F489141

General Info

Members Datasets Scaffolds Average Seq Length
1054 780 2108 260

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2996893221|2996897599
Length 275
Sequence VSLLAALLGGIKPRHGIVLGSGLGSLVGELEGAVHVPYKDLPGFPVSAVSGHAGEVVAGRLGGVPVIMLSGRVHYYEKGDAGAMRLPIEVLKALGVEVLILTNSAGSLRDDMPPGSVMQITDHINYSGMNPLIGEESDRRFVGMTNAYDAGLAAAMQKAAAKLEIELAQGVYMWLSGPSFETPAEIRMARILGADAVGMSTVPEVIIARMLGLRVAAASVITNYGAGMTGNELSHEETKDMAPIGGARLAAILKDMIAAGAIPGKVRSGFPSGIA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
56 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
120 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
123 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
124 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
217 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
226 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 2996893221 Rhizobium sp. R635 Isolate Nodule
230 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
231 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
232 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
233 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
234 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
235 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
236 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
237 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
238 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
239 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
240 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
241 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
242 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
243 2512875024
244 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
245 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
246 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
247 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
248 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
249 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
250 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
251 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
252 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
253 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
254 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
255 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
256 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
257 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
258 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
259 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
260 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
261 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
262 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
263 2519899620 Rhizobium sp. Pop5 Isolate Nodule
264 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
265 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
266 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
267 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
268 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
269 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
270 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
271 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
272 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
273 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
274 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
275 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
276 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
277 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
278 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
279 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
280 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
281 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
282 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
283 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
284 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
285 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
286 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
287 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
288 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
289 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
290 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
291 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
292 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
293 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
294 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
295 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
296 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
297 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
298 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
299 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
300 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
301 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
302 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
303 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
304 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
305 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
306 2643221582 Rhizobium sp. Root651 Isolate Unclassified
307 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
308 2643221599 Rhizobium sp. Root708 Isolate Unclassified
309 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
310 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
311 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
312 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
313 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
314 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
315 2643221693 Rhizobium sp. Root491 Isolate Unclassified
316 2643221719 Rhizobium sp. Root274 Isolate Unclassified
317 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
318 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
319 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
320 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
321 2718217882 Rhizobium sp. N741 Isolate Nodule
322 2718217927 Rhizobium sp. N324 Isolate Nodule
323 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
324 2718218009 Rhizobium sp. N561 Isolate Nodule
325 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
326 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
327 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
328 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
329 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
330 2718218363 Rhizobium sp. N113 Isolate Nodule
331 2718218365 Rhizobium sp. N731 Isolate Nodule
332 2718218366 Rhizobium sp. N621 Isolate Nodule
333 2718218423 Rhizobium sp. N941 Isolate Nodule
334 2721755514 Rhizobium sp. N6212 Isolate Nodule
335 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
336 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
337 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
338 2721755809 Rhizobium sp. N541 Isolate Nodule
339 2721755810 Rhizobium sp. N871 Isolate Nodule
340 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
341 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
342 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
343 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
344 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
345 2728369365 Rhizobium sp. N1341 Isolate Nodule
346 2728369397 Rhizobium sp. N1314 Isolate Nodule
347 2738541293 Rhizobium sp. GV031 Isolate Unclassified
348 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
349 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
350 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
351 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
352 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
353 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
354 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
355 2791355256 Rhizobium sp. M10 Isolate Nodule
356 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
357 2791355260 Rhizobium sp. L9 Isolate Nodule
358 2791355261 Rhizobium sp. J15 Isolate Nodule
359 2791355262 Rhizobium sp. M1 Isolate Nodule
360 2791355263 Rhizobium chutanense C5 Isolate Nodule
361 2791355264 Rhizobium sp. S9 Isolate Nodule
362 2791355265 Rhizobium sp. H4 Isolate Nodule
363 2791355266 Rhizobium sp. L43 Isolate Nodule
364 2791355267 Rhizobium sp. L18 Isolate Nodule
365 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
366 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
367 2802429633 Rhizobium anhuiense J3 Isolate Nodule
368 2802429634 Rhizobium anhuiense S10 Isolate Nodule
369 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
370 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
371 2802429637 Rhizobium anhuiense C15 Isolate Nodule
372 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
373 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
374 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
375 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
376 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
377 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
378 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
379 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
380 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
381 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
382 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
383 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
384 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
385 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
386 2838048938 Rhizobium pisi 27/80 Isolate Nodule
387 2838061910 Rhizobium phaseoli L15 Isolate Nodule
388 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
389 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
390 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
391 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
392 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
393 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
394 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
395 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
396 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
397 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
398 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
399 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
400 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
401 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
402 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
403 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
404 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
405 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
406 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
407 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
408 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
409 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
410 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
411 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
412 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
413 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
414 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
415 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
416 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
417 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
418 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
419 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
420 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
421 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
422 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
423 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
424 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
425 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
426 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
427 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
428 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
429 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
430 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
431 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
432 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
433 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
434 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
435 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
436 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
437 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
438 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
439 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
440 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
441 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
442 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
443 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
444 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
445 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
446 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
447 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
448 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
449 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
450 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
451 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
452 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
453 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
454 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
455 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
456 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
457 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
458 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
459 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
460 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
461 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
462 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
463 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
464 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
465 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
466 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
467 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
468 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
469 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
470 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
471 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
472 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
473 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
474 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
475 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
476 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
477 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
478 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
479 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
480 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
481 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
482 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
483 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
484 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
485 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
486 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
487 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
488 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
489 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
490 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
491 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
492 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
493 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
494 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
495 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
496 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
497 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
498 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
499 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
500 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
501 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
502 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
503 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
504 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
505 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
506 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
507 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
508 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
509 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
510 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
511 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
512 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
513 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
514 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
515 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
516 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
517 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
518 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
519 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
520 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
521 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
522 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
523 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
524 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
525 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
526 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
527 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
528 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
529 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
530 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
531 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
532 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
533 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
534 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
535 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
536 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
537 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
538 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
539 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
540 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
541 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
542 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
543 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
544 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
545 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
546 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
547 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
548 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
549 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
550 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
551 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
552 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
553 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
554 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
555 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
556 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
557 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
558 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
559 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
560 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
561 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
562 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
563 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
564 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
565 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
566 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
567 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
568 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
569 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
570 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
571 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
572 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
573 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
574 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
575 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
576 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
577 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
578 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
579 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
580 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
581 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
582 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
583 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
584 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
585 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
586 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
587 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
588 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
589 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
590 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
591 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
592 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
593 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
594 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
595 2933599457 Rhizobium phaseoli M3 Isolate Nodule
596 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
597 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
598 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
599 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
600 2936381700 Rhizobium chutanense C16 Isolate Unclassified
601 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
602 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
603 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
604 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
605 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
606 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
607 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
608 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
609 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
610 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
611 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
612 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
613 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
614 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
615 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
616 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
617 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
618 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
619 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
620 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
621 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
622 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
623 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
624 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
625 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
626 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
627 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
628 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
629 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
630 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
631 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
632 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
633 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
634 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
635 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
636 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
637 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
638 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
639 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
640 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
641 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
642 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
643 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
644 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
645 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
646 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
647 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
648 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
649 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
650 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
651 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
652 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
653 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
654 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
655 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
656 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
657 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
658 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
659 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
660 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
661 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
662 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
663 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
664 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
665 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
666 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
667 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
668 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
669 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
670 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
671 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
672 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
673 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
674 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
675 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
676 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
677 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
678 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
679 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
680 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
681 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
682 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
683 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
684 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
685 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
686 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
687 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
688 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
689 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
690 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
691 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
692 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
693 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
694 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
695 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
696 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
697 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
698 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
699 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
700 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
701 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
702 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
703 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
704 2996887358 Rhizobium sp. R711 Isolate Nodule
705 3004167301 Mesorhizobium loti 582 Isolate Unclassified
706 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
707 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
708 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
709 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
710 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
711 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
712 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
713 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
714 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
715 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
716 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
717 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
718 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
719 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
720 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
721 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
722 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
723 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
724 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
725 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
726 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
727 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
728 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
729 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
730 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
731 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
732 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
733 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
734 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
735 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
736 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
737 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
738 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
739 8005258706 Rhizobium sp. R693 Isolate Nodule
740 8005275841 Rhizobium sp. N4311 Isolate Nodule
741 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
742 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
743 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
744 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
745 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
746 8005321885 Rhizobium sp. R72 Isolate Nodule
747 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
748 8005382845 Rhizobium sp. R634 Isolate Nodule
749 8005395548 Rhizobium sp. R339 Isolate Nodule
750 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
751 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
752 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
753 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
754 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
755 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
756 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
757 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
758 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
759 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
760 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
761 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
762 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
763 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
764 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
765 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
766 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
767 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
768 8018176218 Rhizobium sp. N122 Isolate Nodule
769 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
770 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
771 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
772 8024501048 Rhizobium sp. H4 Isolate Nodule
773 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
774 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
775 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
776 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
777 8056382006 Rhizobium croatiense 13T Isolate Nodule
778 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
779 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
780 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.53
Metatranscriptomes 0
Isolates 52.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 16.6
Nodule 40.7
Rhizoplane 1.33
Rhizosphere 25.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010356 3300001979 Bacteria 3600
2 JGI24740J21852_10012401 3300001979 Bacteria 3213
3 JGI24740J21852_10058101 3300001979 Bacteria 1077
4 JGI24739J22299_10020720 3300001989 Bacteria 2347
5 JGI25155J39150_1000110 3300002704 Bacteria 43893
6 JGI25156J39149_1000192 3300002705 Bacteria 44040
7 JGI25162J39368_1000302 3300002737 Bacteria 45304
8 JGI25162J39368_1001906 3300002737 Bacteria 9562
9 JGI25154J39366_1000196 3300002738 Bacteria 44040
10 JGI25158J39367_1001549 3300002739 Bacteria 3984
11 JGI25157J39369_1000228 3300002741 Bacteria 44040
12 JGI25157J39369_1001767 3300002741 Bacteria 7056
13 JGI25152J39213_1003523 3300002773 Bacteria 5300
14 JGI25152J39213_1003583 3300002773 Bacteria 5257
15 JGI25152J39213_1023689 3300002773 Bacteria 1041
16 JGI25150J39212_1001258 3300002774 Bacteria 7330
17 JGI25150J39212_1009522 3300002774 Bacteria 1842
18 JGI25159J45721_1000790 3300002987 Bacteria 13778
19 JGI25159J45721_1001258 3300002987 Bacteria 10693
20 JGI25151J46595_10000660 3300003187 Bacteria 29371
21 JGI25151J46595_10001587 3300003187 Bacteria 15099
22 JGI25151J46595_10007774 3300003187 Bacteria 5217
23 JGI25151J46595_10010521 3300003187 Bacteria 4293
24 JGI25151J46595_10031068 3300003187 Bacteria 2090
25 JGI25151J46595_10039452 3300003187 Bacteria 1744
26 JGI25165J46597_1000042 3300003214 Bacteria 271606
27 JGI25165J46597_1000390 3300003214 Bacteria 46779
28 JGI25165J46597_1001741 3300003214 Bacteria 9593
29 JGI25165J46597_1002721 3300003214 Bacteria 5226
30 JGI25153J46596_10007015 3300003215 Bacteria 5611
31 JGI25153J46596_10011601 3300003215 Bacteria 3879
32 JGI25153J46596_10032236 3300003215 Bacteria 1751
33 rootH1_10050935 3300003316 Bacteria 1444
34 rootH2_10047843 3300003320 Bacteria 3297
35 rootL2_10038374 3300003322 Bacteria 5013
36 JGI25160J50197_1000044 3300003354 Bacteria 145379
37 JGI25160J50197_1003769 3300003354 Bacteria 6672
38 JGI25161J50226_1000028 3300003374 Bacteria 145379
39 JGI25161J50226_1000078 3300003374 Bacteria 83416
40 Ga0055542_1000592 3300003762 Bacteria 31197
41 Ga0055526_1005787 3300003771 Bacteria 6969
42 Ga0055526_1006190 3300003771 Bacteria 6581
43 Ga0055526_1012978 3300003771 Bacteria 3572
44 Ga0055526_1019212 3300003771 Bacteria 2500
45 Ga0055526_1019223 3300003771 Bacteria 2500
46 Ga0055524_1004262 3300003775 Bacteria 6648
47 Ga0055524_1012492 3300003775 Bacteria 3257
48 Ga0055528_1000113 3300003790 Bacteria 65323
49 Ga0055528_1001190 3300003790 Bacteria 16795
50 Ga0055528_1006884 3300003790 Bacteria 5100
51 Ga0055540_1001653 3300003792 Bacteria 12938
52 Ga0055540_1007715 3300003792 Bacteria 4006
53 Ga0055540_1022741 3300003792 Bacteria 1596
54 Ga0058692_1002358 3300003856 Bacteria 6357
55 Ga0058692_1002936 3300003856 Bacteria 5486
56 Ga0055543_1000054 3300004625 Bacteria 104176
57 Ga0055543_1000069 3300004625 Bacteria 94040
58 Ga0065165_1000318 3300005262 Bacteria 78352
59 Ga0065165_1012288 3300005262 Bacteria 3496
60 Ga0065165_1016211 3300005262 Bacteria 2800
61 Ga0070670_100000105 3300005331 Bacteria 77938
62 Ga0070667_100596923 3300005367 Bacteria 1017
63 Ga0070663_100051355 3300005455 Bacteria 2937
64 Ga0068853_100006660 3300005539 Bacteria 9199
65 Ga0068853_100551688 3300005539 Bacteria 1092
66 Ga0068855_100128301 3300005563 Bacteria 2898
67 Ga0068857_100483178 3300005577 Bacteria 1161
68 Ga0068857_100493695 3300005577 Bacteria 1148
69 Ga0068856_100169981 3300005614 Bacteria 2192
70 Ga0068856_100314736 3300005614 Bacteria 1583
71 Ga0068852_100018469 3300005616 Bacteria 5495
72 Ga0068851_10037302 3300005834 Bacteria 2436
73 Ga0075365_10004347 3300006038 Bacteria 7489
74 Ga0075365_10017265 3300006038 Bacteria 4411
75 Ga0075365_10020968 3300006038 Bacteria 4066
76 Ga0075365_10038035 3300006038 Bacteria 3125
77 Ga0075365_10078395 3300006038 Bacteria 2234
78 Ga0075365_10083267 3300006038 Bacteria 2170
79 Ga0075365_10190669 3300006038 Bacteria 1434
80 Ga0075368_10001589 3300006042 Bacteria 7293
81 Ga0075368_10024080 3300006042 Bacteria 2329
82 Ga0075368_10035238 3300006042 Bacteria 1952
83 Ga0075363_100009448 3300006048 Bacteria 4585
84 Ga0075363_100023482 3300006048 Bacteria 3126
85 Ga0075363_100059151 3300006048 Bacteria 2060
86 Ga0075364_10042363 3300006051 Bacteria 2957
87 Ga0075362_10001417 3300006177 Bacteria 7642
88 Ga0075362_10092727 3300006177 Bacteria 1403
89 Ga0075367_10004267 3300006178 Bacteria 6952
90 Ga0075367_10010325 3300006178 Bacteria 4904
91 Ga0075367_10018946 3300006178 Bacteria 3807
92 Ga0075367_10089976 3300006178 Bacteria 1866
93 Ga0075367_10204296 3300006178 Bacteria 1234
94 Ga0075369_10044665 3300006186 Bacteria 1904
95 Ga0075366_10024153 3300006195 Bacteria 3546
96 Ga0075370_10000842 3300006353 Bacteria 12429
97 Ga0075370_10037597 3300006353 Bacteria 2722
98 Ga0075370_10039345 3300006353 Bacteria 2664
99 Ga0079104_1000082 3300006946 Bacteria 137722
100 Ga0099826_10006060 3300006948 Bacteria 8757
101 Ga0099826_10097192 3300006948 Bacteria 1785
102 Ga0105240_10001468 3300009093 Bacteria 40305
103 Ga0105240_10249736 3300009093 Bacteria 2052
104 Ga0105240_10398866 3300009093 Bacteria 1550
105 Ga0105240_10563129 3300009093 Bacteria 1259
106 Ga0105245_10672793 3300009098 Bacteria 1067
107 Ga0105243_10003711 3300009148 Bacteria 12270
108 Ga0105248_10054876 3300009177 Bacteria 4469
109 Ga0105237_10004445 3300009545 Bacteria 16237
110 Ga0105237_10011413 3300009545 Bacteria 9397
111 Ga0105238_10307068 3300009551 Bacteria 1571
112 Ga0105249_10365413 3300009553 Bacteria 1465
113 Ga0123341_1000642 3300009765 Bacteria 22722
114 Ga0123341_1057766 3300009765 Bacteria 1988
115 Ga0123342_1010090 3300009766 Bacteria 10966
116 Ga0123342_1021055 3300009766 Bacteria 4648
117 Ga0105239_10046215 3300010375 Bacteria 4770
118 Ga0105239_10048662 3300010375 Bacteria 4648
119 Ga0105239_10328115 3300010375 Bacteria 1726
120 Ga0105246_10185777 3300011119 Bacteria 1604
121 Ga0157373_10018682 3300013100 Bacteria 5045
122 Ga0157371_10000004 3300013102 Bacteria 512593
123 Ga0157370_10001047 3300013104 Bacteria 34825
124 Ga0157370_10001796 3300013104 Bacteria 26445
125 Ga0182008_10087338 3300014497 Bacteria 1536
126 Ga0182008_10095812 3300014497 Bacteria 1465
127 Ga0182006_1020401 3300015261 Bacteria 2777
128 Ga0163161_10396032 3300017792 Bacteria 1107
129 Ga0209435_100087 3300025206 Bacteria 44093
130 Ga0209436_100268 3300025208 Bacteria 23804
131 Ga0209436_112679 3300025208 Bacteria 1419
132 Ga0209672_105109 3300025228 Bacteria 2301
133 Ga0209563_107279 3300025230 Bacteria 1831
134 Ga0209437_100050 3300025233 Bacteria 394010
135 Ga0209437_100205 3300025233 Bacteria 115669
136 Ga0207425_1001736 3300025245 Bacteria 8600
137 Ga0209646_1000285 3300025246 Bacteria 44093
138 Ga0209026_1000029 3300025250 Bacteria 337109
139 Ga0209026_1000347 3300025250 Bacteria 44093
140 Ga0209677_109715 3300025253 Bacteria 1688
141 Ga0209148_1000069 3300025254 Bacteria 334444
142 Ga0209759_1000482 3300025256 Bacteria 44093
143 Ga0209759_1000637 3300025256 Bacteria 32759
144 Ga0209129_1000066 3300025258 Bacteria 226820
145 Ga0209129_1001099 3300025258 Bacteria 15766
146 Ga0209129_1001848 3300025258 Bacteria 11206
147 Ga0209129_1002246 3300025258 Bacteria 9651
148 Ga0209129_1006820 3300025258 Bacteria 3573
149 Ga0209233_1000028 3300025261 Bacteria 642062
150 Ga0209233_1000037 3300025261 Bacteria 554620
151 Ga0209233_1000187 3300025261 Bacteria 133091
152 Ga0209233_1000232 3300025261 Bacteria 96361
153 Ga0209565_1035287 3300025263 Bacteria 955
154 Ga0209455_1000219 3300025272 Bacteria 79850
155 Ga0209673_1000024 3300025273 Bacteria 409632
156 Ga0209673_1000911 3300025273 Bacteria 37766
157 Ga0209673_1002137 3300025273 Bacteria 14721
158 Ga0209673_1002283 3300025273 Bacteria 13700
159 Ga0209673_1003397 3300025273 Bacteria 9438
160 Ga0209673_1013102 3300025273 Bacteria 3297
161 Ga0209673_1034216 3300025273 Bacteria 1538
162 Ga0209130_1000002 3300025284 Bacteria 722648
163 Ga0209130_1000093 3300025284 Bacteria 145707
164 Ga0209025_1000274 3300025294 Bacteria 119322
165 Ga0209025_1000275 3300025294 Bacteria 119220
166 Ga0209025_1000377 3300025294 Bacteria 92728
167 Ga0209025_1000553 3300025294 Bacteria 69760
168 Ga0209025_1008610 3300025294 Bacteria 7302
169 Ga0209025_1015100 3300025294 Bacteria 4686
170 Ga0209564_1000262 3300025295 Bacteria 112256
171 Ga0209564_1000474 3300025295 Bacteria 67143
172 Ga0209564_1000486 3300025295 Bacteria 66011
173 Ga0209758_1000466 3300025297 Bacteria 66920
174 Ga0209758_1000971 3300025297 Bacteria 38600
175 Ga0209758_1003684 3300025297 Bacteria 13618
176 Ga0209758_1009079 3300025297 Bacteria 6272
177 Ga0209758_1009179 3300025297 Bacteria 6217
178 Ga0209758_1025882 3300025297 Bacteria 2560
179 Ga0209050_1006063 3300025298 Bacteria 7313
180 Ga0209256_1000868 3300025299 Bacteria 37527
181 Ga0209256_1003327 3300025299 Bacteria 11402
182 Ga0209256_1011210 3300025299 Bacteria 3618
183 Ga0209256_1038435 3300025299 Bacteria 1240
184 Ga0207426_1000012 3300025302 Bacteria 730942
185 Ga0207426_1000013 3300025302 Bacteria 721897
186 Ga0207426_1000142 3300025302 Bacteria 194023
187 Ga0209051_1000170 3300025303 Bacteria 119026
188 Ga0209051_1002082 3300025303 Bacteria 15092
189 Ga0209051_1027111 3300025303 Bacteria 2290
190 Ga0209051_1037438 3300025303 Bacteria 1778
191 Ga0209257_1007148 3300025304 Bacteria 6862
192 Ga0207688_10199146 3300025901 Bacteria 1200
193 Ga0207647_10058319 3300025904 Bacteria 2364
194 Ga0207695_10000427 3300025913 Bacteria 93089
195 Ga0207695_10635585 3300025913 Bacteria 948
196 Ga0207671_10002841 3300025914 Bacteria 18002
197 Ga0207671_10023638 3300025914 Bacteria 4633
198 Ga0207671_10500607 3300025914 Bacteria 969
199 Ga0207657_10211893 3300025919 Bacteria 1555
200 Ga0207650_10000302 3300025925 Bacteria 48702
201 Ga0207709_10231419 3300025935 Bacteria 1339
202 Ga0207711_10077431 3300025941 Bacteria 2899
203 Ga0207667_10214924 3300025949 Bacteria 1970
204 Ga0207667_10529655 3300025949 Bacteria 1193
205 Ga0207640_10650010 3300025981 Bacteria 898
206 Ga0207658_10519032 3300025986 Bacteria 1063
207 Ga0207639_10242013 3300026041 Bacteria 1569
208 Ga0207639_10473614 3300026041 Bacteria 1140
209 Ga0207678_10046447 3300026067 Bacteria 3755
210 Ga0207702_10034141 3300026078 Bacteria 4252
211 Ga0207702_10257221 3300026078 Bacteria 1642
212 Ga0207674_10144852 3300026116 Bacteria 2334
213 Ga0207674_10877123 3300026116 Bacteria 865
214 Ga0207698_10087512 3300026142 Bacteria 2537
215 Ga0209281_1000043 3300027111 Bacteria 341543
216 Ga0209371_1000009 3300027312 Bacteria 963030
217 Ga0209371_1000569 3300027312 Bacteria 33436
218 Ga0209371_1000597 3300027312 Bacteria 32346
219 Ga0209371_1002100 3300027312 Bacteria 11818
220 Ga0209282_1015117 3300027666 Bacteria 4913
221 Ga0209813_10015632 3300027866 Bacteria 2060
222 Ga0268266_10085620 3300028379 Bacteria 2754
223 Ga0268266_10204443 3300028379 Bacteria 1809
224 Ga0307515_10070922 3300028794 Bacteria 4732
225 Ga0307515_10316134 3300028794 Bacteria 1232
226 Ga0268256_1000010 3300030500 Bacteria 963034
227 Ga0268256_1003765 3300030500 Bacteria 6646
228 Ga0268256_1003954 3300030500 Bacteria 6388
229 Ga0307416_100409987 3300032002 Bacteria 1396
230 Ga0395900_0293062 3300037418 Bacteria 1615
231 Ga0395900_0318882 3300037418 Bacteria 1535
232 Ga0395898_0214279 3300037466 Bacteria 1837
233 Ga0395905_0473627 3300037471 Bacteria 1151
234 Ga0395901_0040590 3300038443 Bacteria 4821
235 Ga0395901_0102150 3300038443 Bacteria 3008
236 Ga0395901_0525704 3300038443 Bacteria 1201
237 Ga0439465_0004289 3300041413 Bacteria 4636
238 Ga0439465_0094693 3300041413 Bacteria 1025
239 Ga0439465_0115285 3300041413 Bacteria 938
240 Ga0451798_0437084 3300041458 Bacteria 1717
241 Ga0451833_0309501 3300041491 Bacteria 946
242 Ga0451839_1518067 3300041496 Bacteria 2007
243 Ga0451841_0823007 3300041498 Bacteria 1296
244 Ga0451845_0491534 3300041501 Bacteria 1916
245 Ga0451847_0530648 3300041503 Bacteria 1242
246 Ga0451849_1413814 3300041505 Bacteria 1033
247 Ga0439445_0067743 3300042004 Bacteria 984
248 Ga0439449_0036973 3300042007 Bacteria 1816
249 Ga0466972_0069426 3300044658 Bacteria 1682
250 Ga0466960_0034427 3300044901 Bacteria 2360
251 Ga0466967_0785893 3300045976 Bacteria 945
252 Ga0495617_013045 3300046452 Bacteria 2831
253 Ga0495627_028697 3300046453 Bacteria 1776
254 Ga0495590_0029742 3300046457 Bacteria 1914
255 Ga0495638_0000566 3300046460 Bacteria 41838
256 Ga0495638_0043090 3300046460 Bacteria 2848
257 Ga0495650_0027816 3300046471 Bacteria 2606
258 Ga0495605_0009235 3300046474 Bacteria 5540
259 Ga0495605_0041550 3300046474 Bacteria 2290
260 Ga0495585_0018694 3300046492 Bacteria 3997
261 Ga0495585_0047303 3300046492 Bacteria 2396
262 Ga0495585_0048677 3300046492 Bacteria 2356
263 Ga0495607_0022489 3300046501 Bacteria 3959
264 Ga0495607_0024783 3300046501 Bacteria 3736
265 Ga0495607_0191834 3300046501 Bacteria 1017
266 Ga0495583_0003929 3300046506 Bacteria 10998
267 Ga0495583_0019864 3300046506 Bacteria 3496
268 Ga0495606_0005067 3300046507 Bacteria 12819
269 Ga0495606_0049724 3300046507 Bacteria 2747
270 Ga0495606_0055336 3300046507 Bacteria 2566
271 Ga0495606_0077288 3300046507 Bacteria 2078
272 Ga0495610_0037953 3300046512 Bacteria 2447
273 Ga0495616_0025367 3300046513 Bacteria 3168
274 Ga0495620_0041131 3300046515 Bacteria 2029
275 Ga0495631_0003763 3300046518 Bacteria 8252
276 Ga0495632_0012650 3300046519 Bacteria 4856
277 Ga0495632_0024308 3300046519 Bacteria 3220
278 Ga0495643_0036691 3300046522 Bacteria 2691
279 Ga0495643_0109703 3300046522 Bacteria 1404
280 Ga0495654_0000314 3300046530 Bacteria 42570
281 Ga0495609_0022681 3300046538 Bacteria 2892
282 Ga0495597_0148905 3300046542 Bacteria 961
283 Ga0495633_0016834 3300046558 Bacteria 3754
284 Ga0495633_0036013 3300046558 Bacteria 2373
285 Ga0495656_0007518 3300046615 Bacteria 3853
286 Ga0495668_0011736 3300046616 Bacteria 5230
287 Ga0495668_0210932 3300046616 Bacteria 1063
288 Ga0495611_0009426 3300046648 Bacteria 4126
289 Ga0495625_0023496 3300046660 Bacteria 4709
290 Ga0495625_0049188 3300046660 Bacteria 3032
291 Ga0495625_0091282 3300046660 Bacteria 2105
292 Ga0495625_0095479 3300046660 Bacteria 2049
293 Ga0495661_0014352 3300046665 Bacteria 5309
294 Ga0495661_0270325 3300046665 Bacteria 860
295 Ga0495670_0032614 3300046691 Bacteria 2591
296 Ga0495670_0071710 3300046691 Bacteria 1754
297 Ga0495671_0014249 3300046692 Bacteria 4284
298 Ga0495671_0106694 3300046692 Bacteria 1368
299 Ga0495649_0023374 3300046694 Bacteria 3454
300 Ga0495636_0114020 3300047318 Bacteria 1191
301 Ga0495681_0009496 3300047470 Bacteria 5984
302 Ga0495686_0002334 3300047472 Bacteria 18121
303 Ga0495686_0020721 3300047472 Bacteria 4382
304 Ga0495686_0182194 3300047472 Bacteria 1216
305 Ga0496101_0192646 3300048904 Bacteria 1574
306 Ga0496102_0169134 3300048905 Bacteria 2058
307 Ga0496103_0188830 3300048906 Bacteria 1325
308 Ga0496106_0006761 3300048909 Bacteria 8490
309 Ga0496108_0453277 3300048911 Bacteria 1121
310 Ga0496112_0004626 3300048915 Bacteria 11705
311 Ga0496113_0037980 3300048916 Bacteria 3538
312 Ga0496116_0018149 3300048919 Bacteria 5433
313 Ga0496116_0141976 3300048919 Bacteria 1349
314 Ga0496117_0000002 3300048920 Bacteria 2483758
315 Ga0496117_0002038 3300048920 Bacteria 26746
316 Ga0496117_0005456 3300048920 Bacteria 13341
317 Ga0496117_0023070 3300048920 Bacteria 4972
318 Ga0496117_0031006 3300048920 Bacteria 4090
319 Ga0496117_0045021 3300048920 Bacteria 3192
320 Ga0496117_0070695 3300048920 Bacteria 2343
321 Ga0496118_0001167 3300048921 Bacteria 40506
322 Ga0496118_0017956 3300048921 Bacteria 6412
323 Ga0496118_0060628 3300048921 Bacteria 2808
324 Ga0496118_0109751 3300048921 Bacteria 1835
325 Ga0496118_0122183 3300048921 Bacteria 1694
326 Ga0496119_0014974 3300048922 Bacteria 6019
327 Ga0496119_0026777 3300048922 Bacteria 3986
328 Ga0496119_0047803 3300048922 Bacteria 2658
329 Ga0496119_0099572 3300048922 Bacteria 1635
330 Ga0496119_0171840 3300048922 Bacteria 1144
331 Ga0496119_0240112 3300048922 Bacteria 918
332 Ga0496120_0002729 3300048923 Bacteria 17241
333 Ga0496120_0015943 3300048923 Bacteria 4933
334 Ga0496120_0017924 3300048923 Bacteria 4575
335 Ga0496120_0020218 3300048923 Bacteria 4238
336 Ga0496121_0000001 3300048924 Bacteria 1830318
337 Ga0496121_0023381 3300048924 Bacteria 5954
338 Ga0496121_0044238 3300048924 Bacteria 3845
339 Ga0496121_0056726 3300048924 Bacteria 3251
340 Ga0496121_0107387 3300048924 Bacteria 2138
341 Ga0496121_0139533 3300048924 Bacteria 1800
342 Ga0496122_0000001 3300048925 Bacteria 1827766
343 Ga0496122_0000018 3300048925 Bacteria 426350
344 Ga0496122_0000321 3300048925 Bacteria 105353
345 Ga0496122_0025714 3300048925 Bacteria 5102
346 Ga0496122_0126865 3300048925 Bacteria 1631
347 Ga0496122_0141991 3300048925 Bacteria 1500
348 Ga0496123_0000001 3300048926 Bacteria 1831497
349 Ga0496123_0000015 3300048926 Bacteria 426088
350 Ga0496123_0000454 3300048926 Bacteria 72735
351 Ga0496123_0004823 3300048926 Bacteria 13917
352 Ga0496123_0139316 3300048926 Bacteria 1329
353 Ga0496124_0000558 3300048927 Bacteria 63070
354 Ga0496124_0006480 3300048927 Bacteria 12741
355 Ga0496124_0043463 3300048927 Bacteria 3863
356 Ga0496124_0046082 3300048927 Bacteria 3736
357 Ga0496124_0046414 3300048927 Bacteria 3719
358 Ga0496124_0131850 3300048927 Bacteria 1984
359 Ga0496125_0000001 3300048928 Bacteria 1766138
360 Ga0496125_0000628 3300048928 Bacteria 59302
361 Ga0496125_0006658 3300048928 Bacteria 12436
362 Ga0496125_0037411 3300048928 Bacteria 4220
363 Ga0496125_0049883 3300048928 Bacteria 3472
364 Ga0496125_0085026 3300048928 Bacteria 2399
365 Ga0496125_0090571 3300048928 Bacteria 2295
366 Ga0496125_0197038 3300048928 Bacteria 1323
367 Ga0496126_0000378 3300048929 Bacteria 92187
368 Ga0496126_0063882 3300048929 Bacteria 3298
369 Ga0496126_0177821 3300048929 Bacteria 1809
370 Ga0496126_0243423 3300048929 Bacteria 1501
371 Ga0496126_0306012 3300048929 Bacteria 1309
372 Ga0496126_0421783 3300048929 Bacteria 1078
373 Ga0495678_047945 3300049459 Bacteria 1669
374 Ga0501031_0004927 3300049568 Bacteria 8677
375 Ga0501031_0085938 3300049568 Bacteria 2051
376 Ga0501032_0000019 3300049569 Bacteria 155168
377 Ga0501032_0051426 3300049569 Bacteria 2778
378 Ga0501032_0055436 3300049569 Bacteria 2667
379 Ga0501032_0374855 3300049569 Bacteria 915
380 Ga0501033_0000260 3300049570 Bacteria 50590
381 Ga0501033_0000461 3300049570 Bacteria 38633
382 Ga0501033_0013860 3300049570 Bacteria 6133
383 Ga0501033_0034352 3300049570 Bacteria 3805
384 Ga0501033_0071969 3300049570 Bacteria 2539
385 Ga0501033_0149740 3300049570 Bacteria 1684
386 Ga0501033_0181834 3300049570 Bacteria 1507
387 Ga0501034_0002910 3300049571 Bacteria 19875
388 Ga0501034_0411430 3300049571 Bacteria 1274
389 Ga0501034_0636201 3300049571 Bacteria 969
390 Ga0501036_0001517 3300049572 Bacteria 17917
391 Ga0501036_0086723 3300049572 Bacteria 2646
392 Ga0501037_0000154 3300049573 Bacteria 64077
393 Ga0501037_0000870 3300049573 Bacteria 22576
394 Ga0501037_0040577 3300049573 Bacteria 3425
395 Ga0501037_0042753 3300049573 Bacteria 3330
396 Ga0501037_0082837 3300049573 Bacteria 2324
397 Ga0501038_0001781 3300049574 Bacteria 20003
398 Ga0501038_0088163 3300049574 Bacteria 2605
399 Ga0501038_0101706 3300049574 Bacteria 2392
400 Ga0501038_0576400 3300049574 Bacteria 853
401 Ga0501039_0001074 3300049575 Bacteria 20003
402 Ga0501039_0139292 3300049575 Bacteria 1906
403 Ga0501039_0438841 3300049575 Bacteria 1025
404 Ga0501043_0000007 3300049579 Bacteria 224595
405 Ga0501043_0000113 3300049579 Bacteria 76112
406 Ga0501043_0048312 3300049579 Bacteria 3345
407 Ga0501043_0069942 3300049579 Bacteria 2757
408 Ga0501043_0159911 3300049579 Bacteria 1760
409 Ga0501046_0191544 3300049580 Bacteria 1525
410 Ga0501047_0037568 3300049581 Bacteria 4682
411 Ga0501047_0092531 3300049581 Bacteria 2902
412 Ga0501047_0127106 3300049581 Bacteria 2429
413 Ga0501047_0186069 3300049581 Bacteria 1942
414 Ga0501047_0319073 3300049581 Bacteria 1394
415 Ga0501067_0176497 3300049583 Bacteria 1190
416 Ga0501068_0021893 3300049584 Bacteria 3735
417 Ga0501068_0109855 3300049584 Bacteria 1714
418 Ga0501068_0342680 3300049584 Bacteria 960
419 Ga0501069_0000027 3300049585 Bacteria 106217
420 Ga0501069_0052485 3300049585 Bacteria 2270
421 Ga0501069_0115122 3300049585 Bacteria 1533
422 Ga0501069_0137725 3300049585 Bacteria 1399
423 Ga0501070_0000231 3300049586 Bacteria 52768
424 Ga0501070_0000822 3300049586 Bacteria 28172
425 Ga0501070_0000825 3300049586 Bacteria 28139
426 Ga0501070_0034270 3300049586 Bacteria 4245
427 Ga0501070_0041305 3300049586 Bacteria 3843
428 Ga0501070_0162893 3300049586 Bacteria 1838
429 Ga0501070_0250959 3300049586 Bacteria 1447
430 Ga0501070_0493250 3300049586 Bacteria 984
431 Ga0501071_0035260 3300049587 Bacteria 3563
432 Ga0501073_0038563 3300049589 Bacteria 3388
433 Ga0501074_0000023 3300049590 Bacteria 68925
434 Ga0501074_0016561 3300049590 Bacteria 5351
435 Ga0501076_0217993 3300049592 Bacteria 1560
436 Ga0501080_0000300 3300049742 Bacteria 37703
437 Ga0501080_0122112 3300049742 Bacteria 2413
438 Ga0501080_0164697 3300049742 Bacteria 2046
439 Ga0501083_0000012 3300049744 Bacteria 178668
440 Ga0501083_0042127 3300049744 Bacteria 3096
441 Ga0501035_0000073 3300049822 Bacteria 122603
442 Ga0501035_0000201 3300049822 Bacteria 72627
443 Ga0501035_0000709 3300049822 Bacteria 36064
444 Ga0501035_0001226 3300049822 Bacteria 26728
445 Ga0501035_0001287 3300049822 Bacteria 25890
446 Ga0501035_0066684 3300049822 Bacteria 3194
447 Ga0501035_0071499 3300049822 Bacteria 3071
448 Ga0501035_0455009 3300049822 Bacteria 1058
449 Ga0501044_0000118 3300049823 Bacteria 95218
450 Ga0501044_0019989 3300049823 Bacteria 7151
451 Ga0501044_0054362 3300049823 Bacteria 4116
452 Ga0501044_0068483 3300049823 Bacteria 3615
453 Ga0501044_0176352 3300049823 Bacteria 2106
454 Ga0501044_0306819 3300049823 Bacteria 1514
455 Ga0501044_0364578 3300049823 Bacteria 1362
456 Ga0501044_0462262 3300049823 Bacteria 1174
457 nmdc:mga03683_203753_c1 3300050489 Bacteria 909
458 nmdc:mga03683_6637_c1 3300050489 Bacteria 3974
459 nmdc:mga03n38_168995_c1 3300050490 Bacteria 1112
460 nmdc:mga03n38_234855_c1 3300050490 Bacteria 963
461 nmdc:mga00v17_611_c1 3300050491 Bacteria 19769
462 nmdc:mga0yw44_16789_c1 3300050492 Bacteria 3965
463 nmdc:mga0yw44_2319_c1 3300050492 Bacteria 8052
464 nmdc:mga0yw44_24863_c1 3300050492 Bacteria 3396
465 nmdc:mga0yw44_55086_c1 3300050492 Bacteria 2419
466 nmdc:mga0yw44_60256_c1 3300050492 Bacteria 2324
467 nmdc:mga0k408_10280_c1 3300050493 Bacteria 5058
468 nmdc:mga06z11_12773_c1 3300050494 Bacteria 3663
469 nmdc:mga06z11_271014_c1 3300050494 Bacteria 1004
470 nmdc:mga06z11_36763_c1 3300050494 Bacteria 2420
471 nmdc:mga06z11_91619_c1 3300050494 Bacteria 1651
472 nmdc:mga04h51_13917_c1 3300050495 Bacteria 2288
473 nmdc:mga07m45_11183_c1 3300050496 Bacteria 4711
474 nmdc:mga0sz30_11473_c1 3300050516 Bacteria 2559
475 nmdc:mga0sz30_42457_c1 3300050516 Bacteria 1913
476 Ga0500610_0039841 3300053079 Bacteria 2426
477 Ga0500578_0035296 3300053086 Bacteria 3214
478 Ga0500578_0072312 3300053086 Bacteria 2197
479 Ga0500643_012418 3300053087 Bacteria 3050
480 Ga0500557_042031 3300053105 Bacteria 1437
481 Ga0500618_000203 3300053125 Bacteria 47421
482 Ga0500618_001739 3300053125 Bacteria 9246
483 Ga0500618_021138 3300053125 Bacteria 1590
484 Ga0500658_0009920 3300053134 Bacteria 3511
485 Ga0500561_0000139 3300053137 Bacteria 14052
486 Ga0500568_0001169 3300053139 Bacteria 17543
487 Ga0500568_0006185 3300053139 Bacteria 6052
488 Ga0500568_0053805 3300053139 Bacteria 1577
489 Ga0500577_0044998 3300053142 Bacteria 1629
490 Ga0500616_0007056 3300053153 Bacteria 7207
491 Ga0500616_0009183 3300053153 Bacteria 6035
492 Ga0500616_0070165 3300053153 Bacteria 1790
493 Ga0500616_0164888 3300053153 Bacteria 1012
494 Ga0500620_007279 3300053155 Bacteria 2723
495 Ga0500622_0009636 3300053156 Bacteria 5337
496 Ga0500624_002343 3300053157 Bacteria 2580
497 Ga0500627_0037793 3300053158 Bacteria 2062
498 Ga0500627_0055473 3300053158 Bacteria 1735
499 Ga0500634_0049682 3300053161 Bacteria 2261
500 Ga0500636_0000022 3300053177 Bacteria 93090
501 Ga0500636_0001307 3300053177 Bacteria 13519
502 2996897599 2996893221 Bacteria 5823108
503 2509114670 2508501123 Bacteria 6283661
504 2509369674 2509276018 Bacteria 6910194
505 2509388994 2509276021 Bacteria 7634384
506 2509394771 2509276022 Bacteria 6200534
507 2509444584 2509276033 Bacteria 7180565
508 2510135669 2510065019 Bacteria 6903379
509 2510318629 2510065059 Bacteria 6847884
510 2510838861 2510461069 Bacteria 5505000
511 2510897142 2510461076 Bacteria 8618824
512 2511136857 2510917022 Bacteria 6504556
513 2511185326 2510917028 Bacteria 6185411
514 2511200522 2510917030 Bacteria 7460662
515 2512932689 2512875016 Bacteria 6529530
516 2512960746 2512875024 Bacteria 7195110
517 2513570830 2513237084 Bacteria 7231967
518 2513574955 2513237085 Bacteria 7695351
519 2513595613 2513237088 Bacteria 6927906
520 2513608777 2513237090 Bacteria 7096802
521 2513633739 2513237093 Bacteria 7545552
522 2513707586 2513237103 Bacteria 7647401
523 2513865362 2513237138 Bacteria 7368160
524 2513910998 2513237144 Bacteria 7530820
525 2513924306 2513237146 Bacteria 7166346
526 2514023680 2513237162 Bacteria 7468464
527 2515114833 2515075009 Bacteria 7288508
528 2515635810 2515154113 Bacteria 7807172
529 2515641424 2515154114 Bacteria 7848616
530 2515659313 2515154116 Bacteria 7552979
531 2515741182 2515154134 Bacteria 7220242
532 2517038451 2516653077 Bacteria 7555578
533 2517078727 2516653085 Bacteria 7346596
534 2517097469 2517093000 Bacteria 7412387
535 2517408925 2517287029 Bacteria 6905599
536 2520379181 2519899620 Bacteria 6499161
537 2523467759 2523231067 Bacteria 5230452
538 2524461871 2524023209 Bacteria 6679728
539 2530648344 2529292951 Bacteria 6916614
540 2535514574 2534681796 Bacteria 7146037
541 2537877273 2537561587 Bacteria 5425293
542 2554246169 2554235003 Bacteria 5877155
543 2559293392 2558860242 Bacteria 5568029
544 2585164442 2582581283 Bacteria 6030556
545 2585201281 2582581294 Bacteria 6626667
546 2585223259 2582581298 Bacteria 7315509
547 2585230949 2582581299 Bacteria 6518058
548 2585256424 2582581304 Bacteria 5831370
549 2585273458 2582581307 Bacteria 6597605
550 2585283170 2582581308 Bacteria 7413247
551 2585328201 2582581315 Bacteria 7318924
552 2585330613 2582581316 Bacteria 7774528
553 2585399100 2582581867 Bacteria 7184437
554 2585523958 2585427526 Bacteria 7258840
555 2585536018 2585427527 Bacteria 7273426
556 2585542102 2585427528 Bacteria 6842387
557 2585546145 2585427529 Bacteria 7395659
558 2585556654 2585427530 Bacteria 7383882
559 2585564014 2585427531 Bacteria 6992870
560 2585818750 2585427590 Bacteria 6824633
561 2585840688 2585427593 Bacteria 7141551
562 2585900316 2585427608 Bacteria 6544331
563 2585909278 2585427609 Bacteria 6667127
564 2587984620 2585428125 Bacteria 6662905
565 2588518775 2588253730 Bacteria 6881675
566 2597810915 2597489875 Bacteria 7010078
567 2599419736 2599185170 Bacteria 7295545
568 2599604276 2599185210 Bacteria 5624189
569 2599718716 2599185236 Bacteria 6875203
570 2599936522 2599185301 Bacteria 6161860
571 2601609588 2600255279 Bacteria 5605316
572 2601746363 2600255308 Bacteria 5611129
573 2616293961 2615840624 Bacteria 6557588
574 2616311187 2615840626 Bacteria 7921970
575 2616556079 2615840698 Bacteria 7319877
576 2617380722 2617270742 Bacteria 6808054
577 2643776674 2643221551 Bacteria 3750538
578 2643795122 2643221555 Bacteria 3749717
579 2643920549 2643221582 Bacteria 5804683
580 2643987466 2643221595 Bacteria 6565519
581 2644004417 2643221599 Bacteria 6292121
582 2644133877 2643221623 Bacteria 5239945
583 2644158014 2643221627 Bacteria 6761570
584 2644191215 2643221634 Bacteria 6705461
585 2644237665 2643221643 Bacteria 5749658
586 2644298211 2643221653 Bacteria 4569637
587 2644498800 2643221689 Bacteria 6042950
588 2644519642 2643221693 Bacteria 5513853
589 2644656463 2643221719 Bacteria 4568197
590 2671115836 2667528174 Bacteria 6435400
591 2688597107 2687453392 Bacteria 6880454
592 2694628810 2693429783 Bacteria 7019804
593 2694637276 2693429784 Bacteria 7241525
594 2719183332 2718217882 Bacteria 6556348
595 2719388092 2718217927 Bacteria 6972593
596 2719667715 2718217997 Bacteria 6740740
597 2719734049 2718218009 Bacteria 6478651
598 2720494135 2718218199 Bacteria 6740745
599 2720615598 2718218232 Bacteria 6720332
600 2720622381 2718218233 Bacteria 6662049
601 2720633735 2718218235 Bacteria 6630699
602 2720777435 2718218269 Bacteria 6906114
603 2721149444 2718218363 Bacteria 6524337
604 2721160847 2718218365 Bacteria 6274507
605 2721166281 2718218366 Bacteria 6425255
606 2721401725 2718218423 Bacteria 6438183
607 2722842451 2721755514 Bacteria 6424414
608 2723029032 2721755556 Bacteria 6745503
609 2723562649 2721755684 Bacteria 6859907
610 2723569342 2721755685 Bacteria 6704835
611 2724040539 2721755809 Bacteria 6438790
612 2724046805 2721755810 Bacteria 6479005
613 2724092042 2721755819 Bacteria 6906405
614 2724106607 2721755822 Bacteria 6726041
615 2724112415 2721755823 Bacteria 6752556
616 2725949667 2724679232 Bacteria 7646494
617 2730109968 2728369352 Bacteria 6745171
618 2730166567 2728369365 Bacteria 6555560
619 2730300479 2728369397 Bacteria 6274511
620 2738800769 2738541293 Bacteria 7065685
621 2739037351 2738541333 Bacteria 7106503
622 2739349209 2738543031 Bacteria 5769731
623 2756671181 2756170246 Bacteria 7451806
624 2766067161 2765235942 Bacteria 7445910
625 2776915980 2775507049 Bacteria 6284736
626 2778179507 2775507266 Bacteria 7392367
627 2792748138 2791355123 Bacteria 8049106
628 2793298460 2791355256 Bacteria 6798008
629 2793315700 2791355259 Bacteria 7254731
630 2793323483 2791355260 Bacteria 6598818
631 2793327571 2791355261 Bacteria 6661293
632 2793335642 2791355262 Bacteria 6774204
633 2793341036 2791355263 Bacteria 6872478
634 2793350287 2791355264 Bacteria 6429314
635 2793354772 2791355265 Bacteria 6539969
636 2793358531 2791355266 Bacteria 7116587
637 2793368983 2791355267 Bacteria 7222458
638 2805928907 2802429605 Bacteria 6875453
639 2805934528 2802429606 Bacteria 6346811
640 2806047078 2802429633 Bacteria 7341974
641 2806054923 2802429634 Bacteria 7083200
642 2806061849 2802429635 Bacteria 7650140
643 2806069628 2802429636 Bacteria 7597525
644 2806076001 2802429637 Bacteria 7067217
645 2808986839 2808606387 Bacteria 5697198
646 2819244208 2818991272 Bacteria 4622173
647 2819556911 2818991439 Bacteria 6907412
648 2819608880 2818991448 Bacteria 6772224
649 2819643305 2818991453 Bacteria 7181617
650 2819685822 2818991461 Bacteria 7026071
651 2821123231 2821123053 Bacteria 7836056
652 2837651500 2837651117 Bacteria 3772164
653 2837679257 2837678835 Bacteria 5252418
654 2838020942 2838016132 Bacteria 6577831
655 2838026845 2838022645 Bacteria 6494267
656 2838033955 2838029111 Bacteria 6603031
657 2838039731 2838035591 Bacteria 7166484
658 2838044856 2838042994 Bacteria 6046894
659 2838052909 2838048938 Bacteria 6044578
660 2838064702 2838061910 Bacteria 6794874
661 2838070521 2838068647 Bacteria 6208656
662 2838664009 2838661181 Bacteria 7385261
663 2838672531 2838668709 Bacteria 6671819
664 2838677647 2838675328 Bacteria 4909118
665 2838685584 2838680041 Bacteria 6545511
666 2838689840 2838686498 Bacteria 7807632
667 2838695960 2838694306 Bacteria 6853137
668 2838705146 2838701080 Bacteria 6669771
669 2838713359 2838707686 Bacteria 6619912
670 2838716536 2838714209 Bacteria 5525906
671 2838719664 2838719591 Bacteria 5523910
672 2838727287 2838724970 Bacteria 4908691
673 2838731464 2838729681 Bacteria 7400765
674 2838739746 2838736955 Bacteria 5760694
675 2838744405 2838742623 Bacteria 7396178
676 2841738025 2841734538 Bacteria 6784580
677 2841844130 2841840854 Bacteria 5761912
678 2841846595 2841846520 Bacteria 5345850
679 2841852945 2841851746 Bacteria 7532261
680 2841860876 2841859092 Bacteria 5436171
681 2841870210 2841864319 Bacteria 6742987
682 2842082593 2842077413 Bacteria 6508645
683 2842112748 2842110456 Bacteria 7656360
684 2842123848 2842118031 Bacteria 7033875
685 2842127376 2842124991 Bacteria 5346824
686 2842132540 2842130223 Bacteria 4909145
687 2842143851 2842140634 Bacteria 5759631
688 2842150140 2842146304 Bacteria 5957337
689 2842152291 2842152218 Bacteria 4908957
690 2842160272 2842156927 Bacteria 6894975
691 2842165750 2842163707 Bacteria 6916235
692 2842172782 2842170452 Bacteria 5525737
693 2842175910 2842175837 Bacteria 4908771
694 2842184062 2842180545 Bacteria 6888678
695 2842189644 2842187318 Bacteria 5524014
696 2842196364 2842192696 Bacteria 6147454
697 2842202438 2842198810 Bacteria 6608673
698 2842208910 2842205361 Bacteria 6340321
699 2842213958 2842211629 Bacteria 5523832
700 2842219426 2842217011 Bacteria 7497767
701 2842224424 2842224351 Bacteria 5524473
702 2842231644 2842229732 Bacteria 7475766
703 2842242903 2842237096 Bacteria 6620661
704 2842245887 2842243621 Bacteria 7421798
705 2842254826 2842250916 Bacteria 6579627
706 2842260265 2842257432 Bacteria 7401195
707 2842267153 2842264693 Bacteria 6472963
708 2842273676 2842271015 Bacteria 7807131
709 2842282400 2842278818 Bacteria 6340002
710 2842290060 2842285085 Bacteria 6011953
711 2842296976 2842291075 Bacteria 7076806
712 2842299937 2842298080 Bacteria 6123127
713 2842308472 2842304105 Bacteria 7023636
714 2842312224 2842311132 Bacteria 6616990
715 2842321818 2842317721 Bacteria 6793725
716 2842344656 2842341865 Bacteria 7003929
717 2842359541 2842357229 Bacteria 6485165
718 2842367769 2842363717 Bacteria 6844742
719 2842376030 2842370503 Bacteria 7038661
720 2842383240 2842377471 Bacteria 7140707
721 2842390373 2842384541 Bacteria 7057858
722 2842397841 2842395702 Bacteria 6780583
723 2842407670 2842402390 Bacteria 6681310
724 2842414301 2842409023 Bacteria 6687331
725 2842420839 2842415677 Bacteria 6596907
726 2842424135 2842422224 Bacteria 6239196
727 2842431151 2842428310 Bacteria 6767288
728 2842437486 2842434925 Bacteria 6502746
729 2842444301 2842441272 Bacteria 6769273
730 2842451272 2842447887 Bacteria 6754142
731 2842465294 2842462802 Bacteria 6588055
732 2842472237 2842469257 Bacteria 6752936
733 2842480701 2842475841 Bacteria 6603183
734 2842487255 2842482326 Bacteria 7212537
735 2842494108 2842489311 Bacteria 6620893
736 2842501247 2842495871 Bacteria 6820686
737 2842507256 2842502639 Bacteria 6604161
738 2842514530 2842509118 Bacteria 6850950
739 2842517661 2842515876 Bacteria 5436280
740 2844008825 2844002411 Bacteria 7168230
741 2844012463 2844009547 Bacteria 6728125
742 2844456588 2844454524 Bacteria 7952546
743 2847674926 2847670302 Bacteria 6165597
744 2852387864 2852387548 Bacteria 8025568
745 2856320645 2856314179 Bacteria 6477897
746 2856322952 2856320880 Bacteria 7263508
747 2856334727 2856328259 Bacteria 6528202
748 2856339617 2856334872 Bacteria 7037011
749 2856345883 2856342000 Bacteria 7176905
750 2856349430 2856349417 Bacteria 6230045
751 2856367940 2856364286 Bacteria 6939991
752 2857351937 2857349434 Bacteria 7926032
753 2857520884 2857516855 Bacteria 7787325
754 2857533817 2857531043 Bacteria 6754041
755 2869164779 2869162929 Bacteria 6399702
756 2869173043 2869169390 Bacteria 6659796
757 2869241470 2869234852 Bacteria 6654993
758 2869244879 2869242130 Bacteria 6609239
759 2869254131 2869249662 Bacteria 6868783
760 2869259748 2869256925 Bacteria 6981691
761 2869271105 2869264136 Bacteria 6880765
762 2869276576 2869271264 Bacteria 6908218
763 2869282504 2869278585 Bacteria 7077053
764 2869290441 2869285874 Bacteria 6901219
765 2871432725 2871429161 Bacteria 6547891
766 2871437390 2871435913 Bacteria 6880295
767 2871454229 2871451962 Bacteria 7336357
768 2871466490 2871459585 Bacteria 6866887
769 2871474301 2871466892 Bacteria 6923287
770 2871477418 2871474448 Bacteria 6806570
771 2871484905 2871481445 Bacteria 6700002
772 2871493335 2871488783 Bacteria 6929816
773 2871499075 2871495908 Bacteria 6935695
774 2874106505 2874102143 Bacteria 6342645
775 2874111837 2874109183 Bacteria 6517025
776 2874117156 2874116593 Bacteria 6674494
777 2874126707 2874123672 Bacteria 7238285
778 2874134939 2874131515 Bacteria 6820270
779 2874142159 2874139085 Bacteria 7021506
780 2874152692 2874146452 Bacteria 7533118
781 2874160092 2874155637 Bacteria 6724144
782 2874168095 2874162495 Bacteria 6174670
783 2874174925 2874168670 Bacteria 8062617
784 2876365059 2876363079 Bacteria 6544991
785 2876374434 2876369609 Bacteria 6807521
786 2876379857 2876377896 Bacteria 6565995
787 2876386761 2876386047 Bacteria 6698674
788 2876397913 2876392853 Bacteria 6660880
789 2876402721 2876399893 Bacteria 6927900
790 2876407866 2876406927 Bacteria 6191900
791 2876418608 2876413966 Bacteria 6831344
792 2876423015 2876420981 Bacteria 6687741
793 2878036052 2878035449 Bacteria 6555736
794 2878733980 2878730984 Bacteria 6380721
795 2878744655 2878738818 Bacteria 7136951
796 2878750339 2878745973 Bacteria 6867388
797 2878757379 2878753008 Bacteria 6922523
798 2878763274 2878760144 Bacteria 6823465
799 2878770262 2878767105 Bacteria 6898628
800 2878779744 2878774303 Bacteria 6108671
801 2878785281 2878781027 Bacteria 6834456
802 2878789503 2878788777 Bacteria 6567085
803 2881149806 2881147464 Bacteria 7779814
804 2881160951 2881155292 Bacteria 6461656
805 2881166691 2881161766 Bacteria 7127907
806 2881848451 2881845957 Bacteria 6611900
807 2881857243 2881853255 Bacteria 6698367
808 2881868938 2881861095 Bacteria 7128710
809 2882912660 2882912400 Bacteria 6801539
810 2885308210 2885305155 Bacteria 7348390
811 2885312981 2885312484 Bacteria 6415165
812 2885321870 2885318864 Bacteria 6729568
813 2885332741 2885326080 Bacteria 7134805
814 2885334613 2885334103 Bacteria 7216818
815 2885342853 2885342637 Bacteria 7011821
816 2885353513 2885350715 Bacteria 6787678
817 2888338186 2888337043 Bacteria 6629336
818 2888345782 2888343758 Bacteria 6611049
819 2888355042 2888350351 Bacteria 7372807
820 2891374796 2891373044 Bacteria 5202277
821 2899794299 2899792073 Bacteria 4926588
822 2899805886 2899803654 Bacteria 5577784
823 2899845679 2899845264 Bacteria 5672268
824 2903450069 2903448605 Bacteria 7357801
825 2903499993 2903492973 Bacteria 13473544
826 2903501107 2903492973 Bacteria 13473544
827 2903520815 2903513507 Bacteria 6344008
828 2903522206 2903521522 Bacteria 6525694
829 2903528584 2903528002 Bacteria 6586099
830 2903543877 2903540706 Bacteria 7062119
831 2904664564 2904659560 Bacteria 6685615
832 2906312697 2906308376 Bacteria 6841989
833 2906325406 2906321335 Bacteria 6579571
834 2906330790 2906328253 Bacteria 6585166
835 2906360034 2906354277 Bacteria 6991324
836 2906367501 2906363423 Bacteria 6856682
837 2906373657 2906370794 Bacteria 6881062
838 2906384463 2906378014 Bacteria 6911440
839 2906391219 2906386501 Bacteria 5977019
840 2906399469 2906393657 Bacteria 6790866
841 2906401458 2906401398 Bacteria 6693206
842 2906411007 2906408224 Bacteria 6162342
843 2906419906 2906414383 Bacteria 6580790
844 2906432720 2906427513 Bacteria 6375796
845 2919101862 2919100787 Bacteria 7710546
846 2919116753 2919114240 Bacteria 5700270
847 2919408328 2919408235 Bacteria 6149349
848 2922138713 2922130491 Bacteria 7173936
849 2922157139 2922151315 Bacteria 6902399
850 2922172874 2922172374 Bacteria 6167644
851 2922179713 2922178524 Bacteria 6025201
852 2922192928 2922185730 Bacteria 7113964
853 2923556181 2923556063 Bacteria 6793593
854 2924714854 2924710171 Bacteria 6752351
855 2924725453 2924718760 Bacteria 6331356
856 2924738036 2924733363 Bacteria 7574837
857 2924749758 2924748358 Bacteria 6154725
858 2924767074 2924762789 Bacteria 6561353
859 2924782685 2924776078 Bacteria 7492003
860 2924786685 2924784321 Bacteria 7416538
861 2926754763 2926754445 Bacteria 5964435
862 2926761931 2926760298 Bacteria 5505990
863 2929138880 2929138655 Bacteria 5810547
864 2933006938 2933006813 Bacteria 4912075
865 2933015472 2933011516 Bacteria 5439334
866 2933574921 2933570622 Bacteria 7023390
867 2933588363 2933586486 Bacteria 7667493
868 2933594141 2933594066 Bacteria 5594265
869 2933601326 2933599457 Bacteria 5858799
870 2935899978 2935894831 Bacteria 6620579
871 2935902325 2935901341 Bacteria 7341747
872 2936369541 2936367885 Bacteria 7324495
873 2936380282 2936375103 Bacteria 6652732
874 2936385261 2936381700 Bacteria 7006523
875 2937819158 2937813078 Bacteria 7783518
876 2937827704 2937822353 Bacteria 7290551
877 2937837329 2937836603 Bacteria 6811263
878 2937852167 2937848649 Bacteria 6983481
879 2937863095 2937861824 Bacteria 6660327
880 2937873092 2937868953 Bacteria 6639878
881 2937881330 2937877337 Bacteria 7246526
882 2937893357 2937891427 Bacteria 6357007
883 2937977422 2937972304 Bacteria 7532020
884 2937984508 2937980651 Bacteria 6517427
885 2937997726 2937994558 Bacteria 7036190
886 2958039286 2958034702 Bacteria 6989922
887 2958053084 2958041894 Bacteria 13082850
888 2958070482 2958064165 Bacteria 7158582
889 2958073918 2958071322 Bacteria 6815895
890 2958088113 2958084443 Bacteria 7312792
891 2958094120 2958092219 Bacteria 6861151
892 2958110099 2958108152 Bacteria 6681128
893 2958121086 2958115193 Bacteria 6923548
894 2958127419 2958122699 Bacteria 7280457
895 2958134829 2958130278 Bacteria 6897202
896 2958143081 2958137437 Bacteria 6050276
897 2958148863 2958144490 Bacteria 6677056
898 2958164469 2958158011 Bacteria 6058449
899 2958168199 2958165035 Bacteria 6906348
900 2958186391 2958179912 Bacteria 6874908
901 2961084890 2961077736 Bacteria 7079850
902 2961119563 2961114664 Bacteria 6680456
903 2961130872 2961127735 Bacteria 7196641
904 2961140618 2961136820 Bacteria 6775228
905 2961166665 2961163497 Bacteria 6901077
906 2961175292 2961170736 Bacteria 7072258
907 2961186024 2961183825 Bacteria 6688536
908 2963646514 2963644680 Bacteria 6530403
909 2965021488 2965018300 Bacteria 6883036
910 2965027482 2965025482 Bacteria 6532201
911 2965037944 2965032056 Bacteria 6887443
912 2965042159 2965040258 Bacteria 6855979
913 2965049605 2965047637 Bacteria 6623551
914 2965064599 2965062239 Bacteria 7412989
915 2965091980 2965089291 Bacteria 6866420
916 2965114393 2965110997 Bacteria 6693150
917 2967999707 2967996073 Bacteria 6787468
918 2968008065 2968003550 Bacteria 6929263
919 2968020611 2968016561 Bacteria 7022047
920 2968090684 2968083720 Bacteria 7351627
921 2968094664 2968091066 Bacteria 6052692
922 2968098042 2968097103 Bacteria 6107094
923 2968115818 2968110612 Bacteria 6814636
924 2968119182 2968117919 Bacteria 6536078
925 2968140370 2968138860 Bacteria 6605449
926 2968175070 2968171901 Bacteria 6894245
927 2970473908 2970469710 Bacteria 6969209
928 2970490569 2970489779 Bacteria 6517260
929 2970507880 2970503327 Bacteria 7099517
930 2970514364 2970510686 Bacteria 7006402
931 2970527254 2970524798 Bacteria 6840927
932 2970535922 2970532167 Bacteria 6553173
933 2970541874 2970540015 Bacteria 6977556
934 2970548545 2970547951 Bacteria 6931819
935 2970558119 2970554993 Bacteria 6814252
936 2970597113 2970593180 Bacteria 7073582
937 2970623537 2970619444 Bacteria 6986144
938 2970627662 2970627176 Bacteria 6680862
939 2977826538 2977821940 Bacteria 6906439
940 2977848485 2977843712 Bacteria 6753583
941 2977856009 2977851361 Bacteria 6694324
942 2977864440 2977858184 Bacteria 6215359
943 2977865066 2977864932 Bacteria 7534097
944 2977880146 2977872689 Bacteria 7270173
945 2977899149 2977898635 Bacteria 6675551
946 2977912292 2977907340 Bacteria 6577984
947 2977916494 2977915119 Bacteria 6829656
948 2977926138 2977922695 Bacteria 6956781
949 2977938052 2977935797 Bacteria 6252826
950 2977944893 2977942078 Bacteria 7570577
951 2977956074 2977950692 Bacteria 6893264
952 2977963302 2977957713 Bacteria 6877875
953 2977977942 2977971508 Bacteria 7472917
954 2977988620 2977986579 Bacteria 6581278
955 2979092802 2979089926 Bacteria 5670289
956 2979099809 2979095461 Bacteria 5669583
957 2979104774 2979100975 Bacteria 5423623
958 2979771804 2979764755 Bacteria 6610066
959 2979774721 2979772303 Bacteria 6618277
960 2979786486 2979779861 Bacteria 6219781
961 2979798947 2979793036 Bacteria 6808957
962 2979813064 2979808191 Bacteria 7179355
963 2984513426 2984509177 Bacteria 5274802
964 2984520206 2984518228 Bacteria 5277463
965 2984539502 2984537506 Bacteria 5277481
966 2984601729 2984601300 Bacteria 5455244
967 2987639121 2987636660 Bacteria 8088555
968 2987651163 2987645492 Bacteria 6117018
969 2987662677 2987659509 Bacteria 6966464
970 2987671560 2987666974 Bacteria 6509233
971 2987679866 2987673487 Bacteria 6884027
972 2989774544 2989771324 Bacteria 5605128
973 2989776831 2989776772 Bacteria 4843317
974 2996311896 2996310559 Bacteria 6357320
975 2996336884 2996336353 Bacteria 5511628
976 2996352771 2996348954 Bacteria 7239054
977 2996387326 2996386984 Bacteria 6978667
978 2996887968 2996887358 Bacteria 5795980
979 3004167502 3004167301 Bacteria 8330599
980 3004191727 3004188549 Bacteria 6952365
981 3004196234 3004195979 Bacteria 6776956
982 3004204636 3004203850 Bacteria 7307914
983 3004217921 3004211236 Bacteria 7417683
984 3004221031 3004218560 Bacteria 7421728
985 3004238621 3004232784 Bacteria 6662140
986 3004253093 3004248173 Bacteria 6563236
987 3004274057 3004268573 Bacteria 7043476
988 3004279453 3004275668 Bacteria 7114440
989 3004293411 3004289098 Bacteria 6135450
990 3004335901 3004334049 Bacteria 8449246
991 3005410635 3005409236 Bacteria 7188837
992 3005423299 3005416602 Bacteria 7064308
993 3005450096 3005445848 Bacteria 6906074
994 3005456332 3005452660 Bacteria 5889319
995 637075773 637000159 Bacteria 7596297
996 639646068 639633055 Bacteria 7751309
997 649871663 649633066 Bacteria 6690028
998 650738628 650716007 Bacteria 5573770
999 8003572174 8003570095 Bacteria 5747666
1000 8004301519 8004300914 Bacteria 6132239
1001 8004319265 8004312739 Bacteria 7444653
1002 8004367006 8004361976 Bacteria 6858373
1003 8004378954 8004374579 Bacteria 6898112
1004 8004392647 8004387939 Bacteria 7049250
1005 8004396203 8004395343 Bacteria 6620908
1006 8004445985 8004445564 Bacteria 6322258
1007 8004636501 8004633249 Bacteria 6723080
1008 8004645254 8004640170 Bacteria 6723001
1009 8004701560 8004695233 Bacteria 6731676
1010 8004712161 8004703790 Bacteria 8006957
1011 8004718956 8004714634 Bacteria 6776161
1012 8005247886 8005246636 Bacteria 4933972
1013 8005261466 8005258706 Bacteria 6184835
1014 8005278294 8005275841 Bacteria 6929066
1015 8005282672 8005282627 Bacteria 6675747
1016 8005291648 8005289223 Bacteria 6634003
1017 8005305479 8005301065 Bacteria 6614431
1018 8005310255 8005307578 Bacteria 7395396
1019 8005315626 8005314921 Bacteria 7072929
1020 8005322495 8005321885 Bacteria 5795980
1021 8005378098 8005376324 Bacteria 6590079
1022 8005384108 8005382845 Bacteria 6732062
1023 8005399614 8005395548 Bacteria 6806915
1024 8005433793 8005430974 Bacteria 6689030
1025 8005465529 8005460587 Bacteria 7157962
1026 8005484467 8005484373 Bacteria 6297373
1027 8005498112 8005497431 Bacteria 6477605
1028 8005543234 8005542996 Bacteria 7077758
1029 8005559979 8005556819 Bacteria 6908598
1030 8005564527 8005563573 Bacteria 7153261
1031 8005571213 8005570704 Bacteria 6957481
1032 8005619321 8005619151 Bacteria 7030230
1033 8005627886 8005626139 Bacteria 6534237
1034 8005647387 8005645114 Bacteria 6950293
1035 8005661545 8005658619 Bacteria 4500593
1036 8005669520 8005668836 Bacteria 6953162
1037 8005687457 8005682033 Bacteria 6726518
1038 8005692769 8005688590 Bacteria 6610080
1039 8005701457 8005695170 Bacteria 6912330
1040 8018132537 8018127388 Bacteria 7351159
1041 8018167603 8018163183 Bacteria 7277977
1042 8018176616 8018176218 Bacteria 6896178
1043 8023681268 8023680758 Bacteria 7729763
1044 8024481901 8024479707 Bacteria 6954785
1045 8024488591 8024486573 Bacteria 6540512
1046 8024506337 8024501048 Bacteria 6427847
1047 8046768681 8046767195 Bacteria 7547379
1048 8054463958 8054460903 Bacteria 4872905
1049 8055619338 8055617313 Bacteria 7548464
1050 8056381186 8056375014 Bacteria 7006639
1051 8056382679 8056382006 Bacteria 6408074
1052 8056878653 8056875544 Bacteria 4355797
1053 8057582456 8057575449 Bacteria 7367519
1054 8057878697 8057874678 Bacteria 7494653
1055 JGI24740J21852_10010356
1056 JGI24740J21852_10012401
1057 JGI24740J21852_10058101
1058 JGI24739J22299_10020720
1059 JGI25155J39150_1000110
1060 JGI25156J39149_1000192
1061 JGI25162J39368_1000302
1062 JGI25162J39368_1001906
1063 JGI25154J39366_1000196
1064 JGI25158J39367_1001549
1065 JGI25157J39369_1000228
1066 JGI25157J39369_1001767
1067 JGI25152J39213_1003523
1068 JGI25152J39213_1003583
1069 JGI25152J39213_1023689
1070 JGI25150J39212_1001258
1071 JGI25150J39212_1009522
1072 JGI25159J45721_1000790
1073 JGI25159J45721_1001258
1074 JGI25151J46595_10000660
1075 JGI25151J46595_10001587
1076 JGI25151J46595_10007774
1077 JGI25151J46595_10010521
1078 JGI25151J46595_10031068
1079 JGI25151J46595_10039452
1080 JGI25165J46597_1000042
1081 JGI25165J46597_1000390
1082 JGI25165J46597_1001741
1083 JGI25165J46597_1002721
1084 JGI25153J46596_10007015
1085 JGI25153J46596_10011601
1086 JGI25153J46596_10032236
1087 rootH1_10050935
1088 rootH2_10047843
1089 rootL2_10038374
1090 JGI25160J50197_1000044
1091 JGI25160J50197_1003769
1092 JGI25161J50226_1000028
1093 JGI25161J50226_1000078
1094 Ga0055542_1000592
1095 Ga0055526_1005787
1096 Ga0055526_1006190
1097 Ga0055526_1012978
1098 Ga0055526_1019212
1099 Ga0055526_1019223
1100 Ga0055524_1004262
1101 Ga0055524_1012492
1102 Ga0055528_1000113
1103 Ga0055528_1001190
1104 Ga0055528_1006884
1105 Ga0055540_1001653
1106 Ga0055540_1007715
1107 Ga0055540_1022741
1108 Ga0058692_1002358
1109 Ga0058692_1002936
1110 Ga0055543_1000054
1111 Ga0055543_1000069
1112 Ga0065165_1000318
1113 Ga0065165_1012288
1114 Ga0065165_1016211
1115 Ga0070670_100000105
1116 Ga0070667_100596923
1117 Ga0070663_100051355
1118 Ga0068853_100006660
1119 Ga0068853_100551688
1120 Ga0068855_100128301
1121 Ga0068857_100483178
1122 Ga0068857_100493695
1123 Ga0068856_100169981
1124 Ga0068856_100314736
1125 Ga0068852_100018469
1126 Ga0068851_10037302
1127 Ga0075365_10004347
1128 Ga0075365_10017265
1129 Ga0075365_10020968
1130 Ga0075365_10038035
1131 Ga0075365_10078395
1132 Ga0075365_10083267
1133 Ga0075365_10190669
1134 Ga0075368_10001589
1135 Ga0075368_10024080
1136 Ga0075368_10035238
1137 Ga0075363_100009448
1138 Ga0075363_100023482
1139 Ga0075363_100059151
1140 Ga0075364_10042363
1141 Ga0075362_10001417
1142 Ga0075362_10092727
1143 Ga0075367_10004267
1144 Ga0075367_10010325
1145 Ga0075367_10018946
1146 Ga0075367_10089976
1147 Ga0075367_10204296
1148 Ga0075369_10044665
1149 Ga0075366_10024153
1150 Ga0075370_10000842
1151 Ga0075370_10037597
1152 Ga0075370_10039345
1153 Ga0079104_1000082
1154 Ga0099826_10006060
1155 Ga0099826_10097192
1156 Ga0105240_10001468
1157 Ga0105240_10249736
1158 Ga0105240_10398866
1159 Ga0105240_10563129
1160 Ga0105245_10672793
1161 Ga0105243_10003711
1162 Ga0105248_10054876
1163 Ga0105237_10004445
1164 Ga0105237_10011413
1165 Ga0105238_10307068
1166 Ga0105249_10365413
1167 Ga0123341_1000642
1168 Ga0123341_1057766
1169 Ga0123342_1010090
1170 Ga0123342_1021055
1171 Ga0105239_10046215
1172 Ga0105239_10048662
1173 Ga0105239_10328115
1174 Ga0105246_10185777
1175 Ga0157373_10018682
1176 Ga0157371_10000004
1177 Ga0157370_10001047
1178 Ga0157370_10001796
1179 Ga0182008_10087338
1180 Ga0182008_10095812
1181 Ga0182006_1020401
1182 Ga0163161_10396032
1183 Ga0209435_100087
1184 Ga0209436_100268
1185 Ga0209436_112679
1186 Ga0209672_105109
1187 Ga0209563_107279
1188 Ga0209437_100050
1189 Ga0209437_100205
1190 Ga0207425_1001736
1191 Ga0209646_1000285
1192 Ga0209026_1000029
1193 Ga0209026_1000347
1194 Ga0209677_109715
1195 Ga0209148_1000069
1196 Ga0209759_1000482
1197 Ga0209759_1000637
1198 Ga0209129_1000066
1199 Ga0209129_1001099
1200 Ga0209129_1001848
1201 Ga0209129_1002246
1202 Ga0209129_1006820
1203 Ga0209233_1000028
1204 Ga0209233_1000037
1205 Ga0209233_1000187
1206 Ga0209233_1000232
1207 Ga0209565_1035287
1208 Ga0209455_1000219
1209 Ga0209673_1000024
1210 Ga0209673_1000911
1211 Ga0209673_1002137
1212 Ga0209673_1002283
1213 Ga0209673_1003397
1214 Ga0209673_1013102
1215 Ga0209673_1034216
1216 Ga0209130_1000002
1217 Ga0209130_1000093
1218 Ga0209025_1000274
1219 Ga0209025_1000275
1220 Ga0209025_1000377
1221 Ga0209025_1000553
1222 Ga0209025_1008610
1223 Ga0209025_1015100
1224 Ga0209564_1000262
1225 Ga0209564_1000474
1226 Ga0209564_1000486
1227 Ga0209758_1000466
1228 Ga0209758_1000971
1229 Ga0209758_1003684
1230 Ga0209758_1009079
1231 Ga0209758_1009179
1232 Ga0209758_1025882
1233 Ga0209050_1006063
1234 Ga0209256_1000868
1235 Ga0209256_1003327
1236 Ga0209256_1011210
1237 Ga0209256_1038435
1238 Ga0207426_1000012
1239 Ga0207426_1000013
1240 Ga0207426_1000142
1241 Ga0209051_1000170
1242 Ga0209051_1002082
1243 Ga0209051_1027111
1244 Ga0209051_1037438
1245 Ga0209257_1007148
1246 Ga0207688_10199146
1247 Ga0207647_10058319
1248 Ga0207695_10000427
1249 Ga0207695_10635585
1250 Ga0207671_10002841
1251 Ga0207671_10023638
1252 Ga0207671_10500607
1253 Ga0207657_10211893
1254 Ga0207650_10000302
1255 Ga0207709_10231419
1256 Ga0207711_10077431
1257 Ga0207667_10214924
1258 Ga0207667_10529655
1259 Ga0207640_10650010
1260 Ga0207658_10519032
1261 Ga0207639_10242013
1262 Ga0207639_10473614
1263 Ga0207678_10046447
1264 Ga0207702_10034141
1265 Ga0207702_10257221
1266 Ga0207674_10144852
1267 Ga0207674_10877123
1268 Ga0207698_10087512
1269 Ga0209281_1000043
1270 Ga0209371_1000009
1271 Ga0209371_1000569
1272 Ga0209371_1000597
1273 Ga0209371_1002100
1274 Ga0209282_1015117
1275 Ga0209813_10015632
1276 Ga0268266_10085620
1277 Ga0268266_10204443
1278 Ga0307515_10070922
1279 Ga0307515_10316134
1280 Ga0268256_1000010
1281 Ga0268256_1003765
1282 Ga0268256_1003954
1283 Ga0307416_100409987
1284 Ga0395900_0293062
1285 Ga0395900_0318882
1286 Ga0395898_0214279
1287 Ga0395905_0473627
1288 Ga0395901_0040590
1289 Ga0395901_0102150
1290 Ga0395901_0525704
1291 Ga0439465_0004289
1292 Ga0439465_0094693
1293 Ga0439465_0115285
1294 Ga0451798_0437084
1295 Ga0451833_0309501
1296 Ga0451839_1518067
1297 Ga0451841_0823007
1298 Ga0451845_0491534
1299 Ga0451847_0530648
1300 Ga0451849_1413814
1301 Ga0439445_0067743
1302 Ga0439449_0036973
1303 Ga0466972_0069426
1304 Ga0466960_0034427
1305 Ga0466967_0785893
1306 Ga0495617_013045
1307 Ga0495627_028697
1308 Ga0495590_0029742
1309 Ga0495638_0000566
1310 Ga0495638_0043090
1311 Ga0495650_0027816
1312 Ga0495605_0009235
1313 Ga0495605_0041550
1314 Ga0495585_0018694
1315 Ga0495585_0047303
1316 Ga0495585_0048677
1317 Ga0495607_0022489
1318 Ga0495607_0024783
1319 Ga0495607_0191834
1320 Ga0495583_0003929
1321 Ga0495583_0019864
1322 Ga0495606_0005067
1323 Ga0495606_0049724
1324 Ga0495606_0055336
1325 Ga0495606_0077288
1326 Ga0495610_0037953
1327 Ga0495616_0025367
1328 Ga0495620_0041131
1329 Ga0495631_0003763
1330 Ga0495632_0012650
1331 Ga0495632_0024308
1332 Ga0495643_0036691
1333 Ga0495643_0109703
1334 Ga0495654_0000314
1335 Ga0495609_0022681
1336 Ga0495597_0148905
1337 Ga0495633_0016834
1338 Ga0495633_0036013
1339 Ga0495656_0007518
1340 Ga0495668_0011736
1341 Ga0495668_0210932
1342 Ga0495611_0009426
1343 Ga0495625_0023496
1344 Ga0495625_0049188
1345 Ga0495625_0091282
1346 Ga0495625_0095479
1347 Ga0495661_0014352
1348 Ga0495661_0270325
1349 Ga0495670_0032614
1350 Ga0495670_0071710
1351 Ga0495671_0014249
1352 Ga0495671_0106694
1353 Ga0495649_0023374
1354 Ga0495636_0114020
1355 Ga0495681_0009496
1356 Ga0495686_0002334
1357 Ga0495686_0020721
1358 Ga0495686_0182194
1359 Ga0496101_0192646
1360 Ga0496102_0169134
1361 Ga0496103_0188830
1362 Ga0496106_0006761
1363 Ga0496108_0453277
1364 Ga0496112_0004626
1365 Ga0496113_0037980
1366 Ga0496116_0018149
1367 Ga0496116_0141976
1368 Ga0496117_0000002
1369 Ga0496117_0002038
1370 Ga0496117_0005456
1371 Ga0496117_0023070
1372 Ga0496117_0031006
1373 Ga0496117_0045021
1374 Ga0496117_0070695
1375 Ga0496118_0001167
1376 Ga0496118_0017956
1377 Ga0496118_0060628
1378 Ga0496118_0109751
1379 Ga0496118_0122183
1380 Ga0496119_0014974
1381 Ga0496119_0026777
1382 Ga0496119_0047803
1383 Ga0496119_0099572
1384 Ga0496119_0171840
1385 Ga0496119_0240112
1386 Ga0496120_0002729
1387 Ga0496120_0015943
1388 Ga0496120_0017924
1389 Ga0496120_0020218
1390 Ga0496121_0000001
1391 Ga0496121_0023381
1392 Ga0496121_0044238
1393 Ga0496121_0056726
1394 Ga0496121_0107387
1395 Ga0496121_0139533
1396 Ga0496122_0000001
1397 Ga0496122_0000018
1398 Ga0496122_0000321
1399 Ga0496122_0025714
1400 Ga0496122_0126865
1401 Ga0496122_0141991
1402 Ga0496123_0000001
1403 Ga0496123_0000015
1404 Ga0496123_0000454
1405 Ga0496123_0004823
1406 Ga0496123_0139316
1407 Ga0496124_0000558
1408 Ga0496124_0006480
1409 Ga0496124_0043463
1410 Ga0496124_0046082
1411 Ga0496124_0046414
1412 Ga0496124_0131850
1413 Ga0496125_0000001
1414 Ga0496125_0000628
1415 Ga0496125_0006658
1416 Ga0496125_0037411
1417 Ga0496125_0049883
1418 Ga0496125_0085026
1419 Ga0496125_0090571
1420 Ga0496125_0197038
1421 Ga0496126_0000378
1422 Ga0496126_0063882
1423 Ga0496126_0177821
1424 Ga0496126_0243423
1425 Ga0496126_0306012
1426 Ga0496126_0421783
1427 Ga0495678_047945
1428 Ga0501031_0004927
1429 Ga0501031_0085938
1430 Ga0501032_0000019
1431 Ga0501032_0051426
1432 Ga0501032_0055436
1433 Ga0501032_0374855
1434 Ga0501033_0000260
1435 Ga0501033_0000461
1436 Ga0501033_0013860
1437 Ga0501033_0034352
1438 Ga0501033_0071969
1439 Ga0501033_0149740
1440 Ga0501033_0181834
1441 Ga0501034_0002910
1442 Ga0501034_0411430
1443 Ga0501034_0636201
1444 Ga0501036_0001517
1445 Ga0501036_0086723
1446 Ga0501037_0000154
1447 Ga0501037_0000870
1448 Ga0501037_0040577
1449 Ga0501037_0042753
1450 Ga0501037_0082837
1451 Ga0501038_0001781
1452 Ga0501038_0088163
1453 Ga0501038_0101706
1454 Ga0501038_0576400
1455 Ga0501039_0001074
1456 Ga0501039_0139292
1457 Ga0501039_0438841
1458 Ga0501043_0000007
1459 Ga0501043_0000113
1460 Ga0501043_0048312
1461 Ga0501043_0069942
1462 Ga0501043_0159911
1463 Ga0501046_0191544
1464 Ga0501047_0037568
1465 Ga0501047_0092531
1466 Ga0501047_0127106
1467 Ga0501047_0186069
1468 Ga0501047_0319073
1469 Ga0501067_0176497
1470 Ga0501068_0021893
1471 Ga0501068_0109855
1472 Ga0501068_0342680
1473 Ga0501069_0000027
1474 Ga0501069_0052485
1475 Ga0501069_0115122
1476 Ga0501069_0137725
1477 Ga0501070_0000231
1478 Ga0501070_0000822
1479 Ga0501070_0000825
1480 Ga0501070_0034270
1481 Ga0501070_0041305
1482 Ga0501070_0162893
1483 Ga0501070_0250959
1484 Ga0501070_0493250
1485 Ga0501071_0035260
1486 Ga0501073_0038563
1487 Ga0501074_0000023
1488 Ga0501074_0016561
1489 Ga0501076_0217993
1490 Ga0501080_0000300
1491 Ga0501080_0122112
1492 Ga0501080_0164697
1493 Ga0501083_0000012
1494 Ga0501083_0042127
1495 Ga0501035_0000073
1496 Ga0501035_0000201
1497 Ga0501035_0000709
1498 Ga0501035_0001226
1499 Ga0501035_0001287
1500 Ga0501035_0066684
1501 Ga0501035_0071499
1502 Ga0501035_0455009
1503 Ga0501044_0000118
1504 Ga0501044_0019989
1505 Ga0501044_0054362
1506 Ga0501044_0068483
1507 Ga0501044_0176352
1508 Ga0501044_0306819
1509 Ga0501044_0364578
1510 Ga0501044_0462262
1511 nmdc:mga03683_203753_c1
1512 nmdc:mga03683_6637_c1
1513 nmdc:mga03n38_168995_c1
1514 nmdc:mga03n38_234855_c1
1515 nmdc:mga00v17_611_c1
1516 nmdc:mga0yw44_16789_c1
1517 nmdc:mga0yw44_2319_c1
1518 nmdc:mga0yw44_24863_c1
1519 nmdc:mga0yw44_55086_c1
1520 nmdc:mga0yw44_60256_c1
1521 nmdc:mga0k408_10280_c1
1522 nmdc:mga06z11_12773_c1
1523 nmdc:mga06z11_271014_c1
1524 nmdc:mga06z11_36763_c1
1525 nmdc:mga06z11_91619_c1
1526 nmdc:mga04h51_13917_c1
1527 nmdc:mga07m45_11183_c1
1528 nmdc:mga0sz30_11473_c1
1529 nmdc:mga0sz30_42457_c1
1530 Ga0500610_0039841
1531 Ga0500578_0035296
1532 Ga0500578_0072312
1533 Ga0500643_012418
1534 Ga0500557_042031
1535 Ga0500618_000203
1536 Ga0500618_001739
1537 Ga0500618_021138
1538 Ga0500658_0009920
1539 Ga0500561_0000139
1540 Ga0500568_0001169
1541 Ga0500568_0006185
1542 Ga0500568_0053805
1543 Ga0500577_0044998
1544 Ga0500616_0007056
1545 Ga0500616_0009183
1546 Ga0500616_0070165
1547 Ga0500616_0164888
1548 Ga0500620_007279
1549 Ga0500622_0009636
1550 Ga0500624_002343
1551 Ga0500627_0037793
1552 Ga0500627_0055473
1553 Ga0500634_0049682
1554 Ga0500636_0000022
1555 Ga0500636_0001307
1556 2996897599
1557 2509114670
1558 2509369674
1559 2509388994
1560 2509394771
1561 2509444584
1562 2510135669
1563 2510318629
1564 2510838861
1565 2510897142
1566 2511136857
1567 2511185326
1568 2511200522
1569 2512932689
1570 2512960746
1571 2513570830
1572 2513574955
1573 2513595613
1574 2513608777
1575 2513633739
1576 2513707586
1577 2513865362
1578 2513910998
1579 2513924306
1580 2514023680
1581 2515114833
1582 2515635810
1583 2515641424
1584 2515659313
1585 2515741182
1586 2517038451
1587 2517078727
1588 2517097469
1589 2517408925
1590 2520379181
1591 2523467759
1592 2524461871
1593 2530648344
1594 2535514574
1595 2537877273
1596 2554246169
1597 2559293392
1598 2585164442
1599 2585201281
1600 2585223259
1601 2585230949
1602 2585256424
1603 2585273458
1604 2585283170
1605 2585328201
1606 2585330613
1607 2585399100
1608 2585523958
1609 2585536018
1610 2585542102
1611 2585546145
1612 2585556654
1613 2585564014
1614 2585818750
1615 2585840688
1616 2585900316
1617 2585909278
1618 2587984620
1619 2588518775
1620 2597810915
1621 2599419736
1622 2599604276
1623 2599718716
1624 2599936522
1625 2601609588
1626 2601746363
1627 2616293961
1628 2616311187
1629 2616556079
1630 2617380722
1631 2643776674
1632 2643795122
1633 2643920549
1634 2643987466
1635 2644004417
1636 2644133877
1637 2644158014
1638 2644191215
1639 2644237665
1640 2644298211
1641 2644498800
1642 2644519642
1643 2644656463
1644 2671115836
1645 2688597107
1646 2694628810
1647 2694637276
1648 2719183332
1649 2719388092
1650 2719667715
1651 2719734049
1652 2720494135
1653 2720615598
1654 2720622381
1655 2720633735
1656 2720777435
1657 2721149444
1658 2721160847
1659 2721166281
1660 2721401725
1661 2722842451
1662 2723029032
1663 2723562649
1664 2723569342
1665 2724040539
1666 2724046805
1667 2724092042
1668 2724106607
1669 2724112415
1670 2725949667
1671 2730109968
1672 2730166567
1673 2730300479
1674 2738800769
1675 2739037351
1676 2739349209
1677 2756671181
1678 2766067161
1679 2776915980
1680 2778179507
1681 2792748138
1682 2793298460
1683 2793315700
1684 2793323483
1685 2793327571
1686 2793335642
1687 2793341036
1688 2793350287
1689 2793354772
1690 2793358531
1691 2793368983
1692 2805928907
1693 2805934528
1694 2806047078
1695 2806054923
1696 2806061849
1697 2806069628
1698 2806076001
1699 2808986839
1700 2819244208
1701 2819556911
1702 2819608880
1703 2819643305
1704 2819685822
1705 2821123231
1706 2837651500
1707 2837679257
1708 2838020942
1709 2838026845
1710 2838033955
1711 2838039731
1712 2838044856
1713 2838052909
1714 2838064702
1715 2838070521
1716 2838664009
1717 2838672531
1718 2838677647
1719 2838685584
1720 2838689840
1721 2838695960
1722 2838705146
1723 2838713359
1724 2838716536
1725 2838719664
1726 2838727287
1727 2838731464
1728 2838739746
1729 2838744405
1730 2841738025
1731 2841844130
1732 2841846595
1733 2841852945
1734 2841860876
1735 2841870210
1736 2842082593
1737 2842112748
1738 2842123848
1739 2842127376
1740 2842132540
1741 2842143851
1742 2842150140
1743 2842152291
1744 2842160272
1745 2842165750
1746 2842172782
1747 2842175910
1748 2842184062
1749 2842189644
1750 2842196364
1751 2842202438
1752 2842208910
1753 2842213958
1754 2842219426
1755 2842224424
1756 2842231644
1757 2842242903
1758 2842245887
1759 2842254826
1760 2842260265
1761 2842267153
1762 2842273676
1763 2842282400
1764 2842290060
1765 2842296976
1766 2842299937
1767 2842308472
1768 2842312224
1769 2842321818
1770 2842344656
1771 2842359541
1772 2842367769
1773 2842376030
1774 2842383240
1775 2842390373
1776 2842397841
1777 2842407670
1778 2842414301
1779 2842420839
1780 2842424135
1781 2842431151
1782 2842437486
1783 2842444301
1784 2842451272
1785 2842465294
1786 2842472237
1787 2842480701
1788 2842487255
1789 2842494108
1790 2842501247
1791 2842507256
1792 2842514530
1793 2842517661
1794 2844008825
1795 2844012463
1796 2844456588
1797 2847674926
1798 2852387864
1799 2856320645
1800 2856322952
1801 2856334727
1802 2856339617
1803 2856345883
1804 2856349430
1805 2856367940
1806 2857351937
1807 2857520884
1808 2857533817
1809 2869164779
1810 2869173043
1811 2869241470
1812 2869244879
1813 2869254131
1814 2869259748
1815 2869271105
1816 2869276576
1817 2869282504
1818 2869290441
1819 2871432725
1820 2871437390
1821 2871454229
1822 2871466490
1823 2871474301
1824 2871477418
1825 2871484905
1826 2871493335
1827 2871499075
1828 2874106505
1829 2874111837
1830 2874117156
1831 2874126707
1832 2874134939
1833 2874142159
1834 2874152692
1835 2874160092
1836 2874168095
1837 2874174925
1838 2876365059
1839 2876374434
1840 2876379857
1841 2876386761
1842 2876397913
1843 2876402721
1844 2876407866
1845 2876418608
1846 2876423015
1847 2878036052
1848 2878733980
1849 2878744655
1850 2878750339
1851 2878757379
1852 2878763274
1853 2878770262
1854 2878779744
1855 2878785281
1856 2878789503
1857 2881149806
1858 2881160951
1859 2881166691
1860 2881848451
1861 2881857243
1862 2881868938
1863 2882912660
1864 2885308210
1865 2885312981
1866 2885321870
1867 2885332741
1868 2885334613
1869 2885342853
1870 2885353513
1871 2888338186
1872 2888345782
1873 2888355042
1874 2891374796
1875 2899794299
1876 2899805886
1877 2899845679
1878 2903450069
1879 2903499993
1880 2903501107
1881 2903520815
1882 2903522206
1883 2903528584
1884 2903543877
1885 2904664564
1886 2906312697
1887 2906325406
1888 2906330790
1889 2906360034
1890 2906367501
1891 2906373657
1892 2906384463
1893 2906391219
1894 2906399469
1895 2906401458
1896 2906411007
1897 2906419906
1898 2906432720
1899 2919101862
1900 2919116753
1901 2919408328
1902 2922138713
1903 2922157139
1904 2922172874
1905 2922179713
1906 2922192928
1907 2923556181
1908 2924714854
1909 2924725453
1910 2924738036
1911 2924749758
1912 2924767074
1913 2924782685
1914 2924786685
1915 2926754763
1916 2926761931
1917 2929138880
1918 2933006938
1919 2933015472
1920 2933574921
1921 2933588363
1922 2933594141
1923 2933601326
1924 2935899978
1925 2935902325
1926 2936369541
1927 2936380282
1928 2936385261
1929 2937819158
1930 2937827704
1931 2937837329
1932 2937852167
1933 2937863095
1934 2937873092
1935 2937881330
1936 2937893357
1937 2937977422
1938 2937984508
1939 2937997726
1940 2958039286
1941 2958053084
1942 2958070482
1943 2958073918
1944 2958088113
1945 2958094120
1946 2958110099
1947 2958121086
1948 2958127419
1949 2958134829
1950 2958143081
1951 2958148863
1952 2958164469
1953 2958168199
1954 2958186391
1955 2961084890
1956 2961119563
1957 2961130872
1958 2961140618
1959 2961166665
1960 2961175292
1961 2961186024
1962 2963646514
1963 2965021488
1964 2965027482
1965 2965037944
1966 2965042159
1967 2965049605
1968 2965064599
1969 2965091980
1970 2965114393
1971 2967999707
1972 2968008065
1973 2968020611
1974 2968090684
1975 2968094664
1976 2968098042
1977 2968115818
1978 2968119182
1979 2968140370
1980 2968175070
1981 2970473908
1982 2970490569
1983 2970507880
1984 2970514364
1985 2970527254
1986 2970535922
1987 2970541874
1988 2970548545
1989 2970558119
1990 2970597113
1991 2970623537
1992 2970627662
1993 2977826538
1994 2977848485
1995 2977856009
1996 2977864440
1997 2977865066
1998 2977880146
1999 2977899149
2000 2977912292
2001 2977916494
2002 2977926138
2003 2977938052
2004 2977944893
2005 2977956074
2006 2977963302
2007 2977977942
2008 2977988620
2009 2979092802
2010 2979099809
2011 2979104774
2012 2979771804
2013 2979774721
2014 2979786486
2015 2979798947
2016 2979813064
2017 2984513426
2018 2984520206
2019 2984539502
2020 2984601729
2021 2987639121
2022 2987651163
2023 2987662677
2024 2987671560
2025 2987679866
2026 2989774544
2027 2989776831
2028 2996311896
2029 2996336884
2030 2996352771
2031 2996387326
2032 2996887968
2033 3004167502
2034 3004191727
2035 3004196234
2036 3004204636
2037 3004217921
2038 3004221031
2039 3004238621
2040 3004253093
2041 3004274057
2042 3004279453
2043 3004293411
2044 3004335901
2045 3005410635
2046 3005423299
2047 3005450096
2048 3005456332
2049 637075773
2050 639646068
2051 649871663
2052 650738628
2053 8003572174
2054 8004301519
2055 8004319265
2056 8004367006
2057 8004378954
2058 8004392647
2059 8004396203
2060 8004445985
2061 8004636501
2062 8004645254
2063 8004701560
2064 8004712161
2065 8004718956
2066 8005247886
2067 8005261466
2068 8005278294
2069 8005282672
2070 8005291648
2071 8005305479
2072 8005310255
2073 8005315626
2074 8005322495
2075 8005378098
2076 8005384108
2077 8005399614
2078 8005433793
2079 8005465529
2080 8005484467
2081 8005498112
2082 8005543234
2083 8005559979
2084 8005564527
2085 8005571213
2086 8005619321
2087 8005627886
2088 8005647387
2089 8005661545
2090 8005669520
2091 8005687457
2092 8005692769
2093 8005701457
2094 8018132537
2095 8018167603
2096 8018176616
2097 8023681268
2098 8024481901
2099 8024488591
2100 8024506337
2101 8046768681
2102 8054463958
2103 8055619338
2104 8056381186
2105 8056382679
2106 8056878653
2107 8057582456
2108 8057878697

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

14

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yqq-assembly1.cif.gz_A escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene 0.8424 2 248
3odg-assembly1.cif.gz_A-3 crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis 0.8359 2 249
8swt-assembly1.cif.gz_A structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate 0.8316 2 248
4m1e-assembly1.cif.gz_B crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. 0.8264 2 245
1fxu-assembly1.cif.gz_A purine nucleoside phosphorylase from calf spleen in complex with n(7)-acycloguanosine inhibitor and a phosphate ion 0.8241 2 248
ID Description Score Start End Superfamily
1yqqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8424 2 248 3.40.50.1580
1yqqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8204 2 248 3.40.50.1580
af_U4PSA1_35_317_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8183 2 248 3.40.50.1580
af_A0A1D8PJL8_4_307_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8151 2 248 3.40.50.1580
1td1C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8107 2 247 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A527GD43-F1-model_v4 Purine-nucleoside phosphorylase 0.9849 1 111 GO:0004731
GO:0005737
GO:0009116
AF-A0A527GD43-F1-model_v4 Purine-nucleoside phosphorylase 0.9762 1 111 GO:0004731
GO:0005737
GO:0009116
AF-A0A536QTZ5-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9576 1 128 GO:0004731
GO:0005737
GO:0009116
AF-A0A2T3XJJ4-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9557 2 124 GO:0004731
GO:0005737
GO:0009116
AF-A0A358PKT2-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.955 2 124 GO:0004731
GO:0005737
GO:0009116

Map