteria 9283
953 Ga0495678_004358 3300049459 Bacteria 8225
954 Ga0495678_015158 3300049459 Bacteria 3558
955 Ga0495678_033475 3300049459 Bacteria 2120
956 Ga0495678_193161 3300049459 Bacteria 631
957 Ga0495682_0000779 3300049460 Bacteria 20252
958 Ga0495682_0001850 3300049460 Bacteria 10612
959 Ga0495682_0002874 3300049460 Bacteria 7921
960 Ga0495682_0004757 3300049460 Bacteria 5734
961 Ga0501300_033155 3300049523 Bacteria 765
962 Ga0501207_006845 3300049654 Bacteria 1611
963 Ga0501280_000079 3300049776 Bacteria 25935
964 Ga0501282_010548 3300049778 Bacteria 992
965 Ga0501035_0005808 3300049822 Bacteria 11635
966 nmdc:mga00v17_230903_c1 3300050491 Bacteria 1199
967 nmdc:mga0yw44_175167_c1 3300050492 Bacteria 1410
968 Ga0495601_0021365 3300053077 Bacteria 3963
969 Ga0495601_0323983 3300053077 Bacteria 1003
970 Ga0495655_0154964 3300053083 Bacteria 723
971 Ga0500583_0004765 3300053092 Bacteria 4467
972 Ga0500650_0000077 3300053098 Bacteria 28370
973 Ga0500594_0017715 3300053118 Bacteria 1747
974 Ga0500614_159553 3300053123 Bacteria 683
975 Ga0500618_000301 3300053125 Bacteria 37462
976 Ga0500618_000821 3300053125 Bacteria 17044
977 Ga0500564_049825 3300053138 Bacteria 1917
978 Ga0500574_000358 3300053141 Bacteria 5632
979 Ga0500622_0279307 3300053156 Bacteria 720
980 Ga0500634_0016724 3300053161 Bacteria 3917
981 Ga0500661_019973 3300055283 Bacteria 1191
982 Ga0587066_023808 3300059490 Bacteria 1037
983 Ga0587066_089812 3300059490 Bacteria 680
984 Ga0587070_012124 3300059491 Bacteria 1303
985 Ga0587077_006576 3300059493 Bacteria 1653
986 Ga0587077_025555 3300059493 Bacteria 1084
987 Ga0587080_010270 3300059503 Bacteria 1377
988 Ga0587083_0023065 3300059505 Bacteria 1171
989 Ga0587085_003884 3300059506 Bacteria 1662
990 Ga0587086_011885 3300059507 Bacteria 1074
991 Ga0587090_001134 3300059510 Bacteria 2599
992 Ga0587090_013222 3300059510 Bacteria 1190
993 Ga0587091_019150 3300059511 Bacteria 1173
994 Ga0587091_019940 3300059511 Bacteria 1159
995 Ga0587106_021228 3300059605 Bacteria 966
996 Ga0587101_054991 3300059623 Bacteria 696
997 Ga0587109_014206 3300059624 Bacteria 1333
998 Ga0587117_016597 3300059627 Bacteria 982
999 Ga0587062_011715 3300059639 Bacteria 1112
1000 Ga0587067_015649 3300059640 Bacteria 1234
1001 Ga0587067_020457 3300059640 Bacteria 1132
1002 Ga0587068_016177 3300059641 Bacteria 1181
1003 Ga0587069_016163 3300059642 Bacteria 1063
1004 Ga0587069_022812 3300059642 Bacteria 953
1005 Ga0587072_005287 3300059643 Bacteria 1923
1006 Ga0587072_025780 3300059643 Bacteria 1071
1007 Ga0587078_011383 3300059646 Bacteria 1032
1008 Ga0587079_043002 3300059647 Bacteria 920
1009 Ga0587105_003927 3300059651 Bacteria 929
1010 Ga0587071_065599 3300060344 Bacteria 780
1011 Ga0587111_0001153 3300060346 Bacteria 3028
1012 Ga0466962_0032893 3300061719 Bacteria 2481
1013 Ga0466962_0091908 3300061719 Bacteria 1454
1014 2511250064 2511231003 Bacteria 5606035
1015 2511383608 2511231026 Bacteria 5225445
1016 2521557364 2521172590 Bacteria 5047645
1017 2550693247 2548876994 Bacteria 4904866
1018 2553005285 2551306416 Bacteria 6152985
1019 2643791370 2643221554 Bacteria 6603920
1020 2643800212 2643221556 Bacteria 7251154
1021 2644027726 2643221603 Bacteria 6147767
1022 2644215594 2643221638 Bacteria 6579467
1023 2644251577 2643221645 Bacteria 7207331
1024 2644358246 2643221664 Bacteria 7272945
1025 2644472006 2643221684 Bacteria 7145183
1026 2738742420 2738541280 Bacteria 6630198
1027 2738845373 2738541300 Bacteria 6675882
1028 2739276426 2738543018 Bacteria 6718814
1029 2739345470 2738543030 Bacteria 6719714
1030 2765568487 2765235838 Bacteria 5445269
1031 2808981228 2808606386 Bacteria 4471946
1032 2809131718 2808606415 Bacteria 4576710
1033 2809142462 2808606418 Bacteria 6724496
1034 2809151470 2808606419 Bacteria 4576925
1035 2819543187 2818991436 Bacteria 5376622
1036 2819592044 2818991445 Bacteria 4955017
1037 2819617647 2818991449 Bacteria 5518009
1038 2821133472 2821131069 Bacteria 6108407
1039 2839096648 2839094727 Bacteria 5534556
1040 2852620954 2852618963 Bacteria 4577824
1041 2884813179 2884811622 Bacteria 5552861
1042 2884840539 2884836552 Bacteria 5219991
1043 2884855796 2884852848 Bacteria 5221161
1044 2896157279 2896154374 Bacteria 5221518
1045 2904439898 2904439833 Bacteria 5931679
1046 2904531153 2904530477 Bacteria 5876334
1047 2904587200 2904584206 Bacteria 6028872
1048 2904592766 2904589729 Bacteria 6113573
1049 2904604452 2904601388 Bacteria 5884906
1050 2919050215 2919046199 Bacteria 5567169
1051 2919082273 2919079590 Bacteria 5946433
1052 2923516029 2923510766 Bacteria 5926163
1053 2928133217 2928130867 Bacteria 5467269
1054 8047674766 8047673197 Bacteria 7395230
1055 Ga0495588_0014347
1056 JGI25155J39150_1000363
1057 JGI25155J39150_1000557
1058 JGI25156J39149_1000170
1059 JGI25156J39149_1001095
1060 JGI25162J39368_1000026
1061 JGI25162J39368_1010038
1062 JGI25154J39366_1000351
1063 JGI25154J39366_1000415
1064 JGI25157J39369_1000170
1065 JGI25157J39369_1000605
1066 JGI25159J45721_1004210
1067 JGI25159J45721_1008279
1068 JGI25165J46597_1000031
1069 JGI25161J50226_1001131
1070 Ga0007417J51691_1071950
1071 Ga0007416J51690_1059972
1072 Ga0032354_1079230
1073 Ga0055538_1000018
1074 Ga0055539_1000023
1075 Ga0055533_1000031
1076 Ga0055532_1000017
1077 Ga0055525_1000029
1078 Ga0055525_1000039
1079 Ga0055542_1021560
1080 Ga0055526_1000068
1081 Ga0055526_1001163
1082 Ga0055526_1005093
1083 Ga0055526_1007187
1084 Ga0055537_1000678
1085 Ga0055524_1000021
1086 Ga0055524_1003016
1087 Ga0055524_1005587
1088 Ga0055524_1013711
1089 Ga0055534_1000195
1090 Ga0055534_1004625
1091 Ga0055528_1000368
1092 Ga0055530_10003380
1093 Ga0055541_1000016
1094 Ga0055543_1001470
1095 Ga0065165_1004144
1096 Ga0065165_1046881
1097 Ga0070658_10447686
1098 Ga0070670_100000017
1099 Ga0070670_100008239
1100 Ga0070666_10001017
1101 Ga0070666_10403118
1102 Ga0070682_100516816
1103 Ga0070660_100000420
1104 Ga0070660_100018151
1105 Ga0070660_100081746
1106 Ga0070660_100422141
1107 Ga0070689_100111630
1108 Ga0070661_100098624
1109 Ga0070661_100127414
1110 Ga0070668_100007166
1111 Ga0070669_100028281
1112 Ga0070669_100039493
1113 Ga0070675_100029487
1114 Ga0070671_100000173
1115 Ga0070671_100099885
1116 Ga0070673_100010734
1117 Ga0070688_100003318
1118 Ga0070688_100019613
1119 Ga0070659_100115125
1120 Ga0070659_100117647
1121 Ga0070659_100170659
1122 Ga0070667_100001097
1123 Ga0070667_100003801
1124 Ga0070663_100390729
1125 Ga0070678_100004615
1126 Ga0068867_100003865
1127 Ga0070685_10000026
1128 Ga0070685_10172828
1129 Ga0070665_100285816
1130 Ga0068855_100001073
1131 Ga0068855_100018683
1132 Ga0068855_100206715
1133 Ga0068855_100544190
1134 Ga0070664_100029568
1135 Ga0070664_100057458
1136 Ga0070664_100100244
1137 Ga0068857_100708483
1138 Ga0068854_100006965
1139 Ga0068856_100506920
1140 Ga0068856_100833244
1141 Ga0068852_100220358
1142 Ga0068852_100574624
1143 Ga0068859_100317621
1144 Ga0068864_100000029
1145 Ga0068861_100127381
1146 Ga0068851_10336586
1147 Ga0068863_100600276
1148 Ga0068858_100133592
1149 Ga0068860_100000228
1150 Ga0068860_101144895
1151 Ga0068862_100069792
1152 Ga0068862_100089363
1153 Ga0075365_10197172
1154 Ga0075364_10446427
1155 Ga0075367_10558457
1156 Ga0075366_10026204
1157 Ga0097621_100441709
1158 Ga0068871_100939794
1159 Ga0097620_100317629
1160 Ga0079104_1008344
1161 Ga0099826_10000041
1162 Ga0105251_10236994
1163 Ga0105240_10009083
1164 Ga0105240_10011970
1165 Ga0105240_10020783
1166 Ga0105241_10016300
1167 Ga0105248_10006207
1168 Ga0105237_10135525
1169 Ga0105237_10259678
1170 Ga0105238_10000065
1171 Ga0105238_10150406
1172 Ga0105238_10233962
1173 Ga0105238_10262147
1174 Ga0105249_10901723
1175 Ga0105239_10009136
1176 Ga0105239_10457761
1177 Ga0105239_11353967
1178 Ga0157373_10037009
1179 Ga0157371_10000013
1180 Ga0157371_10374609
1181 Ga0157374_10014078
1182 Ga0157378_10351285
1183 Ga0157378_10667619
1184 Ga0163162_10003303
1185 Ga0163162_10609494
1186 Ga0163163_10423409
1187 Ga0157380_10007300
1188 Ga0182008_10046094
1189 Ga0182008_10057555
1190 Ga0157379_10015472
1191 Ga0157379_10637077
1192 Ga0182006_1016620
1193 Ga0182006_1029100
1194 Ga0182006_1050588
1195 Ga0182006_1174230
1196 Ga0182007_10031167
1197 Ga0182007_10115956
1198 Ga0182005_1003156
1199 Ga0163161_10032386
1200 Ga0213872_10000242
1201 Ga0213872_10000443
1202 Ga0213872_10001513
1203 Ga0213872_10001692
1204 Ga0213872_10019294
1205 Ga0213872_10019678
1206 Ga0213872_10044898
1207 Ga0213872_10091690
1208 Ga0213872_10108111
1209 Ga0213872_10156063
1210 Ga0213876_10076148
1211 Ga0209435_100015
1212 Ga0209435_100161
1213 Ga0209760_100622
1214 Ga0209436_101543
1215 Ga0209784_100027
1216 Ga0209566_100027
1217 Ga0209674_100044
1218 Ga0209672_102164
1219 Ga0209147_100004
1220 Ga0209563_100003
1221 Ga0209563_100048
1222 Ga0207427_100643
1223 Ga0209437_100045
1224 Ga0209437_100055
1225 Ga0209437_108693
1226 Ga0209437_110183
1227 Ga0209258_100226
1228 Ga0209646_1000020
1229 Ga0209646_1000040
1230 Ga0209646_1000077
1231 Ga0209026_1000034
1232 Ga0209026_1009492
1233 Ga0209026_1016102
1234 Ga0209677_100028
1235 Ga0209148_1001819
1236 Ga0209759_1000049
1237 Ga0209759_1000357
1238 Ga0209233_1000070
1239 Ga0209565_1000015
1240 Ga0209565_1001939
1241 Ga0209455_1000169
1242 Ga0209455_1008089
1243 Ga0209673_1000394
1244 Ga0209130_1001054
1245 Ga0209675_1000012
1246 Ga0209675_1001711
1247 Ga0209564_1000016
1248 Ga0209564_1000071
1249 Ga0209564_1000072
1250 Ga0209564_1028688
1251 Ga0209050_1000240
1252 Ga0209256_1000044
1253 Ga0209256_1000076
1254 Ga0209256_1003100
1255 Ga0207426_1054078
1256 Ga0207680_10014776
1257 Ga0207705_10017557
1258 Ga0207654_10004697
1259 Ga0207695_10001341
1260 Ga0207695_10005745
1261 Ga0207695_10438637
1262 Ga0207671_10037277
1263 Ga0207671_10307253
1264 Ga0207657_10001145
1265 Ga0207657_10024222
1266 Ga0207657_10034425
1267 Ga0207657_10134734
1268 Ga0207649_10026917
1269 Ga0207681_10022277
1270 Ga0207681_10070592
1271 Ga0207694_10001114
1272 Ga0207694_10189850
1273 Ga0207650_10000003
1274 Ga0207650_10004390
1275 Ga0207644_10004443
1276 Ga0207690_10084366
1277 Ga0207690_10191480
1278 Ga0207690_10819946
1279 Ga0207706_10336169
1280 Ga0207686_10187296
1281 Ga0207709_10112420
1282 Ga0207711_10000472
1283 Ga0207679_10019205
1284 Ga0207679_10248449
1285 Ga0207679_10267272
1286 Ga0207667_10000078
1287 Ga0207667_10023739
1288 Ga0207667_10041450
1289 Ga0207667_10217165
1290 Ga0207667_10297414
1291 Ga0207712_10135816
1292 Ga0207668_10007151
1293 Ga0207668_10118956
1294 Ga0207640_10055935
1295 Ga0207658_10000012
1296 Ga0207703_10130918
1297 Ga0207678_10312327
1298 Ga0207678_10912544
1299 Ga0207702_10478919
1300 Ga0207702_10885972
1301 Ga0207702_11225745
1302 Ga0207641_10025128
1303 Ga0207648_10076849
1304 Ga0207676_10000003
1305 Ga0207674_10349182
1306 Ga0207674_10350919
1307 Ga0207698_10158976
1308 Ga0209282_1000001
1309 Ga0268266_10032903
1310 Ga0268265_10002832
1311 Ga0268265_10048589
1312 Ga0268264_10000009
1313 Ga0268264_10099773
1314 Ga0307511_10008326
1315 Ga0316180_1021737
1316 Ga0316183_1190372
1317 Ga0265331_10064063
1318 Ga0265327_10090693
1319 Ga0265327_10165282
1320 Ga0307509_10270648
1321 Ga0307408_100000239
1322 Ga0307408_100224828
1323 Ga0307416_100005633
1324 Ga0307414_10788244
1325 Ga0316583_10009603
1326 Ga0373931_0114275
1327 Ga0395899_0000128
1328 Ga0395899_0000753
1329 Ga0395899_0006694
1330 Ga0395899_0010304
1331 Ga0395899_0010704
1332 Ga0395899_0012339
1333 Ga0395899_0013728
1334 Ga0395899_0055314
1335 Ga0395899_0293240
1336 Ga0395900_0000123
1337 Ga0395900_0007904
1338 Ga0395900_0008621
1339 Ga0395900_0009260
1340 Ga0395900_0010088
1341 Ga0395900_0021826
1342 Ga0395900_0035310
1343 Ga0395900_0073035
1344 Ga0395900_0116934
1345 Ga0395900_0140769
1346 Ga0395900_0209971
1347 Ga0395900_0287131
1348 Ga0395900_0323735
1349 Ga0395900_0328620
1350 Ga0395898_0004536
1351 Ga0395898_0075038
1352 Ga0395898_0109879
1353 Ga0395898_0125841
1354 Ga0395898_0257386
1355 Ga0395898_0383923
1356 Ga0395898_0517499
1357 Ga0395898_0628288
1358 Ga0395905_0000905
1359 Ga0395905_0001709
1360 Ga0395905_0012941
1361 Ga0395905_0013998
1362 Ga0395905_0020397
1363 Ga0395905_0042482
1364 Ga0395905_0078281
1365 Ga0395905_0099213
1366 Ga0395905_0128099
1367 Ga0395905_0152274
1368 Ga0395905_0310643
1369 Ga0395905_0380827
1370 Ga0395905_0392670
1371 Ga0395905_0503627
1372 Ga0395905_0623628
1373 Ga0395901_0000411
1374 Ga0395901_0001908
1375 Ga0395901_0021000
1376 Ga0395901_0023907
1377 Ga0395901_0278987
1378 Ga0395901_0346430
1379 Ga0395901_0355927
1380 Ga0395901_0504377
1381 Ga0395901_0796251
1382 Ga0436365_1765823
1383 Ga0436361_0014452
1384 Ga0436361_0032641
1385 Ga0436361_0149158
1386 Ga0436361_0161443
1387 Ga0436361_0275924
1388 Ga0436361_0458162
1389 Ga0436361_0568983
1390 Ga0436361_0632651
1391 Ga0436361_0746087
1392 Ga0436361_0830100
1393 Ga0436361_0938544
1394 Ga0436361_0973589
1395 Ga0436361_1043948
1396 Ga0436362_0115419
1397 Ga0439448_0010043
1398 Ga0439448_0123959
1399 Ga0439449_0013722
1400 Ga0439450_010428
1401 Ga0439450_018780
1402 Ga0439455_0106565
1403 Ga0450897_013149
1404 Ga0450904_000276
1405 Ga0439458_0022881
1406 Ga0451577_0625920
1407 Ga0466969_0038118
1408 Ga0466969_0080543
1409 Ga0466972_0000087
1410 Ga0466972_0001100
1411 Ga0466972_0006991
1412 Ga0466972_0097290
1413 Ga0466965_0002700
1414 Ga0466965_0010006
1415 Ga0466965_0011686
1416 Ga0466965_0065720
1417 Ga0466965_0107579
1418 Ga0466966_0011821
1419 Ga0466966_0013678
1420 Ga0466966_0068924
1421 Ga0466966_0082220
1422 Ga0466961_0159699
1423 Ga0466964_0000256
1424 Ga0466964_0199537
1425 Ga0466964_0206904
1426 Ga0453684_0000102
1427 Ga0466971_0017407
1428 Ga0466968_0001835
1429 Ga0466968_0037123
1430 Ga0466968_0117279
1431 Ga0466970_0016339
1432 Ga0466957_0009721
1433 Ga0466959_0009557
1434 Ga0466959_0011644
1435 Ga0466959_0052704
1436 Ga0466959_0054139
1437 Ga0466959_0586236
1438 Ga0451576_0000171
1439 Ga0451576_0000386
1440 Ga0451576_0080204
1441 Ga0451576_0724582
1442 Ga0466958_0275718
1443 Ga0466958_0396809
1444 Ga0466967_0005324
1445 Ga0495617_000034
1446 Ga0495617_002482
1447 Ga0495617_002980
1448 Ga0495617_008361
1449 Ga0495627_000876
1450 Ga0495627_024085
1451 Ga0495592_0003280
1452 Ga0495592_0405274
1453 Ga0495603_0033409
1454 Ga0495603_0044124
1455 Ga0495590_0000027
1456 Ga0495590_0000257
1457 Ga0495590_0006267
1458 Ga0495590_0028084
1459 Ga0495590_0033182
1460 Ga0495590_0067583
1461 Ga0495590_0085440
1462 Ga0495591_000272
1463 Ga0495629_0014017
1464 Ga0495638_0000098
1465 Ga0495638_0045252
1466 Ga0495638_0050498
1467 Ga0495651_0015119
1468 Ga0495651_0058856
1469 Ga0495653_0002089
1470 Ga0495653_0144561
1471 Ga0495653_0169254
1472 Ga0495650_0000011
1473 Ga0495650_0002150
1474 Ga0495580_0030809
1475 Ga0495580_0445460
1476 Ga0495582_0004649
1477 Ga0495582_0017936
1478 Ga0495582_0114750
1479 Ga0495605_0000029
1480 Ga0495605_0000042
1481 Ga0495605_0000151
1482 Ga0495605_0006348
1483 Ga0495605_0007689
1484 Ga0495605_0010229
1485 Ga0495605_0024677
1486 Ga0495605_0035098
1487 Ga0495605_0044828
1488 Ga0495605_0132566
1489 Ga0495639_0309380
1490 Ga0495584_0000007
1491 Ga0495584_0000122
1492 Ga0495584_0000506
1493 Ga0495584_0002007
1494 Ga0495584_0002049
1495 Ga0495584_0003276
1496 Ga0495584_0005376
1497 Ga0495584_0005715
1498 Ga0495584_0006099
1499 Ga0495584_0010896
1500 Ga0495584_0021540
1501 Ga0495584_0069350
1502 Ga0495584_0110508
1503 Ga0495584_0163756
1504 Ga0495584_0173545
1505 Ga0495584_0204880
1506 Ga0495585_0000115
1507 Ga0495585_0000421
1508 Ga0495585_0002934
1509 Ga0495585_0003505
1510 Ga0495585_0010560
1511 Ga0495585_0017306
1512 Ga0495585_0018451
1513 Ga0495585_0020952
1514 Ga0495585_0024454
1515 Ga0495585_0029130
1516 Ga0495585_0040655
1517 Ga0495585_0062272
1518 Ga0495585_0098278
1519 Ga0495585_0107344
1520 Ga0495594_0003496
1521 Ga0495594_0010511
1522 Ga0495594_0010807
1523 Ga0495594_0013150
1524 Ga0495594_0028672
1525 Ga0495596_0000474
1526 Ga0495596_0000530
1527 Ga0495596_0002008
1528 Ga0495596_0002300
1529 Ga0495596_0004690
1530 Ga0495596_0014436
1531 Ga0495596_0019973
1532 Ga0495596_0028741
1533 Ga0495607_0001671
1534 Ga0495607_0001966
1535 Ga0495607_0002476
1536 Ga0495607_0002735
1537 Ga0495607_0004292
1538 Ga0495607_0017561
1539 Ga0495607_0020165
1540 Ga0495607_0025435
1541 Ga0495607_0028377
1542 Ga0495607_0051721
1543 Ga0495607_0071761
1544 Ga0495607_0077910
1545 Ga0495607_0083439
1546 Ga0495607_0225317
1547 Ga0495583_0000348
1548 Ga0495583_0000472
1549 Ga0495583_0000569
1550 Ga0495583_0001444
1551 Ga0495583_0015121
1552 Ga0495583_0033337
1553 Ga0495583_0034886
1554 Ga0495583_0049226
1555 Ga0495583_0110774
1556 Ga0495583_0194134
1557 Ga0495606_0000084
1558 Ga0495606_0000652
1559 Ga0495606_0000787
1560 Ga0495606_0001481
1561 Ga0495606_0012677
1562 Ga0495606_0021021
1563 Ga0495606_0029545
1564 Ga0495606_0031347
1565 Ga0495606_0034767
1566 Ga0495606_0039821
1567 Ga0495606_0047069
1568 Ga0495606_0106051
1569 Ga0495606_0349720
1570 Ga0495608_0001512
1571 Ga0495608_0013677
1572 Ga0495610_0000473
1573 Ga0495610_0148582
1574 Ga0495616_0001479
1575 Ga0495616_0001547
1576 Ga0495616_0004099
1577 Ga0495616_0007026
1578 Ga0495616_0008239
1579 Ga0495616_0010806
1580 Ga0495616_0010992
1581 Ga0495616_0021408
1582 Ga0495616_0025599
1583 Ga0495616_0030670
1584 Ga0495616_0033463
1585 Ga0495616_0042972
1586 Ga0495616_0044363
1587 Ga0495616_0057484
1588 Ga0495616_0094410
1589 Ga0495620_0003439
1590 Ga0495628_0004339
1591 Ga0495628_0018273
1592 Ga0495628_0305552
1593 Ga0495630_0009137
1594 Ga0495630_0332897
1595 Ga0495631_0000550
1596 Ga0495631_0000810
1597 Ga0495631_0001888
1598 Ga0495631_0002771
1599 Ga0495631_0005099
1600 Ga0495631_0006258
1601 Ga0495631_0015840
1602 Ga0495631_0017560
1603 Ga0495631_0272480
1604 Ga0495632_0000852
1605 Ga0495632_0000903
1606 Ga0495632_0001985
1607 Ga0495632_0007957
1608 Ga0495632_0042567
1609 Ga0495637_0000013
1610 Ga0495637_0008688
1611 Ga0495637_0021577
1612 Ga0495643_0000200
1613 Ga0495643_0000551
1614 Ga0495643_0002412
1615 Ga0495643_0004464
1616 Ga0495643_0012215
1617 Ga0495643_0024119
1618 Ga0495643_0025001
1619 Ga0495643_0071122
1620 Ga0495643_0072128
1621 Ga0495644_0002518
1622 Ga0495644_0004268
1623 Ga0495644_0004891
1624 Ga0495644_0005339
1625 Ga0495644_0011582
1626 Ga0495644_0015732
1627 Ga0495644_0017413
1628 Ga0495644_0020348
1629 Ga0495644_0036772
1630 Ga0495648_0000112
1631 Ga0495648_0000169
1632 Ga0495648_0001096
1633 Ga0495648_0002536
1634 Ga0495648_0007990
1635 Ga0495648_0009310
1636 Ga0495648_0027171
1637 Ga0495648_0034097
1638 Ga0495648_0051763
1639 Ga0495648_0054917
1640 Ga0495648_0177240
1641 Ga0495648_0313657
1642 Ga0495663_0004796
1643 Ga0495663_0032141
1644 Ga0495666_0015313
1645 Ga0495666_0049841
1646 Ga0495642_0000050
1647 Ga0495642_0001068
1648 Ga0495642_0001340
1649 Ga0495642_0001809
1650 Ga0495642_0003687
1651 Ga0495642_0004398
1652 Ga0495642_0008082
1653 Ga0495642_0021157
1654 Ga0495642_0029202
1655 Ga0495642_0056547
1656 Ga0495642_0134247
1657 Ga0495642_0186853
1658 Ga0495652_0005056
1659 Ga0495652_0016097
1660 Ga0495652_0019388
1661 Ga0495652_0049462
1662 Ga0495654_0004305
1663 Ga0495654_0006380
1664 Ga0495654_0008593
1665 Ga0495654_0010005
1666 Ga0495654_0044679
1667 Ga0495665_0005554
1668 Ga0495665_0035779
1669 Ga0495665_0102901
1670 Ga0495665_0103170
1671 Ga0495586_0018982
1672 Ga0495586_0019447
1673 Ga0495587_0008756
1674 Ga0495609_0000022
1675 Ga0495609_0000163
1676 Ga0495609_0001355
1677 Ga0495609_0002267
1678 Ga0495609_0003271
1679 Ga0495609_0026941
1680 Ga0495609_0031532
1681 Ga0495609_0047144
1682 Ga0495609_0080225
1683 Ga0495597_0000064
1684 Ga0495597_0000266
1685 Ga0495597_0000566
1686 Ga0495597_0001407
1687 Ga0495597_0002770
1688 Ga0495597_0006826
1689 Ga0495597_0006959
1690 Ga0495597_0013020
1691 Ga0495597_0074237
1692 Ga0495597_0240246
1693 Ga0495645_0042584
1694 Ga0495645_0073481
1695 Ga0495622_0000311
1696 Ga0495622_0000707
1697 Ga0495622_0007277
1698 Ga0495622_0039180
1699 Ga0495622_0039684
1700 Ga0495622_0085890
1701 Ga0495622_0228631
1702 Ga0495633_0001165
1703 Ga0495633_0001850
1704 Ga0495633_0010505
1705 Ga0495633_0016664
1706 Ga0495633_0018317
1707 Ga0495633_0020708
1708 Ga0495633_0024214
1709 Ga0495633_0047924
1710 Ga0495633_0086336
1711 Ga0495633_0123951
1712 Ga0495633_0230476
1713 Ga0495656_0001658
1714 Ga0495656_0002958
1715 Ga0495656_0006533
1716 Ga0495656_0026222
1717 Ga0495656_0100038
1718 Ga0495656_0119591
1719 Ga0495668_0001322
1720 Ga0495668_0001809
1721 Ga0495668_0002020
1722 Ga0495668_0006891
1723 Ga0495668_0011176
1724 Ga0495668_0013456
1725 Ga0495668_0029492
1726 Ga0495668_0057478
1727 Ga0495668_0061174
1728 Ga0495668_0093914
1729 Ga0495668_0395699
1730 Ga0495634_0015301
1731 Ga0495611_0000515
1732 Ga0495611_0003505
1733 Ga0495611_0003835
1734 Ga0495611_0007685
1735 Ga0495611_0009941
1736 Ga0495611_0010893
1737 Ga0495611_0015786
1738 Ga0495611_0016265
1739 Ga0495611_0055477
1740 Ga0495611_0056545
1741 Ga0495611_0098122
1742 Ga0495625_0000810
1743 Ga0495625_0002543
1744 Ga0495625_0005310
1745 Ga0495625_0011709
1746 Ga0495625_0013813
1747 Ga0495625_0020304
1748 Ga0495625_0061488
1749 Ga0495625_0203186
1750 Ga0495659_0000019
1751 Ga0495659_0000167
1752 Ga0495659_0001683
1753 Ga0495659_0009447
1754 Ga0495659_0020073
1755 Ga0495661_0000151
1756 Ga0495661_0000590
1757 Ga0495661_0003517
1758 Ga0495661_0007238
1759 Ga0495661_0007385
1760 Ga0495661_0012488
1761 Ga0495661_0020506
1762 Ga0495661_0023945
1763 Ga0495661_0028727
1764 Ga0495661_0039994
1765 Ga0495661_0043396
1766 Ga0495661_0047504
1767 Ga0495661_0063816
1768 Ga0495661_0165231
1769 Ga0495661_0166458
1770 Ga0495661_0213394
1771 Ga0495661_0255821
1772 Ga0495588_0000086
1773 Ga0495588_0011973
1774 Ga0495588_0017075
1775 Ga0495588_0032962
1776 Ga0495588_0034728
1777 Ga0495588_0058010
1778 Ga0495588_0116559
1779 Ga0495657_0058805
1780 Ga0495599_0003514
1781 Ga0495623_0008207
1782 Ga0495623_0011302
1783 Ga0495623_0035632
1784 Ga0495623_0041958
1785 Ga0495623_0048369
1786 Ga0495646_0001555
1787 Ga0495669_0000018
1788 Ga0495669_0026346
1789 Ga0495669_0093968
1790 Ga0495613_0089487
1791 Ga0495624_0033919
1792 Ga0495624_0036132
1793 Ga0495624_0292209
1794 Ga0495670_0000143
1795 Ga0495670_0001120
1796 Ga0495670_0010421
1797 Ga0495670_0013539
1798 Ga0495670_0035185
1799 Ga0495670_0079714
1800 Ga0495670_0081229
1801 Ga0495670_0247697
1802 Ga0495671_0000658
1803 Ga0495671_0001049
1804 Ga0495671_0019545
1805 Ga0495671_0031072
1806 Ga0495671_0127303
1807 Ga0495671_0154071
1808 Ga0495649_0003442
1809 Ga0495649_0009418
1810 Ga0495649_0015222
1811 Ga0495649_0027732
1812 Ga0495649_0048732
1813 Ga0495589_0000017
1814 Ga0495589_0000513
1815 Ga0495589_0001742
1816 Ga0495589_0004248
1817 Ga0495589_0011131
1818 Ga0495589_0013061
1819 Ga0495589_0020691
1820 Ga0495589_0022368
1821 Ga0495589_0043009
1822 Ga0495589_0082237
1823 Ga0495600_0000834
1824 Ga0495600_0006403
1825 Ga0495600_0131479
1826 Ga0495660_0000067
1827 Ga0495660_0002349
1828 Ga0495660_0004163
1829 Ga0495660_0007858
1830 Ga0495660_0014127
1831 Ga0495660_0047272
1832 Ga0495660_0059026
1833 Ga0495660_0063365
1834 Ga0495660_0128657
1835 Ga0495660_0166579
1836 Ga0495581_0009510
1837 Ga0495581_0018889
1838 Ga0495581_0055668
1839 Ga0495604_0004591
1840 Ga0495604_0034285
1841 Ga0495604_0246697
1842 Ga0495604_0437459
1843 Ga0495636_0000388
1844 Ga0495636_0003301
1845 Ga0495636_0004667
1846 Ga0495636_0009037
1847 Ga0495636_0023781
1848 Ga0495636_0061353
1849 Ga0495636_0135464
1850 Ga0495674_0221331
1851 Ga0495672_0000067
1852 Ga0495672_0000343
1853 Ga0495672_0000718
1854 Ga0495672_0001478
1855 Ga0495672_0003293
1856 Ga0495672_0004198
1857 Ga0495672_0034084
1858 Ga0495672_0052482
1859 Ga0495672_0128740
1860 Ga0495676_0000067
1861 Ga0495676_0028953
1862 Ga0495676_0461324
1863 Ga0495683_0000083
1864 Ga0495683_0000348
1865 Ga0495683_0002803
1866 Ga0495683_0006314
1867 Ga0495683_0019894
1868 Ga0495683_0022607
1869 Ga0495683_0057907
1870 Ga0495683_0078187
1871 Ga0495683_0079896
1872 Ga0495687_000033
1873 Ga0495687_000126
1874 Ga0495687_000252
1875 Ga0495687_000640
1876 Ga0495687_008102
1877 Ga0495687_010751
1878 Ga0495687_010893
1879 Ga0495687_022520
1880 Ga0495675_0003787
1881 Ga0495675_0030000
1882 Ga0495675_0088516
1883 Ga0495677_0000002
1884 Ga0495677_0005091
1885 Ga0495677_0008034
1886 Ga0495677_0008164
1887 Ga0495677_0014812
1888 Ga0495677_0021668
1889 Ga0495677_0032123
1890 Ga0495677_0044837
1891 Ga0495677_0051623
1892 Ga0495677_0098020
1893 Ga0495677_0128864
1894 Ga0495679_008082
1895 Ga0495679_008137
1896 Ga0495679_019799
1897 Ga0495679_034537
1898 Ga0495679_074564
1899 Ga0495685_000053
1900 Ga0495685_000183
1901 Ga0495685_001317
1902 Ga0495685_004689
1903 Ga0495685_016533
1904 Ga0495673_0000265
1905 Ga0495681_0000321
1906 Ga0495681_0007275
1907 Ga0495681_0016273
1908 Ga0495681_0030372
1909 Ga0495681_0032989
1910 Ga0495681_0046396
1911 Ga0495686_0000628
1912 Ga0495686_0033337
1913 Ga0495686_0040123
1914 Ga0495686_0091644
1915 Ga0495686_0129523
1916 Ga0495686_0181975
1917 Ga0495593_0054376
1918 Ga0495602_0024798
1919 Ga0495602_0104784
1920 Ga0495602_0159563
1921 Ga0495614_0001110
1922 Ga0495614_0018070
1923 Ga0495615_0001150
1924 Ga0495615_0029638
1925 Ga0495626_0000097
1926 Ga0495626_0000209
1927 Ga0495626_0000258
1928 Ga0495626_0003284
1929 Ga0495626_0007634
1930 Ga0495626_0011560
1931 Ga0495626_0016093
1932 Ga0495626_0018518
1933 Ga0495626_0021333
1934 Ga0495626_0026399
1935 Ga0495626_0044605
1936 Ga0495626_0049911
1937 Ga0495626_0059885
1938 Ga0495626_0145896
1939 Ga0496100_0052012
1940 Ga0496100_0159307
1941 Ga0496101_0044781
1942 Ga0496101_0092574
1943 Ga0496102_0000313
1944 Ga0496102_0000487
1945 Ga0496102_0055639
1946 Ga0496102_0420493
1947 Ga0496103_0091804
1948 Ga0496103_0231148
1949 Ga0496103_0422697
1950 Ga0496103_0443694
1951 Ga0496103_0450071
1952 Ga0496104_0848884
1953 Ga0496106_0006127
1954 Ga0496107_0075821
1955 Ga0496107_0293454
1956 Ga0496108_0217414
1957 Ga0496108_0711016
1958 Ga0496109_0068134
1959 Ga0496109_0229028
1960 Ga0496110_0000024
1961 Ga0496110_0104634
1962 Ga0496110_0570064
1963 Ga0496111_0635735
1964 Ga0496112_0367515
1965 Ga0496112_0755078
1966 Ga0496113_0019700
1967 Ga0496114_0047812
1968 Ga0496114_0067969
1969 Ga0496114_0478533
1970 Ga0496115_0026659
1971 Ga0496115_0056234
1972 Ga0496115_0082225
1973 Ga0496115_0215720
1974 Ga0496115_0555710
1975 Ga0496116_0026481
1976 Ga0496118_0131119
1977 Ga0496121_0095442
1978 Ga0496121_0154136
1979 Ga0496121_0514578
1980 Ga0496122_0000439
1981 Ga0496122_0002153
1982 Ga0496122_0004757
1983 Ga0496122_0011837
1984 Ga0496123_0000487
1985 Ga0496123_0003789
1986 Ga0496123_0022480
1987 Ga0496124_0016901
1988 Ga0496124_0021248
1989 Ga0496124_0023141
1990 Ga0496124_0045759
1991 Ga0496124_0076458
1992 Ga0496124_0303252
1993 Ga0496125_0001079
1994 Ga0496125_0003984
1995 Ga0496125_0099527
1996 Ga0496125_0182288
1997 Ga0496125_0246345
1998 Ga0496126_0060200
1999 Ga0496126_0224826
2000 Ga0501308_013232
2001 Ga0501304_003196
2002 Ga0501305_039264
2003 Ga0495678_000131
2004 Ga0495678_000355
2005 Ga0495678_001074
2006 Ga0495678_003680
2007 Ga0495678_004358
2008 Ga0495678_015158
2009 Ga0495678_033475
2010 Ga0495678_193161
2011 Ga0495682_0000779
2012 Ga0495682_0001850
2013 Ga0495682_0002874
2014 Ga0495682_0004757
2015 Ga0501300_033155
2016 Ga0501207_006845
2017 Ga0501280_000079
2018 Ga0501282_010548
2019 Ga0501035_0005808
2020 nmdc:mga00v17_230903_c1
2021 nmdc:mga0yw44_175167_c1
2022 Ga0495601_0021365
2023 Ga0495601_0323983
2024 Ga0495655_0154964
2025 Ga0500583_0004765
2026 Ga0500650_0000077
2027 Ga0500594_0017715
2028 Ga0500614_159553
2029 Ga0500618_000301
2030 Ga0500618_000821
2031 Ga0500564_049825
2032 Ga0500574_000358
2033 Ga0500622_0279307
2034 Ga0500634_0016724
2035 Ga0500661_019973
2036 Ga0587066_023808
2037 Ga0587066_089812
2038 Ga0587070_012124
2039 Ga0587077_006576
2040 Ga0587077_025555
2041 Ga0587080_010270
2042 Ga0587083_0023065
2043 Ga0587085_003884
2044 Ga0587086_011885
2045 Ga0587090_001134
2046 Ga0587090_013222
2047 Ga0587091_019150
2048 Ga0587091_019940
2049 Ga0587106_021228
2050 Ga0587101_054991
2051 Ga0587109_014206
2052 Ga0587117_016597
2053 Ga0587062_011715
2054 Ga0587067_015649
2055 Ga0587067_020457
2056 Ga0587068_016177
2057 Ga0587069_016163
2058 Ga0587069_022812
2059 Ga0587072_005287
2060 Ga0587072_025780
2061 Ga0587078_011383
2062 Ga0587079_043002
2063 Ga0587105_003927
2064 Ga0587071_065599
2065 Ga0587111_0001153
2066 Ga0466962_0032893
2067 Ga0466962_0091908
2068 2511250064
2069 2511383608
2070 2521557364
2071 2550693247
2072 2553005285
2073 2643791370
2074 2643800212
2075 2644027726
2076 2644215594
2077 2644251577
2078 2644358246
2079 2644472006
2080 2738742420
2081 2738845373
2082 2739276426
2083 2739345470
2084 2765568487
2085 2808981228
2086 2809131718
2087 2809142462
2088 2809151470
2089 2819543187
2090 2819592044
2091 2819617647
2092 2821133472
2093 2839096648
2094 2852620954
2095 2884813179
2096 2884840539
2097 2884855796
2098 2896157279
2099 2904439898
2100 2904531153
2101 2904587200
2102 2904592766
2103 2904604452
2104 2919050215
2105 2919082273
2106 2923516029
2107 2928133217
2108 8047674766

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

53

215

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cy4-assembly1.cif.gz_B crystal structure of an oligoribonuclease from acinetobacter baumannii 0.9744 20 193
3tr8-assembly1.cif.gz_B structure of an oligoribonuclease (orn) from coxiella burnetii 0.9732 18 196
5cy4-assembly2.cif.gz_C crystal structure of an oligoribonuclease from acinetobacter baumannii 0.973 20 193
6n6h-assembly1.cif.gz_A vibrio cholerae oligoribonuclease bound to pcpu 0.9726 18 196
5cy4-assembly3.cif.gz_E crystal structure of an oligoribonuclease from acinetobacter baumannii 0.9713 20 193
ID Description Score Start End Superfamily
af_P9WIU1_1_181_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9546 19 192 3.30.420.10
af_Q556Y2_11_190_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9441 21 195 3.30.420.10
af_Q17819_4_192_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9431 21 196 3.30.420.10
af_Q6K4V8_62_244_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9364 20 196 3.30.420.10
1ytaA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9199 18 196 3.30.420.10
ID Description Score Start End GO Terms
AF-X1BLJ9-F1-model_v4 Exonuclease domain-containing protein 0.995 20 112 GO:0000175
GO:0003676
AF-A0A353PFZ1-F1-model_v4 Oligoribonuclease 0.9949 18 115 GO:0003676
GO:0004527
GO:0006259
AF-A0A3D2DDW7-F1-model_v4 deleted 0.9944 18 113
AF-U6CZQ9-F1-model_v4 Oligoribonuclease, mitochondrial 0.9895 21 113 GO:0000175
GO:0003676
GO:0005739
AF-A0A227J347-F1-model_v4 Oligoribonuclease 0.9894 19 99 GO:0000175
GO:0003676
GO:0006259

Map