F489136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 395 | 2108 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300046674|Ga0495588_0014347|Ga0495588_0014347_142_819 |
| Length | 225 |
| Sequence | LAEKRSCTLVQRASQAESATRSRFGEPSTKERIMSQETQAASATPRPNDMNLVWLDMEMTGLDPDNDRIIEVAVVVTDAELNILAEGPVFAIHQSDETLDKMDNWNKGTHGKSGLIDRVKASTVNEAQAEEQLIAFLKQWVPANKSPMCGNSICQDRRFMARGMPKLEAFFHYRNLDVSTLKELCRRWKPELASGFKKHQKHTALADIVESIEELRYYREHFIKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 70 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 157 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 175 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 176 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 177 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 178 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 179 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 303 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 313 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 314 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 315 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 322 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 325 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 329 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 330 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 331 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 356 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 357 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 358 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 359 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 360 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 361 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 362 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 363 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 364 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 365 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 366 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 367 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 368 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 369 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 370 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 371 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 372 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 373 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 374 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 375 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 376 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 377 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 378 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 379 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 380 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 381 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 382 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 383 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 384 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 385 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 386 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 387 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 388 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 389 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 390 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 391 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 392 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 393 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 394 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 395 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.69 |
| Metatranscriptomes | 3.42 |
| Isolates | 3.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.78 |
| Nodule | 0.57 |
| Rhizoplane | 3.42 |
| Rhizosphere | 81.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495588_0014347 | 3300046674 | Bacteria | 3791 |
| 2 | JGI25155J39150_1000363 | 3300002704 | Bacteria | 13840 |
| 3 | JGI25155J39150_1000557 | 3300002704 | Bacteria | 8407 |
| 4 | JGI25156J39149_1000170 | 3300002705 | Bacteria | 47634 |
| 5 | JGI25156J39149_1001095 | 3300002705 | Bacteria | 12376 |
| 6 | JGI25162J39368_1000026 | 3300002737 | Bacteria | 227710 |
| 7 | JGI25162J39368_1010038 | 3300002737 | Bacteria | 1223 |
| 8 | JGI25154J39366_1000351 | 3300002738 | Bacteria | 26227 |
| 9 | JGI25154J39366_1000415 | 3300002738 | Bacteria | 22969 |
| 10 | JGI25157J39369_1000170 | 3300002741 | Bacteria | 54809 |
| 11 | JGI25157J39369_1000605 | 3300002741 | Bacteria | 20744 |
| 12 | JGI25159J45721_1004210 | 3300002987 | Bacteria | 4850 |
| 13 | JGI25159J45721_1008279 | 3300002987 | Bacteria | 2875 |
| 14 | JGI25165J46597_1000031 | 3300003214 | Bacteria | 296858 |
| 15 | JGI25161J50226_1001131 | 3300003374 | Bacteria | 8930 |
| 16 | Ga0007417J51691_1071950 | 3300003544 | Bacteria | 1190 |
| 17 | Ga0007416J51690_1059972 | 3300003577 | Bacteria | 870 |
| 18 | Ga0032354_1079230 | 3300003693 | Bacteria | 1120 |
| 19 | Ga0055538_1000018 | 3300003751 | Bacteria | 296858 |
| 20 | Ga0055539_1000023 | 3300003752 | Bacteria | 296858 |
| 21 | Ga0055533_1000031 | 3300003756 | Bacteria | 296858 |
| 22 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 23 | Ga0055525_1000029 | 3300003759 | Bacteria | 320663 |
| 24 | Ga0055525_1000039 | 3300003759 | Bacteria | 296858 |
| 25 | Ga0055542_1021560 | 3300003762 | Bacteria | 927 |
| 26 | Ga0055526_1000068 | 3300003771 | Bacteria | 98723 |
| 27 | Ga0055526_1001163 | 3300003771 | Bacteria | 19080 |
| 28 | Ga0055526_1005093 | 3300003771 | Bacteria | 7667 |
| 29 | Ga0055526_1007187 | 3300003771 | Bacteria | 5855 |
| 30 | Ga0055537_1000678 | 3300003773 | Bacteria | 17886 |
| 31 | Ga0055524_1000021 | 3300003775 | Bacteria | 227578 |
| 32 | Ga0055524_1003016 | 3300003775 | Bacteria | 8340 |
| 33 | Ga0055524_1005587 | 3300003775 | Bacteria | 5584 |
| 34 | Ga0055524_1013711 | 3300003775 | Bacteria | 3043 |
| 35 | Ga0055534_1000195 | 3300003784 | Bacteria | 44284 |
| 36 | Ga0055534_1004625 | 3300003784 | Bacteria | 3918 |
| 37 | Ga0055528_1000368 | 3300003790 | Bacteria | 36674 |
| 38 | Ga0055530_10003380 | 3300003791 | Bacteria | 9123 |
| 39 | Ga0055541_1000016 | 3300003841 | Bacteria | 296861 |
| 40 | Ga0055543_1001470 | 3300004625 | Bacteria | 9303 |
| 41 | Ga0065165_1004144 | 3300005262 | Bacteria | 9303 |
| 42 | Ga0065165_1046881 | 3300005262 | Bacteria | 1251 |
| 43 | Ga0070658_10447686 | 3300005327 | Bacteria | 1112 |
| 44 | Ga0070670_100000017 | 3300005331 | Bacteria | 224429 |
| 45 | Ga0070670_100008239 | 3300005331 | Bacteria | 8877 |
| 46 | Ga0070666_10001017 | 3300005335 | Bacteria | 17184 |
| 47 | Ga0070666_10403118 | 3300005335 | Bacteria | 983 |
| 48 | Ga0070682_100516816 | 3300005337 | Bacteria | 928 |
| 49 | Ga0070660_100000420 | 3300005339 | Bacteria | 28168 |
| 50 | Ga0070660_100018151 | 3300005339 | Bacteria | 5135 |
| 51 | Ga0070660_100081746 | 3300005339 | Bacteria | 2536 |
| 52 | Ga0070660_100422141 | 3300005339 | Bacteria | 1104 |
| 53 | Ga0070689_100111630 | 3300005340 | Bacteria | 2175 |
| 54 | Ga0070661_100098624 | 3300005344 | Bacteria | 2170 |
| 55 | Ga0070661_100127414 | 3300005344 | Bacteria | 1910 |
| 56 | Ga0070668_100007166 | 3300005347 | Bacteria | 8265 |
| 57 | Ga0070669_100028281 | 3300005353 | Bacteria | 4037 |
| 58 | Ga0070669_100039493 | 3300005353 | Bacteria | 3430 |
| 59 | Ga0070675_100029487 | 3300005354 | Bacteria | 4426 |
| 60 | Ga0070671_100000173 | 3300005355 | Bacteria | 42660 |
| 61 | Ga0070671_100099885 | 3300005355 | Bacteria | 2434 |
| 62 | Ga0070673_100010734 | 3300005364 | Bacteria | 6213 |
| 63 | Ga0070688_100003318 | 3300005365 | Bacteria | 8251 |
| 64 | Ga0070688_100019613 | 3300005365 | Bacteria | 3920 |
| 65 | Ga0070659_100115125 | 3300005366 | Bacteria | 2173 |
| 66 | Ga0070659_100117647 | 3300005366 | Bacteria | 2149 |
| 67 | Ga0070659_100170659 | 3300005366 | Bacteria | 1782 |
| 68 | Ga0070667_100001097 | 3300005367 | Bacteria | 24823 |
| 69 | Ga0070667_100003801 | 3300005367 | Bacteria | 12845 |
| 70 | Ga0070663_100390729 | 3300005455 | Bacteria | 1135 |
| 71 | Ga0070678_100004615 | 3300005456 | Bacteria | 7827 |
| 72 | Ga0068867_100003865 | 3300005459 | Bacteria | 10535 |
| 73 | Ga0070685_10000026 | 3300005466 | Bacteria | 98490 |
| 74 | Ga0070685_10172828 | 3300005466 | Bacteria | 1386 |
| 75 | Ga0070665_100285816 | 3300005548 | Bacteria | 1651 |
| 76 | Ga0068855_100001073 | 3300005563 | Bacteria | 33944 |
| 77 | Ga0068855_100018683 | 3300005563 | Bacteria | 8336 |
| 78 | Ga0068855_100206715 | 3300005563 | Bacteria | 2208 |
| 79 | Ga0068855_100544190 | 3300005563 | Bacteria | 1257 |
| 80 | Ga0070664_100029568 | 3300005564 | Bacteria | 4568 |
| 81 | Ga0070664_100057458 | 3300005564 | Bacteria | 3307 |
| 82 | Ga0070664_100100244 | 3300005564 | Bacteria | 2518 |
| 83 | Ga0068857_100708483 | 3300005577 | Bacteria | 957 |
| 84 | Ga0068854_100006965 | 3300005578 | Bacteria | 7213 |
| 85 | Ga0068856_100506920 | 3300005614 | Bacteria | 1228 |
| 86 | Ga0068856_100833244 | 3300005614 | Bacteria | 942 |
| 87 | Ga0068852_100220358 | 3300005616 | Bacteria | 1804 |
| 88 | Ga0068852_100574624 | 3300005616 | Bacteria | 1129 |
| 89 | Ga0068859_100317621 | 3300005617 | Bacteria | 1651 |
| 90 | Ga0068864_100000029 | 3300005618 | Bacteria | 224429 |
| 91 | Ga0068861_100127381 | 3300005719 | Bacteria | 2062 |
| 92 | Ga0068851_10336586 | 3300005834 | Bacteria | 875 |
| 93 | Ga0068863_100600276 | 3300005841 | Bacteria | 1089 |
| 94 | Ga0068858_100133592 | 3300005842 | Bacteria | 2327 |
| 95 | Ga0068860_100000228 | 3300005843 | Bacteria | 86756 |
| 96 | Ga0068860_101144895 | 3300005843 | Bacteria | 798 |
| 97 | Ga0068862_100069792 | 3300005844 | Bacteria | 3033 |
| 98 | Ga0068862_100089363 | 3300005844 | Bacteria | 2681 |
| 99 | Ga0075365_10197172 | 3300006038 | Bacteria | 1410 |
| 100 | Ga0075364_10446427 | 3300006051 | Bacteria | 883 |
| 101 | Ga0075367_10558457 | 3300006178 | Bacteria | 727 |
| 102 | Ga0075366_10026204 | 3300006195 | Bacteria | 3414 |
| 103 | Ga0097621_100441709 | 3300006237 | Bacteria | 1171 |
| 104 | Ga0068871_100939794 | 3300006358 | Bacteria | 803 |
| 105 | Ga0097620_100317629 | 3300006931 | Bacteria | 1651 |
| 106 | Ga0079104_1008344 | 3300006946 | Bacteria | 3639 |
| 107 | Ga0099826_10000041 | 3300006948 | Bacteria | 96536 |
| 108 | Ga0105251_10236994 | 3300009011 | Bacteria | 822 |
| 109 | Ga0105240_10009083 | 3300009093 | Bacteria | 14111 |
| 110 | Ga0105240_10011970 | 3300009093 | Bacteria | 12023 |
| 111 | Ga0105240_10020783 | 3300009093 | Bacteria | 8745 |
| 112 | Ga0105241_10016300 | 3300009174 | Bacteria | 5446 |
| 113 | Ga0105248_10006207 | 3300009177 | Bacteria | 13098 |
| 114 | Ga0105237_10135525 | 3300009545 | Bacteria | 2457 |
| 115 | Ga0105237_10259678 | 3300009545 | Bacteria | 1740 |
| 116 | Ga0105238_10000065 | 3300009551 | Bacteria | 121196 |
| 117 | Ga0105238_10150406 | 3300009551 | Bacteria | 2303 |
| 118 | Ga0105238_10233962 | 3300009551 | Bacteria | 1814 |
| 119 | Ga0105238_10262147 | 3300009551 | Bacteria | 1708 |
| 120 | Ga0105249_10901723 | 3300009553 | Bacteria | 951 |
| 121 | Ga0105239_10009136 | 3300010375 | Bacteria | 11211 |
| 122 | Ga0105239_10457761 | 3300010375 | Bacteria | 1448 |
| 123 | Ga0105239_11353967 | 3300010375 | Bacteria | 821 |
| 124 | Ga0157373_10037009 | 3300013100 | Bacteria | 3501 |
| 125 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 126 | Ga0157371_10374609 | 3300013102 | Bacteria | 1039 |
| 127 | Ga0157374_10014078 | 3300013296 | Bacteria | 6993 |
| 128 | Ga0157378_10351285 | 3300013297 | Bacteria | 1440 |
| 129 | Ga0157378_10667619 | 3300013297 | Bacteria | 1056 |
| 130 | Ga0163162_10003303 | 3300013306 | Bacteria | 15434 |
| 131 | Ga0163162_10609494 | 3300013306 | Bacteria | 1217 |
| 132 | Ga0163163_10423409 | 3300014325 | Bacteria | 1390 |
| 133 | Ga0157380_10007300 | 3300014326 | Bacteria | 7844 |
| 134 | Ga0182008_10046094 | 3300014497 | Bacteria | 2167 |
| 135 | Ga0182008_10057555 | 3300014497 | Bacteria | 1919 |
| 136 | Ga0157379_10015472 | 3300014968 | Bacteria | 6695 |
| 137 | Ga0157379_10637077 | 3300014968 | Bacteria | 997 |
| 138 | Ga0182006_1016620 | 3300015261 | Bacteria | 3136 |
| 139 | Ga0182006_1029100 | 3300015261 | Bacteria | 2241 |
| 140 | Ga0182006_1050588 | 3300015261 | Bacteria | 1601 |
| 141 | Ga0182006_1174230 | 3300015261 | Bacteria | 719 |
| 142 | Ga0182007_10031167 | 3300015262 | Bacteria | 1818 |
| 143 | Ga0182007_10115956 | 3300015262 | Bacteria | 894 |
| 144 | Ga0182005_1003156 | 3300015265 | Bacteria | 5657 |
| 145 | Ga0163161_10032386 | 3300017792 | Bacteria | 3731 |
| 146 | Ga0213872_10000242 | 3300021361 | Bacteria | 48194 |
| 147 | Ga0213872_10000443 | 3300021361 | Bacteria | 33899 |
| 148 | Ga0213872_10001513 | 3300021361 | Bacteria | 14948 |
| 149 | Ga0213872_10001692 | 3300021361 | Bacteria | 13879 |
| 150 | Ga0213872_10019294 | 3300021361 | Bacteria | 3141 |
| 151 | Ga0213872_10019678 | 3300021361 | Bacteria | 3109 |
| 152 | Ga0213872_10044898 | 3300021361 | Bacteria | 2010 |
| 153 | Ga0213872_10091690 | 3300021361 | Bacteria | 1359 |
| 154 | Ga0213872_10108111 | 3300021361 | Bacteria | 1236 |
| 155 | Ga0213872_10156063 | 3300021361 | Bacteria | 995 |
| 156 | Ga0213876_10076148 | 3300021384 | Bacteria | 1772 |
| 157 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 158 | Ga0209435_100161 | 3300025206 | Bacteria | 21397 |
| 159 | Ga0209760_100622 | 3300025207 | Bacteria | 6046 |
| 160 | Ga0209436_101543 | 3300025208 | Bacteria | 7827 |
| 161 | Ga0209784_100027 | 3300025224 | Bacteria | 363933 |
| 162 | Ga0209566_100027 | 3300025225 | Bacteria | 363933 |
| 163 | Ga0209674_100044 | 3300025226 | Bacteria | 363933 |
| 164 | Ga0209672_102164 | 3300025228 | Bacteria | 5179 |
| 165 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 166 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 167 | Ga0209563_100048 | 3300025230 | Bacteria | 363933 |
| 168 | Ga0207427_100643 | 3300025231 | Bacteria | 16924 |
| 169 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 170 | Ga0209437_100055 | 3300025233 | Bacteria | 363933 |
| 171 | Ga0209437_108693 | 3300025233 | Bacteria | 1614 |
| 172 | Ga0209437_110183 | 3300025233 | Bacteria | 1444 |
| 173 | Ga0209258_100226 | 3300025242 | Bacteria | 106588 |
| 174 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 175 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 176 | Ga0209646_1000077 | 3300025246 | Bacteria | 208262 |
| 177 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 178 | Ga0209026_1009492 | 3300025250 | Bacteria | 1907 |
| 179 | Ga0209026_1016102 | 3300025250 | Bacteria | 1215 |
| 180 | Ga0209677_100028 | 3300025253 | Bacteria | 363933 |
| 181 | Ga0209148_1001819 | 3300025254 | Bacteria | 8981 |
| 182 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 183 | Ga0209759_1000357 | 3300025256 | Bacteria | 59208 |
| 184 | Ga0209233_1000070 | 3300025261 | Bacteria | 363933 |
| 185 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 186 | Ga0209565_1001939 | 3300025263 | Bacteria | 8132 |
| 187 | Ga0209455_1000169 | 3300025272 | Bacteria | 111454 |
| 188 | Ga0209455_1008089 | 3300025272 | Bacteria | 2893 |
| 189 | Ga0209673_1000394 | 3300025273 | Bacteria | 78048 |
| 190 | Ga0209130_1001054 | 3300025284 | Bacteria | 20900 |
| 191 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 192 | Ga0209675_1001711 | 3300025291 | Bacteria | 12096 |
| 193 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 194 | Ga0209564_1000071 | 3300025295 | Bacteria | 301332 |
| 195 | Ga0209564_1000072 | 3300025295 | Bacteria | 289331 |
| 196 | Ga0209564_1028688 | 3300025295 | Bacteria | 1771 |
| 197 | Ga0209050_1000240 | 3300025298 | Bacteria | 118992 |
| 198 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 199 | Ga0209256_1000076 | 3300025299 | Bacteria | 234735 |
| 200 | Ga0209256_1003100 | 3300025299 | Bacteria | 12161 |
| 201 | Ga0207426_1054078 | 3300025302 | Bacteria | 1183 |
| 202 | Ga0207680_10014776 | 3300025903 | Bacteria | 4055 |
| 203 | Ga0207705_10017557 | 3300025909 | Bacteria | 5123 |
| 204 | Ga0207654_10004697 | 3300025911 | Bacteria | 6913 |
| 205 | Ga0207695_10001341 | 3300025913 | Bacteria | 41772 |
| 206 | Ga0207695_10005745 | 3300025913 | Bacteria | 16337 |
| 207 | Ga0207695_10438637 | 3300025913 | Bacteria | 1189 |
| 208 | Ga0207671_10037277 | 3300025914 | Bacteria | 3606 |
| 209 | Ga0207671_10307253 | 3300025914 | Bacteria | 1253 |
| 210 | Ga0207657_10001145 | 3300025919 | Bacteria | 28192 |
| 211 | Ga0207657_10024222 | 3300025919 | Bacteria | 5631 |
| 212 | Ga0207657_10034425 | 3300025919 | Bacteria | 4555 |
| 213 | Ga0207657_10134734 | 3300025919 | Bacteria | 2022 |
| 214 | Ga0207649_10026917 | 3300025920 | Bacteria | 3369 |
| 215 | Ga0207681_10022277 | 3300025923 | Bacteria | 4039 |
| 216 | Ga0207681_10070592 | 3300025923 | Bacteria | 2433 |
| 217 | Ga0207694_10001114 | 3300025924 | Bacteria | 23252 |
| 218 | Ga0207694_10189850 | 3300025924 | Bacteria | 1669 |
| 219 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 220 | Ga0207650_10004390 | 3300025925 | Bacteria | 9637 |
| 221 | Ga0207644_10004443 | 3300025931 | Bacteria | 9107 |
| 222 | Ga0207690_10084366 | 3300025932 | Bacteria | 2226 |
| 223 | Ga0207690_10191480 | 3300025932 | Bacteria | 1547 |
| 224 | Ga0207690_10819946 | 3300025932 | Bacteria | 769 |
| 225 | Ga0207706_10336169 | 3300025933 | Bacteria | 1314 |
| 226 | Ga0207686_10187296 | 3300025934 | Bacteria | 1472 |
| 227 | Ga0207709_10112420 | 3300025935 | Bacteria | 1824 |
| 228 | Ga0207711_10000472 | 3300025941 | Bacteria | 41502 |
| 229 | Ga0207679_10019205 | 3300025945 | Bacteria | 4589 |
| 230 | Ga0207679_10248449 | 3300025945 | Bacteria | 1511 |
| 231 | Ga0207679_10267272 | 3300025945 | Bacteria | 1461 |
| 232 | Ga0207667_10000078 | 3300025949 | Bacteria | 165061 |
| 233 | Ga0207667_10023739 | 3300025949 | Bacteria | 6750 |
| 234 | Ga0207667_10041450 | 3300025949 | Bacteria | 4896 |
| 235 | Ga0207667_10217165 | 3300025949 | Bacteria | 1959 |
| 236 | Ga0207667_10297414 | 3300025949 | Bacteria | 1649 |
| 237 | Ga0207712_10135816 | 3300025961 | Bacteria | 1881 |
| 238 | Ga0207668_10007151 | 3300025972 | Bacteria | 6628 |
| 239 | Ga0207668_10118956 | 3300025972 | Bacteria | 1997 |
| 240 | Ga0207640_10055935 | 3300025981 | Bacteria | 2587 |
| 241 | Ga0207658_10000012 | 3300025986 | Bacteria | 224402 |
| 242 | Ga0207703_10130918 | 3300026035 | Bacteria | 2166 |
| 243 | Ga0207678_10312327 | 3300026067 | Bacteria | 1351 |
| 244 | Ga0207678_10912544 | 3300026067 | Bacteria | 777 |
| 245 | Ga0207702_10478919 | 3300026078 | Bacteria | 1211 |
| 246 | Ga0207702_10885972 | 3300026078 | Bacteria | 884 |
| 247 | Ga0207702_11225745 | 3300026078 | Bacteria | 744 |
| 248 | Ga0207641_10025128 | 3300026088 | Bacteria | 4910 |
| 249 | Ga0207648_10076849 | 3300026089 | Bacteria | 2911 |
| 250 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 251 | Ga0207674_10349182 | 3300026116 | Bacteria | 1430 |
| 252 | Ga0207674_10350919 | 3300026116 | Bacteria | 1426 |
| 253 | Ga0207698_10158976 | 3300026142 | Bacteria | 1973 |
| 254 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 255 | Ga0268266_10032903 | 3300028379 | Bacteria | 4406 |
| 256 | Ga0268265_10002832 | 3300028380 | Bacteria | 12751 |
| 257 | Ga0268265_10048589 | 3300028380 | Bacteria | 3186 |
| 258 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 259 | Ga0268264_10099773 | 3300028381 | Bacteria | 2520 |
| 260 | Ga0307511_10008326 | 3300030521 | Bacteria | 10380 |
| 261 | Ga0316180_1021737 | 3300030736 | Bacteria | 2639 |
| 262 | Ga0316183_1190372 | 3300030742 | Bacteria | 979 |
| 263 | Ga0265331_10064063 | 3300031250 | Bacteria | 1731 |
| 264 | Ga0265327_10090693 | 3300031251 | Bacteria | 1491 |
| 265 | Ga0265327_10165282 | 3300031251 | Bacteria | 1020 |
| 266 | Ga0307509_10270648 | 3300031507 | Bacteria | 1467 |
| 267 | Ga0307408_100000239 | 3300031548 | Bacteria | 57570 |
| 268 | Ga0307408_100224828 | 3300031548 | Bacteria | 1533 |
| 269 | Ga0307416_100005633 | 3300032002 | Bacteria | 7726 |
| 270 | Ga0307414_10788244 | 3300032004 | Bacteria | 866 |
| 271 | Ga0316583_10009603 | 3300032133 | Bacteria | 3485 |
| 272 | Ga0373931_0114275 | 3300035691 | Bacteria | 1535 |
| 273 | Ga0395899_0000128 | 3300037312 | Bacteria | 119014 |
| 274 | Ga0395899_0000753 | 3300037312 | Bacteria | 32064 |
| 275 | Ga0395899_0006694 | 3300037312 | Bacteria | 8931 |
| 276 | Ga0395899_0010304 | 3300037312 | Bacteria | 7167 |
| 277 | Ga0395899_0010704 | 3300037312 | Bacteria | 7031 |
| 278 | Ga0395899_0012339 | 3300037312 | Bacteria | 6544 |
| 279 | Ga0395899_0013728 | 3300037312 | Bacteria | 6193 |
| 280 | Ga0395899_0055314 | 3300037312 | Bacteria | 2935 |
| 281 | Ga0395899_0293240 | 3300037312 | Bacteria | 1103 |
| 282 | Ga0395900_0000123 | 3300037418 | Bacteria | 133326 |
| 283 | Ga0395900_0007904 | 3300037418 | Bacteria | 10955 |
| 284 | Ga0395900_0008621 | 3300037418 | Bacteria | 10478 |
| 285 | Ga0395900_0009260 | 3300037418 | Bacteria | 10096 |
| 286 | Ga0395900_0010088 | 3300037418 | Bacteria | 9661 |
| 287 | Ga0395900_0021826 | 3300037418 | Bacteria | 6546 |
| 288 | Ga0395900_0035310 | 3300037418 | Bacteria | 5149 |
| 289 | Ga0395900_0073035 | 3300037418 | Bacteria | 3526 |
| 290 | Ga0395900_0116934 | 3300037418 | Bacteria | 2736 |
| 291 | Ga0395900_0140769 | 3300037418 | Bacteria | 2470 |
| 292 | Ga0395900_0209971 | 3300037418 | Bacteria | 1966 |
| 293 | Ga0395900_0287131 | 3300037418 | Bacteria | 1635 |
| 294 | Ga0395900_0323735 | 3300037418 | Bacteria | 1521 |
| 295 | Ga0395900_0328620 | 3300037418 | Bacteria | 1507 |
| 296 | Ga0395898_0004536 | 3300037466 | Bacteria | 15161 |
| 297 | Ga0395898_0075038 | 3300037466 | Bacteria | 3266 |
| 298 | Ga0395898_0109879 | 3300037466 | Bacteria | 2643 |
| 299 | Ga0395898_0125841 | 3300037466 | Bacteria | 2455 |
| 300 | Ga0395898_0257386 | 3300037466 | Bacteria | 1664 |
| 301 | Ga0395898_0383923 | 3300037466 | Bacteria | 1339 |
| 302 | Ga0395898_0517499 | 3300037466 | Bacteria | 1134 |
| 303 | Ga0395898_0628288 | 3300037466 | Bacteria | 1016 |
| 304 | Ga0395905_0000905 | 3300037471 | Bacteria | 38512 |
| 305 | Ga0395905_0001709 | 3300037471 | Bacteria | 25795 |
| 306 | Ga0395905_0012941 | 3300037471 | Bacteria | 8020 |
| 307 | Ga0395905_0013998 | 3300037471 | Bacteria | 7674 |
| 308 | Ga0395905_0020397 | 3300037471 | Bacteria | 6279 |
| 309 | Ga0395905_0042482 | 3300037471 | Bacteria | 4267 |
| 310 | Ga0395905_0078281 | 3300037471 | Bacteria | 3098 |
| 311 | Ga0395905_0099213 | 3300037471 | Bacteria | 2735 |
| 312 | Ga0395905_0128099 | 3300037471 | Bacteria | 2387 |
| 313 | Ga0395905_0152274 | 3300037471 | Bacteria | 2175 |
| 314 | Ga0395905_0310643 | 3300037471 | Bacteria | 1465 |
| 315 | Ga0395905_0380827 | 3300037471 | Bacteria | 1305 |
| 316 | Ga0395905_0392670 | 3300037471 | Bacteria | 1282 |
| 317 | Ga0395905_0503627 | 3300037471 | Bacteria | 1111 |
| 318 | Ga0395905_0623628 | 3300037471 | Bacteria | 980 |
| 319 | Ga0395901_0000411 | 3300038443 | Bacteria | 50643 |
| 320 | Ga0395901_0001908 | 3300038443 | Bacteria | 21493 |
| 321 | Ga0395901_0021000 | 3300038443 | Bacteria | 6689 |
| 322 | Ga0395901_0023907 | 3300038443 | Bacteria | 6267 |
| 323 | Ga0395901_0278987 | 3300038443 | Bacteria | 1737 |
| 324 | Ga0395901_0346430 | 3300038443 | Bacteria | 1534 |
| 325 | Ga0395901_0355927 | 3300038443 | Bacteria | 1510 |
| 326 | Ga0395901_0504377 | 3300038443 | Bacteria | 1231 |
| 327 | Ga0395901_0796251 | 3300038443 | Bacteria | 934 |
| 328 | Ga0436365_1765823 | 3300039437 | Bacteria | 5366 |
| 329 | Ga0436361_0014452 | 3300039447 | Bacteria | 4411 |
| 330 | Ga0436361_0032641 | 3300039447 | Bacteria | 1118 |
| 331 | Ga0436361_0149158 | 3300039447 | Bacteria | 4068 |
| 332 | Ga0436361_0161443 | 3300039447 | Bacteria | 5435 |
| 333 | Ga0436361_0275924 | 3300039447 | Bacteria | 2979 |
| 334 | Ga0436361_0458162 | 3300039447 | Bacteria | 1237 |
| 335 | Ga0436361_0568983 | 3300039447 | Bacteria | 33450 |
| 336 | Ga0436361_0632651 | 3300039447 | Bacteria | 49929 |
| 337 | Ga0436361_0746087 | 3300039447 | Bacteria | 1617 |
| 338 | Ga0436361_0830100 | 3300039447 | Bacteria | 16365 |
| 339 | Ga0436361_0938544 | 3300039447 | Bacteria | 31788 |
| 340 | Ga0436361_0973589 | 3300039447 | Bacteria | 2003 |
| 341 | Ga0436361_1043948 | 3300039447 | Bacteria | 4310 |
| 342 | Ga0436362_0115419 | 3300039453 | Bacteria | 1304 |
| 343 | Ga0439448_0010043 | 3300042005 | Bacteria | 2797 |
| 344 | Ga0439448_0123959 | 3300042005 | Bacteria | 888 |
| 345 | Ga0439449_0013722 | 3300042007 | Bacteria | 3049 |
| 346 | Ga0439450_010428 | 3300042008 | Bacteria | 1792 |
| 347 | Ga0439450_018780 | 3300042008 | Bacteria | 1456 |
| 348 | Ga0439455_0106565 | 3300042012 | Bacteria | 777 |
| 349 | Ga0450897_013149 | 3300042128 | Bacteria | 823 |
| 350 | Ga0450904_000276 | 3300042139 | Bacteria | 11138 |
| 351 | Ga0439458_0022881 | 3300042157 | Bacteria | 1454 |
| 352 | Ga0451577_0625920 | 3300042876 | Bacteria | 976 |
| 353 | Ga0466969_0038118 | 3300044656 | Bacteria | 2420 |
| 354 | Ga0466969_0080543 | 3300044656 | Bacteria | 1555 |
| 355 | Ga0466972_0000087 | 3300044658 | Bacteria | 84646 |
| 356 | Ga0466972_0001100 | 3300044658 | Bacteria | 12928 |
| 357 | Ga0466972_0006991 | 3300044658 | Bacteria | 5660 |
| 358 | Ga0466972_0097290 | 3300044658 | Bacteria | 1394 |
| 359 | Ga0466965_0002700 | 3300044683 | Bacteria | 7599 |
| 360 | Ga0466965_0010006 | 3300044683 | Bacteria | 4412 |
| 361 | Ga0466965_0011686 | 3300044683 | Bacteria | 4118 |
| 362 | Ga0466965_0065720 | 3300044683 | Bacteria | 1817 |
| 363 | Ga0466965_0107579 | 3300044683 | Bacteria | 1431 |
| 364 | Ga0466966_0011821 | 3300044684 | Bacteria | 5780 |
| 365 | Ga0466966_0013678 | 3300044684 | Bacteria | 5369 |
| 366 | Ga0466966_0068924 | 3300044684 | Bacteria | 2219 |
| 367 | Ga0466966_0082220 | 3300044684 | Bacteria | 2004 |
| 368 | Ga0466961_0159699 | 3300044693 | Bacteria | 1405 |
| 369 | Ga0466964_0000256 | 3300044706 | Bacteria | 15366 |
| 370 | Ga0466964_0199537 | 3300044706 | Bacteria | 960 |
| 371 | Ga0466964_0206904 | 3300044706 | Bacteria | 945 |
| 372 | Ga0453684_0000102 | 3300044712 | Bacteria | 366870 |
| 373 | Ga0466971_0017407 | 3300044719 | Bacteria | 3179 |
| 374 | Ga0466968_0001835 | 3300044735 | Bacteria | 7668 |
| 375 | Ga0466968_0037123 | 3300044735 | Bacteria | 2043 |
| 376 | Ga0466968_0117279 | 3300044735 | Bacteria | 1202 |
| 377 | Ga0466970_0016339 | 3300044765 | Bacteria | 3824 |
| 378 | Ga0466957_0009721 | 3300044842 | Bacteria | 5492 |
| 379 | Ga0466959_0009557 | 3300045049 | Bacteria | 6899 |
| 380 | Ga0466959_0011644 | 3300045049 | Bacteria | 6325 |
| 381 | Ga0466959_0052704 | 3300045049 | Bacteria | 2978 |
| 382 | Ga0466959_0054139 | 3300045049 | Bacteria | 2932 |
| 383 | Ga0466959_0586236 | 3300045049 | Bacteria | 750 |
| 384 | Ga0451576_0000171 | 3300045051 | Bacteria | 162452 |
| 385 | Ga0451576_0000386 | 3300045051 | Bacteria | 102813 |
| 386 | Ga0451576_0080204 | 3300045051 | Bacteria | 3396 |
| 387 | Ga0451576_0724582 | 3300045051 | Bacteria | 1045 |
| 388 | Ga0466958_0275718 | 3300045836 | Bacteria | 1077 |
| 389 | Ga0466958_0396809 | 3300045836 | Bacteria | 890 |
| 390 | Ga0466967_0005324 | 3300045976 | Bacteria | 8891 |
| 391 | Ga0495617_000034 | 3300046452 | Bacteria | 147232 |
| 392 | Ga0495617_002482 | 3300046452 | Bacteria | 7321 |
| 393 | Ga0495617_002980 | 3300046452 | Bacteria | 6473 |
| 394 | Ga0495617_008361 | 3300046452 | Bacteria | 3570 |
| 395 | Ga0495627_000876 | 3300046453 | Bacteria | 21280 |
| 396 | Ga0495627_024085 | 3300046453 | Bacteria | 1987 |
| 397 | Ga0495592_0003280 | 3300046454 | Bacteria | 11595 |
| 398 | Ga0495592_0405274 | 3300046454 | Bacteria | 863 |
| 399 | Ga0495603_0033409 | 3300046455 | Bacteria | 3096 |
| 400 | Ga0495603_0044124 | 3300046455 | Bacteria | 2660 |
| 401 | Ga0495590_0000027 | 3300046457 | Bacteria | 158323 |
| 402 | Ga0495590_0000257 | 3300046457 | Bacteria | 28989 |
| 403 | Ga0495590_0006267 | 3300046457 | Bacteria | 4656 |
| 404 | Ga0495590_0028084 | 3300046457 | Bacteria | 1973 |
| 405 | Ga0495590_0033182 | 3300046457 | Bacteria | 1805 |
| 406 | Ga0495590_0067583 | 3300046457 | Bacteria | 1252 |
| 407 | Ga0495590_0085440 | 3300046457 | Bacteria | 1113 |
| 408 | Ga0495591_000272 | 3300046458 | Bacteria | 48725 |
| 409 | Ga0495629_0014017 | 3300046459 | Bacteria | 5777 |
| 410 | Ga0495638_0000098 | 3300046460 | Bacteria | 140656 |
| 411 | Ga0495638_0045252 | 3300046460 | Bacteria | 2769 |
| 412 | Ga0495638_0050498 | 3300046460 | Bacteria | 2597 |
| 413 | Ga0495651_0015119 | 3300046462 | Bacteria | 5965 |
| 414 | Ga0495651_0058856 | 3300046462 | Bacteria | 2947 |
| 415 | Ga0495653_0002089 | 3300046463 | Bacteria | 15731 |
| 416 | Ga0495653_0144561 | 3300046463 | Bacteria | 1668 |
| 417 | Ga0495653_0169254 | 3300046463 | Bacteria | 1509 |
| 418 | Ga0495650_0000011 | 3300046471 | Bacteria | 615329 |
| 419 | Ga0495650_0002150 | 3300046471 | Bacteria | 16729 |
| 420 | Ga0495580_0030809 | 3300046472 | Bacteria | 3880 |
| 421 | Ga0495580_0445460 | 3300046472 | Bacteria | 869 |
| 422 | Ga0495582_0004649 | 3300046473 | Bacteria | 7718 |
| 423 | Ga0495582_0017936 | 3300046473 | Bacteria | 3869 |
| 424 | Ga0495582_0114750 | 3300046473 | Bacteria | 1514 |
| 425 | Ga0495605_0000029 | 3300046474 | Bacteria | 215329 |
| 426 | Ga0495605_0000042 | 3300046474 | Bacteria | 185225 |
| 427 | Ga0495605_0000151 | 3300046474 | Bacteria | 89442 |
| 428 | Ga0495605_0006348 | 3300046474 | Bacteria | 6815 |
| 429 | Ga0495605_0007689 | 3300046474 | Bacteria | 6109 |
| 430 | Ga0495605_0010229 | 3300046474 | Bacteria | 5252 |
| 431 | Ga0495605_0024677 | 3300046474 | Bacteria | 3142 |
| 432 | Ga0495605_0035098 | 3300046474 | Bacteria | 2536 |
| 433 | Ga0495605_0044828 | 3300046474 | Bacteria | 2183 |
| 434 | Ga0495605_0132566 | 3300046474 | Bacteria | 1123 |
| 435 | Ga0495639_0309380 | 3300046475 | Bacteria | 789 |
| 436 | Ga0495584_0000007 | 3300046491 | Bacteria | 294820 |
| 437 | Ga0495584_0000122 | 3300046491 | Bacteria | 53611 |
| 438 | Ga0495584_0000506 | 3300046491 | Bacteria | 26745 |
| 439 | Ga0495584_0002007 | 3300046491 | Bacteria | 11695 |
| 440 | Ga0495584_0002049 | 3300046491 | Bacteria | 11580 |
| 441 | Ga0495584_0003276 | 3300046491 | Bacteria | 8969 |
| 442 | Ga0495584_0005376 | 3300046491 | Bacteria | 6790 |
| 443 | Ga0495584_0005715 | 3300046491 | Bacteria | 6566 |
| 444 | Ga0495584_0006099 | 3300046491 | Bacteria | 6343 |
| 445 | Ga0495584_0010896 | 3300046491 | Bacteria | 4667 |
| 446 | Ga0495584_0021540 | 3300046491 | Bacteria | 3273 |
| 447 | Ga0495584_0069350 | 3300046491 | Bacteria | 1771 |
| 448 | Ga0495584_0110508 | 3300046491 | Bacteria | 1390 |
| 449 | Ga0495584_0163756 | 3300046491 | Bacteria | 1130 |
| 450 | Ga0495584_0173545 | 3300046491 | Bacteria | 1096 |
| 451 | Ga0495584_0204880 | 3300046491 | Bacteria | 1002 |
| 452 | Ga0495585_0000115 | 3300046492 | Bacteria | 86460 |
| 453 | Ga0495585_0000421 | 3300046492 | Bacteria | 40862 |
| 454 | Ga0495585_0002934 | 3300046492 | Bacteria | 11799 |
| 455 | Ga0495585_0003505 | 3300046492 | Bacteria | 10583 |
| 456 | Ga0495585_0010560 | 3300046492 | Bacteria | 5494 |
| 457 | Ga0495585_0017306 | 3300046492 | Bacteria | 4166 |
| 458 | Ga0495585_0018451 | 3300046492 | Bacteria | 4022 |
| 459 | Ga0495585_0020952 | 3300046492 | Bacteria | 3756 |
| 460 | Ga0495585_0024454 | 3300046492 | Bacteria | 3463 |
| 461 | Ga0495585_0029130 | 3300046492 | Bacteria | 3144 |
| 462 | Ga0495585_0040655 | 3300046492 | Bacteria | 2610 |
| 463 | Ga0495585_0062272 | 3300046492 | Bacteria | 2049 |
| 464 | Ga0495585_0098278 | 3300046492 | Bacteria | 1568 |
| 465 | Ga0495585_0107344 | 3300046492 | Bacteria | 1487 |
| 466 | Ga0495594_0003496 | 3300046499 | Bacteria | 8092 |
| 467 | Ga0495594_0010511 | 3300046499 | Bacteria | 4800 |
| 468 | Ga0495594_0010807 | 3300046499 | Bacteria | 4742 |
| 469 | Ga0495594_0013150 | 3300046499 | Bacteria | 4316 |
| 470 | Ga0495594_0028672 | 3300046499 | Bacteria | 3005 |
| 471 | Ga0495596_0000474 | 3300046500 | Bacteria | 25448 |
| 472 | Ga0495596_0000530 | 3300046500 | Bacteria | 23944 |
| 473 | Ga0495596_0002008 | 3300046500 | Bacteria | 11201 |
| 474 | Ga0495596_0002300 | 3300046500 | Bacteria | 10378 |
| 475 | Ga0495596_0004690 | 3300046500 | Bacteria | 6612 |
| 476 | Ga0495596_0014436 | 3300046500 | Bacteria | 3329 |
| 477 | Ga0495596_0019973 | 3300046500 | Bacteria | 2745 |
| 478 | Ga0495596_0028741 | 3300046500 | Bacteria | 2230 |
| 479 | Ga0495607_0001671 | 3300046501 | Bacteria | 19192 |
| 480 | Ga0495607_0001966 | 3300046501 | Bacteria | 17334 |
| 481 | Ga0495607_0002476 | 3300046501 | Bacteria | 14990 |
| 482 | Ga0495607_0002735 | 3300046501 | Bacteria | 14072 |
| 483 | Ga0495607_0004292 | 3300046501 | Bacteria | 10526 |
| 484 | Ga0495607_0017561 | 3300046501 | Bacteria | 4588 |
| 485 | Ga0495607_0020165 | 3300046501 | Bacteria | 4219 |
| 486 | Ga0495607_0025435 | 3300046501 | Bacteria | 3681 |
| 487 | Ga0495607_0028377 | 3300046501 | Bacteria | 3453 |
| 488 | Ga0495607_0051721 | 3300046501 | Bacteria | 2384 |
| 489 | Ga0495607_0071761 | 3300046501 | Bacteria | 1930 |
| 490 | Ga0495607_0077910 | 3300046501 | Bacteria | 1830 |
| 491 | Ga0495607_0083439 | 3300046501 | Bacteria | 1750 |
| 492 | Ga0495607_0225317 | 3300046501 | Bacteria | 914 |
| 493 | Ga0495583_0000348 | 3300046506 | Bacteria | 73050 |
| 494 | Ga0495583_0000472 | 3300046506 | Bacteria | 58906 |
| 495 | Ga0495583_0000569 | 3300046506 | Bacteria | 50860 |
| 496 | Ga0495583_0001444 | 3300046506 | Bacteria | 24128 |
| 497 | Ga0495583_0015121 | 3300046506 | Bacteria | 4212 |
| 498 | Ga0495583_0033337 | 3300046506 | Bacteria | 2477 |
| 499 | Ga0495583_0034886 | 3300046506 | Bacteria | 2406 |
| 500 | Ga0495583_0049226 | 3300046506 | Bacteria | 1931 |
| 501 | Ga0495583_0110774 | 3300046506 | Bacteria | 1163 |
| 502 | Ga0495583_0194134 | 3300046506 | Bacteria | 827 |
| 503 | Ga0495606_0000084 | 3300046507 | Bacteria | 158428 |
| 504 | Ga0495606_0000652 | 3300046507 | Bacteria | 54651 |
| 505 | Ga0495606_0000787 | 3300046507 | Bacteria | 48504 |
| 506 | Ga0495606_0001481 | 3300046507 | Bacteria | 31269 |
| 507 | Ga0495606_0012677 | 3300046507 | Bacteria | 6729 |
| 508 | Ga0495606_0021021 | 3300046507 | Bacteria | 4791 |
| 509 | Ga0495606_0029545 | 3300046507 | Bacteria | 3845 |
| 510 | Ga0495606_0031347 | 3300046507 | Bacteria | 3698 |
| 511 | Ga0495606_0034767 | 3300046507 | Bacteria | 3455 |
| 512 | Ga0495606_0039821 | 3300046507 | Bacteria | 3161 |
| 513 | Ga0495606_0047069 | 3300046507 | Bacteria | 2846 |
| 514 | Ga0495606_0106051 | 3300046507 | Bacteria | 1702 |
| 515 | Ga0495606_0349720 | 3300046507 | Bacteria | 785 |
| 516 | Ga0495608_0001512 | 3300046511 | Bacteria | 16556 |
| 517 | Ga0495608_0013677 | 3300046511 | Bacteria | 5631 |
| 518 | Ga0495610_0000473 | 3300046512 | Bacteria | 41477 |
| 519 | Ga0495610_0148582 | 3300046512 | Bacteria | 1002 |
| 520 | Ga0495616_0001479 | 3300046513 | Bacteria | 16296 |
| 521 | Ga0495616_0001547 | 3300046513 | Bacteria | 15843 |
| 522 | Ga0495616_0004099 | 3300046513 | Bacteria | 9242 |
| 523 | Ga0495616_0007026 | 3300046513 | Bacteria | 6773 |
| 524 | Ga0495616_0008239 | 3300046513 | Bacteria | 6186 |
| 525 | Ga0495616_0010806 | 3300046513 | Bacteria | 5262 |
| 526 | Ga0495616_0010992 | 3300046513 | Bacteria | 5207 |
| 527 | Ga0495616_0021408 | 3300046513 | Bacteria | 3501 |
| 528 | Ga0495616_0025599 | 3300046513 | Bacteria | 3150 |
| 529 | Ga0495616_0030670 | 3300046513 | Bacteria | 2822 |
| 530 | Ga0495616_0033463 | 3300046513 | Bacteria | 2677 |
| 531 | Ga0495616_0042972 | 3300046513 | Bacteria | 2297 |
| 532 | Ga0495616_0044363 | 3300046513 | Bacteria | 2255 |
| 533 | Ga0495616_0057484 | 3300046513 | Bacteria | 1918 |
| 534 | Ga0495616_0094410 | 3300046513 | Bacteria | 1411 |
| 535 | Ga0495620_0003439 | 3300046515 | Bacteria | 9059 |
| 536 | Ga0495628_0004339 | 3300046516 | Bacteria | 12585 |
| 537 | Ga0495628_0018273 | 3300046516 | Bacteria | 5812 |
| 538 | Ga0495628_0305552 | 3300046516 | Bacteria | 1177 |
| 539 | Ga0495630_0009137 | 3300046517 | Bacteria | 7128 |
| 540 | Ga0495630_0332897 | 3300046517 | Bacteria | 1161 |
| 541 | Ga0495631_0000550 | 3300046518 | Bacteria | 25263 |
| 542 | Ga0495631_0000810 | 3300046518 | Bacteria | 19974 |
| 543 | Ga0495631_0001888 | 3300046518 | Bacteria | 12341 |
| 544 | Ga0495631_0002771 | 3300046518 | Bacteria | 9721 |
| 545 | Ga0495631_0005099 | 3300046518 | Bacteria | 6919 |
| 546 | Ga0495631_0006258 | 3300046518 | Bacteria | 6165 |
| 547 | Ga0495631_0015840 | 3300046518 | Bacteria | 3603 |
| 548 | Ga0495631_0017560 | 3300046518 | Bacteria | 3381 |
| 549 | Ga0495631_0272480 | 3300046518 | Bacteria | 721 |
| 550 | Ga0495632_0000852 | 3300046519 | Bacteria | 26846 |
| 551 | Ga0495632_0000903 | 3300046519 | Bacteria | 26010 |
| 552 | Ga0495632_0001985 | 3300046519 | Bacteria | 16245 |
| 553 | Ga0495632_0007957 | 3300046519 | Bacteria | 6584 |
| 554 | Ga0495632_0042567 | 3300046519 | Bacteria | 2275 |
| 555 | Ga0495637_0000013 | 3300046520 | Bacteria | 244837 |
| 556 | Ga0495637_0008688 | 3300046520 | Bacteria | 4983 |
| 557 | Ga0495637_0021577 | 3300046520 | Bacteria | 2951 |
| 558 | Ga0495643_0000200 | 3300046522 | Bacteria | 93353 |
| 559 | Ga0495643_0000551 | 3300046522 | Bacteria | 46367 |
| 560 | Ga0495643_0002412 | 3300046522 | Bacteria | 14864 |
| 561 | Ga0495643_0004464 | 3300046522 | Bacteria | 9775 |
| 562 | Ga0495643_0012215 | 3300046522 | Bacteria | 5187 |
| 563 | Ga0495643_0024119 | 3300046522 | Bacteria | 3453 |
| 564 | Ga0495643_0025001 | 3300046522 | Bacteria | 3383 |
| 565 | Ga0495643_0071122 | 3300046522 | Bacteria | 1826 |
| 566 | Ga0495643_0072128 | 3300046522 | Bacteria | 1811 |
| 567 | Ga0495644_0002518 | 3300046523 | Bacteria | 7308 |
| 568 | Ga0495644_0004268 | 3300046523 | Bacteria | 5613 |
| 569 | Ga0495644_0004891 | 3300046523 | Bacteria | 5258 |
| 570 | Ga0495644_0005339 | 3300046523 | Bacteria | 5017 |
| 571 | Ga0495644_0011582 | 3300046523 | Bacteria | 3394 |
| 572 | Ga0495644_0015732 | 3300046523 | Bacteria | 2899 |
| 573 | Ga0495644_0017413 | 3300046523 | Bacteria | 2747 |
| 574 | Ga0495644_0020348 | 3300046523 | Bacteria | 2533 |
| 575 | Ga0495644_0036772 | 3300046523 | Bacteria | 1847 |
| 576 | Ga0495648_0000112 | 3300046524 | Bacteria | 99859 |
| 577 | Ga0495648_0000169 | 3300046524 | Bacteria | 75523 |
| 578 | Ga0495648_0001096 | 3300046524 | Bacteria | 27557 |
| 579 | Ga0495648_0002536 | 3300046524 | Bacteria | 16749 |
| 580 | Ga0495648_0007990 | 3300046524 | Bacteria | 8391 |
| 581 | Ga0495648_0009310 | 3300046524 | Bacteria | 7632 |
| 582 | Ga0495648_0027171 | 3300046524 | Bacteria | 3836 |
| 583 | Ga0495648_0034097 | 3300046524 | Bacteria | 3318 |
| 584 | Ga0495648_0051763 | 3300046524 | Bacteria | 2499 |
| 585 | Ga0495648_0054917 | 3300046524 | Bacteria | 2403 |
| 586 | Ga0495648_0177240 | 3300046524 | Bacteria | 1087 |
| 587 | Ga0495648_0313657 | 3300046524 | Bacteria | 730 |
| 588 | Ga0495663_0004796 | 3300046525 | Bacteria | 3781 |
| 589 | Ga0495663_0032141 | 3300046525 | Bacteria | 1562 |
| 590 | Ga0495666_0015313 | 3300046526 | Bacteria | 3818 |
| 591 | Ga0495666_0049841 | 3300046526 | Bacteria | 2014 |
| 592 | Ga0495642_0000050 | 3300046528 | Bacteria | 71246 |
| 593 | Ga0495642_0001068 | 3300046528 | Bacteria | 12668 |
| 594 | Ga0495642_0001340 | 3300046528 | Bacteria | 11027 |
| 595 | Ga0495642_0001809 | 3300046528 | Bacteria | 9172 |
| 596 | Ga0495642_0003687 | 3300046528 | Bacteria | 6013 |
| 597 | Ga0495642_0004398 | 3300046528 | Bacteria | 5471 |
| 598 | Ga0495642_0008082 | 3300046528 | Bacteria | 4025 |
| 599 | Ga0495642_0021157 | 3300046528 | Bacteria | 2557 |
| 600 | Ga0495642_0029202 | 3300046528 | Bacteria | 2200 |
| 601 | Ga0495642_0056547 | 3300046528 | Bacteria | 1620 |
| 602 | Ga0495642_0134247 | 3300046528 | Bacteria | 1066 |
| 603 | Ga0495642_0186853 | 3300046528 | Bacteria | 902 |
| 604 | Ga0495652_0005056 | 3300046529 | Bacteria | 12485 |
| 605 | Ga0495652_0016097 | 3300046529 | Bacteria | 6689 |
| 606 | Ga0495652_0019388 | 3300046529 | Bacteria | 6058 |
| 607 | Ga0495652_0049462 | 3300046529 | Bacteria | 3598 |
| 608 | Ga0495654_0004305 | 3300046530 | Bacteria | 8491 |
| 609 | Ga0495654_0006380 | 3300046530 | Bacteria | 6706 |
| 610 | Ga0495654_0008593 | 3300046530 | Bacteria | 5628 |
| 611 | Ga0495654_0010005 | 3300046530 | Bacteria | 5180 |
| 612 | Ga0495654_0044679 | 3300046530 | Bacteria | 2190 |
| 613 | Ga0495665_0005554 | 3300046531 | Bacteria | 6794 |
| 614 | Ga0495665_0035779 | 3300046531 | Bacteria | 2651 |
| 615 | Ga0495665_0102901 | 3300046531 | Bacteria | 1498 |
| 616 | Ga0495665_0103170 | 3300046531 | Bacteria | 1496 |
| 617 | Ga0495586_0018982 | 3300046535 | Bacteria | 3659 |
| 618 | Ga0495586_0019447 | 3300046535 | Bacteria | 3615 |
| 619 | Ga0495587_0008756 | 3300046536 | Bacteria | 6490 |
| 620 | Ga0495609_0000022 | 3300046538 | Bacteria | 279488 |
| 621 | Ga0495609_0000163 | 3300046538 | Bacteria | 69578 |
| 622 | Ga0495609_0001355 | 3300046538 | Bacteria | 16522 |
| 623 | Ga0495609_0002267 | 3300046538 | Bacteria | 12004 |
| 624 | Ga0495609_0003271 | 3300046538 | Bacteria | 9357 |
| 625 | Ga0495609_0026941 | 3300046538 | Bacteria | 2628 |
| 626 | Ga0495609_0031532 | 3300046538 | Bacteria | 2408 |
| 627 | Ga0495609_0047144 | 3300046538 | Bacteria | 1928 |
| 628 | Ga0495609_0080225 | 3300046538 | Bacteria | 1427 |
| 629 | Ga0495597_0000064 | 3300046542 | Bacteria | 91446 |
| 630 | Ga0495597_0000266 | 3300046542 | Bacteria | 47830 |
| 631 | Ga0495597_0000566 | 3300046542 | Bacteria | 30712 |
| 632 | Ga0495597_0001407 | 3300046542 | Bacteria | 17367 |
| 633 | Ga0495597_0002770 | 3300046542 | Bacteria | 10797 |
| 634 | Ga0495597_0006826 | 3300046542 | Bacteria | 5864 |
| 635 | Ga0495597_0006959 | 3300046542 | Bacteria | 5796 |
| 636 | Ga0495597_0013020 | 3300046542 | Bacteria | 3994 |
| 637 | Ga0495597_0074237 | 3300046542 | Bacteria | 1460 |
| 638 | Ga0495597_0240246 | 3300046542 | Bacteria | 714 |
| 639 | Ga0495645_0042584 | 3300046543 | Bacteria | 3311 |
| 640 | Ga0495645_0073481 | 3300046543 | Bacteria | 2463 |
| 641 | Ga0495622_0000311 | 3300046557 | Bacteria | 36067 |
| 642 | Ga0495622_0000707 | 3300046557 | Bacteria | 18899 |
| 643 | Ga0495622_0007277 | 3300046557 | Bacteria | 5138 |
| 644 | Ga0495622_0039180 | 3300046557 | Bacteria | 2207 |
| 645 | Ga0495622_0039684 | 3300046557 | Bacteria | 2192 |
| 646 | Ga0495622_0085890 | 3300046557 | Bacteria | 1447 |
| 647 | Ga0495622_0228631 | 3300046557 | Bacteria | 822 |
| 648 | Ga0495633_0001165 | 3300046558 | Bacteria | 21122 |
| 649 | Ga0495633_0001850 | 3300046558 | Bacteria | 15548 |
| 650 | Ga0495633_0010505 | 3300046558 | Bacteria | 5046 |
| 651 | Ga0495633_0016664 | 3300046558 | Bacteria | 3781 |
| 652 | Ga0495633_0018317 | 3300046558 | Bacteria | 3558 |
| 653 | Ga0495633_0020708 | 3300046558 | Bacteria | 3302 |
| 654 | Ga0495633_0024214 | 3300046558 | Bacteria | 3001 |
| 655 | Ga0495633_0047924 | 3300046558 | Bacteria | 2018 |
| 656 | Ga0495633_0086336 | 3300046558 | Bacteria | 1459 |
| 657 | Ga0495633_0123951 | 3300046558 | Bacteria | 1196 |
| 658 | Ga0495633_0230476 | 3300046558 | Bacteria | 847 |
| 659 | Ga0495656_0001658 | 3300046615 | Bacteria | 7274 |
| 660 | Ga0495656_0002958 | 3300046615 | Bacteria | 5701 |
| 661 | Ga0495656_0006533 | 3300046615 | Bacteria | 4094 |
| 662 | Ga0495656_0026222 | 3300046615 | Bacteria | 2318 |
| 663 | Ga0495656_0100038 | 3300046615 | Bacteria | 1340 |
| 664 | Ga0495656_0119591 | 3300046615 | Bacteria | 1242 |
| 665 | Ga0495668_0001322 | 3300046616 | Bacteria | 24393 |
| 666 | Ga0495668_0001809 | 3300046616 | Bacteria | 19467 |
| 667 | Ga0495668_0002020 | 3300046616 | Bacteria | 17709 |
| 668 | Ga0495668_0006891 | 3300046616 | Bacteria | 7361 |
| 669 | Ga0495668_0011176 | 3300046616 | Bacteria | 5388 |
| 670 | Ga0495668_0013456 | 3300046616 | Bacteria | 4823 |
| 671 | Ga0495668_0029492 | 3300046616 | Bacteria | 3099 |
| 672 | Ga0495668_0057478 | 3300046616 | Bacteria | 2146 |
| 673 | Ga0495668_0061174 | 3300046616 | Bacteria | 2077 |
| 674 | Ga0495668_0093914 | 3300046616 | Bacteria | 1642 |
| 675 | Ga0495668_0395699 | 3300046616 | Bacteria | 759 |
| 676 | Ga0495634_0015301 | 3300046642 | Bacteria | 5515 |
| 677 | Ga0495611_0000515 | 3300046648 | Bacteria | 22974 |
| 678 | Ga0495611_0003505 | 3300046648 | Bacteria | 6905 |
| 679 | Ga0495611_0003835 | 3300046648 | Bacteria | 6556 |
| 680 | Ga0495611_0007685 | 3300046648 | Bacteria | 4578 |
| 681 | Ga0495611_0009941 | 3300046648 | Bacteria | 4027 |
| 682 | Ga0495611_0010893 | 3300046648 | Bacteria | 3851 |
| 683 | Ga0495611_0015786 | 3300046648 | Bacteria | 3227 |
| 684 | Ga0495611_0016265 | 3300046648 | Bacteria | 3180 |
| 685 | Ga0495611_0055477 | 3300046648 | Bacteria | 1792 |
| 686 | Ga0495611_0056545 | 3300046648 | Bacteria | 1776 |
| 687 | Ga0495611_0098122 | 3300046648 | Bacteria | 1358 |
| 688 | Ga0495625_0000810 | 3300046660 | Bacteria | 43340 |
| 689 | Ga0495625_0002543 | 3300046660 | Bacteria | 19615 |
| 690 | Ga0495625_0005310 | 3300046660 | Bacteria | 11801 |
| 691 | Ga0495625_0011709 | 3300046660 | Bacteria | 7131 |
| 692 | Ga0495625_0013813 | 3300046660 | Bacteria | 6471 |
| 693 | Ga0495625_0020304 | 3300046660 | Bacteria | 5131 |
| 694 | Ga0495625_0061488 | 3300046660 | Bacteria | 2657 |
| 695 | Ga0495625_0203186 | 3300046660 | Bacteria | 1306 |
| 696 | Ga0495659_0000019 | 3300046664 | Bacteria | 74610 |
| 697 | Ga0495659_0000167 | 3300046664 | Bacteria | 29514 |
| 698 | Ga0495659_0001683 | 3300046664 | Bacteria | 7409 |
| 699 | Ga0495659_0009447 | 3300046664 | Bacteria | 3112 |
| 700 | Ga0495659_0020073 | 3300046664 | Bacteria | 2241 |
| 701 | Ga0495661_0000151 | 3300046665 | Bacteria | 81275 |
| 702 | Ga0495661_0000590 | 3300046665 | Bacteria | 37515 |
| 703 | Ga0495661_0003517 | 3300046665 | Bacteria | 11544 |
| 704 | Ga0495661_0007238 | 3300046665 | Bacteria | 7740 |
| 705 | Ga0495661_0007385 | 3300046665 | Bacteria | 7657 |
| 706 | Ga0495661_0012488 | 3300046665 | Bacteria | 5736 |
| 707 | Ga0495661_0020506 | 3300046665 | Bacteria | 4313 |
| 708 | Ga0495661_0023945 | 3300046665 | Bacteria | 3957 |
| 709 | Ga0495661_0028727 | 3300046665 | Bacteria | 3556 |
| 710 | Ga0495661_0039994 | 3300046665 | Bacteria | 2910 |
| 711 | Ga0495661_0043396 | 3300046665 | Bacteria | 2764 |
| 712 | Ga0495661_0047504 | 3300046665 | Bacteria | 2613 |
| 713 | Ga0495661_0063816 | 3300046665 | Bacteria | 2176 |
| 714 | Ga0495661_0165231 | 3300046665 | Bacteria | 1185 |
| 715 | Ga0495661_0166458 | 3300046665 | Bacteria | 1179 |
| 716 | Ga0495661_0213394 | 3300046665 | Bacteria | 1003 |
| 717 | Ga0495661_0255821 | 3300046665 | Bacteria | 892 |
| 718 | Ga0495588_0000086 | 3300046674 | Bacteria | 193241 |
| 719 | Ga0495588_0011973 | 3300046674 | Bacteria | 4085 |
| 720 | Ga0495588_0017075 | 3300046674 | Bacteria | 3518 |
| 721 | Ga0495588_0032962 | 3300046674 | Bacteria | 2613 |
| 722 | Ga0495588_0034728 | 3300046674 | Bacteria | 2552 |
| 723 | Ga0495588_0058010 | 3300046674 | Bacteria | 2001 |
| 724 | Ga0495588_0116559 | 3300046674 | Bacteria | 1407 |
| 725 | Ga0495657_0058805 | 3300046675 | Bacteria | 2551 |
| 726 | Ga0495599_0003514 | 3300046678 | Bacteria | 9176 |
| 727 | Ga0495623_0008207 | 3300046679 | Bacteria | 6793 |
| 728 | Ga0495623_0011302 | 3300046679 | Bacteria | 5776 |
| 729 | Ga0495623_0035632 | 3300046679 | Bacteria | 3189 |
| 730 | Ga0495623_0041958 | 3300046679 | Bacteria | 2916 |
| 731 | Ga0495623_0048369 | 3300046679 | Bacteria | 2697 |
| 732 | Ga0495646_0001555 | 3300046680 | Bacteria | 13656 |
| 733 | Ga0495669_0000018 | 3300046684 | Bacteria | 127866 |
| 734 | Ga0495669_0026346 | 3300046684 | Bacteria | 2540 |
| 735 | Ga0495669_0093968 | 3300046684 | Bacteria | 1387 |
| 736 | Ga0495613_0089487 | 3300046689 | Bacteria | 2230 |
| 737 | Ga0495624_0033919 | 3300046690 | Bacteria | 3305 |
| 738 | Ga0495624_0036132 | 3300046690 | Bacteria | 3187 |
| 739 | Ga0495624_0292209 | 3300046690 | Bacteria | 983 |
| 740 | Ga0495670_0000143 | 3300046691 | Bacteria | 31142 |
| 741 | Ga0495670_0001120 | 3300046691 | Bacteria | 12994 |
| 742 | Ga0495670_0010421 | 3300046691 | Bacteria | 4566 |
| 743 | Ga0495670_0013539 | 3300046691 | Bacteria | 4011 |
| 744 | Ga0495670_0035185 | 3300046691 | Bacteria | 2495 |
| 745 | Ga0495670_0079714 | 3300046691 | Bacteria | 1667 |
| 746 | Ga0495670_0081229 | 3300046691 | Bacteria | 1651 |
| 747 | Ga0495670_0247697 | 3300046691 | Bacteria | 949 |
| 748 | Ga0495671_0000658 | 3300046692 | Bacteria | 25041 |
| 749 | Ga0495671_0001049 | 3300046692 | Bacteria | 19213 |
| 750 | Ga0495671_0019545 | 3300046692 | Bacteria | 3578 |
| 751 | Ga0495671_0031072 | 3300046692 | Bacteria | 2731 |
| 752 | Ga0495671_0127303 | 3300046692 | Bacteria | 1242 |
| 753 | Ga0495671_0154071 | 3300046692 | Bacteria | 1118 |
| 754 | Ga0495649_0003442 | 3300046694 | Bacteria | 10671 |
| 755 | Ga0495649_0009418 | 3300046694 | Bacteria | 5808 |
| 756 | Ga0495649_0015222 | 3300046694 | Bacteria | 4379 |
| 757 | Ga0495649_0027732 | 3300046694 | Bacteria | 3141 |
| 758 | Ga0495649_0048732 | 3300046694 | Bacteria | 2302 |
| 759 | Ga0495589_0000017 | 3300046794 | Bacteria | 206113 |
| 760 | Ga0495589_0000513 | 3300046794 | Bacteria | 27274 |
| 761 | Ga0495589_0001742 | 3300046794 | Bacteria | 12371 |
| 762 | Ga0495589_0004248 | 3300046794 | Bacteria | 7661 |
| 763 | Ga0495589_0011131 | 3300046794 | Bacteria | 4668 |
| 764 | Ga0495589_0013061 | 3300046794 | Bacteria | 4289 |
| 765 | Ga0495589_0020691 | 3300046794 | Bacteria | 3364 |
| 766 | Ga0495589_0022368 | 3300046794 | Bacteria | 3226 |
| 767 | Ga0495589_0043009 | 3300046794 | Bacteria | 2250 |
| 768 | Ga0495589_0082237 | 3300046794 | Bacteria | 1566 |
| 769 | Ga0495600_0000834 | 3300046809 | Bacteria | 16422 |
| 770 | Ga0495600_0006403 | 3300046809 | Bacteria | 7166 |
| 771 | Ga0495600_0131479 | 3300046809 | Bacteria | 1627 |
| 772 | Ga0495660_0000067 | 3300046810 | Bacteria | 119390 |
| 773 | Ga0495660_0002349 | 3300046810 | Bacteria | 12097 |
| 774 | Ga0495660_0004163 | 3300046810 | Bacteria | 8799 |
| 775 | Ga0495660_0007858 | 3300046810 | Bacteria | 6263 |
| 776 | Ga0495660_0014127 | 3300046810 | Bacteria | 4624 |
| 777 | Ga0495660_0047272 | 3300046810 | Bacteria | 2357 |
| 778 | Ga0495660_0059026 | 3300046810 | Bacteria | 2064 |
| 779 | Ga0495660_0063365 | 3300046810 | Bacteria | 1980 |
| 780 | Ga0495660_0128657 | 3300046810 | Bacteria | 1272 |
| 781 | Ga0495660_0166579 | 3300046810 | Bacteria | 1076 |
| 782 | Ga0495581_0009510 | 3300047315 | Bacteria | 5625 |
| 783 | Ga0495581_0018889 | 3300047315 | Bacteria | 4001 |
| 784 | Ga0495581_0055668 | 3300047315 | Bacteria | 2282 |
| 785 | Ga0495604_0004591 | 3300047317 | Bacteria | 10939 |
| 786 | Ga0495604_0034285 | 3300047317 | Bacteria | 4016 |
| 787 | Ga0495604_0246697 | 3300047317 | Bacteria | 1219 |
| 788 | Ga0495604_0437459 | 3300047317 | Bacteria | 856 |
| 789 | Ga0495636_0000388 | 3300047318 | Bacteria | 16592 |
| 790 | Ga0495636_0003301 | 3300047318 | Bacteria | 6250 |
| 791 | Ga0495636_0004667 | 3300047318 | Bacteria | 5374 |
| 792 | Ga0495636_0009037 | 3300047318 | Bacteria | 3918 |
| 793 | Ga0495636_0023781 | 3300047318 | Bacteria | 2482 |
| 794 | Ga0495636_0061353 | 3300047318 | Bacteria | 1590 |
| 795 | Ga0495636_0135464 | 3300047318 | Bacteria | 1097 |
| 796 | Ga0495674_0221331 | 3300047319 | Bacteria | 1564 |
| 797 | Ga0495672_0000067 | 3300047320 | Bacteria | 190335 |
| 798 | Ga0495672_0000343 | 3300047320 | Bacteria | 59629 |
| 799 | Ga0495672_0000718 | 3300047320 | Bacteria | 36426 |
| 800 | Ga0495672_0001478 | 3300047320 | Bacteria | 23059 |
| 801 | Ga0495672_0003293 | 3300047320 | Bacteria | 13969 |
| 802 | Ga0495672_0004198 | 3300047320 | Bacteria | 11934 |
| 803 | Ga0495672_0034084 | 3300047320 | Bacteria | 3149 |
| 804 | Ga0495672_0052482 | 3300047320 | Bacteria | 2394 |
| 805 | Ga0495672_0128740 | 3300047320 | Bacteria | 1334 |
| 806 | Ga0495676_0000067 | 3300047321 | Bacteria | 80084 |
| 807 | Ga0495676_0028953 | 3300047321 | Bacteria | 4722 |
| 808 | Ga0495676_0461324 | 3300047321 | Bacteria | 837 |
| 809 | Ga0495683_0000083 | 3300047323 | Bacteria | 93743 |
| 810 | Ga0495683_0000348 | 3300047323 | Bacteria | 38313 |
| 811 | Ga0495683_0002803 | 3300047323 | Bacteria | 10339 |
| 812 | Ga0495683_0006314 | 3300047323 | Bacteria | 6481 |
| 813 | Ga0495683_0019894 | 3300047323 | Bacteria | 3463 |
| 814 | Ga0495683_0022607 | 3300047323 | Bacteria | 3233 |
| 815 | Ga0495683_0057907 | 3300047323 | Bacteria | 1925 |
| 816 | Ga0495683_0078187 | 3300047323 | Bacteria | 1616 |
| 817 | Ga0495683_0079896 | 3300047323 | Bacteria | 1596 |
| 818 | Ga0495687_000033 | 3300047443 | Bacteria | 263788 |
| 819 | Ga0495687_000126 | 3300047443 | Bacteria | 117879 |
| 820 | Ga0495687_000252 | 3300047443 | Bacteria | 72401 |
| 821 | Ga0495687_000640 | 3300047443 | Bacteria | 40137 |
| 822 | Ga0495687_008102 | 3300047443 | Bacteria | 6070 |
| 823 | Ga0495687_010751 | 3300047443 | Bacteria | 4988 |
| 824 | Ga0495687_010893 | 3300047443 | Bacteria | 4939 |
| 825 | Ga0495687_022520 | 3300047443 | Bacteria | 3022 |
| 826 | Ga0495675_0003787 | 3300047444 | Bacteria | 9148 |
| 827 | Ga0495675_0030000 | 3300047444 | Bacteria | 3470 |
| 828 | Ga0495675_0088516 | 3300047444 | Bacteria | 1944 |
| 829 | Ga0495677_0000002 | 3300047445 | Bacteria | 346767 |
| 830 | Ga0495677_0005091 | 3300047445 | Bacteria | 5003 |
| 831 | Ga0495677_0008034 | 3300047445 | Bacteria | 3920 |
| 832 | Ga0495677_0008164 | 3300047445 | Bacteria | 3888 |
| 833 | Ga0495677_0014812 | 3300047445 | Bacteria | 2836 |
| 834 | Ga0495677_0021668 | 3300047445 | Bacteria | 2329 |
| 835 | Ga0495677_0032123 | 3300047445 | Bacteria | 1911 |
| 836 | Ga0495677_0044837 | 3300047445 | Bacteria | 1621 |
| 837 | Ga0495677_0051623 | 3300047445 | Bacteria | 1514 |
| 838 | Ga0495677_0098020 | 3300047445 | Bacteria | 1108 |
| 839 | Ga0495677_0128864 | 3300047445 | Bacteria | 968 |
| 840 | Ga0495679_008082 | 3300047446 | Bacteria | 4310 |
| 841 | Ga0495679_008137 | 3300047446 | Bacteria | 4292 |
| 842 | Ga0495679_019799 | 3300047446 | Bacteria | 2356 |
| 843 | Ga0495679_034537 | 3300047446 | Bacteria | 1608 |
| 844 | Ga0495679_074564 | 3300047446 | Bacteria | 971 |
| 845 | Ga0495685_000053 | 3300047447 | Bacteria | 45514 |
| 846 | Ga0495685_000183 | 3300047447 | Bacteria | 20748 |
| 847 | Ga0495685_001317 | 3300047447 | Bacteria | 7585 |
| 848 | Ga0495685_004689 | 3300047447 | Bacteria | 4434 |
| 849 | Ga0495685_016533 | 3300047447 | Bacteria | 2521 |
| 850 | Ga0495673_0000265 | 3300047469 | Bacteria | 72840 |
| 851 | Ga0495681_0000321 | 3300047470 | Bacteria | 38154 |
| 852 | Ga0495681_0007275 | 3300047470 | Bacteria | 7112 |
| 853 | Ga0495681_0016273 | 3300047470 | Bacteria | 4176 |
| 854 | Ga0495681_0030372 | 3300047470 | Bacteria | 2752 |
| 855 | Ga0495681_0032989 | 3300047470 | Bacteria | 2599 |
| 856 | Ga0495681_0046396 | 3300047470 | Bacteria | 2072 |
| 857 | Ga0495686_0000628 | 3300047472 | Bacteria | 48588 |
| 858 | Ga0495686_0033337 | 3300047472 | Bacteria | 3326 |
| 859 | Ga0495686_0040123 | 3300047472 | Bacteria | 2987 |
| 860 | Ga0495686_0091644 | 3300047472 | Bacteria | 1844 |
| 861 | Ga0495686_0129523 | 3300047472 | Bacteria | 1497 |
| 862 | Ga0495686_0181975 | 3300047472 | Bacteria | 1217 |
| 863 | Ga0495593_0054376 | 3300047673 | Bacteria | 2110 |
| 864 | Ga0495602_0024798 | 3300048088 | Bacteria | 5814 |
| 865 | Ga0495602_0104784 | 3300048088 | Bacteria | 2313 |
| 866 | Ga0495602_0159563 | 3300048088 | Bacteria | 1762 |
| 867 | Ga0495614_0001110 | 3300048089 | Bacteria | 11534 |
| 868 | Ga0495614_0018070 | 3300048089 | Bacteria | 3056 |
| 869 | Ga0495615_0001150 | 3300048090 | Bacteria | 3817 |
| 870 | Ga0495615_0029638 | 3300048090 | Bacteria | 1300 |
| 871 | Ga0495626_0000097 | 3300048091 | Bacteria | 113925 |
| 872 | Ga0495626_0000209 | 3300048091 | Bacteria | 70145 |
| 873 | Ga0495626_0000258 | 3300048091 | Bacteria | 60668 |
| 874 | Ga0495626_0003284 | 3300048091 | Bacteria | 10440 |
| 875 | Ga0495626_0007634 | 3300048091 | Bacteria | 5998 |
| 876 | Ga0495626_0011560 | 3300048091 | Bacteria | 4666 |
| 877 | Ga0495626_0016093 | 3300048091 | Bacteria | 3809 |
| 878 | Ga0495626_0018518 | 3300048091 | Bacteria | 3495 |
| 879 | Ga0495626_0021333 | 3300048091 | Bacteria | 3214 |
| 880 | Ga0495626_0026399 | 3300048091 | Bacteria | 2831 |
| 881 | Ga0495626_0044605 | 3300048091 | Bacteria | 2073 |
| 882 | Ga0495626_0049911 | 3300048091 | Bacteria | 1935 |
| 883 | Ga0495626_0059885 | 3300048091 | Bacteria | 1736 |
| 884 | Ga0495626_0145896 | 3300048091 | Bacteria | 1000 |
| 885 | Ga0496100_0052012 | 3300048903 | Bacteria | 2661 |
| 886 | Ga0496100_0159307 | 3300048903 | Bacteria | 1617 |
| 887 | Ga0496101_0044781 | 3300048904 | Bacteria | 3167 |
| 888 | Ga0496101_0092574 | 3300048904 | Bacteria | 2251 |
| 889 | Ga0496102_0000313 | 3300048905 | Bacteria | 61085 |
| 890 | Ga0496102_0000487 | 3300048905 | Bacteria | 43875 |
| 891 | Ga0496102_0055639 | 3300048905 | Bacteria | 3607 |
| 892 | Ga0496102_0420493 | 3300048905 | Bacteria | 1255 |
| 893 | Ga0496103_0091804 | 3300048906 | Bacteria | 1916 |
| 894 | Ga0496103_0231148 | 3300048906 | Bacteria | 1189 |
| 895 | Ga0496103_0422697 | 3300048906 | Bacteria | 855 |
| 896 | Ga0496103_0443694 | 3300048906 | Bacteria | 832 |
| 897 | Ga0496103_0450071 | 3300048906 | Bacteria | 826 |
| 898 | Ga0496104_0848884 | 3300048907 | Bacteria | 819 |
| 899 | Ga0496106_0006127 | 3300048909 | Bacteria | 8896 |
| 900 | Ga0496107_0075821 | 3300048910 | Bacteria | 2448 |
| 901 | Ga0496107_0293454 | 3300048910 | Bacteria | 1210 |
| 902 | Ga0496108_0217414 | 3300048911 | Bacteria | 1660 |
| 903 | Ga0496108_0711016 | 3300048911 | Bacteria | 871 |
| 904 | Ga0496109_0068134 | 3300048912 | Bacteria | 3262 |
| 905 | Ga0496109_0229028 | 3300048912 | Bacteria | 1748 |
| 906 | Ga0496110_0000024 | 3300048913 | Bacteria | 74685 |
| 907 | Ga0496110_0104634 | 3300048913 | Bacteria | 2539 |
| 908 | Ga0496110_0570064 | 3300048913 | Bacteria | 1028 |
| 909 | Ga0496111_0635735 | 3300048914 | Bacteria | 779 |
| 910 | Ga0496112_0367515 | 3300048915 | Bacteria | 1380 |
| 911 | Ga0496112_0755078 | 3300048915 | Bacteria | 899 |
| 912 | Ga0496113_0019700 | 3300048916 | Bacteria | 4726 |
| 913 | Ga0496114_0047812 | 3300048917 | Bacteria | 3558 |
| 914 | Ga0496114_0067969 | 3300048917 | Bacteria | 2991 |
| 915 | Ga0496114_0478533 | 3300048917 | Bacteria | 1102 |
| 916 | Ga0496115_0026659 | 3300048918 | Bacteria | 4512 |
| 917 | Ga0496115_0056234 | 3300048918 | Bacteria | 3162 |
| 918 | Ga0496115_0082225 | 3300048918 | Bacteria | 2623 |
| 919 | Ga0496115_0215720 | 3300048918 | Bacteria | 1584 |
| 920 | Ga0496115_0555710 | 3300048918 | Bacteria | 917 |
| 921 | Ga0496116_0026481 | 3300048919 | Bacteria | 4240 |
| 922 | Ga0496118_0131119 | 3300048921 | Bacteria | 1609 |
| 923 | Ga0496121_0095442 | 3300048924 | Bacteria | 2311 |
| 924 | Ga0496121_0154136 | 3300048924 | Bacteria | 1687 |
| 925 | Ga0496121_0514578 | 3300048924 | Bacteria | 757 |
| 926 | Ga0496122_0000439 | 3300048925 | Bacteria | 87380 |
| 927 | Ga0496122_0002153 | 3300048925 | Bacteria | 28900 |
| 928 | Ga0496122_0004757 | 3300048925 | Bacteria | 16624 |
| 929 | Ga0496122_0011837 | 3300048925 | Bacteria | 8770 |
| 930 | Ga0496123_0000487 | 3300048926 | Bacteria | 69019 |
| 931 | Ga0496123_0003789 | 3300048926 | Bacteria | 16558 |
| 932 | Ga0496123_0022480 | 3300048926 | Bacteria | 4858 |
| 933 | Ga0496124_0016901 | 3300048927 | Bacteria | 6913 |
| 934 | Ga0496124_0021248 | 3300048927 | Bacteria | 5984 |
| 935 | Ga0496124_0023141 | 3300048927 | Bacteria | 5680 |
| 936 | Ga0496124_0045759 | 3300048927 | Bacteria | 3751 |
| 937 | Ga0496124_0076458 | 3300048927 | Bacteria | 2763 |
| 938 | Ga0496124_0303252 | 3300048927 | Bacteria | 1152 |
| 939 | Ga0496125_0001079 | 3300048928 | Bacteria | 41999 |
| 940 | Ga0496125_0003984 | 3300048928 | Bacteria | 17378 |
| 941 | Ga0496125_0099527 | 3300048928 | Bacteria | 2147 |
| 942 | Ga0496125_0182288 | 3300048928 | Bacteria | 1397 |
| 943 | Ga0496125_0246345 | 3300048928 | Bacteria | 1131 |
| 944 | Ga0496126_0060200 | 3300048929 | Bacteria | 3416 |
| 945 | Ga0496126_0224826 | 3300048929 | Bacteria | 1575 |
| 946 | Ga0501308_013232 | 3300049128 | Bacteria | 952 |
| 947 | Ga0501304_003196 | 3300049160 | Bacteria | 1188 |
| 948 | Ga0501305_039264 | 3300049161 | Bacteria | 765 |
| 949 | Ga0495678_000131 | 3300049459 | Bacteria | 88620 |
| 950 | Ga0495678_000355 | 3300049459 | Bacteria | 47179 |
| 951 | Ga0495678_001074 | 3300049459 | Bacteria | 23088 |
| 952 | Ga0495678_003680 | 3300049459 | Bacteria | 9283 |
| 953 | Ga0495678_004358 | 3300049459 | Bacteria | 8225 |
| 954 | Ga0495678_015158 | 3300049459 | Bacteria | 3558 |
| 955 | Ga0495678_033475 | 3300049459 | Bacteria | 2120 |
| 956 | Ga0495678_193161 | 3300049459 | Bacteria | 631 |
| 957 | Ga0495682_0000779 | 3300049460 | Bacteria | 20252 |
| 958 | Ga0495682_0001850 | 3300049460 | Bacteria | 10612 |
| 959 | Ga0495682_0002874 | 3300049460 | Bacteria | 7921 |
| 960 | Ga0495682_0004757 | 3300049460 | Bacteria | 5734 |
| 961 | Ga0501300_033155 | 3300049523 | Bacteria | 765 |
| 962 | Ga0501207_006845 | 3300049654 | Bacteria | 1611 |
| 963 | Ga0501280_000079 | 3300049776 | Bacteria | 25935 |
| 964 | Ga0501282_010548 | 3300049778 | Bacteria | 992 |
| 965 | Ga0501035_0005808 | 3300049822 | Bacteria | 11635 |
| 966 | nmdc:mga00v17_230903_c1 | 3300050491 | Bacteria | 1199 |
| 967 | nmdc:mga0yw44_175167_c1 | 3300050492 | Bacteria | 1410 |
| 968 | Ga0495601_0021365 | 3300053077 | Bacteria | 3963 |
| 969 | Ga0495601_0323983 | 3300053077 | Bacteria | 1003 |
| 970 | Ga0495655_0154964 | 3300053083 | Bacteria | 723 |
| 971 | Ga0500583_0004765 | 3300053092 | Bacteria | 4467 |
| 972 | Ga0500650_0000077 | 3300053098 | Bacteria | 28370 |
| 973 | Ga0500594_0017715 | 3300053118 | Bacteria | 1747 |
| 974 | Ga0500614_159553 | 3300053123 | Bacteria | 683 |
| 975 | Ga0500618_000301 | 3300053125 | Bacteria | 37462 |
| 976 | Ga0500618_000821 | 3300053125 | Bacteria | 17044 |
| 977 | Ga0500564_049825 | 3300053138 | Bacteria | 1917 |
| 978 | Ga0500574_000358 | 3300053141 | Bacteria | 5632 |
| 979 | Ga0500622_0279307 | 3300053156 | Bacteria | 720 |
| 980 | Ga0500634_0016724 | 3300053161 | Bacteria | 3917 |
| 981 | Ga0500661_019973 | 3300055283 | Bacteria | 1191 |
| 982 | Ga0587066_023808 | 3300059490 | Bacteria | 1037 |
| 983 | Ga0587066_089812 | 3300059490 | Bacteria | 680 |
| 984 | Ga0587070_012124 | 3300059491 | Bacteria | 1303 |
| 985 | Ga0587077_006576 | 3300059493 | Bacteria | 1653 |
| 986 | Ga0587077_025555 | 3300059493 | Bacteria | 1084 |
| 987 | Ga0587080_010270 | 3300059503 | Bacteria | 1377 |
| 988 | Ga0587083_0023065 | 3300059505 | Bacteria | 1171 |
| 989 | Ga0587085_003884 | 3300059506 | Bacteria | 1662 |
| 990 | Ga0587086_011885 | 3300059507 | Bacteria | 1074 |
| 991 | Ga0587090_001134 | 3300059510 | Bacteria | 2599 |
| 992 | Ga0587090_013222 | 3300059510 | Bacteria | 1190 |
| 993 | Ga0587091_019150 | 3300059511 | Bacteria | 1173 |
| 994 | Ga0587091_019940 | 3300059511 | Bacteria | 1159 |
| 995 | Ga0587106_021228 | 3300059605 | Bacteria | 966 |
| 996 | Ga0587101_054991 | 3300059623 | Bacteria | 696 |
| 997 | Ga0587109_014206 | 3300059624 | Bacteria | 1333 |
| 998 | Ga0587117_016597 | 3300059627 | Bacteria | 982 |
| 999 | Ga0587062_011715 | 3300059639 | Bacteria | 1112 |
| 1000 | Ga0587067_015649 | 3300059640 | Bacteria | 1234 |
| 1001 | Ga0587067_020457 | 3300059640 | Bacteria | 1132 |
| 1002 | Ga0587068_016177 | 3300059641 | Bacteria | 1181 |
| 1003 | Ga0587069_016163 | 3300059642 | Bacteria | 1063 |
| 1004 | Ga0587069_022812 | 3300059642 | Bacteria | 953 |
| 1005 | Ga0587072_005287 | 3300059643 | Bacteria | 1923 |
| 1006 | Ga0587072_025780 | 3300059643 | Bacteria | 1071 |
| 1007 | Ga0587078_011383 | 3300059646 | Bacteria | 1032 |
| 1008 | Ga0587079_043002 | 3300059647 | Bacteria | 920 |
| 1009 | Ga0587105_003927 | 3300059651 | Bacteria | 929 |
| 1010 | Ga0587071_065599 | 3300060344 | Bacteria | 780 |
| 1011 | Ga0587111_0001153 | 3300060346 | Bacteria | 3028 |
| 1012 | Ga0466962_0032893 | 3300061719 | Bacteria | 2481 |
| 1013 | Ga0466962_0091908 | 3300061719 | Bacteria | 1454 |
| 1014 | 2511250064 | 2511231003 | Bacteria | 5606035 |
| 1015 | 2511383608 | 2511231026 | Bacteria | 5225445 |
| 1016 | 2521557364 | 2521172590 | Bacteria | 5047645 |
| 1017 | 2550693247 | 2548876994 | Bacteria | 4904866 |
| 1018 | 2553005285 | 2551306416 | Bacteria | 6152985 |
| 1019 | 2643791370 | 2643221554 | Bacteria | 6603920 |
| 1020 | 2643800212 | 2643221556 | Bacteria | 7251154 |
| 1021 | 2644027726 | 2643221603 | Bacteria | 6147767 |
| 1022 | 2644215594 | 2643221638 | Bacteria | 6579467 |
| 1023 | 2644251577 | 2643221645 | Bacteria | 7207331 |
| 1024 | 2644358246 | 2643221664 | Bacteria | 7272945 |
| 1025 | 2644472006 | 2643221684 | Bacteria | 7145183 |
| 1026 | 2738742420 | 2738541280 | Bacteria | 6630198 |
| 1027 | 2738845373 | 2738541300 | Bacteria | 6675882 |
| 1028 | 2739276426 | 2738543018 | Bacteria | 6718814 |
| 1029 | 2739345470 | 2738543030 | Bacteria | 6719714 |
| 1030 | 2765568487 | 2765235838 | Bacteria | 5445269 |
| 1031 | 2808981228 | 2808606386 | Bacteria | 4471946 |
| 1032 | 2809131718 | 2808606415 | Bacteria | 4576710 |
| 1033 | 2809142462 | 2808606418 | Bacteria | 6724496 |
| 1034 | 2809151470 | 2808606419 | Bacteria | 4576925 |
| 1035 | 2819543187 | 2818991436 | Bacteria | 5376622 |
| 1036 | 2819592044 | 2818991445 | Bacteria | 4955017 |
| 1037 | 2819617647 | 2818991449 | Bacteria | 5518009 |
| 1038 | 2821133472 | 2821131069 | Bacteria | 6108407 |
| 1039 | 2839096648 | 2839094727 | Bacteria | 5534556 |
| 1040 | 2852620954 | 2852618963 | Bacteria | 4577824 |
| 1041 | 2884813179 | 2884811622 | Bacteria | 5552861 |
| 1042 | 2884840539 | 2884836552 | Bacteria | 5219991 |
| 1043 | 2884855796 | 2884852848 | Bacteria | 5221161 |
| 1044 | 2896157279 | 2896154374 | Bacteria | 5221518 |
| 1045 | 2904439898 | 2904439833 | Bacteria | 5931679 |
| 1046 | 2904531153 | 2904530477 | Bacteria | 5876334 |
| 1047 | 2904587200 | 2904584206 | Bacteria | 6028872 |
| 1048 | 2904592766 | 2904589729 | Bacteria | 6113573 |
| 1049 | 2904604452 | 2904601388 | Bacteria | 5884906 |
| 1050 | 2919050215 | 2919046199 | Bacteria | 5567169 |
| 1051 | 2919082273 | 2919079590 | Bacteria | 5946433 |
| 1052 | 2923516029 | 2923510766 | Bacteria | 5926163 |
| 1053 | 2928133217 | 2928130867 | Bacteria | 5467269 |
| 1054 | 8047674766 | 8047673197 | Bacteria | 7395230 |
| 1055 | Ga0495588_0014347 | |||
| 1056 | JGI25155J39150_1000363 | |||
| 1057 | JGI25155J39150_1000557 | |||
| 1058 | JGI25156J39149_1000170 | |||
| 1059 | JGI25156J39149_1001095 | |||
| 1060 | JGI25162J39368_1000026 | |||
| 1061 | JGI25162J39368_1010038 | |||
| 1062 | JGI25154J39366_1000351 | |||
| 1063 | JGI25154J39366_1000415 | |||
| 1064 | JGI25157J39369_1000170 | |||
| 1065 | JGI25157J39369_1000605 | |||
| 1066 | JGI25159J45721_1004210 | |||
| 1067 | JGI25159J45721_1008279 | |||
| 1068 | JGI25165J46597_1000031 | |||
| 1069 | JGI25161J50226_1001131 | |||
| 1070 | Ga0007417J51691_1071950 | |||
| 1071 | Ga0007416J51690_1059972 | |||
| 1072 | Ga0032354_1079230 | |||
| 1073 | Ga0055538_1000018 | |||
| 1074 | Ga0055539_1000023 | |||
| 1075 | Ga0055533_1000031 | |||
| 1076 | Ga0055532_1000017 | |||
| 1077 | Ga0055525_1000029 | |||
| 1078 | Ga0055525_1000039 | |||
| 1079 | Ga0055542_1021560 | |||
| 1080 | Ga0055526_1000068 | |||
| 1081 | Ga0055526_1001163 | |||
| 1082 | Ga0055526_1005093 | |||
| 1083 | Ga0055526_1007187 | |||
| 1084 | Ga0055537_1000678 | |||
| 1085 | Ga0055524_1000021 | |||
| 1086 | Ga0055524_1003016 | |||
| 1087 | Ga0055524_1005587 | |||
| 1088 | Ga0055524_1013711 | |||
| 1089 | Ga0055534_1000195 | |||
| 1090 | Ga0055534_1004625 | |||
| 1091 | Ga0055528_1000368 | |||
| 1092 | Ga0055530_10003380 | |||
| 1093 | Ga0055541_1000016 | |||
| 1094 | Ga0055543_1001470 | |||
| 1095 | Ga0065165_1004144 | |||
| 1096 | Ga0065165_1046881 | |||
| 1097 | Ga0070658_10447686 | |||
| 1098 | Ga0070670_100000017 | |||
| 1099 | Ga0070670_100008239 | |||
| 1100 | Ga0070666_10001017 | |||
| 1101 | Ga0070666_10403118 | |||
| 1102 | Ga0070682_100516816 | |||
| 1103 | Ga0070660_100000420 | |||
| 1104 | Ga0070660_100018151 | |||
| 1105 | Ga0070660_100081746 | |||
| 1106 | Ga0070660_100422141 | |||
| 1107 | Ga0070689_100111630 | |||
| 1108 | Ga0070661_100098624 | |||
| 1109 | Ga0070661_100127414 | |||
| 1110 | Ga0070668_100007166 | |||
| 1111 | Ga0070669_100028281 | |||
| 1112 | Ga0070669_100039493 | |||
| 1113 | Ga0070675_100029487 | |||
| 1114 | Ga0070671_100000173 | |||
| 1115 | Ga0070671_100099885 | |||
| 1116 | Ga0070673_100010734 | |||
| 1117 | Ga0070688_100003318 | |||
| 1118 | Ga0070688_100019613 | |||
| 1119 | Ga0070659_100115125 | |||
| 1120 | Ga0070659_100117647 | |||
| 1121 | Ga0070659_100170659 | |||
| 1122 | Ga0070667_100001097 | |||
| 1123 | Ga0070667_100003801 | |||
| 1124 | Ga0070663_100390729 | |||
| 1125 | Ga0070678_100004615 | |||
| 1126 | Ga0068867_100003865 | |||
| 1127 | Ga0070685_10000026 | |||
| 1128 | Ga0070685_10172828 | |||
| 1129 | Ga0070665_100285816 | |||
| 1130 | Ga0068855_100001073 | |||
| 1131 | Ga0068855_100018683 | |||
| 1132 | Ga0068855_100206715 | |||
| 1133 | Ga0068855_100544190 | |||
| 1134 | Ga0070664_100029568 | |||
| 1135 | Ga0070664_100057458 | |||
| 1136 | Ga0070664_100100244 | |||
| 1137 | Ga0068857_100708483 | |||
| 1138 | Ga0068854_100006965 | |||
| 1139 | Ga0068856_100506920 | |||
| 1140 | Ga0068856_100833244 | |||
| 1141 | Ga0068852_100220358 | |||
| 1142 | Ga0068852_100574624 | |||
| 1143 | Ga0068859_100317621 | |||
| 1144 | Ga0068864_100000029 | |||
| 1145 | Ga0068861_100127381 | |||
| 1146 | Ga0068851_10336586 | |||
| 1147 | Ga0068863_100600276 | |||
| 1148 | Ga0068858_100133592 | |||
| 1149 | Ga0068860_100000228 | |||
| 1150 | Ga0068860_101144895 | |||
| 1151 | Ga0068862_100069792 | |||
| 1152 | Ga0068862_100089363 | |||
| 1153 | Ga0075365_10197172 | |||
| 1154 | Ga0075364_10446427 | |||
| 1155 | Ga0075367_10558457 | |||
| 1156 | Ga0075366_10026204 | |||
| 1157 | Ga0097621_100441709 | |||
| 1158 | Ga0068871_100939794 | |||
| 1159 | Ga0097620_100317629 | |||
| 1160 | Ga0079104_1008344 | |||
| 1161 | Ga0099826_10000041 | |||
| 1162 | Ga0105251_10236994 | |||
| 1163 | Ga0105240_10009083 | |||
| 1164 | Ga0105240_10011970 | |||
| 1165 | Ga0105240_10020783 | |||
| 1166 | Ga0105241_10016300 | |||
| 1167 | Ga0105248_10006207 | |||
| 1168 | Ga0105237_10135525 | |||
| 1169 | Ga0105237_10259678 | |||
| 1170 | Ga0105238_10000065 | |||
| 1171 | Ga0105238_10150406 | |||
| 1172 | Ga0105238_10233962 | |||
| 1173 | Ga0105238_10262147 | |||
| 1174 | Ga0105249_10901723 | |||
| 1175 | Ga0105239_10009136 | |||
| 1176 | Ga0105239_10457761 | |||
| 1177 | Ga0105239_11353967 | |||
| 1178 | Ga0157373_10037009 | |||
| 1179 | Ga0157371_10000013 | |||
| 1180 | Ga0157371_10374609 | |||
| 1181 | Ga0157374_10014078 | |||
| 1182 | Ga0157378_10351285 | |||
| 1183 | Ga0157378_10667619 | |||
| 1184 | Ga0163162_10003303 | |||
| 1185 | Ga0163162_10609494 | |||
| 1186 | Ga0163163_10423409 | |||
| 1187 | Ga0157380_10007300 | |||
| 1188 | Ga0182008_10046094 | |||
| 1189 | Ga0182008_10057555 | |||
| 1190 | Ga0157379_10015472 | |||
| 1191 | Ga0157379_10637077 | |||
| 1192 | Ga0182006_1016620 | |||
| 1193 | Ga0182006_1029100 | |||
| 1194 | Ga0182006_1050588 | |||
| 1195 | Ga0182006_1174230 | |||
| 1196 | Ga0182007_10031167 | |||
| 1197 | Ga0182007_10115956 | |||
| 1198 | Ga0182005_1003156 | |||
| 1199 | Ga0163161_10032386 | |||
| 1200 | Ga0213872_10000242 | |||
| 1201 | Ga0213872_10000443 | |||
| 1202 | Ga0213872_10001513 | |||
| 1203 | Ga0213872_10001692 | |||
| 1204 | Ga0213872_10019294 | |||
| 1205 | Ga0213872_10019678 | |||
| 1206 | Ga0213872_10044898 | |||
| 1207 | Ga0213872_10091690 | |||
| 1208 | Ga0213872_10108111 | |||
| 1209 | Ga0213872_10156063 | |||
| 1210 | Ga0213876_10076148 | |||
| 1211 | Ga0209435_100015 | |||
| 1212 | Ga0209435_100161 | |||
| 1213 | Ga0209760_100622 | |||
| 1214 | Ga0209436_101543 | |||
| 1215 | Ga0209784_100027 | |||
| 1216 | Ga0209566_100027 | |||
| 1217 | Ga0209674_100044 | |||
| 1218 | Ga0209672_102164 | |||
| 1219 | Ga0209147_100004 | |||
| 1220 | Ga0209563_100003 | |||
| 1221 | Ga0209563_100048 | |||
| 1222 | Ga0207427_100643 | |||
| 1223 | Ga0209437_100045 | |||
| 1224 | Ga0209437_100055 | |||
| 1225 | Ga0209437_108693 | |||
| 1226 | Ga0209437_110183 | |||
| 1227 | Ga0209258_100226 | |||
| 1228 | Ga0209646_1000020 | |||
| 1229 | Ga0209646_1000040 | |||
| 1230 | Ga0209646_1000077 | |||
| 1231 | Ga0209026_1000034 | |||
| 1232 | Ga0209026_1009492 | |||
| 1233 | Ga0209026_1016102 | |||
| 1234 | Ga0209677_100028 | |||
| 1235 | Ga0209148_1001819 | |||
| 1236 | Ga0209759_1000049 | |||
| 1237 | Ga0209759_1000357 | |||
| 1238 | Ga0209233_1000070 | |||
| 1239 | Ga0209565_1000015 | |||
| 1240 | Ga0209565_1001939 | |||
| 1241 | Ga0209455_1000169 | |||
| 1242 | Ga0209455_1008089 | |||
| 1243 | Ga0209673_1000394 | |||
| 1244 | Ga0209130_1001054 | |||
| 1245 | Ga0209675_1000012 | |||
| 1246 | Ga0209675_1001711 | |||
| 1247 | Ga0209564_1000016 | |||
| 1248 | Ga0209564_1000071 | |||
| 1249 | Ga0209564_1000072 | |||
| 1250 | Ga0209564_1028688 | |||
| 1251 | Ga0209050_1000240 | |||
| 1252 | Ga0209256_1000044 | |||
| 1253 | Ga0209256_1000076 | |||
| 1254 | Ga0209256_1003100 | |||
| 1255 | Ga0207426_1054078 | |||
| 1256 | Ga0207680_10014776 | |||
| 1257 | Ga0207705_10017557 | |||
| 1258 | Ga0207654_10004697 | |||
| 1259 | Ga0207695_10001341 | |||
| 1260 | Ga0207695_10005745 | |||
| 1261 | Ga0207695_10438637 | |||
| 1262 | Ga0207671_10037277 | |||
| 1263 | Ga0207671_10307253 | |||
| 1264 | Ga0207657_10001145 | |||
| 1265 | Ga0207657_10024222 | |||
| 1266 | Ga0207657_10034425 | |||
| 1267 | Ga0207657_10134734 | |||
| 1268 | Ga0207649_10026917 | |||
| 1269 | Ga0207681_10022277 | |||
| 1270 | Ga0207681_10070592 | |||
| 1271 | Ga0207694_10001114 | |||
| 1272 | Ga0207694_10189850 | |||
| 1273 | Ga0207650_10000003 | |||
| 1274 | Ga0207650_10004390 | |||
| 1275 | Ga0207644_10004443 | |||
| 1276 | Ga0207690_10084366 | |||
| 1277 | Ga0207690_10191480 | |||
| 1278 | Ga0207690_10819946 | |||
| 1279 | Ga0207706_10336169 | |||
| 1280 | Ga0207686_10187296 | |||
| 1281 | Ga0207709_10112420 | |||
| 1282 | Ga0207711_10000472 | |||
| 1283 | Ga0207679_10019205 | |||
| 1284 | Ga0207679_10248449 | |||
| 1285 | Ga0207679_10267272 | |||
| 1286 | Ga0207667_10000078 | |||
| 1287 | Ga0207667_10023739 | |||
| 1288 | Ga0207667_10041450 | |||
| 1289 | Ga0207667_10217165 | |||
| 1290 | Ga0207667_10297414 | |||
| 1291 | Ga0207712_10135816 | |||
| 1292 | Ga0207668_10007151 | |||
| 1293 | Ga0207668_10118956 | |||
| 1294 | Ga0207640_10055935 | |||
| 1295 | Ga0207658_10000012 | |||
| 1296 | Ga0207703_10130918 | |||
| 1297 | Ga0207678_10312327 | |||
| 1298 | Ga0207678_10912544 | |||
| 1299 | Ga0207702_10478919 | |||
| 1300 | Ga0207702_10885972 | |||
| 1301 | Ga0207702_11225745 | |||
| 1302 | Ga0207641_10025128 | |||
| 1303 | Ga0207648_10076849 | |||
| 1304 | Ga0207676_10000003 | |||
| 1305 | Ga0207674_10349182 | |||
| 1306 | Ga0207674_10350919 | |||
| 1307 | Ga0207698_10158976 | |||
| 1308 | Ga0209282_1000001 | |||
| 1309 | Ga0268266_10032903 | |||
| 1310 | Ga0268265_10002832 | |||
| 1311 | Ga0268265_10048589 | |||
| 1312 | Ga0268264_10000009 | |||
| 1313 | Ga0268264_10099773 | |||
| 1314 | Ga0307511_10008326 | |||
| 1315 | Ga0316180_1021737 | |||
| 1316 | Ga0316183_1190372 | |||
| 1317 | Ga0265331_10064063 | |||
| 1318 | Ga0265327_10090693 | |||
| 1319 | Ga0265327_10165282 | |||
| 1320 | Ga0307509_10270648 | |||
| 1321 | Ga0307408_100000239 | |||
| 1322 | Ga0307408_100224828 | |||
| 1323 | Ga0307416_100005633 | |||
| 1324 | Ga0307414_10788244 | |||
| 1325 | Ga0316583_10009603 | |||
| 1326 | Ga0373931_0114275 | |||
| 1327 | Ga0395899_0000128 | |||
| 1328 | Ga0395899_0000753 | |||
| 1329 | Ga0395899_0006694 | |||
| 1330 | Ga0395899_0010304 | |||
| 1331 | Ga0395899_0010704 | |||
| 1332 | Ga0395899_0012339 | |||
| 1333 | Ga0395899_0013728 | |||
| 1334 | Ga0395899_0055314 | |||
| 1335 | Ga0395899_0293240 | |||
| 1336 | Ga0395900_0000123 | |||
| 1337 | Ga0395900_0007904 | |||
| 1338 | Ga0395900_0008621 | |||
| 1339 | Ga0395900_0009260 | |||
| 1340 | Ga0395900_0010088 | |||
| 1341 | Ga0395900_0021826 | |||
| 1342 | Ga0395900_0035310 | |||
| 1343 | Ga0395900_0073035 | |||
| 1344 | Ga0395900_0116934 | |||
| 1345 | Ga0395900_0140769 | |||
| 1346 | Ga0395900_0209971 | |||
| 1347 | Ga0395900_0287131 | |||
| 1348 | Ga0395900_0323735 | |||
| 1349 | Ga0395900_0328620 | |||
| 1350 | Ga0395898_0004536 | |||
| 1351 | Ga0395898_0075038 | |||
| 1352 | Ga0395898_0109879 | |||
| 1353 | Ga0395898_0125841 | |||
| 1354 | Ga0395898_0257386 | |||
| 1355 | Ga0395898_0383923 | |||
| 1356 | Ga0395898_0517499 | |||
| 1357 | Ga0395898_0628288 | |||
| 1358 | Ga0395905_0000905 | |||
| 1359 | Ga0395905_0001709 | |||
| 1360 | Ga0395905_0012941 | |||
| 1361 | Ga0395905_0013998 | |||
| 1362 | Ga0395905_0020397 | |||
| 1363 | Ga0395905_0042482 | |||
| 1364 | Ga0395905_0078281 | |||
| 1365 | Ga0395905_0099213 | |||
| 1366 | Ga0395905_0128099 | |||
| 1367 | Ga0395905_0152274 | |||
| 1368 | Ga0395905_0310643 | |||
| 1369 | Ga0395905_0380827 | |||
| 1370 | Ga0395905_0392670 | |||
| 1371 | Ga0395905_0503627 | |||
| 1372 | Ga0395905_0623628 | |||
| 1373 | Ga0395901_0000411 | |||
| 1374 | Ga0395901_0001908 | |||
| 1375 | Ga0395901_0021000 | |||
| 1376 | Ga0395901_0023907 | |||
| 1377 | Ga0395901_0278987 | |||
| 1378 | Ga0395901_0346430 | |||
| 1379 | Ga0395901_0355927 | |||
| 1380 | Ga0395901_0504377 | |||
| 1381 | Ga0395901_0796251 | |||
| 1382 | Ga0436365_1765823 | |||
| 1383 | Ga0436361_0014452 | |||
| 1384 | Ga0436361_0032641 | |||
| 1385 | Ga0436361_0149158 | |||
| 1386 | Ga0436361_0161443 | |||
| 1387 | Ga0436361_0275924 | |||
| 1388 | Ga0436361_0458162 | |||
| 1389 | Ga0436361_0568983 | |||
| 1390 | Ga0436361_0632651 | |||
| 1391 | Ga0436361_0746087 | |||
| 1392 | Ga0436361_0830100 | |||
| 1393 | Ga0436361_0938544 | |||
| 1394 | Ga0436361_0973589 | |||
| 1395 | Ga0436361_1043948 | |||
| 1396 | Ga0436362_0115419 | |||
| 1397 | Ga0439448_0010043 | |||
| 1398 | Ga0439448_0123959 | |||
| 1399 | Ga0439449_0013722 | |||
| 1400 | Ga0439450_010428 | |||
| 1401 | Ga0439450_018780 | |||
| 1402 | Ga0439455_0106565 | |||
| 1403 | Ga0450897_013149 | |||
| 1404 | Ga0450904_000276 | |||
| 1405 | Ga0439458_0022881 | |||
| 1406 | Ga0451577_0625920 | |||
| 1407 | Ga0466969_0038118 | |||
| 1408 | Ga0466969_0080543 | |||
| 1409 | Ga0466972_0000087 | |||
| 1410 | Ga0466972_0001100 | |||
| 1411 | Ga0466972_0006991 | |||
| 1412 | Ga0466972_0097290 | |||
| 1413 | Ga0466965_0002700 | |||
| 1414 | Ga0466965_0010006 | |||
| 1415 | Ga0466965_0011686 | |||
| 1416 | Ga0466965_0065720 | |||
| 1417 | Ga0466965_0107579 | |||
| 1418 | Ga0466966_0011821 | |||
| 1419 | Ga0466966_0013678 | |||
| 1420 | Ga0466966_0068924 | |||
| 1421 | Ga0466966_0082220 | |||
| 1422 | Ga0466961_0159699 | |||
| 1423 | Ga0466964_0000256 | |||
| 1424 | Ga0466964_0199537 | |||
| 1425 | Ga0466964_0206904 | |||
| 1426 | Ga0453684_0000102 | |||
| 1427 | Ga0466971_0017407 | |||
| 1428 | Ga0466968_0001835 | |||
| 1429 | Ga0466968_0037123 | |||
| 1430 | Ga0466968_0117279 | |||
| 1431 | Ga0466970_0016339 | |||
| 1432 | Ga0466957_0009721 | |||
| 1433 | Ga0466959_0009557 | |||
| 1434 | Ga0466959_0011644 | |||
| 1435 | Ga0466959_0052704 | |||
| 1436 | Ga0466959_0054139 | |||
| 1437 | Ga0466959_0586236 | |||
| 1438 | Ga0451576_0000171 | |||
| 1439 | Ga0451576_0000386 | |||
| 1440 | Ga0451576_0080204 | |||
| 1441 | Ga0451576_0724582 | |||
| 1442 | Ga0466958_0275718 | |||
| 1443 | Ga0466958_0396809 | |||
| 1444 | Ga0466967_0005324 | |||
| 1445 | Ga0495617_000034 | |||
| 1446 | Ga0495617_002482 | |||
| 1447 | Ga0495617_002980 | |||
| 1448 | Ga0495617_008361 | |||
| 1449 | Ga0495627_000876 | |||
| 1450 | Ga0495627_024085 | |||
| 1451 | Ga0495592_0003280 | |||
| 1452 | Ga0495592_0405274 | |||
| 1453 | Ga0495603_0033409 | |||
| 1454 | Ga0495603_0044124 | |||
| 1455 | Ga0495590_0000027 | |||
| 1456 | Ga0495590_0000257 | |||
| 1457 | Ga0495590_0006267 | |||
| 1458 | Ga0495590_0028084 | |||
| 1459 | Ga0495590_0033182 | |||
| 1460 | Ga0495590_0067583 | |||
| 1461 | Ga0495590_0085440 | |||
| 1462 | Ga0495591_000272 | |||
| 1463 | Ga0495629_0014017 | |||
| 1464 | Ga0495638_0000098 | |||
| 1465 | Ga0495638_0045252 | |||
| 1466 | Ga0495638_0050498 | |||
| 1467 | Ga0495651_0015119 | |||
| 1468 | Ga0495651_0058856 | |||
| 1469 | Ga0495653_0002089 | |||
| 1470 | Ga0495653_0144561 | |||
| 1471 | Ga0495653_0169254 | |||
| 1472 | Ga0495650_0000011 | |||
| 1473 | Ga0495650_0002150 | |||
| 1474 | Ga0495580_0030809 | |||
| 1475 | Ga0495580_0445460 | |||
| 1476 | Ga0495582_0004649 | |||
| 1477 | Ga0495582_0017936 | |||
| 1478 | Ga0495582_0114750 | |||
| 1479 | Ga0495605_0000029 | |||
| 1480 | Ga0495605_0000042 | |||
| 1481 | Ga0495605_0000151 | |||
| 1482 | Ga0495605_0006348 | |||
| 1483 | Ga0495605_0007689 | |||
| 1484 | Ga0495605_0010229 | |||
| 1485 | Ga0495605_0024677 | |||
| 1486 | Ga0495605_0035098 | |||
| 1487 | Ga0495605_0044828 | |||
| 1488 | Ga0495605_0132566 | |||
| 1489 | Ga0495639_0309380 | |||
| 1490 | Ga0495584_0000007 | |||
| 1491 | Ga0495584_0000122 | |||
| 1492 | Ga0495584_0000506 | |||
| 1493 | Ga0495584_0002007 | |||
| 1494 | Ga0495584_0002049 | |||
| 1495 | Ga0495584_0003276 | |||
| 1496 | Ga0495584_0005376 | |||
| 1497 | Ga0495584_0005715 | |||
| 1498 | Ga0495584_0006099 | |||
| 1499 | Ga0495584_0010896 | |||
| 1500 | Ga0495584_0021540 | |||
| 1501 | Ga0495584_0069350 | |||
| 1502 | Ga0495584_0110508 | |||
| 1503 | Ga0495584_0163756 | |||
| 1504 | Ga0495584_0173545 | |||
| 1505 | Ga0495584_0204880 | |||
| 1506 | Ga0495585_0000115 | |||
| 1507 | Ga0495585_0000421 | |||
| 1508 | Ga0495585_0002934 | |||
| 1509 | Ga0495585_0003505 | |||
| 1510 | Ga0495585_0010560 | |||
| 1511 | Ga0495585_0017306 | |||
| 1512 | Ga0495585_0018451 | |||
| 1513 | Ga0495585_0020952 | |||
| 1514 | Ga0495585_0024454 | |||
| 1515 | Ga0495585_0029130 | |||
| 1516 | Ga0495585_0040655 | |||
| 1517 | Ga0495585_0062272 | |||
| 1518 | Ga0495585_0098278 | |||
| 1519 | Ga0495585_0107344 | |||
| 1520 | Ga0495594_0003496 | |||
| 1521 | Ga0495594_0010511 | |||
| 1522 | Ga0495594_0010807 | |||
| 1523 | Ga0495594_0013150 | |||
| 1524 | Ga0495594_0028672 | |||
| 1525 | Ga0495596_0000474 | |||
| 1526 | Ga0495596_0000530 | |||
| 1527 | Ga0495596_0002008 | |||
| 1528 | Ga0495596_0002300 | |||
| 1529 | Ga0495596_0004690 | |||
| 1530 | Ga0495596_0014436 | |||
| 1531 | Ga0495596_0019973 | |||
| 1532 | Ga0495596_0028741 | |||
| 1533 | Ga0495607_0001671 | |||
| 1534 | Ga0495607_0001966 | |||
| 1535 | Ga0495607_0002476 | |||
| 1536 | Ga0495607_0002735 | |||
| 1537 | Ga0495607_0004292 | |||
| 1538 | Ga0495607_0017561 | |||
| 1539 | Ga0495607_0020165 | |||
| 1540 | Ga0495607_0025435 | |||
| 1541 | Ga0495607_0028377 | |||
| 1542 | Ga0495607_0051721 | |||
| 1543 | Ga0495607_0071761 | |||
| 1544 | Ga0495607_0077910 | |||
| 1545 | Ga0495607_0083439 | |||
| 1546 | Ga0495607_0225317 | |||
| 1547 | Ga0495583_0000348 | |||
| 1548 | Ga0495583_0000472 | |||
| 1549 | Ga0495583_0000569 | |||
| 1550 | Ga0495583_0001444 | |||
| 1551 | Ga0495583_0015121 | |||
| 1552 | Ga0495583_0033337 | |||
| 1553 | Ga0495583_0034886 | |||
| 1554 | Ga0495583_0049226 | |||
| 1555 | Ga0495583_0110774 | |||
| 1556 | Ga0495583_0194134 | |||
| 1557 | Ga0495606_0000084 | |||
| 1558 | Ga0495606_0000652 | |||
| 1559 | Ga0495606_0000787 | |||
| 1560 | Ga0495606_0001481 | |||
| 1561 | Ga0495606_0012677 | |||
| 1562 | Ga0495606_0021021 | |||
| 1563 | Ga0495606_0029545 | |||
| 1564 | Ga0495606_0031347 | |||
| 1565 | Ga0495606_0034767 | |||
| 1566 | Ga0495606_0039821 | |||
| 1567 | Ga0495606_0047069 | |||
| 1568 | Ga0495606_0106051 | |||
| 1569 | Ga0495606_0349720 | |||
| 1570 | Ga0495608_0001512 | |||
| 1571 | Ga0495608_0013677 | |||
| 1572 | Ga0495610_0000473 | |||
| 1573 | Ga0495610_0148582 | |||
| 1574 | Ga0495616_0001479 | |||
| 1575 | Ga0495616_0001547 | |||
| 1576 | Ga0495616_0004099 | |||
| 1577 | Ga0495616_0007026 | |||
| 1578 | Ga0495616_0008239 | |||
| 1579 | Ga0495616_0010806 | |||
| 1580 | Ga0495616_0010992 | |||
| 1581 | Ga0495616_0021408 | |||
| 1582 | Ga0495616_0025599 | |||
| 1583 | Ga0495616_0030670 | |||
| 1584 | Ga0495616_0033463 | |||
| 1585 | Ga0495616_0042972 | |||
| 1586 | Ga0495616_0044363 | |||
| 1587 | Ga0495616_0057484 | |||
| 1588 | Ga0495616_0094410 | |||
| 1589 | Ga0495620_0003439 | |||
| 1590 | Ga0495628_0004339 | |||
| 1591 | Ga0495628_0018273 | |||
| 1592 | Ga0495628_0305552 | |||
| 1593 | Ga0495630_0009137 | |||
| 1594 | Ga0495630_0332897 | |||
| 1595 | Ga0495631_0000550 | |||
| 1596 | Ga0495631_0000810 | |||
| 1597 | Ga0495631_0001888 | |||
| 1598 | Ga0495631_0002771 | |||
| 1599 | Ga0495631_0005099 | |||
| 1600 | Ga0495631_0006258 | |||
| 1601 | Ga0495631_0015840 | |||
| 1602 | Ga0495631_0017560 | |||
| 1603 | Ga0495631_0272480 | |||
| 1604 | Ga0495632_0000852 | |||
| 1605 | Ga0495632_0000903 | |||
| 1606 | Ga0495632_0001985 | |||
| 1607 | Ga0495632_0007957 | |||
| 1608 | Ga0495632_0042567 | |||
| 1609 | Ga0495637_0000013 | |||
| 1610 | Ga0495637_0008688 | |||
| 1611 | Ga0495637_0021577 | |||
| 1612 | Ga0495643_0000200 | |||
| 1613 | Ga0495643_0000551 | |||
| 1614 | Ga0495643_0002412 | |||
| 1615 | Ga0495643_0004464 | |||
| 1616 | Ga0495643_0012215 | |||
| 1617 | Ga0495643_0024119 | |||
| 1618 | Ga0495643_0025001 | |||
| 1619 | Ga0495643_0071122 | |||
| 1620 | Ga0495643_0072128 | |||
| 1621 | Ga0495644_0002518 | |||
| 1622 | Ga0495644_0004268 | |||
| 1623 | Ga0495644_0004891 | |||
| 1624 | Ga0495644_0005339 | |||
| 1625 | Ga0495644_0011582 | |||
| 1626 | Ga0495644_0015732 | |||
| 1627 | Ga0495644_0017413 | |||
| 1628 | Ga0495644_0020348 | |||
| 1629 | Ga0495644_0036772 | |||
| 1630 | Ga0495648_0000112 | |||
| 1631 | Ga0495648_0000169 | |||
| 1632 | Ga0495648_0001096 | |||
| 1633 | Ga0495648_0002536 | |||
| 1634 | Ga0495648_0007990 | |||
| 1635 | Ga0495648_0009310 | |||
| 1636 | Ga0495648_0027171 | |||
| 1637 | Ga0495648_0034097 | |||
| 1638 | Ga0495648_0051763 | |||
| 1639 | Ga0495648_0054917 | |||
| 1640 | Ga0495648_0177240 | |||
| 1641 | Ga0495648_0313657 | |||
| 1642 | Ga0495663_0004796 | |||
| 1643 | Ga0495663_0032141 | |||
| 1644 | Ga0495666_0015313 | |||
| 1645 | Ga0495666_0049841 | |||
| 1646 | Ga0495642_0000050 | |||
| 1647 | Ga0495642_0001068 | |||
| 1648 | Ga0495642_0001340 | |||
| 1649 | Ga0495642_0001809 | |||
| 1650 | Ga0495642_0003687 | |||
| 1651 | Ga0495642_0004398 | |||
| 1652 | Ga0495642_0008082 | |||
| 1653 | Ga0495642_0021157 | |||
| 1654 | Ga0495642_0029202 | |||
| 1655 | Ga0495642_0056547 | |||
| 1656 | Ga0495642_0134247 | |||
| 1657 | Ga0495642_0186853 | |||
| 1658 | Ga0495652_0005056 | |||
| 1659 | Ga0495652_0016097 | |||
| 1660 | Ga0495652_0019388 | |||
| 1661 | Ga0495652_0049462 | |||
| 1662 | Ga0495654_0004305 | |||
| 1663 | Ga0495654_0006380 | |||
| 1664 | Ga0495654_0008593 | |||
| 1665 | Ga0495654_0010005 | |||
| 1666 | Ga0495654_0044679 | |||
| 1667 | Ga0495665_0005554 | |||
| 1668 | Ga0495665_0035779 | |||
| 1669 | Ga0495665_0102901 | |||
| 1670 | Ga0495665_0103170 | |||
| 1671 | Ga0495586_0018982 | |||
| 1672 | Ga0495586_0019447 | |||
| 1673 | Ga0495587_0008756 | |||
| 1674 | Ga0495609_0000022 | |||
| 1675 | Ga0495609_0000163 | |||
| 1676 | Ga0495609_0001355 | |||
| 1677 | Ga0495609_0002267 | |||
| 1678 | Ga0495609_0003271 | |||
| 1679 | Ga0495609_0026941 | |||
| 1680 | Ga0495609_0031532 | |||
| 1681 | Ga0495609_0047144 | |||
| 1682 | Ga0495609_0080225 | |||
| 1683 | Ga0495597_0000064 | |||
| 1684 | Ga0495597_0000266 | |||
| 1685 | Ga0495597_0000566 | |||
| 1686 | Ga0495597_0001407 | |||
| 1687 | Ga0495597_0002770 | |||
| 1688 | Ga0495597_0006826 | |||
| 1689 | Ga0495597_0006959 | |||
| 1690 | Ga0495597_0013020 | |||
| 1691 | Ga0495597_0074237 | |||
| 1692 | Ga0495597_0240246 | |||
| 1693 | Ga0495645_0042584 | |||
| 1694 | Ga0495645_0073481 | |||
| 1695 | Ga0495622_0000311 | |||
| 1696 | Ga0495622_0000707 | |||
| 1697 | Ga0495622_0007277 | |||
| 1698 | Ga0495622_0039180 | |||
| 1699 | Ga0495622_0039684 | |||
| 1700 | Ga0495622_0085890 | |||
| 1701 | Ga0495622_0228631 | |||
| 1702 | Ga0495633_0001165 | |||
| 1703 | Ga0495633_0001850 | |||
| 1704 | Ga0495633_0010505 | |||
| 1705 | Ga0495633_0016664 | |||
| 1706 | Ga0495633_0018317 | |||
| 1707 | Ga0495633_0020708 | |||
| 1708 | Ga0495633_0024214 | |||
| 1709 | Ga0495633_0047924 | |||
| 1710 | Ga0495633_0086336 | |||
| 1711 | Ga0495633_0123951 | |||
| 1712 | Ga0495633_0230476 | |||
| 1713 | Ga0495656_0001658 | |||
| 1714 | Ga0495656_0002958 | |||
| 1715 | Ga0495656_0006533 | |||
| 1716 | Ga0495656_0026222 | |||
| 1717 | Ga0495656_0100038 | |||
| 1718 | Ga0495656_0119591 | |||
| 1719 | Ga0495668_0001322 | |||
| 1720 | Ga0495668_0001809 | |||
| 1721 | Ga0495668_0002020 | |||
| 1722 | Ga0495668_0006891 | |||
| 1723 | Ga0495668_0011176 | |||
| 1724 | Ga0495668_0013456 | |||
| 1725 | Ga0495668_0029492 | |||
| 1726 | Ga0495668_0057478 | |||
| 1727 | Ga0495668_0061174 | |||
| 1728 | Ga0495668_0093914 | |||
| 1729 | Ga0495668_0395699 | |||
| 1730 | Ga0495634_0015301 | |||
| 1731 | Ga0495611_0000515 | |||
| 1732 | Ga0495611_0003505 | |||
| 1733 | Ga0495611_0003835 | |||
| 1734 | Ga0495611_0007685 | |||
| 1735 | Ga0495611_0009941 | |||
| 1736 | Ga0495611_0010893 | |||
| 1737 | Ga0495611_0015786 | |||
| 1738 | Ga0495611_0016265 | |||
| 1739 | Ga0495611_0055477 | |||
| 1740 | Ga0495611_0056545 | |||
| 1741 | Ga0495611_0098122 | |||
| 1742 | Ga0495625_0000810 | |||
| 1743 | Ga0495625_0002543 | |||
| 1744 | Ga0495625_0005310 | |||
| 1745 | Ga0495625_0011709 | |||
| 1746 | Ga0495625_0013813 | |||
| 1747 | Ga0495625_0020304 | |||
| 1748 | Ga0495625_0061488 | |||
| 1749 | Ga0495625_0203186 | |||
| 1750 | Ga0495659_0000019 | |||
| 1751 | Ga0495659_0000167 | |||
| 1752 | Ga0495659_0001683 | |||
| 1753 | Ga0495659_0009447 | |||
| 1754 | Ga0495659_0020073 | |||
| 1755 | Ga0495661_0000151 | |||
| 1756 | Ga0495661_0000590 | |||
| 1757 | Ga0495661_0003517 | |||
| 1758 | Ga0495661_0007238 | |||
| 1759 | Ga0495661_0007385 | |||
| 1760 | Ga0495661_0012488 | |||
| 1761 | Ga0495661_0020506 | |||
| 1762 | Ga0495661_0023945 | |||
| 1763 | Ga0495661_0028727 | |||
| 1764 | Ga0495661_0039994 | |||
| 1765 | Ga0495661_0043396 | |||
| 1766 | Ga0495661_0047504 | |||
| 1767 | Ga0495661_0063816 | |||
| 1768 | Ga0495661_0165231 | |||
| 1769 | Ga0495661_0166458 | |||
| 1770 | Ga0495661_0213394 | |||
| 1771 | Ga0495661_0255821 | |||
| 1772 | Ga0495588_0000086 | |||
| 1773 | Ga0495588_0011973 | |||
| 1774 | Ga0495588_0017075 | |||
| 1775 | Ga0495588_0032962 | |||
| 1776 | Ga0495588_0034728 | |||
| 1777 | Ga0495588_0058010 | |||
| 1778 | Ga0495588_0116559 | |||
| 1779 | Ga0495657_0058805 | |||
| 1780 | Ga0495599_0003514 | |||
| 1781 | Ga0495623_0008207 | |||
| 1782 | Ga0495623_0011302 | |||
| 1783 | Ga0495623_0035632 | |||
| 1784 | Ga0495623_0041958 | |||
| 1785 | Ga0495623_0048369 | |||
| 1786 | Ga0495646_0001555 | |||
| 1787 | Ga0495669_0000018 | |||
| 1788 | Ga0495669_0026346 | |||
| 1789 | Ga0495669_0093968 | |||
| 1790 | Ga0495613_0089487 | |||
| 1791 | Ga0495624_0033919 | |||
| 1792 | Ga0495624_0036132 | |||
| 1793 | Ga0495624_0292209 | |||
| 1794 | Ga0495670_0000143 | |||
| 1795 | Ga0495670_0001120 | |||
| 1796 | Ga0495670_0010421 | |||
| 1797 | Ga0495670_0013539 | |||
| 1798 | Ga0495670_0035185 | |||
| 1799 | Ga0495670_0079714 | |||
| 1800 | Ga0495670_0081229 | |||
| 1801 | Ga0495670_0247697 | |||
| 1802 | Ga0495671_0000658 | |||
| 1803 | Ga0495671_0001049 | |||
| 1804 | Ga0495671_0019545 | |||
| 1805 | Ga0495671_0031072 | |||
| 1806 | Ga0495671_0127303 | |||
| 1807 | Ga0495671_0154071 | |||
| 1808 | Ga0495649_0003442 | |||
| 1809 | Ga0495649_0009418 | |||
| 1810 | Ga0495649_0015222 | |||
| 1811 | Ga0495649_0027732 | |||
| 1812 | Ga0495649_0048732 | |||
| 1813 | Ga0495589_0000017 | |||
| 1814 | Ga0495589_0000513 | |||
| 1815 | Ga0495589_0001742 | |||
| 1816 | Ga0495589_0004248 | |||
| 1817 | Ga0495589_0011131 | |||
| 1818 | Ga0495589_0013061 | |||
| 1819 | Ga0495589_0020691 | |||
| 1820 | Ga0495589_0022368 | |||
| 1821 | Ga0495589_0043009 | |||
| 1822 | Ga0495589_0082237 | |||
| 1823 | Ga0495600_0000834 | |||
| 1824 | Ga0495600_0006403 | |||
| 1825 | Ga0495600_0131479 | |||
| 1826 | Ga0495660_0000067 | |||
| 1827 | Ga0495660_0002349 | |||
| 1828 | Ga0495660_0004163 | |||
| 1829 | Ga0495660_0007858 | |||
| 1830 | Ga0495660_0014127 | |||
| 1831 | Ga0495660_0047272 | |||
| 1832 | Ga0495660_0059026 | |||
| 1833 | Ga0495660_0063365 | |||
| 1834 | Ga0495660_0128657 | |||
| 1835 | Ga0495660_0166579 | |||
| 1836 | Ga0495581_0009510 | |||
| 1837 | Ga0495581_0018889 | |||
| 1838 | Ga0495581_0055668 | |||
| 1839 | Ga0495604_0004591 | |||
| 1840 | Ga0495604_0034285 | |||
| 1841 | Ga0495604_0246697 | |||
| 1842 | Ga0495604_0437459 | |||
| 1843 | Ga0495636_0000388 | |||
| 1844 | Ga0495636_0003301 | |||
| 1845 | Ga0495636_0004667 | |||
| 1846 | Ga0495636_0009037 | |||
| 1847 | Ga0495636_0023781 | |||
| 1848 | Ga0495636_0061353 | |||
| 1849 | Ga0495636_0135464 | |||
| 1850 | Ga0495674_0221331 | |||
| 1851 | Ga0495672_0000067 | |||
| 1852 | Ga0495672_0000343 | |||
| 1853 | Ga0495672_0000718 | |||
| 1854 | Ga0495672_0001478 | |||
| 1855 | Ga0495672_0003293 | |||
| 1856 | Ga0495672_0004198 | |||
| 1857 | Ga0495672_0034084 | |||
| 1858 | Ga0495672_0052482 | |||
| 1859 | Ga0495672_0128740 | |||
| 1860 | Ga0495676_0000067 | |||
| 1861 | Ga0495676_0028953 | |||
| 1862 | Ga0495676_0461324 | |||
| 1863 | Ga0495683_0000083 | |||
| 1864 | Ga0495683_0000348 | |||
| 1865 | Ga0495683_0002803 | |||
| 1866 | Ga0495683_0006314 | |||
| 1867 | Ga0495683_0019894 | |||
| 1868 | Ga0495683_0022607 | |||
| 1869 | Ga0495683_0057907 | |||
| 1870 | Ga0495683_0078187 | |||
| 1871 | Ga0495683_0079896 | |||
| 1872 | Ga0495687_000033 | |||
| 1873 | Ga0495687_000126 | |||
| 1874 | Ga0495687_000252 | |||
| 1875 | Ga0495687_000640 | |||
| 1876 | Ga0495687_008102 | |||
| 1877 | Ga0495687_010751 | |||
| 1878 | Ga0495687_010893 | |||
| 1879 | Ga0495687_022520 | |||
| 1880 | Ga0495675_0003787 | |||
| 1881 | Ga0495675_0030000 | |||
| 1882 | Ga0495675_0088516 | |||
| 1883 | Ga0495677_0000002 | |||
| 1884 | Ga0495677_0005091 | |||
| 1885 | Ga0495677_0008034 | |||
| 1886 | Ga0495677_0008164 | |||
| 1887 | Ga0495677_0014812 | |||
| 1888 | Ga0495677_0021668 | |||
| 1889 | Ga0495677_0032123 | |||
| 1890 | Ga0495677_0044837 | |||
| 1891 | Ga0495677_0051623 | |||
| 1892 | Ga0495677_0098020 | |||
| 1893 | Ga0495677_0128864 | |||
| 1894 | Ga0495679_008082 | |||
| 1895 | Ga0495679_008137 | |||
| 1896 | Ga0495679_019799 | |||
| 1897 | Ga0495679_034537 | |||
| 1898 | Ga0495679_074564 | |||
| 1899 | Ga0495685_000053 | |||
| 1900 | Ga0495685_000183 | |||
| 1901 | Ga0495685_001317 | |||
| 1902 | Ga0495685_004689 | |||
| 1903 | Ga0495685_016533 | |||
| 1904 | Ga0495673_0000265 | |||
| 1905 | Ga0495681_0000321 | |||
| 1906 | Ga0495681_0007275 | |||
| 1907 | Ga0495681_0016273 | |||
| 1908 | Ga0495681_0030372 | |||
| 1909 | Ga0495681_0032989 | |||
| 1910 | Ga0495681_0046396 | |||
| 1911 | Ga0495686_0000628 | |||
| 1912 | Ga0495686_0033337 | |||
| 1913 | Ga0495686_0040123 | |||
| 1914 | Ga0495686_0091644 | |||
| 1915 | Ga0495686_0129523 | |||
| 1916 | Ga0495686_0181975 | |||
| 1917 | Ga0495593_0054376 | |||
| 1918 | Ga0495602_0024798 | |||
| 1919 | Ga0495602_0104784 | |||
| 1920 | Ga0495602_0159563 | |||
| 1921 | Ga0495614_0001110 | |||
| 1922 | Ga0495614_0018070 | |||
| 1923 | Ga0495615_0001150 | |||
| 1924 | Ga0495615_0029638 | |||
| 1925 | Ga0495626_0000097 | |||
| 1926 | Ga0495626_0000209 | |||
| 1927 | Ga0495626_0000258 | |||
| 1928 | Ga0495626_0003284 | |||
| 1929 | Ga0495626_0007634 | |||
| 1930 | Ga0495626_0011560 | |||
| 1931 | Ga0495626_0016093 | |||
| 1932 | Ga0495626_0018518 | |||
| 1933 | Ga0495626_0021333 | |||
| 1934 | Ga0495626_0026399 | |||
| 1935 | Ga0495626_0044605 | |||
| 1936 | Ga0495626_0049911 | |||
| 1937 | Ga0495626_0059885 | |||
| 1938 | Ga0495626_0145896 | |||
| 1939 | Ga0496100_0052012 | |||
| 1940 | Ga0496100_0159307 | |||
| 1941 | Ga0496101_0044781 | |||
| 1942 | Ga0496101_0092574 | |||
| 1943 | Ga0496102_0000313 | |||
| 1944 | Ga0496102_0000487 | |||
| 1945 | Ga0496102_0055639 | |||
| 1946 | Ga0496102_0420493 | |||
| 1947 | Ga0496103_0091804 | |||
| 1948 | Ga0496103_0231148 | |||
| 1949 | Ga0496103_0422697 | |||
| 1950 | Ga0496103_0443694 | |||
| 1951 | Ga0496103_0450071 | |||
| 1952 | Ga0496104_0848884 | |||
| 1953 | Ga0496106_0006127 | |||
| 1954 | Ga0496107_0075821 | |||
| 1955 | Ga0496107_0293454 | |||
| 1956 | Ga0496108_0217414 | |||
| 1957 | Ga0496108_0711016 | |||
| 1958 | Ga0496109_0068134 | |||
| 1959 | Ga0496109_0229028 | |||
| 1960 | Ga0496110_0000024 | |||
| 1961 | Ga0496110_0104634 | |||
| 1962 | Ga0496110_0570064 | |||
| 1963 | Ga0496111_0635735 | |||
| 1964 | Ga0496112_0367515 | |||
| 1965 | Ga0496112_0755078 | |||
| 1966 | Ga0496113_0019700 | |||
| 1967 | Ga0496114_0047812 | |||
| 1968 | Ga0496114_0067969 | |||
| 1969 | Ga0496114_0478533 | |||
| 1970 | Ga0496115_0026659 | |||
| 1971 | Ga0496115_0056234 | |||
| 1972 | Ga0496115_0082225 | |||
| 1973 | Ga0496115_0215720 | |||
| 1974 | Ga0496115_0555710 | |||
| 1975 | Ga0496116_0026481 | |||
| 1976 | Ga0496118_0131119 | |||
| 1977 | Ga0496121_0095442 | |||
| 1978 | Ga0496121_0154136 | |||
| 1979 | Ga0496121_0514578 | |||
| 1980 | Ga0496122_0000439 | |||
| 1981 | Ga0496122_0002153 | |||
| 1982 | Ga0496122_0004757 | |||
| 1983 | Ga0496122_0011837 | |||
| 1984 | Ga0496123_0000487 | |||
| 1985 | Ga0496123_0003789 | |||
| 1986 | Ga0496123_0022480 | |||
| 1987 | Ga0496124_0016901 | |||
| 1988 | Ga0496124_0021248 | |||
| 1989 | Ga0496124_0023141 | |||
| 1990 | Ga0496124_0045759 | |||
| 1991 | Ga0496124_0076458 | |||
| 1992 | Ga0496124_0303252 | |||
| 1993 | Ga0496125_0001079 | |||
| 1994 | Ga0496125_0003984 | |||
| 1995 | Ga0496125_0099527 | |||
| 1996 | Ga0496125_0182288 | |||
| 1997 | Ga0496125_0246345 | |||
| 1998 | Ga0496126_0060200 | |||
| 1999 | Ga0496126_0224826 | |||
| 2000 | Ga0501308_013232 | |||
| 2001 | Ga0501304_003196 | |||
| 2002 | Ga0501305_039264 | |||
| 2003 | Ga0495678_000131 | |||
| 2004 | Ga0495678_000355 | |||
| 2005 | Ga0495678_001074 | |||
| 2006 | Ga0495678_003680 | |||
| 2007 | Ga0495678_004358 | |||
| 2008 | Ga0495678_015158 | |||
| 2009 | Ga0495678_033475 | |||
| 2010 | Ga0495678_193161 | |||
| 2011 | Ga0495682_0000779 | |||
| 2012 | Ga0495682_0001850 | |||
| 2013 | Ga0495682_0002874 | |||
| 2014 | Ga0495682_0004757 | |||
| 2015 | Ga0501300_033155 | |||
| 2016 | Ga0501207_006845 | |||
| 2017 | Ga0501280_000079 | |||
| 2018 | Ga0501282_010548 | |||
| 2019 | Ga0501035_0005808 | |||
| 2020 | nmdc:mga00v17_230903_c1 | |||
| 2021 | nmdc:mga0yw44_175167_c1 | |||
| 2022 | Ga0495601_0021365 | |||
| 2023 | Ga0495601_0323983 | |||
| 2024 | Ga0495655_0154964 | |||
| 2025 | Ga0500583_0004765 | |||
| 2026 | Ga0500650_0000077 | |||
| 2027 | Ga0500594_0017715 | |||
| 2028 | Ga0500614_159553 | |||
| 2029 | Ga0500618_000301 | |||
| 2030 | Ga0500618_000821 | |||
| 2031 | Ga0500564_049825 | |||
| 2032 | Ga0500574_000358 | |||
| 2033 | Ga0500622_0279307 | |||
| 2034 | Ga0500634_0016724 | |||
| 2035 | Ga0500661_019973 | |||
| 2036 | Ga0587066_023808 | |||
| 2037 | Ga0587066_089812 | |||
| 2038 | Ga0587070_012124 | |||
| 2039 | Ga0587077_006576 | |||
| 2040 | Ga0587077_025555 | |||
| 2041 | Ga0587080_010270 | |||
| 2042 | Ga0587083_0023065 | |||
| 2043 | Ga0587085_003884 | |||
| 2044 | Ga0587086_011885 | |||
| 2045 | Ga0587090_001134 | |||
| 2046 | Ga0587090_013222 | |||
| 2047 | Ga0587091_019150 | |||
| 2048 | Ga0587091_019940 | |||
| 2049 | Ga0587106_021228 | |||
| 2050 | Ga0587101_054991 | |||
| 2051 | Ga0587109_014206 | |||
| 2052 | Ga0587117_016597 | |||
| 2053 | Ga0587062_011715 | |||
| 2054 | Ga0587067_015649 | |||
| 2055 | Ga0587067_020457 | |||
| 2056 | Ga0587068_016177 | |||
| 2057 | Ga0587069_016163 | |||
| 2058 | Ga0587069_022812 | |||
| 2059 | Ga0587072_005287 | |||
| 2060 | Ga0587072_025780 | |||
| 2061 | Ga0587078_011383 | |||
| 2062 | Ga0587079_043002 | |||
| 2063 | Ga0587105_003927 | |||
| 2064 | Ga0587071_065599 | |||
| 2065 | Ga0587111_0001153 | |||
| 2066 | Ga0466962_0032893 | |||
| 2067 | Ga0466962_0091908 | |||
| 2068 | 2511250064 | |||
| 2069 | 2511383608 | |||
| 2070 | 2521557364 | |||
| 2071 | 2550693247 | |||
| 2072 | 2553005285 | |||
| 2073 | 2643791370 | |||
| 2074 | 2643800212 | |||
| 2075 | 2644027726 | |||
| 2076 | 2644215594 | |||
| 2077 | 2644251577 | |||
| 2078 | 2644358246 | |||
| 2079 | 2644472006 | |||
| 2080 | 2738742420 | |||
| 2081 | 2738845373 | |||
| 2082 | 2739276426 | |||
| 2083 | 2739345470 | |||
| 2084 | 2765568487 | |||
| 2085 | 2808981228 | |||
| 2086 | 2809131718 | |||
| 2087 | 2809142462 | |||
| 2088 | 2809151470 | |||
| 2089 | 2819543187 | |||
| 2090 | 2819592044 | |||
| 2091 | 2819617647 | |||
| 2092 | 2821133472 | |||
| 2093 | 2839096648 | |||
| 2094 | 2852620954 | |||
| 2095 | 2884813179 | |||
| 2096 | 2884840539 | |||
| 2097 | 2884855796 | |||
| 2098 | 2896157279 | |||
| 2099 | 2904439898 | |||
| 2100 | 2904531153 | |||
| 2101 | 2904587200 | |||
| 2102 | 2904592766 | |||
| 2103 | 2904604452 | |||
| 2104 | 2919050215 | |||
| 2105 | 2919082273 | |||
| 2106 | 2923516029 | |||
| 2107 | 2928133217 | |||
| 2108 | 8047674766 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cy4-assembly1.cif.gz_B | crystal structure of an oligoribonuclease from acinetobacter baumannii | 0.9744 | 20 | 193 |
| 3tr8-assembly1.cif.gz_B | structure of an oligoribonuclease (orn) from coxiella burnetii | 0.9732 | 18 | 196 |
| 5cy4-assembly2.cif.gz_C | crystal structure of an oligoribonuclease from acinetobacter baumannii | 0.973 | 20 | 193 |
| 6n6h-assembly1.cif.gz_A | vibrio cholerae oligoribonuclease bound to pcpu | 0.9726 | 18 | 196 |
| 5cy4-assembly3.cif.gz_E | crystal structure of an oligoribonuclease from acinetobacter baumannii | 0.9713 | 20 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIU1_1_181_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9546 | 19 | 192 | 3.30.420.10 |
| af_Q556Y2_11_190_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9441 | 21 | 195 | 3.30.420.10 |
| af_Q17819_4_192_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9431 | 21 | 196 | 3.30.420.10 |
| af_Q6K4V8_62_244_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9364 | 20 | 196 | 3.30.420.10 |
| 1ytaA00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9199 | 18 | 196 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1BLJ9-F1-model_v4 | Exonuclease domain-containing protein | 0.995 | 20 | 112 |
GO:0000175
GO:0003676 |
| AF-A0A353PFZ1-F1-model_v4 | Oligoribonuclease | 0.9949 | 18 | 115 |
GO:0003676
GO:0004527 GO:0006259 |
| AF-A0A3D2DDW7-F1-model_v4 | deleted | 0.9944 | 18 | 113 |
|
| AF-U6CZQ9-F1-model_v4 | Oligoribonuclease, mitochondrial | 0.9895 | 21 | 113 |
GO:0000175
GO:0003676 GO:0005739 |
| AF-A0A227J347-F1-model_v4 | Oligoribonuclease | 0.9894 | 19 | 99 |
GO:0000175
GO:0003676 GO:0006259 |