F489141
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 780 | 2108 | 260 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2996893221|2996897599 |
| Length | 275 |
| Sequence | VSLLAALLGGIKPRHGIVLGSGLGSLVGELEGAVHVPYKDLPGFPVSAVSGHAGEVVAGRLGGVPVIMLSGRVHYYEKGDAGAMRLPIEVLKALGVEVLILTNSAGSLRDDMPPGSVMQITDHINYSGMNPLIGEESDRRFVGMTNAYDAGLAAAMQKAAAKLEIELAQGVYMWLSGPSFETPAEIRMARILGADAVGMSTVPEVIIARMLGLRVAAASVITNYGAGMTGNELSHEETKDMAPIGGARLAAILKDMIAAGAIPGKVRSGFPSGIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 47 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 56 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 107 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 109 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 119 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 121 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 122 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 123 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 124 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 125 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 126 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 127 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 128 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 129 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 130 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 131 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 166 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 172 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 173 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 174 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 175 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 176 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 205 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 206 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 207 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 208 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 209 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 210 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 211 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 213 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 214 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 215 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 216 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 217 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 219 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 220 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 221 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 222 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 223 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 224 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 225 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 226 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 228 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 229 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 230 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 231 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 232 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 233 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 234 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 235 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 236 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 237 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 238 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 239 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 240 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 241 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 242 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 243 | 2512875024 | |||
| 244 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 245 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 246 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 247 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 248 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 249 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 250 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 251 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 252 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 253 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 254 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 255 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 256 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 257 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 258 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 259 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 260 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 261 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 262 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 263 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 264 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 265 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 266 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 267 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 268 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 269 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 270 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 271 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 272 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 273 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 274 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 275 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 276 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 277 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 278 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 279 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 280 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 281 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 282 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 283 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 284 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 285 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 286 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 287 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 288 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 289 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 290 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 291 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 292 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 293 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 294 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 295 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 296 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 297 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 298 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 299 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 300 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 301 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 302 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 303 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 304 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 305 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 306 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 307 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 308 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 309 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 310 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 311 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 312 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 313 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 314 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 315 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 316 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 317 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 318 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 319 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 320 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 321 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 322 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 323 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 324 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 325 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 326 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 327 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 328 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 329 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 330 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 331 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 332 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 333 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 334 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 335 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 336 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 337 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 338 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 339 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 340 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 341 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 342 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 343 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 344 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 345 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 346 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 347 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 348 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 349 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 350 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 351 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 352 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 353 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 354 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 355 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 356 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 357 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 358 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 359 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 360 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 361 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 362 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 363 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 364 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 365 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 366 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 367 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 368 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 369 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 370 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 371 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 372 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 373 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 374 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 375 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 376 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 377 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 378 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 379 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 380 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 381 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 382 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 383 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 384 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 385 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 386 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 387 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 388 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 389 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 390 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 391 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 392 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 393 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 394 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 395 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 396 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 397 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 398 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 399 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 400 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 401 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 402 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 403 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 404 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 405 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 406 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 407 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 408 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 409 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 410 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 411 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 412 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 413 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 414 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 415 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 416 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 417 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 418 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 419 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 420 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 421 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 422 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 423 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 424 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 425 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 426 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 427 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 428 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 429 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 430 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 431 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 432 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 433 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 434 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 435 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 436 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 437 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 438 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 439 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 440 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 441 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 442 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 443 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 444 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 445 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 446 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 447 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 448 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 449 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 450 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 451 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 452 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 453 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 454 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 455 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 456 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 457 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 458 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 459 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 460 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 461 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 462 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 463 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 464 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 465 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 466 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 467 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 468 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 469 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 470 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 471 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 472 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 473 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 474 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 475 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 476 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 477 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 478 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 479 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 480 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 481 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 482 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 483 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 484 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 485 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 486 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 487 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 488 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 489 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 490 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 491 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 492 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 493 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 494 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 495 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 496 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 497 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 498 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 499 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 500 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 501 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 502 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 503 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 504 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 505 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 506 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 507 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 508 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 509 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 510 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 511 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 512 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 513 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 514 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 515 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 516 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 517 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 518 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 519 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 520 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 521 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 522 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 523 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 524 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 525 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 526 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 527 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 528 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 529 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 530 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 531 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 532 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 533 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 534 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 535 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 536 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 537 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 538 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 539 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 540 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 541 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 542 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 543 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 544 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 545 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 546 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 547 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 548 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 549 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 550 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 551 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 552 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 553 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 554 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 555 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 556 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 557 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 558 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 559 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 560 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 561 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 562 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 563 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 564 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 565 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 566 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 567 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 568 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 569 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 570 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 571 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 572 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 573 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 574 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 575 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 576 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 577 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 578 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 579 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 580 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 581 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 582 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 583 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 584 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 585 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 586 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 587 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 588 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 589 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 590 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 591 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 592 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 593 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 594 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 595 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 596 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 597 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 598 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 599 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 600 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 601 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 602 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 603 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 604 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 605 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 606 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 607 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 608 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 609 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 610 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 611 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 612 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 613 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 614 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 615 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 616 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 617 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 618 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 619 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 620 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 621 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 622 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 623 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 624 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 625 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 626 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 627 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 628 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 629 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 630 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 631 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 632 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 633 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 634 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 635 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 636 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 637 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 638 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 639 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 640 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 641 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 642 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 643 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 644 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 645 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 646 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 647 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 648 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 649 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 650 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 651 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 652 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 653 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 654 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 655 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 656 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 657 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 658 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 659 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 660 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 661 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 662 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 663 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 664 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 665 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 666 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 667 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 668 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 669 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 670 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 671 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 672 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 673 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 674 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 675 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 676 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 677 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 678 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 679 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 680 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 681 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 682 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 683 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 684 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 685 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 686 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 687 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 688 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 689 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 690 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 691 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 692 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 693 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 694 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 695 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 696 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 697 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 698 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 699 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 700 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 701 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 702 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 703 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 704 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 705 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 706 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 707 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 708 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 709 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 710 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 711 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 712 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 713 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 714 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 715 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 716 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 717 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 718 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 719 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 720 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 721 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 722 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 723 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 724 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 725 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 726 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 727 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 728 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 729 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 730 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 731 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 732 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 733 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 734 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 735 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 736 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 737 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 738 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 739 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 740 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 741 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 742 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 743 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 744 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 745 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 746 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 747 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 748 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 749 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 750 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 751 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 752 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 753 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 754 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 755 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 756 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 757 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 758 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 759 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 760 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 761 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 762 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 763 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 764 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 765 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 766 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 767 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 768 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 769 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 770 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 771 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 772 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 773 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 774 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 775 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 776 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 777 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 778 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 779 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 780 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 47.53 |
| Metatranscriptomes | 0 |
| Isolates | 52.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.38 |
| Bulb | 0 |
| Endosphere | 16.6 |
| Nodule | 40.7 |
| Rhizoplane | 1.33 |
| Rhizosphere | 25.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010356 | 3300001979 | Bacteria | 3600 |
| 2 | JGI24740J21852_10012401 | 3300001979 | Bacteria | 3213 |
| 3 | JGI24740J21852_10058101 | 3300001979 | Bacteria | 1077 |
| 4 | JGI24739J22299_10020720 | 3300001989 | Bacteria | 2347 |
| 5 | JGI25155J39150_1000110 | 3300002704 | Bacteria | 43893 |
| 6 | JGI25156J39149_1000192 | 3300002705 | Bacteria | 44040 |
| 7 | JGI25162J39368_1000302 | 3300002737 | Bacteria | 45304 |
| 8 | JGI25162J39368_1001906 | 3300002737 | Bacteria | 9562 |
| 9 | JGI25154J39366_1000196 | 3300002738 | Bacteria | 44040 |
| 10 | JGI25158J39367_1001549 | 3300002739 | Bacteria | 3984 |
| 11 | JGI25157J39369_1000228 | 3300002741 | Bacteria | 44040 |
| 12 | JGI25157J39369_1001767 | 3300002741 | Bacteria | 7056 |
| 13 | JGI25152J39213_1003523 | 3300002773 | Bacteria | 5300 |
| 14 | JGI25152J39213_1003583 | 3300002773 | Bacteria | 5257 |
| 15 | JGI25152J39213_1023689 | 3300002773 | Bacteria | 1041 |
| 16 | JGI25150J39212_1001258 | 3300002774 | Bacteria | 7330 |
| 17 | JGI25150J39212_1009522 | 3300002774 | Bacteria | 1842 |
| 18 | JGI25159J45721_1000790 | 3300002987 | Bacteria | 13778 |
| 19 | JGI25159J45721_1001258 | 3300002987 | Bacteria | 10693 |
| 20 | JGI25151J46595_10000660 | 3300003187 | Bacteria | 29371 |
| 21 | JGI25151J46595_10001587 | 3300003187 | Bacteria | 15099 |
| 22 | JGI25151J46595_10007774 | 3300003187 | Bacteria | 5217 |
| 23 | JGI25151J46595_10010521 | 3300003187 | Bacteria | 4293 |
| 24 | JGI25151J46595_10031068 | 3300003187 | Bacteria | 2090 |
| 25 | JGI25151J46595_10039452 | 3300003187 | Bacteria | 1744 |
| 26 | JGI25165J46597_1000042 | 3300003214 | Bacteria | 271606 |
| 27 | JGI25165J46597_1000390 | 3300003214 | Bacteria | 46779 |
| 28 | JGI25165J46597_1001741 | 3300003214 | Bacteria | 9593 |
| 29 | JGI25165J46597_1002721 | 3300003214 | Bacteria | 5226 |
| 30 | JGI25153J46596_10007015 | 3300003215 | Bacteria | 5611 |
| 31 | JGI25153J46596_10011601 | 3300003215 | Bacteria | 3879 |
| 32 | JGI25153J46596_10032236 | 3300003215 | Bacteria | 1751 |
| 33 | rootH1_10050935 | 3300003316 | Bacteria | 1444 |
| 34 | rootH2_10047843 | 3300003320 | Bacteria | 3297 |
| 35 | rootL2_10038374 | 3300003322 | Bacteria | 5013 |
| 36 | JGI25160J50197_1000044 | 3300003354 | Bacteria | 145379 |
| 37 | JGI25160J50197_1003769 | 3300003354 | Bacteria | 6672 |
| 38 | JGI25161J50226_1000028 | 3300003374 | Bacteria | 145379 |
| 39 | JGI25161J50226_1000078 | 3300003374 | Bacteria | 83416 |
| 40 | Ga0055542_1000592 | 3300003762 | Bacteria | 31197 |
| 41 | Ga0055526_1005787 | 3300003771 | Bacteria | 6969 |
| 42 | Ga0055526_1006190 | 3300003771 | Bacteria | 6581 |
| 43 | Ga0055526_1012978 | 3300003771 | Bacteria | 3572 |
| 44 | Ga0055526_1019212 | 3300003771 | Bacteria | 2500 |
| 45 | Ga0055526_1019223 | 3300003771 | Bacteria | 2500 |
| 46 | Ga0055524_1004262 | 3300003775 | Bacteria | 6648 |
| 47 | Ga0055524_1012492 | 3300003775 | Bacteria | 3257 |
| 48 | Ga0055528_1000113 | 3300003790 | Bacteria | 65323 |
| 49 | Ga0055528_1001190 | 3300003790 | Bacteria | 16795 |
| 50 | Ga0055528_1006884 | 3300003790 | Bacteria | 5100 |
| 51 | Ga0055540_1001653 | 3300003792 | Bacteria | 12938 |
| 52 | Ga0055540_1007715 | 3300003792 | Bacteria | 4006 |
| 53 | Ga0055540_1022741 | 3300003792 | Bacteria | 1596 |
| 54 | Ga0058692_1002358 | 3300003856 | Bacteria | 6357 |
| 55 | Ga0058692_1002936 | 3300003856 | Bacteria | 5486 |
| 56 | Ga0055543_1000054 | 3300004625 | Bacteria | 104176 |
| 57 | Ga0055543_1000069 | 3300004625 | Bacteria | 94040 |
| 58 | Ga0065165_1000318 | 3300005262 | Bacteria | 78352 |
| 59 | Ga0065165_1012288 | 3300005262 | Bacteria | 3496 |
| 60 | Ga0065165_1016211 | 3300005262 | Bacteria | 2800 |
| 61 | Ga0070670_100000105 | 3300005331 | Bacteria | 77938 |
| 62 | Ga0070667_100596923 | 3300005367 | Bacteria | 1017 |
| 63 | Ga0070663_100051355 | 3300005455 | Bacteria | 2937 |
| 64 | Ga0068853_100006660 | 3300005539 | Bacteria | 9199 |
| 65 | Ga0068853_100551688 | 3300005539 | Bacteria | 1092 |
| 66 | Ga0068855_100128301 | 3300005563 | Bacteria | 2898 |
| 67 | Ga0068857_100483178 | 3300005577 | Bacteria | 1161 |
| 68 | Ga0068857_100493695 | 3300005577 | Bacteria | 1148 |
| 69 | Ga0068856_100169981 | 3300005614 | Bacteria | 2192 |
| 70 | Ga0068856_100314736 | 3300005614 | Bacteria | 1583 |
| 71 | Ga0068852_100018469 | 3300005616 | Bacteria | 5495 |
| 72 | Ga0068851_10037302 | 3300005834 | Bacteria | 2436 |
| 73 | Ga0075365_10004347 | 3300006038 | Bacteria | 7489 |
| 74 | Ga0075365_10017265 | 3300006038 | Bacteria | 4411 |
| 75 | Ga0075365_10020968 | 3300006038 | Bacteria | 4066 |
| 76 | Ga0075365_10038035 | 3300006038 | Bacteria | 3125 |
| 77 | Ga0075365_10078395 | 3300006038 | Bacteria | 2234 |
| 78 | Ga0075365_10083267 | 3300006038 | Bacteria | 2170 |
| 79 | Ga0075365_10190669 | 3300006038 | Bacteria | 1434 |
| 80 | Ga0075368_10001589 | 3300006042 | Bacteria | 7293 |
| 81 | Ga0075368_10024080 | 3300006042 | Bacteria | 2329 |
| 82 | Ga0075368_10035238 | 3300006042 | Bacteria | 1952 |
| 83 | Ga0075363_100009448 | 3300006048 | Bacteria | 4585 |
| 84 | Ga0075363_100023482 | 3300006048 | Bacteria | 3126 |
| 85 | Ga0075363_100059151 | 3300006048 | Bacteria | 2060 |
| 86 | Ga0075364_10042363 | 3300006051 | Bacteria | 2957 |
| 87 | Ga0075362_10001417 | 3300006177 | Bacteria | 7642 |
| 88 | Ga0075362_10092727 | 3300006177 | Bacteria | 1403 |
| 89 | Ga0075367_10004267 | 3300006178 | Bacteria | 6952 |
| 90 | Ga0075367_10010325 | 3300006178 | Bacteria | 4904 |
| 91 | Ga0075367_10018946 | 3300006178 | Bacteria | 3807 |
| 92 | Ga0075367_10089976 | 3300006178 | Bacteria | 1866 |
| 93 | Ga0075367_10204296 | 3300006178 | Bacteria | 1234 |
| 94 | Ga0075369_10044665 | 3300006186 | Bacteria | 1904 |
| 95 | Ga0075366_10024153 | 3300006195 | Bacteria | 3546 |
| 96 | Ga0075370_10000842 | 3300006353 | Bacteria | 12429 |
| 97 | Ga0075370_10037597 | 3300006353 | Bacteria | 2722 |
| 98 | Ga0075370_10039345 | 3300006353 | Bacteria | 2664 |
| 99 | Ga0079104_1000082 | 3300006946 | Bacteria | 137722 |
| 100 | Ga0099826_10006060 | 3300006948 | Bacteria | 8757 |
| 101 | Ga0099826_10097192 | 3300006948 | Bacteria | 1785 |
| 102 | Ga0105240_10001468 | 3300009093 | Bacteria | 40305 |
| 103 | Ga0105240_10249736 | 3300009093 | Bacteria | 2052 |
| 104 | Ga0105240_10398866 | 3300009093 | Bacteria | 1550 |
| 105 | Ga0105240_10563129 | 3300009093 | Bacteria | 1259 |
| 106 | Ga0105245_10672793 | 3300009098 | Bacteria | 1067 |
| 107 | Ga0105243_10003711 | 3300009148 | Bacteria | 12270 |
| 108 | Ga0105248_10054876 | 3300009177 | Bacteria | 4469 |
| 109 | Ga0105237_10004445 | 3300009545 | Bacteria | 16237 |
| 110 | Ga0105237_10011413 | 3300009545 | Bacteria | 9397 |
| 111 | Ga0105238_10307068 | 3300009551 | Bacteria | 1571 |
| 112 | Ga0105249_10365413 | 3300009553 | Bacteria | 1465 |
| 113 | Ga0123341_1000642 | 3300009765 | Bacteria | 22722 |
| 114 | Ga0123341_1057766 | 3300009765 | Bacteria | 1988 |
| 115 | Ga0123342_1010090 | 3300009766 | Bacteria | 10966 |
| 116 | Ga0123342_1021055 | 3300009766 | Bacteria | 4648 |
| 117 | Ga0105239_10046215 | 3300010375 | Bacteria | 4770 |
| 118 | Ga0105239_10048662 | 3300010375 | Bacteria | 4648 |
| 119 | Ga0105239_10328115 | 3300010375 | Bacteria | 1726 |
| 120 | Ga0105246_10185777 | 3300011119 | Bacteria | 1604 |
| 121 | Ga0157373_10018682 | 3300013100 | Bacteria | 5045 |
| 122 | Ga0157371_10000004 | 3300013102 | Bacteria | 512593 |
| 123 | Ga0157370_10001047 | 3300013104 | Bacteria | 34825 |
| 124 | Ga0157370_10001796 | 3300013104 | Bacteria | 26445 |
| 125 | Ga0182008_10087338 | 3300014497 | Bacteria | 1536 |
| 126 | Ga0182008_10095812 | 3300014497 | Bacteria | 1465 |
| 127 | Ga0182006_1020401 | 3300015261 | Bacteria | 2777 |
| 128 | Ga0163161_10396032 | 3300017792 | Bacteria | 1107 |
| 129 | Ga0209435_100087 | 3300025206 | Bacteria | 44093 |
| 130 | Ga0209436_100268 | 3300025208 | Bacteria | 23804 |
| 131 | Ga0209436_112679 | 3300025208 | Bacteria | 1419 |
| 132 | Ga0209672_105109 | 3300025228 | Bacteria | 2301 |
| 133 | Ga0209563_107279 | 3300025230 | Bacteria | 1831 |
| 134 | Ga0209437_100050 | 3300025233 | Bacteria | 394010 |
| 135 | Ga0209437_100205 | 3300025233 | Bacteria | 115669 |
| 136 | Ga0207425_1001736 | 3300025245 | Bacteria | 8600 |
| 137 | Ga0209646_1000285 | 3300025246 | Bacteria | 44093 |
| 138 | Ga0209026_1000029 | 3300025250 | Bacteria | 337109 |
| 139 | Ga0209026_1000347 | 3300025250 | Bacteria | 44093 |
| 140 | Ga0209677_109715 | 3300025253 | Bacteria | 1688 |
| 141 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 142 | Ga0209759_1000482 | 3300025256 | Bacteria | 44093 |
| 143 | Ga0209759_1000637 | 3300025256 | Bacteria | 32759 |
| 144 | Ga0209129_1000066 | 3300025258 | Bacteria | 226820 |
| 145 | Ga0209129_1001099 | 3300025258 | Bacteria | 15766 |
| 146 | Ga0209129_1001848 | 3300025258 | Bacteria | 11206 |
| 147 | Ga0209129_1002246 | 3300025258 | Bacteria | 9651 |
| 148 | Ga0209129_1006820 | 3300025258 | Bacteria | 3573 |
| 149 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 150 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 151 | Ga0209233_1000187 | 3300025261 | Bacteria | 133091 |
| 152 | Ga0209233_1000232 | 3300025261 | Bacteria | 96361 |
| 153 | Ga0209565_1035287 | 3300025263 | Bacteria | 955 |
| 154 | Ga0209455_1000219 | 3300025272 | Bacteria | 79850 |
| 155 | Ga0209673_1000024 | 3300025273 | Bacteria | 409632 |
| 156 | Ga0209673_1000911 | 3300025273 | Bacteria | 37766 |
| 157 | Ga0209673_1002137 | 3300025273 | Bacteria | 14721 |
| 158 | Ga0209673_1002283 | 3300025273 | Bacteria | 13700 |
| 159 | Ga0209673_1003397 | 3300025273 | Bacteria | 9438 |
| 160 | Ga0209673_1013102 | 3300025273 | Bacteria | 3297 |
| 161 | Ga0209673_1034216 | 3300025273 | Bacteria | 1538 |
| 162 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 163 | Ga0209130_1000093 | 3300025284 | Bacteria | 145707 |
| 164 | Ga0209025_1000274 | 3300025294 | Bacteria | 119322 |
| 165 | Ga0209025_1000275 | 3300025294 | Bacteria | 119220 |
| 166 | Ga0209025_1000377 | 3300025294 | Bacteria | 92728 |
| 167 | Ga0209025_1000553 | 3300025294 | Bacteria | 69760 |
| 168 | Ga0209025_1008610 | 3300025294 | Bacteria | 7302 |
| 169 | Ga0209025_1015100 | 3300025294 | Bacteria | 4686 |
| 170 | Ga0209564_1000262 | 3300025295 | Bacteria | 112256 |
| 171 | Ga0209564_1000474 | 3300025295 | Bacteria | 67143 |
| 172 | Ga0209564_1000486 | 3300025295 | Bacteria | 66011 |
| 173 | Ga0209758_1000466 | 3300025297 | Bacteria | 66920 |
| 174 | Ga0209758_1000971 | 3300025297 | Bacteria | 38600 |
| 175 | Ga0209758_1003684 | 3300025297 | Bacteria | 13618 |
| 176 | Ga0209758_1009079 | 3300025297 | Bacteria | 6272 |
| 177 | Ga0209758_1009179 | 3300025297 | Bacteria | 6217 |
| 178 | Ga0209758_1025882 | 3300025297 | Bacteria | 2560 |
| 179 | Ga0209050_1006063 | 3300025298 | Bacteria | 7313 |
| 180 | Ga0209256_1000868 | 3300025299 | Bacteria | 37527 |
| 181 | Ga0209256_1003327 | 3300025299 | Bacteria | 11402 |
| 182 | Ga0209256_1011210 | 3300025299 | Bacteria | 3618 |
| 183 | Ga0209256_1038435 | 3300025299 | Bacteria | 1240 |
| 184 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 185 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 186 | Ga0207426_1000142 | 3300025302 | Bacteria | 194023 |
| 187 | Ga0209051_1000170 | 3300025303 | Bacteria | 119026 |
| 188 | Ga0209051_1002082 | 3300025303 | Bacteria | 15092 |
| 189 | Ga0209051_1027111 | 3300025303 | Bacteria | 2290 |
| 190 | Ga0209051_1037438 | 3300025303 | Bacteria | 1778 |
| 191 | Ga0209257_1007148 | 3300025304 | Bacteria | 6862 |
| 192 | Ga0207688_10199146 | 3300025901 | Bacteria | 1200 |
| 193 | Ga0207647_10058319 | 3300025904 | Bacteria | 2364 |
| 194 | Ga0207695_10000427 | 3300025913 | Bacteria | 93089 |
| 195 | Ga0207695_10635585 | 3300025913 | Bacteria | 948 |
| 196 | Ga0207671_10002841 | 3300025914 | Bacteria | 18002 |
| 197 | Ga0207671_10023638 | 3300025914 | Bacteria | 4633 |
| 198 | Ga0207671_10500607 | 3300025914 | Bacteria | 969 |
| 199 | Ga0207657_10211893 | 3300025919 | Bacteria | 1555 |
| 200 | Ga0207650_10000302 | 3300025925 | Bacteria | 48702 |
| 201 | Ga0207709_10231419 | 3300025935 | Bacteria | 1339 |
| 202 | Ga0207711_10077431 | 3300025941 | Bacteria | 2899 |
| 203 | Ga0207667_10214924 | 3300025949 | Bacteria | 1970 |
| 204 | Ga0207667_10529655 | 3300025949 | Bacteria | 1193 |
| 205 | Ga0207640_10650010 | 3300025981 | Bacteria | 898 |
| 206 | Ga0207658_10519032 | 3300025986 | Bacteria | 1063 |
| 207 | Ga0207639_10242013 | 3300026041 | Bacteria | 1569 |
| 208 | Ga0207639_10473614 | 3300026041 | Bacteria | 1140 |
| 209 | Ga0207678_10046447 | 3300026067 | Bacteria | 3755 |
| 210 | Ga0207702_10034141 | 3300026078 | Bacteria | 4252 |
| 211 | Ga0207702_10257221 | 3300026078 | Bacteria | 1642 |
| 212 | Ga0207674_10144852 | 3300026116 | Bacteria | 2334 |
| 213 | Ga0207674_10877123 | 3300026116 | Bacteria | 865 |
| 214 | Ga0207698_10087512 | 3300026142 | Bacteria | 2537 |
| 215 | Ga0209281_1000043 | 3300027111 | Bacteria | 341543 |
| 216 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 217 | Ga0209371_1000569 | 3300027312 | Bacteria | 33436 |
| 218 | Ga0209371_1000597 | 3300027312 | Bacteria | 32346 |
| 219 | Ga0209371_1002100 | 3300027312 | Bacteria | 11818 |
| 220 | Ga0209282_1015117 | 3300027666 | Bacteria | 4913 |
| 221 | Ga0209813_10015632 | 3300027866 | Bacteria | 2060 |
| 222 | Ga0268266_10085620 | 3300028379 | Bacteria | 2754 |
| 223 | Ga0268266_10204443 | 3300028379 | Bacteria | 1809 |
| 224 | Ga0307515_10070922 | 3300028794 | Bacteria | 4732 |
| 225 | Ga0307515_10316134 | 3300028794 | Bacteria | 1232 |
| 226 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 227 | Ga0268256_1003765 | 3300030500 | Bacteria | 6646 |
| 228 | Ga0268256_1003954 | 3300030500 | Bacteria | 6388 |
| 229 | Ga0307416_100409987 | 3300032002 | Bacteria | 1396 |
| 230 | Ga0395900_0293062 | 3300037418 | Bacteria | 1615 |
| 231 | Ga0395900_0318882 | 3300037418 | Bacteria | 1535 |
| 232 | Ga0395898_0214279 | 3300037466 | Bacteria | 1837 |
| 233 | Ga0395905_0473627 | 3300037471 | Bacteria | 1151 |
| 234 | Ga0395901_0040590 | 3300038443 | Bacteria | 4821 |
| 235 | Ga0395901_0102150 | 3300038443 | Bacteria | 3008 |
| 236 | Ga0395901_0525704 | 3300038443 | Bacteria | 1201 |
| 237 | Ga0439465_0004289 | 3300041413 | Bacteria | 4636 |
| 238 | Ga0439465_0094693 | 3300041413 | Bacteria | 1025 |
| 239 | Ga0439465_0115285 | 3300041413 | Bacteria | 938 |
| 240 | Ga0451798_0437084 | 3300041458 | Bacteria | 1717 |
| 241 | Ga0451833_0309501 | 3300041491 | Bacteria | 946 |
| 242 | Ga0451839_1518067 | 3300041496 | Bacteria | 2007 |
| 243 | Ga0451841_0823007 | 3300041498 | Bacteria | 1296 |
| 244 | Ga0451845_0491534 | 3300041501 | Bacteria | 1916 |
| 245 | Ga0451847_0530648 | 3300041503 | Bacteria | 1242 |
| 246 | Ga0451849_1413814 | 3300041505 | Bacteria | 1033 |
| 247 | Ga0439445_0067743 | 3300042004 | Bacteria | 984 |
| 248 | Ga0439449_0036973 | 3300042007 | Bacteria | 1816 |
| 249 | Ga0466972_0069426 | 3300044658 | Bacteria | 1682 |
| 250 | Ga0466960_0034427 | 3300044901 | Bacteria | 2360 |
| 251 | Ga0466967_0785893 | 3300045976 | Bacteria | 945 |
| 252 | Ga0495617_013045 | 3300046452 | Bacteria | 2831 |
| 253 | Ga0495627_028697 | 3300046453 | Bacteria | 1776 |
| 254 | Ga0495590_0029742 | 3300046457 | Bacteria | 1914 |
| 255 | Ga0495638_0000566 | 3300046460 | Bacteria | 41838 |
| 256 | Ga0495638_0043090 | 3300046460 | Bacteria | 2848 |
| 257 | Ga0495650_0027816 | 3300046471 | Bacteria | 2606 |
| 258 | Ga0495605_0009235 | 3300046474 | Bacteria | 5540 |
| 259 | Ga0495605_0041550 | 3300046474 | Bacteria | 2290 |
| 260 | Ga0495585_0018694 | 3300046492 | Bacteria | 3997 |
| 261 | Ga0495585_0047303 | 3300046492 | Bacteria | 2396 |
| 262 | Ga0495585_0048677 | 3300046492 | Bacteria | 2356 |
| 263 | Ga0495607_0022489 | 3300046501 | Bacteria | 3959 |
| 264 | Ga0495607_0024783 | 3300046501 | Bacteria | 3736 |
| 265 | Ga0495607_0191834 | 3300046501 | Bacteria | 1017 |
| 266 | Ga0495583_0003929 | 3300046506 | Bacteria | 10998 |
| 267 | Ga0495583_0019864 | 3300046506 | Bacteria | 3496 |
| 268 | Ga0495606_0005067 | 3300046507 | Bacteria | 12819 |
| 269 | Ga0495606_0049724 | 3300046507 | Bacteria | 2747 |
| 270 | Ga0495606_0055336 | 3300046507 | Bacteria | 2566 |
| 271 | Ga0495606_0077288 | 3300046507 | Bacteria | 2078 |
| 272 | Ga0495610_0037953 | 3300046512 | Bacteria | 2447 |
| 273 | Ga0495616_0025367 | 3300046513 | Bacteria | 3168 |
| 274 | Ga0495620_0041131 | 3300046515 | Bacteria | 2029 |
| 275 | Ga0495631_0003763 | 3300046518 | Bacteria | 8252 |
| 276 | Ga0495632_0012650 | 3300046519 | Bacteria | 4856 |
| 277 | Ga0495632_0024308 | 3300046519 | Bacteria | 3220 |
| 278 | Ga0495643_0036691 | 3300046522 | Bacteria | 2691 |
| 279 | Ga0495643_0109703 | 3300046522 | Bacteria | 1404 |
| 280 | Ga0495654_0000314 | 3300046530 | Bacteria | 42570 |
| 281 | Ga0495609_0022681 | 3300046538 | Bacteria | 2892 |
| 282 | Ga0495597_0148905 | 3300046542 | Bacteria | 961 |
| 283 | Ga0495633_0016834 | 3300046558 | Bacteria | 3754 |
| 284 | Ga0495633_0036013 | 3300046558 | Bacteria | 2373 |
| 285 | Ga0495656_0007518 | 3300046615 | Bacteria | 3853 |
| 286 | Ga0495668_0011736 | 3300046616 | Bacteria | 5230 |
| 287 | Ga0495668_0210932 | 3300046616 | Bacteria | 1063 |
| 288 | Ga0495611_0009426 | 3300046648 | Bacteria | 4126 |
| 289 | Ga0495625_0023496 | 3300046660 | Bacteria | 4709 |
| 290 | Ga0495625_0049188 | 3300046660 | Bacteria | 3032 |
| 291 | Ga0495625_0091282 | 3300046660 | Bacteria | 2105 |
| 292 | Ga0495625_0095479 | 3300046660 | Bacteria | 2049 |
| 293 | Ga0495661_0014352 | 3300046665 | Bacteria | 5309 |
| 294 | Ga0495661_0270325 | 3300046665 | Bacteria | 860 |
| 295 | Ga0495670_0032614 | 3300046691 | Bacteria | 2591 |
| 296 | Ga0495670_0071710 | 3300046691 | Bacteria | 1754 |
| 297 | Ga0495671_0014249 | 3300046692 | Bacteria | 4284 |
| 298 | Ga0495671_0106694 | 3300046692 | Bacteria | 1368 |
| 299 | Ga0495649_0023374 | 3300046694 | Bacteria | 3454 |
| 300 | Ga0495636_0114020 | 3300047318 | Bacteria | 1191 |
| 301 | Ga0495681_0009496 | 3300047470 | Bacteria | 5984 |
| 302 | Ga0495686_0002334 | 3300047472 | Bacteria | 18121 |
| 303 | Ga0495686_0020721 | 3300047472 | Bacteria | 4382 |
| 304 | Ga0495686_0182194 | 3300047472 | Bacteria | 1216 |
| 305 | Ga0496101_0192646 | 3300048904 | Bacteria | 1574 |
| 306 | Ga0496102_0169134 | 3300048905 | Bacteria | 2058 |
| 307 | Ga0496103_0188830 | 3300048906 | Bacteria | 1325 |
| 308 | Ga0496106_0006761 | 3300048909 | Bacteria | 8490 |
| 309 | Ga0496108_0453277 | 3300048911 | Bacteria | 1121 |
| 310 | Ga0496112_0004626 | 3300048915 | Bacteria | 11705 |
| 311 | Ga0496113_0037980 | 3300048916 | Bacteria | 3538 |
| 312 | Ga0496116_0018149 | 3300048919 | Bacteria | 5433 |
| 313 | Ga0496116_0141976 | 3300048919 | Bacteria | 1349 |
| 314 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 315 | Ga0496117_0002038 | 3300048920 | Bacteria | 26746 |
| 316 | Ga0496117_0005456 | 3300048920 | Bacteria | 13341 |
| 317 | Ga0496117_0023070 | 3300048920 | Bacteria | 4972 |
| 318 | Ga0496117_0031006 | 3300048920 | Bacteria | 4090 |
| 319 | Ga0496117_0045021 | 3300048920 | Bacteria | 3192 |
| 320 | Ga0496117_0070695 | 3300048920 | Bacteria | 2343 |
| 321 | Ga0496118_0001167 | 3300048921 | Bacteria | 40506 |
| 322 | Ga0496118_0017956 | 3300048921 | Bacteria | 6412 |
| 323 | Ga0496118_0060628 | 3300048921 | Bacteria | 2808 |
| 324 | Ga0496118_0109751 | 3300048921 | Bacteria | 1835 |
| 325 | Ga0496118_0122183 | 3300048921 | Bacteria | 1694 |
| 326 | Ga0496119_0014974 | 3300048922 | Bacteria | 6019 |
| 327 | Ga0496119_0026777 | 3300048922 | Bacteria | 3986 |
| 328 | Ga0496119_0047803 | 3300048922 | Bacteria | 2658 |
| 329 | Ga0496119_0099572 | 3300048922 | Bacteria | 1635 |
| 330 | Ga0496119_0171840 | 3300048922 | Bacteria | 1144 |
| 331 | Ga0496119_0240112 | 3300048922 | Bacteria | 918 |
| 332 | Ga0496120_0002729 | 3300048923 | Bacteria | 17241 |
| 333 | Ga0496120_0015943 | 3300048923 | Bacteria | 4933 |
| 334 | Ga0496120_0017924 | 3300048923 | Bacteria | 4575 |
| 335 | Ga0496120_0020218 | 3300048923 | Bacteria | 4238 |
| 336 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 337 | Ga0496121_0023381 | 3300048924 | Bacteria | 5954 |
| 338 | Ga0496121_0044238 | 3300048924 | Bacteria | 3845 |
| 339 | Ga0496121_0056726 | 3300048924 | Bacteria | 3251 |
| 340 | Ga0496121_0107387 | 3300048924 | Bacteria | 2138 |
| 341 | Ga0496121_0139533 | 3300048924 | Bacteria | 1800 |
| 342 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 343 | Ga0496122_0000018 | 3300048925 | Bacteria | 426350 |
| 344 | Ga0496122_0000321 | 3300048925 | Bacteria | 105353 |
| 345 | Ga0496122_0025714 | 3300048925 | Bacteria | 5102 |
| 346 | Ga0496122_0126865 | 3300048925 | Bacteria | 1631 |
| 347 | Ga0496122_0141991 | 3300048925 | Bacteria | 1500 |
| 348 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 349 | Ga0496123_0000015 | 3300048926 | Bacteria | 426088 |
| 350 | Ga0496123_0000454 | 3300048926 | Bacteria | 72735 |
| 351 | Ga0496123_0004823 | 3300048926 | Bacteria | 13917 |
| 352 | Ga0496123_0139316 | 3300048926 | Bacteria | 1329 |
| 353 | Ga0496124_0000558 | 3300048927 | Bacteria | 63070 |
| 354 | Ga0496124_0006480 | 3300048927 | Bacteria | 12741 |
| 355 | Ga0496124_0043463 | 3300048927 | Bacteria | 3863 |
| 356 | Ga0496124_0046082 | 3300048927 | Bacteria | 3736 |
| 357 | Ga0496124_0046414 | 3300048927 | Bacteria | 3719 |
| 358 | Ga0496124_0131850 | 3300048927 | Bacteria | 1984 |
| 359 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 360 | Ga0496125_0000628 | 3300048928 | Bacteria | 59302 |
| 361 | Ga0496125_0006658 | 3300048928 | Bacteria | 12436 |
| 362 | Ga0496125_0037411 | 3300048928 | Bacteria | 4220 |
| 363 | Ga0496125_0049883 | 3300048928 | Bacteria | 3472 |
| 364 | Ga0496125_0085026 | 3300048928 | Bacteria | 2399 |
| 365 | Ga0496125_0090571 | 3300048928 | Bacteria | 2295 |
| 366 | Ga0496125_0197038 | 3300048928 | Bacteria | 1323 |
| 367 | Ga0496126_0000378 | 3300048929 | Bacteria | 92187 |
| 368 | Ga0496126_0063882 | 3300048929 | Bacteria | 3298 |
| 369 | Ga0496126_0177821 | 3300048929 | Bacteria | 1809 |
| 370 | Ga0496126_0243423 | 3300048929 | Bacteria | 1501 |
| 371 | Ga0496126_0306012 | 3300048929 | Bacteria | 1309 |
| 372 | Ga0496126_0421783 | 3300048929 | Bacteria | 1078 |
| 373 | Ga0495678_047945 | 3300049459 | Bacteria | 1669 |
| 374 | Ga0501031_0004927 | 3300049568 | Bacteria | 8677 |
| 375 | Ga0501031_0085938 | 3300049568 | Bacteria | 2051 |
| 376 | Ga0501032_0000019 | 3300049569 | Bacteria | 155168 |
| 377 | Ga0501032_0051426 | 3300049569 | Bacteria | 2778 |
| 378 | Ga0501032_0055436 | 3300049569 | Bacteria | 2667 |
| 379 | Ga0501032_0374855 | 3300049569 | Bacteria | 915 |
| 380 | Ga0501033_0000260 | 3300049570 | Bacteria | 50590 |
| 381 | Ga0501033_0000461 | 3300049570 | Bacteria | 38633 |
| 382 | Ga0501033_0013860 | 3300049570 | Bacteria | 6133 |
| 383 | Ga0501033_0034352 | 3300049570 | Bacteria | 3805 |
| 384 | Ga0501033_0071969 | 3300049570 | Bacteria | 2539 |
| 385 | Ga0501033_0149740 | 3300049570 | Bacteria | 1684 |
| 386 | Ga0501033_0181834 | 3300049570 | Bacteria | 1507 |
| 387 | Ga0501034_0002910 | 3300049571 | Bacteria | 19875 |
| 388 | Ga0501034_0411430 | 3300049571 | Bacteria | 1274 |
| 389 | Ga0501034_0636201 | 3300049571 | Bacteria | 969 |
| 390 | Ga0501036_0001517 | 3300049572 | Bacteria | 17917 |
| 391 | Ga0501036_0086723 | 3300049572 | Bacteria | 2646 |
| 392 | Ga0501037_0000154 | 3300049573 | Bacteria | 64077 |
| 393 | Ga0501037_0000870 | 3300049573 | Bacteria | 22576 |
| 394 | Ga0501037_0040577 | 3300049573 | Bacteria | 3425 |
| 395 | Ga0501037_0042753 | 3300049573 | Bacteria | 3330 |
| 396 | Ga0501037_0082837 | 3300049573 | Bacteria | 2324 |
| 397 | Ga0501038_0001781 | 3300049574 | Bacteria | 20003 |
| 398 | Ga0501038_0088163 | 3300049574 | Bacteria | 2605 |
| 399 | Ga0501038_0101706 | 3300049574 | Bacteria | 2392 |
| 400 | Ga0501038_0576400 | 3300049574 | Bacteria | 853 |
| 401 | Ga0501039_0001074 | 3300049575 | Bacteria | 20003 |
| 402 | Ga0501039_0139292 | 3300049575 | Bacteria | 1906 |
| 403 | Ga0501039_0438841 | 3300049575 | Bacteria | 1025 |
| 404 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 405 | Ga0501043_0000113 | 3300049579 | Bacteria | 76112 |
| 406 | Ga0501043_0048312 | 3300049579 | Bacteria | 3345 |
| 407 | Ga0501043_0069942 | 3300049579 | Bacteria | 2757 |
| 408 | Ga0501043_0159911 | 3300049579 | Bacteria | 1760 |
| 409 | Ga0501046_0191544 | 3300049580 | Bacteria | 1525 |
| 410 | Ga0501047_0037568 | 3300049581 | Bacteria | 4682 |
| 411 | Ga0501047_0092531 | 3300049581 | Bacteria | 2902 |
| 412 | Ga0501047_0127106 | 3300049581 | Bacteria | 2429 |
| 413 | Ga0501047_0186069 | 3300049581 | Bacteria | 1942 |
| 414 | Ga0501047_0319073 | 3300049581 | Bacteria | 1394 |
| 415 | Ga0501067_0176497 | 3300049583 | Bacteria | 1190 |
| 416 | Ga0501068_0021893 | 3300049584 | Bacteria | 3735 |
| 417 | Ga0501068_0109855 | 3300049584 | Bacteria | 1714 |
| 418 | Ga0501068_0342680 | 3300049584 | Bacteria | 960 |
| 419 | Ga0501069_0000027 | 3300049585 | Bacteria | 106217 |
| 420 | Ga0501069_0052485 | 3300049585 | Bacteria | 2270 |
| 421 | Ga0501069_0115122 | 3300049585 | Bacteria | 1533 |
| 422 | Ga0501069_0137725 | 3300049585 | Bacteria | 1399 |
| 423 | Ga0501070_0000231 | 3300049586 | Bacteria | 52768 |
| 424 | Ga0501070_0000822 | 3300049586 | Bacteria | 28172 |
| 425 | Ga0501070_0000825 | 3300049586 | Bacteria | 28139 |
| 426 | Ga0501070_0034270 | 3300049586 | Bacteria | 4245 |
| 427 | Ga0501070_0041305 | 3300049586 | Bacteria | 3843 |
| 428 | Ga0501070_0162893 | 3300049586 | Bacteria | 1838 |
| 429 | Ga0501070_0250959 | 3300049586 | Bacteria | 1447 |
| 430 | Ga0501070_0493250 | 3300049586 | Bacteria | 984 |
| 431 | Ga0501071_0035260 | 3300049587 | Bacteria | 3563 |
| 432 | Ga0501073_0038563 | 3300049589 | Bacteria | 3388 |
| 433 | Ga0501074_0000023 | 3300049590 | Bacteria | 68925 |
| 434 | Ga0501074_0016561 | 3300049590 | Bacteria | 5351 |
| 435 | Ga0501076_0217993 | 3300049592 | Bacteria | 1560 |
| 436 | Ga0501080_0000300 | 3300049742 | Bacteria | 37703 |
| 437 | Ga0501080_0122112 | 3300049742 | Bacteria | 2413 |
| 438 | Ga0501080_0164697 | 3300049742 | Bacteria | 2046 |
| 439 | Ga0501083_0000012 | 3300049744 | Bacteria | 178668 |
| 440 | Ga0501083_0042127 | 3300049744 | Bacteria | 3096 |
| 441 | Ga0501035_0000073 | 3300049822 | Bacteria | 122603 |
| 442 | Ga0501035_0000201 | 3300049822 | Bacteria | 72627 |
| 443 | Ga0501035_0000709 | 3300049822 | Bacteria | 36064 |
| 444 | Ga0501035_0001226 | 3300049822 | Bacteria | 26728 |
| 445 | Ga0501035_0001287 | 3300049822 | Bacteria | 25890 |
| 446 | Ga0501035_0066684 | 3300049822 | Bacteria | 3194 |
| 447 | Ga0501035_0071499 | 3300049822 | Bacteria | 3071 |
| 448 | Ga0501035_0455009 | 3300049822 | Bacteria | 1058 |
| 449 | Ga0501044_0000118 | 3300049823 | Bacteria | 95218 |
| 450 | Ga0501044_0019989 | 3300049823 | Bacteria | 7151 |
| 451 | Ga0501044_0054362 | 3300049823 | Bacteria | 4116 |
| 452 | Ga0501044_0068483 | 3300049823 | Bacteria | 3615 |
| 453 | Ga0501044_0176352 | 3300049823 | Bacteria | 2106 |
| 454 | Ga0501044_0306819 | 3300049823 | Bacteria | 1514 |
| 455 | Ga0501044_0364578 | 3300049823 | Bacteria | 1362 |
| 456 | Ga0501044_0462262 | 3300049823 | Bacteria | 1174 |
| 457 | nmdc:mga03683_203753_c1 | 3300050489 | Bacteria | 909 |
| 458 | nmdc:mga03683_6637_c1 | 3300050489 | Bacteria | 3974 |
| 459 | nmdc:mga03n38_168995_c1 | 3300050490 | Bacteria | 1112 |
| 460 | nmdc:mga03n38_234855_c1 | 3300050490 | Bacteria | 963 |
| 461 | nmdc:mga00v17_611_c1 | 3300050491 | Bacteria | 19769 |
| 462 | nmdc:mga0yw44_16789_c1 | 3300050492 | Bacteria | 3965 |
| 463 | nmdc:mga0yw44_2319_c1 | 3300050492 | Bacteria | 8052 |
| 464 | nmdc:mga0yw44_24863_c1 | 3300050492 | Bacteria | 3396 |
| 465 | nmdc:mga0yw44_55086_c1 | 3300050492 | Bacteria | 2419 |
| 466 | nmdc:mga0yw44_60256_c1 | 3300050492 | Bacteria | 2324 |
| 467 | nmdc:mga0k408_10280_c1 | 3300050493 | Bacteria | 5058 |
| 468 | nmdc:mga06z11_12773_c1 | 3300050494 | Bacteria | 3663 |
| 469 | nmdc:mga06z11_271014_c1 | 3300050494 | Bacteria | 1004 |
| 470 | nmdc:mga06z11_36763_c1 | 3300050494 | Bacteria | 2420 |
| 471 | nmdc:mga06z11_91619_c1 | 3300050494 | Bacteria | 1651 |
| 472 | nmdc:mga04h51_13917_c1 | 3300050495 | Bacteria | 2288 |
| 473 | nmdc:mga07m45_11183_c1 | 3300050496 | Bacteria | 4711 |
| 474 | nmdc:mga0sz30_11473_c1 | 3300050516 | Bacteria | 2559 |
| 475 | nmdc:mga0sz30_42457_c1 | 3300050516 | Bacteria | 1913 |
| 476 | Ga0500610_0039841 | 3300053079 | Bacteria | 2426 |
| 477 | Ga0500578_0035296 | 3300053086 | Bacteria | 3214 |
| 478 | Ga0500578_0072312 | 3300053086 | Bacteria | 2197 |
| 479 | Ga0500643_012418 | 3300053087 | Bacteria | 3050 |
| 480 | Ga0500557_042031 | 3300053105 | Bacteria | 1437 |
| 481 | Ga0500618_000203 | 3300053125 | Bacteria | 47421 |
| 482 | Ga0500618_001739 | 3300053125 | Bacteria | 9246 |
| 483 | Ga0500618_021138 | 3300053125 | Bacteria | 1590 |
| 484 | Ga0500658_0009920 | 3300053134 | Bacteria | 3511 |
| 485 | Ga0500561_0000139 | 3300053137 | Bacteria | 14052 |
| 486 | Ga0500568_0001169 | 3300053139 | Bacteria | 17543 |
| 487 | Ga0500568_0006185 | 3300053139 | Bacteria | 6052 |
| 488 | Ga0500568_0053805 | 3300053139 | Bacteria | 1577 |
| 489 | Ga0500577_0044998 | 3300053142 | Bacteria | 1629 |
| 490 | Ga0500616_0007056 | 3300053153 | Bacteria | 7207 |
| 491 | Ga0500616_0009183 | 3300053153 | Bacteria | 6035 |
| 492 | Ga0500616_0070165 | 3300053153 | Bacteria | 1790 |
| 493 | Ga0500616_0164888 | 3300053153 | Bacteria | 1012 |
| 494 | Ga0500620_007279 | 3300053155 | Bacteria | 2723 |
| 495 | Ga0500622_0009636 | 3300053156 | Bacteria | 5337 |
| 496 | Ga0500624_002343 | 3300053157 | Bacteria | 2580 |
| 497 | Ga0500627_0037793 | 3300053158 | Bacteria | 2062 |
| 498 | Ga0500627_0055473 | 3300053158 | Bacteria | 1735 |
| 499 | Ga0500634_0049682 | 3300053161 | Bacteria | 2261 |
| 500 | Ga0500636_0000022 | 3300053177 | Bacteria | 93090 |
| 501 | Ga0500636_0001307 | 3300053177 | Bacteria | 13519 |
| 502 | 2996897599 | 2996893221 | Bacteria | 5823108 |
| 503 | 2509114670 | 2508501123 | Bacteria | 6283661 |
| 504 | 2509369674 | 2509276018 | Bacteria | 6910194 |
| 505 | 2509388994 | 2509276021 | Bacteria | 7634384 |
| 506 | 2509394771 | 2509276022 | Bacteria | 6200534 |
| 507 | 2509444584 | 2509276033 | Bacteria | 7180565 |
| 508 | 2510135669 | 2510065019 | Bacteria | 6903379 |
| 509 | 2510318629 | 2510065059 | Bacteria | 6847884 |
| 510 | 2510838861 | 2510461069 | Bacteria | 5505000 |
| 511 | 2510897142 | 2510461076 | Bacteria | 8618824 |
| 512 | 2511136857 | 2510917022 | Bacteria | 6504556 |
| 513 | 2511185326 | 2510917028 | Bacteria | 6185411 |
| 514 | 2511200522 | 2510917030 | Bacteria | 7460662 |
| 515 | 2512932689 | 2512875016 | Bacteria | 6529530 |
| 516 | 2512960746 | 2512875024 | Bacteria | 7195110 |
| 517 | 2513570830 | 2513237084 | Bacteria | 7231967 |
| 518 | 2513574955 | 2513237085 | Bacteria | 7695351 |
| 519 | 2513595613 | 2513237088 | Bacteria | 6927906 |
| 520 | 2513608777 | 2513237090 | Bacteria | 7096802 |
| 521 | 2513633739 | 2513237093 | Bacteria | 7545552 |
| 522 | 2513707586 | 2513237103 | Bacteria | 7647401 |
| 523 | 2513865362 | 2513237138 | Bacteria | 7368160 |
| 524 | 2513910998 | 2513237144 | Bacteria | 7530820 |
| 525 | 2513924306 | 2513237146 | Bacteria | 7166346 |
| 526 | 2514023680 | 2513237162 | Bacteria | 7468464 |
| 527 | 2515114833 | 2515075009 | Bacteria | 7288508 |
| 528 | 2515635810 | 2515154113 | Bacteria | 7807172 |
| 529 | 2515641424 | 2515154114 | Bacteria | 7848616 |
| 530 | 2515659313 | 2515154116 | Bacteria | 7552979 |
| 531 | 2515741182 | 2515154134 | Bacteria | 7220242 |
| 532 | 2517038451 | 2516653077 | Bacteria | 7555578 |
| 533 | 2517078727 | 2516653085 | Bacteria | 7346596 |
| 534 | 2517097469 | 2517093000 | Bacteria | 7412387 |
| 535 | 2517408925 | 2517287029 | Bacteria | 6905599 |
| 536 | 2520379181 | 2519899620 | Bacteria | 6499161 |
| 537 | 2523467759 | 2523231067 | Bacteria | 5230452 |
| 538 | 2524461871 | 2524023209 | Bacteria | 6679728 |
| 539 | 2530648344 | 2529292951 | Bacteria | 6916614 |
| 540 | 2535514574 | 2534681796 | Bacteria | 7146037 |
| 541 | 2537877273 | 2537561587 | Bacteria | 5425293 |
| 542 | 2554246169 | 2554235003 | Bacteria | 5877155 |
| 543 | 2559293392 | 2558860242 | Bacteria | 5568029 |
| 544 | 2585164442 | 2582581283 | Bacteria | 6030556 |
| 545 | 2585201281 | 2582581294 | Bacteria | 6626667 |
| 546 | 2585223259 | 2582581298 | Bacteria | 7315509 |
| 547 | 2585230949 | 2582581299 | Bacteria | 6518058 |
| 548 | 2585256424 | 2582581304 | Bacteria | 5831370 |
| 549 | 2585273458 | 2582581307 | Bacteria | 6597605 |
| 550 | 2585283170 | 2582581308 | Bacteria | 7413247 |
| 551 | 2585328201 | 2582581315 | Bacteria | 7318924 |
| 552 | 2585330613 | 2582581316 | Bacteria | 7774528 |
| 553 | 2585399100 | 2582581867 | Bacteria | 7184437 |
| 554 | 2585523958 | 2585427526 | Bacteria | 7258840 |
| 555 | 2585536018 | 2585427527 | Bacteria | 7273426 |
| 556 | 2585542102 | 2585427528 | Bacteria | 6842387 |
| 557 | 2585546145 | 2585427529 | Bacteria | 7395659 |
| 558 | 2585556654 | 2585427530 | Bacteria | 7383882 |
| 559 | 2585564014 | 2585427531 | Bacteria | 6992870 |
| 560 | 2585818750 | 2585427590 | Bacteria | 6824633 |
| 561 | 2585840688 | 2585427593 | Bacteria | 7141551 |
| 562 | 2585900316 | 2585427608 | Bacteria | 6544331 |
| 563 | 2585909278 | 2585427609 | Bacteria | 6667127 |
| 564 | 2587984620 | 2585428125 | Bacteria | 6662905 |
| 565 | 2588518775 | 2588253730 | Bacteria | 6881675 |
| 566 | 2597810915 | 2597489875 | Bacteria | 7010078 |
| 567 | 2599419736 | 2599185170 | Bacteria | 7295545 |
| 568 | 2599604276 | 2599185210 | Bacteria | 5624189 |
| 569 | 2599718716 | 2599185236 | Bacteria | 6875203 |
| 570 | 2599936522 | 2599185301 | Bacteria | 6161860 |
| 571 | 2601609588 | 2600255279 | Bacteria | 5605316 |
| 572 | 2601746363 | 2600255308 | Bacteria | 5611129 |
| 573 | 2616293961 | 2615840624 | Bacteria | 6557588 |
| 574 | 2616311187 | 2615840626 | Bacteria | 7921970 |
| 575 | 2616556079 | 2615840698 | Bacteria | 7319877 |
| 576 | 2617380722 | 2617270742 | Bacteria | 6808054 |
| 577 | 2643776674 | 2643221551 | Bacteria | 3750538 |
| 578 | 2643795122 | 2643221555 | Bacteria | 3749717 |
| 579 | 2643920549 | 2643221582 | Bacteria | 5804683 |
| 580 | 2643987466 | 2643221595 | Bacteria | 6565519 |
| 581 | 2644004417 | 2643221599 | Bacteria | 6292121 |
| 582 | 2644133877 | 2643221623 | Bacteria | 5239945 |
| 583 | 2644158014 | 2643221627 | Bacteria | 6761570 |
| 584 | 2644191215 | 2643221634 | Bacteria | 6705461 |
| 585 | 2644237665 | 2643221643 | Bacteria | 5749658 |
| 586 | 2644298211 | 2643221653 | Bacteria | 4569637 |
| 587 | 2644498800 | 2643221689 | Bacteria | 6042950 |
| 588 | 2644519642 | 2643221693 | Bacteria | 5513853 |
| 589 | 2644656463 | 2643221719 | Bacteria | 4568197 |
| 590 | 2671115836 | 2667528174 | Bacteria | 6435400 |
| 591 | 2688597107 | 2687453392 | Bacteria | 6880454 |
| 592 | 2694628810 | 2693429783 | Bacteria | 7019804 |
| 593 | 2694637276 | 2693429784 | Bacteria | 7241525 |
| 594 | 2719183332 | 2718217882 | Bacteria | 6556348 |
| 595 | 2719388092 | 2718217927 | Bacteria | 6972593 |
| 596 | 2719667715 | 2718217997 | Bacteria | 6740740 |
| 597 | 2719734049 | 2718218009 | Bacteria | 6478651 |
| 598 | 2720494135 | 2718218199 | Bacteria | 6740745 |
| 599 | 2720615598 | 2718218232 | Bacteria | 6720332 |
| 600 | 2720622381 | 2718218233 | Bacteria | 6662049 |
| 601 | 2720633735 | 2718218235 | Bacteria | 6630699 |
| 602 | 2720777435 | 2718218269 | Bacteria | 6906114 |
| 603 | 2721149444 | 2718218363 | Bacteria | 6524337 |
| 604 | 2721160847 | 2718218365 | Bacteria | 6274507 |
| 605 | 2721166281 | 2718218366 | Bacteria | 6425255 |
| 606 | 2721401725 | 2718218423 | Bacteria | 6438183 |
| 607 | 2722842451 | 2721755514 | Bacteria | 6424414 |
| 608 | 2723029032 | 2721755556 | Bacteria | 6745503 |
| 609 | 2723562649 | 2721755684 | Bacteria | 6859907 |
| 610 | 2723569342 | 2721755685 | Bacteria | 6704835 |
| 611 | 2724040539 | 2721755809 | Bacteria | 6438790 |
| 612 | 2724046805 | 2721755810 | Bacteria | 6479005 |
| 613 | 2724092042 | 2721755819 | Bacteria | 6906405 |
| 614 | 2724106607 | 2721755822 | Bacteria | 6726041 |
| 615 | 2724112415 | 2721755823 | Bacteria | 6752556 |
| 616 | 2725949667 | 2724679232 | Bacteria | 7646494 |
| 617 | 2730109968 | 2728369352 | Bacteria | 6745171 |
| 618 | 2730166567 | 2728369365 | Bacteria | 6555560 |
| 619 | 2730300479 | 2728369397 | Bacteria | 6274511 |
| 620 | 2738800769 | 2738541293 | Bacteria | 7065685 |
| 621 | 2739037351 | 2738541333 | Bacteria | 7106503 |
| 622 | 2739349209 | 2738543031 | Bacteria | 5769731 |
| 623 | 2756671181 | 2756170246 | Bacteria | 7451806 |
| 624 | 2766067161 | 2765235942 | Bacteria | 7445910 |
| 625 | 2776915980 | 2775507049 | Bacteria | 6284736 |
| 626 | 2778179507 | 2775507266 | Bacteria | 7392367 |
| 627 | 2792748138 | 2791355123 | Bacteria | 8049106 |
| 628 | 2793298460 | 2791355256 | Bacteria | 6798008 |
| 629 | 2793315700 | 2791355259 | Bacteria | 7254731 |
| 630 | 2793323483 | 2791355260 | Bacteria | 6598818 |
| 631 | 2793327571 | 2791355261 | Bacteria | 6661293 |
| 632 | 2793335642 | 2791355262 | Bacteria | 6774204 |
| 633 | 2793341036 | 2791355263 | Bacteria | 6872478 |
| 634 | 2793350287 | 2791355264 | Bacteria | 6429314 |
| 635 | 2793354772 | 2791355265 | Bacteria | 6539969 |
| 636 | 2793358531 | 2791355266 | Bacteria | 7116587 |
| 637 | 2793368983 | 2791355267 | Bacteria | 7222458 |
| 638 | 2805928907 | 2802429605 | Bacteria | 6875453 |
| 639 | 2805934528 | 2802429606 | Bacteria | 6346811 |
| 640 | 2806047078 | 2802429633 | Bacteria | 7341974 |
| 641 | 2806054923 | 2802429634 | Bacteria | 7083200 |
| 642 | 2806061849 | 2802429635 | Bacteria | 7650140 |
| 643 | 2806069628 | 2802429636 | Bacteria | 7597525 |
| 644 | 2806076001 | 2802429637 | Bacteria | 7067217 |
| 645 | 2808986839 | 2808606387 | Bacteria | 5697198 |
| 646 | 2819244208 | 2818991272 | Bacteria | 4622173 |
| 647 | 2819556911 | 2818991439 | Bacteria | 6907412 |
| 648 | 2819608880 | 2818991448 | Bacteria | 6772224 |
| 649 | 2819643305 | 2818991453 | Bacteria | 7181617 |
| 650 | 2819685822 | 2818991461 | Bacteria | 7026071 |
| 651 | 2821123231 | 2821123053 | Bacteria | 7836056 |
| 652 | 2837651500 | 2837651117 | Bacteria | 3772164 |
| 653 | 2837679257 | 2837678835 | Bacteria | 5252418 |
| 654 | 2838020942 | 2838016132 | Bacteria | 6577831 |
| 655 | 2838026845 | 2838022645 | Bacteria | 6494267 |
| 656 | 2838033955 | 2838029111 | Bacteria | 6603031 |
| 657 | 2838039731 | 2838035591 | Bacteria | 7166484 |
| 658 | 2838044856 | 2838042994 | Bacteria | 6046894 |
| 659 | 2838052909 | 2838048938 | Bacteria | 6044578 |
| 660 | 2838064702 | 2838061910 | Bacteria | 6794874 |
| 661 | 2838070521 | 2838068647 | Bacteria | 6208656 |
| 662 | 2838664009 | 2838661181 | Bacteria | 7385261 |
| 663 | 2838672531 | 2838668709 | Bacteria | 6671819 |
| 664 | 2838677647 | 2838675328 | Bacteria | 4909118 |
| 665 | 2838685584 | 2838680041 | Bacteria | 6545511 |
| 666 | 2838689840 | 2838686498 | Bacteria | 7807632 |
| 667 | 2838695960 | 2838694306 | Bacteria | 6853137 |
| 668 | 2838705146 | 2838701080 | Bacteria | 6669771 |
| 669 | 2838713359 | 2838707686 | Bacteria | 6619912 |
| 670 | 2838716536 | 2838714209 | Bacteria | 5525906 |
| 671 | 2838719664 | 2838719591 | Bacteria | 5523910 |
| 672 | 2838727287 | 2838724970 | Bacteria | 4908691 |
| 673 | 2838731464 | 2838729681 | Bacteria | 7400765 |
| 674 | 2838739746 | 2838736955 | Bacteria | 5760694 |
| 675 | 2838744405 | 2838742623 | Bacteria | 7396178 |
| 676 | 2841738025 | 2841734538 | Bacteria | 6784580 |
| 677 | 2841844130 | 2841840854 | Bacteria | 5761912 |
| 678 | 2841846595 | 2841846520 | Bacteria | 5345850 |
| 679 | 2841852945 | 2841851746 | Bacteria | 7532261 |
| 680 | 2841860876 | 2841859092 | Bacteria | 5436171 |
| 681 | 2841870210 | 2841864319 | Bacteria | 6742987 |
| 682 | 2842082593 | 2842077413 | Bacteria | 6508645 |
| 683 | 2842112748 | 2842110456 | Bacteria | 7656360 |
| 684 | 2842123848 | 2842118031 | Bacteria | 7033875 |
| 685 | 2842127376 | 2842124991 | Bacteria | 5346824 |
| 686 | 2842132540 | 2842130223 | Bacteria | 4909145 |
| 687 | 2842143851 | 2842140634 | Bacteria | 5759631 |
| 688 | 2842150140 | 2842146304 | Bacteria | 5957337 |
| 689 | 2842152291 | 2842152218 | Bacteria | 4908957 |
| 690 | 2842160272 | 2842156927 | Bacteria | 6894975 |
| 691 | 2842165750 | 2842163707 | Bacteria | 6916235 |
| 692 | 2842172782 | 2842170452 | Bacteria | 5525737 |
| 693 | 2842175910 | 2842175837 | Bacteria | 4908771 |
| 694 | 2842184062 | 2842180545 | Bacteria | 6888678 |
| 695 | 2842189644 | 2842187318 | Bacteria | 5524014 |
| 696 | 2842196364 | 2842192696 | Bacteria | 6147454 |
| 697 | 2842202438 | 2842198810 | Bacteria | 6608673 |
| 698 | 2842208910 | 2842205361 | Bacteria | 6340321 |
| 699 | 2842213958 | 2842211629 | Bacteria | 5523832 |
| 700 | 2842219426 | 2842217011 | Bacteria | 7497767 |
| 701 | 2842224424 | 2842224351 | Bacteria | 5524473 |
| 702 | 2842231644 | 2842229732 | Bacteria | 7475766 |
| 703 | 2842242903 | 2842237096 | Bacteria | 6620661 |
| 704 | 2842245887 | 2842243621 | Bacteria | 7421798 |
| 705 | 2842254826 | 2842250916 | Bacteria | 6579627 |
| 706 | 2842260265 | 2842257432 | Bacteria | 7401195 |
| 707 | 2842267153 | 2842264693 | Bacteria | 6472963 |
| 708 | 2842273676 | 2842271015 | Bacteria | 7807131 |
| 709 | 2842282400 | 2842278818 | Bacteria | 6340002 |
| 710 | 2842290060 | 2842285085 | Bacteria | 6011953 |
| 711 | 2842296976 | 2842291075 | Bacteria | 7076806 |
| 712 | 2842299937 | 2842298080 | Bacteria | 6123127 |
| 713 | 2842308472 | 2842304105 | Bacteria | 7023636 |
| 714 | 2842312224 | 2842311132 | Bacteria | 6616990 |
| 715 | 2842321818 | 2842317721 | Bacteria | 6793725 |
| 716 | 2842344656 | 2842341865 | Bacteria | 7003929 |
| 717 | 2842359541 | 2842357229 | Bacteria | 6485165 |
| 718 | 2842367769 | 2842363717 | Bacteria | 6844742 |
| 719 | 2842376030 | 2842370503 | Bacteria | 7038661 |
| 720 | 2842383240 | 2842377471 | Bacteria | 7140707 |
| 721 | 2842390373 | 2842384541 | Bacteria | 7057858 |
| 722 | 2842397841 | 2842395702 | Bacteria | 6780583 |
| 723 | 2842407670 | 2842402390 | Bacteria | 6681310 |
| 724 | 2842414301 | 2842409023 | Bacteria | 6687331 |
| 725 | 2842420839 | 2842415677 | Bacteria | 6596907 |
| 726 | 2842424135 | 2842422224 | Bacteria | 6239196 |
| 727 | 2842431151 | 2842428310 | Bacteria | 6767288 |
| 728 | 2842437486 | 2842434925 | Bacteria | 6502746 |
| 729 | 2842444301 | 2842441272 | Bacteria | 6769273 |
| 730 | 2842451272 | 2842447887 | Bacteria | 6754142 |
| 731 | 2842465294 | 2842462802 | Bacteria | 6588055 |
| 732 | 2842472237 | 2842469257 | Bacteria | 6752936 |
| 733 | 2842480701 | 2842475841 | Bacteria | 6603183 |
| 734 | 2842487255 | 2842482326 | Bacteria | 7212537 |
| 735 | 2842494108 | 2842489311 | Bacteria | 6620893 |
| 736 | 2842501247 | 2842495871 | Bacteria | 6820686 |
| 737 | 2842507256 | 2842502639 | Bacteria | 6604161 |
| 738 | 2842514530 | 2842509118 | Bacteria | 6850950 |
| 739 | 2842517661 | 2842515876 | Bacteria | 5436280 |
| 740 | 2844008825 | 2844002411 | Bacteria | 7168230 |
| 741 | 2844012463 | 2844009547 | Bacteria | 6728125 |
| 742 | 2844456588 | 2844454524 | Bacteria | 7952546 |
| 743 | 2847674926 | 2847670302 | Bacteria | 6165597 |
| 744 | 2852387864 | 2852387548 | Bacteria | 8025568 |
| 745 | 2856320645 | 2856314179 | Bacteria | 6477897 |
| 746 | 2856322952 | 2856320880 | Bacteria | 7263508 |
| 747 | 2856334727 | 2856328259 | Bacteria | 6528202 |
| 748 | 2856339617 | 2856334872 | Bacteria | 7037011 |
| 749 | 2856345883 | 2856342000 | Bacteria | 7176905 |
| 750 | 2856349430 | 2856349417 | Bacteria | 6230045 |
| 751 | 2856367940 | 2856364286 | Bacteria | 6939991 |
| 752 | 2857351937 | 2857349434 | Bacteria | 7926032 |
| 753 | 2857520884 | 2857516855 | Bacteria | 7787325 |
| 754 | 2857533817 | 2857531043 | Bacteria | 6754041 |
| 755 | 2869164779 | 2869162929 | Bacteria | 6399702 |
| 756 | 2869173043 | 2869169390 | Bacteria | 6659796 |
| 757 | 2869241470 | 2869234852 | Bacteria | 6654993 |
| 758 | 2869244879 | 2869242130 | Bacteria | 6609239 |
| 759 | 2869254131 | 2869249662 | Bacteria | 6868783 |
| 760 | 2869259748 | 2869256925 | Bacteria | 6981691 |
| 761 | 2869271105 | 2869264136 | Bacteria | 6880765 |
| 762 | 2869276576 | 2869271264 | Bacteria | 6908218 |
| 763 | 2869282504 | 2869278585 | Bacteria | 7077053 |
| 764 | 2869290441 | 2869285874 | Bacteria | 6901219 |
| 765 | 2871432725 | 2871429161 | Bacteria | 6547891 |
| 766 | 2871437390 | 2871435913 | Bacteria | 6880295 |
| 767 | 2871454229 | 2871451962 | Bacteria | 7336357 |
| 768 | 2871466490 | 2871459585 | Bacteria | 6866887 |
| 769 | 2871474301 | 2871466892 | Bacteria | 6923287 |
| 770 | 2871477418 | 2871474448 | Bacteria | 6806570 |
| 771 | 2871484905 | 2871481445 | Bacteria | 6700002 |
| 772 | 2871493335 | 2871488783 | Bacteria | 6929816 |
| 773 | 2871499075 | 2871495908 | Bacteria | 6935695 |
| 774 | 2874106505 | 2874102143 | Bacteria | 6342645 |
| 775 | 2874111837 | 2874109183 | Bacteria | 6517025 |
| 776 | 2874117156 | 2874116593 | Bacteria | 6674494 |
| 777 | 2874126707 | 2874123672 | Bacteria | 7238285 |
| 778 | 2874134939 | 2874131515 | Bacteria | 6820270 |
| 779 | 2874142159 | 2874139085 | Bacteria | 7021506 |
| 780 | 2874152692 | 2874146452 | Bacteria | 7533118 |
| 781 | 2874160092 | 2874155637 | Bacteria | 6724144 |
| 782 | 2874168095 | 2874162495 | Bacteria | 6174670 |
| 783 | 2874174925 | 2874168670 | Bacteria | 8062617 |
| 784 | 2876365059 | 2876363079 | Bacteria | 6544991 |
| 785 | 2876374434 | 2876369609 | Bacteria | 6807521 |
| 786 | 2876379857 | 2876377896 | Bacteria | 6565995 |
| 787 | 2876386761 | 2876386047 | Bacteria | 6698674 |
| 788 | 2876397913 | 2876392853 | Bacteria | 6660880 |
| 789 | 2876402721 | 2876399893 | Bacteria | 6927900 |
| 790 | 2876407866 | 2876406927 | Bacteria | 6191900 |
| 791 | 2876418608 | 2876413966 | Bacteria | 6831344 |
| 792 | 2876423015 | 2876420981 | Bacteria | 6687741 |
| 793 | 2878036052 | 2878035449 | Bacteria | 6555736 |
| 794 | 2878733980 | 2878730984 | Bacteria | 6380721 |
| 795 | 2878744655 | 2878738818 | Bacteria | 7136951 |
| 796 | 2878750339 | 2878745973 | Bacteria | 6867388 |
| 797 | 2878757379 | 2878753008 | Bacteria | 6922523 |
| 798 | 2878763274 | 2878760144 | Bacteria | 6823465 |
| 799 | 2878770262 | 2878767105 | Bacteria | 6898628 |
| 800 | 2878779744 | 2878774303 | Bacteria | 6108671 |
| 801 | 2878785281 | 2878781027 | Bacteria | 6834456 |
| 802 | 2878789503 | 2878788777 | Bacteria | 6567085 |
| 803 | 2881149806 | 2881147464 | Bacteria | 7779814 |
| 804 | 2881160951 | 2881155292 | Bacteria | 6461656 |
| 805 | 2881166691 | 2881161766 | Bacteria | 7127907 |
| 806 | 2881848451 | 2881845957 | Bacteria | 6611900 |
| 807 | 2881857243 | 2881853255 | Bacteria | 6698367 |
| 808 | 2881868938 | 2881861095 | Bacteria | 7128710 |
| 809 | 2882912660 | 2882912400 | Bacteria | 6801539 |
| 810 | 2885308210 | 2885305155 | Bacteria | 7348390 |
| 811 | 2885312981 | 2885312484 | Bacteria | 6415165 |
| 812 | 2885321870 | 2885318864 | Bacteria | 6729568 |
| 813 | 2885332741 | 2885326080 | Bacteria | 7134805 |
| 814 | 2885334613 | 2885334103 | Bacteria | 7216818 |
| 815 | 2885342853 | 2885342637 | Bacteria | 7011821 |
| 816 | 2885353513 | 2885350715 | Bacteria | 6787678 |
| 817 | 2888338186 | 2888337043 | Bacteria | 6629336 |
| 818 | 2888345782 | 2888343758 | Bacteria | 6611049 |
| 819 | 2888355042 | 2888350351 | Bacteria | 7372807 |
| 820 | 2891374796 | 2891373044 | Bacteria | 5202277 |
| 821 | 2899794299 | 2899792073 | Bacteria | 4926588 |
| 822 | 2899805886 | 2899803654 | Bacteria | 5577784 |
| 823 | 2899845679 | 2899845264 | Bacteria | 5672268 |
| 824 | 2903450069 | 2903448605 | Bacteria | 7357801 |
| 825 | 2903499993 | 2903492973 | Bacteria | 13473544 |
| 826 | 2903501107 | 2903492973 | Bacteria | 13473544 |
| 827 | 2903520815 | 2903513507 | Bacteria | 6344008 |
| 828 | 2903522206 | 2903521522 | Bacteria | 6525694 |
| 829 | 2903528584 | 2903528002 | Bacteria | 6586099 |
| 830 | 2903543877 | 2903540706 | Bacteria | 7062119 |
| 831 | 2904664564 | 2904659560 | Bacteria | 6685615 |
| 832 | 2906312697 | 2906308376 | Bacteria | 6841989 |
| 833 | 2906325406 | 2906321335 | Bacteria | 6579571 |
| 834 | 2906330790 | 2906328253 | Bacteria | 6585166 |
| 835 | 2906360034 | 2906354277 | Bacteria | 6991324 |
| 836 | 2906367501 | 2906363423 | Bacteria | 6856682 |
| 837 | 2906373657 | 2906370794 | Bacteria | 6881062 |
| 838 | 2906384463 | 2906378014 | Bacteria | 6911440 |
| 839 | 2906391219 | 2906386501 | Bacteria | 5977019 |
| 840 | 2906399469 | 2906393657 | Bacteria | 6790866 |
| 841 | 2906401458 | 2906401398 | Bacteria | 6693206 |
| 842 | 2906411007 | 2906408224 | Bacteria | 6162342 |
| 843 | 2906419906 | 2906414383 | Bacteria | 6580790 |
| 844 | 2906432720 | 2906427513 | Bacteria | 6375796 |
| 845 | 2919101862 | 2919100787 | Bacteria | 7710546 |
| 846 | 2919116753 | 2919114240 | Bacteria | 5700270 |
| 847 | 2919408328 | 2919408235 | Bacteria | 6149349 |
| 848 | 2922138713 | 2922130491 | Bacteria | 7173936 |
| 849 | 2922157139 | 2922151315 | Bacteria | 6902399 |
| 850 | 2922172874 | 2922172374 | Bacteria | 6167644 |
| 851 | 2922179713 | 2922178524 | Bacteria | 6025201 |
| 852 | 2922192928 | 2922185730 | Bacteria | 7113964 |
| 853 | 2923556181 | 2923556063 | Bacteria | 6793593 |
| 854 | 2924714854 | 2924710171 | Bacteria | 6752351 |
| 855 | 2924725453 | 2924718760 | Bacteria | 6331356 |
| 856 | 2924738036 | 2924733363 | Bacteria | 7574837 |
| 857 | 2924749758 | 2924748358 | Bacteria | 6154725 |
| 858 | 2924767074 | 2924762789 | Bacteria | 6561353 |
| 859 | 2924782685 | 2924776078 | Bacteria | 7492003 |
| 860 | 2924786685 | 2924784321 | Bacteria | 7416538 |
| 861 | 2926754763 | 2926754445 | Bacteria | 5964435 |
| 862 | 2926761931 | 2926760298 | Bacteria | 5505990 |
| 863 | 2929138880 | 2929138655 | Bacteria | 5810547 |
| 864 | 2933006938 | 2933006813 | Bacteria | 4912075 |
| 865 | 2933015472 | 2933011516 | Bacteria | 5439334 |
| 866 | 2933574921 | 2933570622 | Bacteria | 7023390 |
| 867 | 2933588363 | 2933586486 | Bacteria | 7667493 |
| 868 | 2933594141 | 2933594066 | Bacteria | 5594265 |
| 869 | 2933601326 | 2933599457 | Bacteria | 5858799 |
| 870 | 2935899978 | 2935894831 | Bacteria | 6620579 |
| 871 | 2935902325 | 2935901341 | Bacteria | 7341747 |
| 872 | 2936369541 | 2936367885 | Bacteria | 7324495 |
| 873 | 2936380282 | 2936375103 | Bacteria | 6652732 |
| 874 | 2936385261 | 2936381700 | Bacteria | 7006523 |
| 875 | 2937819158 | 2937813078 | Bacteria | 7783518 |
| 876 | 2937827704 | 2937822353 | Bacteria | 7290551 |
| 877 | 2937837329 | 2937836603 | Bacteria | 6811263 |
| 878 | 2937852167 | 2937848649 | Bacteria | 6983481 |
| 879 | 2937863095 | 2937861824 | Bacteria | 6660327 |
| 880 | 2937873092 | 2937868953 | Bacteria | 6639878 |
| 881 | 2937881330 | 2937877337 | Bacteria | 7246526 |
| 882 | 2937893357 | 2937891427 | Bacteria | 6357007 |
| 883 | 2937977422 | 2937972304 | Bacteria | 7532020 |
| 884 | 2937984508 | 2937980651 | Bacteria | 6517427 |
| 885 | 2937997726 | 2937994558 | Bacteria | 7036190 |
| 886 | 2958039286 | 2958034702 | Bacteria | 6989922 |
| 887 | 2958053084 | 2958041894 | Bacteria | 13082850 |
| 888 | 2958070482 | 2958064165 | Bacteria | 7158582 |
| 889 | 2958073918 | 2958071322 | Bacteria | 6815895 |
| 890 | 2958088113 | 2958084443 | Bacteria | 7312792 |
| 891 | 2958094120 | 2958092219 | Bacteria | 6861151 |
| 892 | 2958110099 | 2958108152 | Bacteria | 6681128 |
| 893 | 2958121086 | 2958115193 | Bacteria | 6923548 |
| 894 | 2958127419 | 2958122699 | Bacteria | 7280457 |
| 895 | 2958134829 | 2958130278 | Bacteria | 6897202 |
| 896 | 2958143081 | 2958137437 | Bacteria | 6050276 |
| 897 | 2958148863 | 2958144490 | Bacteria | 6677056 |
| 898 | 2958164469 | 2958158011 | Bacteria | 6058449 |
| 899 | 2958168199 | 2958165035 | Bacteria | 6906348 |
| 900 | 2958186391 | 2958179912 | Bacteria | 6874908 |
| 901 | 2961084890 | 2961077736 | Bacteria | 7079850 |
| 902 | 2961119563 | 2961114664 | Bacteria | 6680456 |
| 903 | 2961130872 | 2961127735 | Bacteria | 7196641 |
| 904 | 2961140618 | 2961136820 | Bacteria | 6775228 |
| 905 | 2961166665 | 2961163497 | Bacteria | 6901077 |
| 906 | 2961175292 | 2961170736 | Bacteria | 7072258 |
| 907 | 2961186024 | 2961183825 | Bacteria | 6688536 |
| 908 | 2963646514 | 2963644680 | Bacteria | 6530403 |
| 909 | 2965021488 | 2965018300 | Bacteria | 6883036 |
| 910 | 2965027482 | 2965025482 | Bacteria | 6532201 |
| 911 | 2965037944 | 2965032056 | Bacteria | 6887443 |
| 912 | 2965042159 | 2965040258 | Bacteria | 6855979 |
| 913 | 2965049605 | 2965047637 | Bacteria | 6623551 |
| 914 | 2965064599 | 2965062239 | Bacteria | 7412989 |
| 915 | 2965091980 | 2965089291 | Bacteria | 6866420 |
| 916 | 2965114393 | 2965110997 | Bacteria | 6693150 |
| 917 | 2967999707 | 2967996073 | Bacteria | 6787468 |
| 918 | 2968008065 | 2968003550 | Bacteria | 6929263 |
| 919 | 2968020611 | 2968016561 | Bacteria | 7022047 |
| 920 | 2968090684 | 2968083720 | Bacteria | 7351627 |
| 921 | 2968094664 | 2968091066 | Bacteria | 6052692 |
| 922 | 2968098042 | 2968097103 | Bacteria | 6107094 |
| 923 | 2968115818 | 2968110612 | Bacteria | 6814636 |
| 924 | 2968119182 | 2968117919 | Bacteria | 6536078 |
| 925 | 2968140370 | 2968138860 | Bacteria | 6605449 |
| 926 | 2968175070 | 2968171901 | Bacteria | 6894245 |
| 927 | 2970473908 | 2970469710 | Bacteria | 6969209 |
| 928 | 2970490569 | 2970489779 | Bacteria | 6517260 |
| 929 | 2970507880 | 2970503327 | Bacteria | 7099517 |
| 930 | 2970514364 | 2970510686 | Bacteria | 7006402 |
| 931 | 2970527254 | 2970524798 | Bacteria | 6840927 |
| 932 | 2970535922 | 2970532167 | Bacteria | 6553173 |
| 933 | 2970541874 | 2970540015 | Bacteria | 6977556 |
| 934 | 2970548545 | 2970547951 | Bacteria | 6931819 |
| 935 | 2970558119 | 2970554993 | Bacteria | 6814252 |
| 936 | 2970597113 | 2970593180 | Bacteria | 7073582 |
| 937 | 2970623537 | 2970619444 | Bacteria | 6986144 |
| 938 | 2970627662 | 2970627176 | Bacteria | 6680862 |
| 939 | 2977826538 | 2977821940 | Bacteria | 6906439 |
| 940 | 2977848485 | 2977843712 | Bacteria | 6753583 |
| 941 | 2977856009 | 2977851361 | Bacteria | 6694324 |
| 942 | 2977864440 | 2977858184 | Bacteria | 6215359 |
| 943 | 2977865066 | 2977864932 | Bacteria | 7534097 |
| 944 | 2977880146 | 2977872689 | Bacteria | 7270173 |
| 945 | 2977899149 | 2977898635 | Bacteria | 6675551 |
| 946 | 2977912292 | 2977907340 | Bacteria | 6577984 |
| 947 | 2977916494 | 2977915119 | Bacteria | 6829656 |
| 948 | 2977926138 | 2977922695 | Bacteria | 6956781 |
| 949 | 2977938052 | 2977935797 | Bacteria | 6252826 |
| 950 | 2977944893 | 2977942078 | Bacteria | 7570577 |
| 951 | 2977956074 | 2977950692 | Bacteria | 6893264 |
| 952 | 2977963302 | 2977957713 | Bacteria | 6877875 |
| 953 | 2977977942 | 2977971508 | Bacteria | 7472917 |
| 954 | 2977988620 | 2977986579 | Bacteria | 6581278 |
| 955 | 2979092802 | 2979089926 | Bacteria | 5670289 |
| 956 | 2979099809 | 2979095461 | Bacteria | 5669583 |
| 957 | 2979104774 | 2979100975 | Bacteria | 5423623 |
| 958 | 2979771804 | 2979764755 | Bacteria | 6610066 |
| 959 | 2979774721 | 2979772303 | Bacteria | 6618277 |
| 960 | 2979786486 | 2979779861 | Bacteria | 6219781 |
| 961 | 2979798947 | 2979793036 | Bacteria | 6808957 |
| 962 | 2979813064 | 2979808191 | Bacteria | 7179355 |
| 963 | 2984513426 | 2984509177 | Bacteria | 5274802 |
| 964 | 2984520206 | 2984518228 | Bacteria | 5277463 |
| 965 | 2984539502 | 2984537506 | Bacteria | 5277481 |
| 966 | 2984601729 | 2984601300 | Bacteria | 5455244 |
| 967 | 2987639121 | 2987636660 | Bacteria | 8088555 |
| 968 | 2987651163 | 2987645492 | Bacteria | 6117018 |
| 969 | 2987662677 | 2987659509 | Bacteria | 6966464 |
| 970 | 2987671560 | 2987666974 | Bacteria | 6509233 |
| 971 | 2987679866 | 2987673487 | Bacteria | 6884027 |
| 972 | 2989774544 | 2989771324 | Bacteria | 5605128 |
| 973 | 2989776831 | 2989776772 | Bacteria | 4843317 |
| 974 | 2996311896 | 2996310559 | Bacteria | 6357320 |
| 975 | 2996336884 | 2996336353 | Bacteria | 5511628 |
| 976 | 2996352771 | 2996348954 | Bacteria | 7239054 |
| 977 | 2996387326 | 2996386984 | Bacteria | 6978667 |
| 978 | 2996887968 | 2996887358 | Bacteria | 5795980 |
| 979 | 3004167502 | 3004167301 | Bacteria | 8330599 |
| 980 | 3004191727 | 3004188549 | Bacteria | 6952365 |
| 981 | 3004196234 | 3004195979 | Bacteria | 6776956 |
| 982 | 3004204636 | 3004203850 | Bacteria | 7307914 |
| 983 | 3004217921 | 3004211236 | Bacteria | 7417683 |
| 984 | 3004221031 | 3004218560 | Bacteria | 7421728 |
| 985 | 3004238621 | 3004232784 | Bacteria | 6662140 |
| 986 | 3004253093 | 3004248173 | Bacteria | 6563236 |
| 987 | 3004274057 | 3004268573 | Bacteria | 7043476 |
| 988 | 3004279453 | 3004275668 | Bacteria | 7114440 |
| 989 | 3004293411 | 3004289098 | Bacteria | 6135450 |
| 990 | 3004335901 | 3004334049 | Bacteria | 8449246 |
| 991 | 3005410635 | 3005409236 | Bacteria | 7188837 |
| 992 | 3005423299 | 3005416602 | Bacteria | 7064308 |
| 993 | 3005450096 | 3005445848 | Bacteria | 6906074 |
| 994 | 3005456332 | 3005452660 | Bacteria | 5889319 |
| 995 | 637075773 | 637000159 | Bacteria | 7596297 |
| 996 | 639646068 | 639633055 | Bacteria | 7751309 |
| 997 | 649871663 | 649633066 | Bacteria | 6690028 |
| 998 | 650738628 | 650716007 | Bacteria | 5573770 |
| 999 | 8003572174 | 8003570095 | Bacteria | 5747666 |
| 1000 | 8004301519 | 8004300914 | Bacteria | 6132239 |
| 1001 | 8004319265 | 8004312739 | Bacteria | 7444653 |
| 1002 | 8004367006 | 8004361976 | Bacteria | 6858373 |
| 1003 | 8004378954 | 8004374579 | Bacteria | 6898112 |
| 1004 | 8004392647 | 8004387939 | Bacteria | 7049250 |
| 1005 | 8004396203 | 8004395343 | Bacteria | 6620908 |
| 1006 | 8004445985 | 8004445564 | Bacteria | 6322258 |
| 1007 | 8004636501 | 8004633249 | Bacteria | 6723080 |
| 1008 | 8004645254 | 8004640170 | Bacteria | 6723001 |
| 1009 | 8004701560 | 8004695233 | Bacteria | 6731676 |
| 1010 | 8004712161 | 8004703790 | Bacteria | 8006957 |
| 1011 | 8004718956 | 8004714634 | Bacteria | 6776161 |
| 1012 | 8005247886 | 8005246636 | Bacteria | 4933972 |
| 1013 | 8005261466 | 8005258706 | Bacteria | 6184835 |
| 1014 | 8005278294 | 8005275841 | Bacteria | 6929066 |
| 1015 | 8005282672 | 8005282627 | Bacteria | 6675747 |
| 1016 | 8005291648 | 8005289223 | Bacteria | 6634003 |
| 1017 | 8005305479 | 8005301065 | Bacteria | 6614431 |
| 1018 | 8005310255 | 8005307578 | Bacteria | 7395396 |
| 1019 | 8005315626 | 8005314921 | Bacteria | 7072929 |
| 1020 | 8005322495 | 8005321885 | Bacteria | 5795980 |
| 1021 | 8005378098 | 8005376324 | Bacteria | 6590079 |
| 1022 | 8005384108 | 8005382845 | Bacteria | 6732062 |
| 1023 | 8005399614 | 8005395548 | Bacteria | 6806915 |
| 1024 | 8005433793 | 8005430974 | Bacteria | 6689030 |
| 1025 | 8005465529 | 8005460587 | Bacteria | 7157962 |
| 1026 | 8005484467 | 8005484373 | Bacteria | 6297373 |
| 1027 | 8005498112 | 8005497431 | Bacteria | 6477605 |
| 1028 | 8005543234 | 8005542996 | Bacteria | 7077758 |
| 1029 | 8005559979 | 8005556819 | Bacteria | 6908598 |
| 1030 | 8005564527 | 8005563573 | Bacteria | 7153261 |
| 1031 | 8005571213 | 8005570704 | Bacteria | 6957481 |
| 1032 | 8005619321 | 8005619151 | Bacteria | 7030230 |
| 1033 | 8005627886 | 8005626139 | Bacteria | 6534237 |
| 1034 | 8005647387 | 8005645114 | Bacteria | 6950293 |
| 1035 | 8005661545 | 8005658619 | Bacteria | 4500593 |
| 1036 | 8005669520 | 8005668836 | Bacteria | 6953162 |
| 1037 | 8005687457 | 8005682033 | Bacteria | 6726518 |
| 1038 | 8005692769 | 8005688590 | Bacteria | 6610080 |
| 1039 | 8005701457 | 8005695170 | Bacteria | 6912330 |
| 1040 | 8018132537 | 8018127388 | Bacteria | 7351159 |
| 1041 | 8018167603 | 8018163183 | Bacteria | 7277977 |
| 1042 | 8018176616 | 8018176218 | Bacteria | 6896178 |
| 1043 | 8023681268 | 8023680758 | Bacteria | 7729763 |
| 1044 | 8024481901 | 8024479707 | Bacteria | 6954785 |
| 1045 | 8024488591 | 8024486573 | Bacteria | 6540512 |
| 1046 | 8024506337 | 8024501048 | Bacteria | 6427847 |
| 1047 | 8046768681 | 8046767195 | Bacteria | 7547379 |
| 1048 | 8054463958 | 8054460903 | Bacteria | 4872905 |
| 1049 | 8055619338 | 8055617313 | Bacteria | 7548464 |
| 1050 | 8056381186 | 8056375014 | Bacteria | 7006639 |
| 1051 | 8056382679 | 8056382006 | Bacteria | 6408074 |
| 1052 | 8056878653 | 8056875544 | Bacteria | 4355797 |
| 1053 | 8057582456 | 8057575449 | Bacteria | 7367519 |
| 1054 | 8057878697 | 8057874678 | Bacteria | 7494653 |
| 1055 | JGI24740J21852_10010356 | |||
| 1056 | JGI24740J21852_10012401 | |||
| 1057 | JGI24740J21852_10058101 | |||
| 1058 | JGI24739J22299_10020720 | |||
| 1059 | JGI25155J39150_1000110 | |||
| 1060 | JGI25156J39149_1000192 | |||
| 1061 | JGI25162J39368_1000302 | |||
| 1062 | JGI25162J39368_1001906 | |||
| 1063 | JGI25154J39366_1000196 | |||
| 1064 | JGI25158J39367_1001549 | |||
| 1065 | JGI25157J39369_1000228 | |||
| 1066 | JGI25157J39369_1001767 | |||
| 1067 | JGI25152J39213_1003523 | |||
| 1068 | JGI25152J39213_1003583 | |||
| 1069 | JGI25152J39213_1023689 | |||
| 1070 | JGI25150J39212_1001258 | |||
| 1071 | JGI25150J39212_1009522 | |||
| 1072 | JGI25159J45721_1000790 | |||
| 1073 | JGI25159J45721_1001258 | |||
| 1074 | JGI25151J46595_10000660 | |||
| 1075 | JGI25151J46595_10001587 | |||
| 1076 | JGI25151J46595_10007774 | |||
| 1077 | JGI25151J46595_10010521 | |||
| 1078 | JGI25151J46595_10031068 | |||
| 1079 | JGI25151J46595_10039452 | |||
| 1080 | JGI25165J46597_1000042 | |||
| 1081 | JGI25165J46597_1000390 | |||
| 1082 | JGI25165J46597_1001741 | |||
| 1083 | JGI25165J46597_1002721 | |||
| 1084 | JGI25153J46596_10007015 | |||
| 1085 | JGI25153J46596_10011601 | |||
| 1086 | JGI25153J46596_10032236 | |||
| 1087 | rootH1_10050935 | |||
| 1088 | rootH2_10047843 | |||
| 1089 | rootL2_10038374 | |||
| 1090 | JGI25160J50197_1000044 | |||
| 1091 | JGI25160J50197_1003769 | |||
| 1092 | JGI25161J50226_1000028 | |||
| 1093 | JGI25161J50226_1000078 | |||
| 1094 | Ga0055542_1000592 | |||
| 1095 | Ga0055526_1005787 | |||
| 1096 | Ga0055526_1006190 | |||
| 1097 | Ga0055526_1012978 | |||
| 1098 | Ga0055526_1019212 | |||
| 1099 | Ga0055526_1019223 | |||
| 1100 | Ga0055524_1004262 | |||
| 1101 | Ga0055524_1012492 | |||
| 1102 | Ga0055528_1000113 | |||
| 1103 | Ga0055528_1001190 | |||
| 1104 | Ga0055528_1006884 | |||
| 1105 | Ga0055540_1001653 | |||
| 1106 | Ga0055540_1007715 | |||
| 1107 | Ga0055540_1022741 | |||
| 1108 | Ga0058692_1002358 | |||
| 1109 | Ga0058692_1002936 | |||
| 1110 | Ga0055543_1000054 | |||
| 1111 | Ga0055543_1000069 | |||
| 1112 | Ga0065165_1000318 | |||
| 1113 | Ga0065165_1012288 | |||
| 1114 | Ga0065165_1016211 | |||
| 1115 | Ga0070670_100000105 | |||
| 1116 | Ga0070667_100596923 | |||
| 1117 | Ga0070663_100051355 | |||
| 1118 | Ga0068853_100006660 | |||
| 1119 | Ga0068853_100551688 | |||
| 1120 | Ga0068855_100128301 | |||
| 1121 | Ga0068857_100483178 | |||
| 1122 | Ga0068857_100493695 | |||
| 1123 | Ga0068856_100169981 | |||
| 1124 | Ga0068856_100314736 | |||
| 1125 | Ga0068852_100018469 | |||
| 1126 | Ga0068851_10037302 | |||
| 1127 | Ga0075365_10004347 | |||
| 1128 | Ga0075365_10017265 | |||
| 1129 | Ga0075365_10020968 | |||
| 1130 | Ga0075365_10038035 | |||
| 1131 | Ga0075365_10078395 | |||
| 1132 | Ga0075365_10083267 | |||
| 1133 | Ga0075365_10190669 | |||
| 1134 | Ga0075368_10001589 | |||
| 1135 | Ga0075368_10024080 | |||
| 1136 | Ga0075368_10035238 | |||
| 1137 | Ga0075363_100009448 | |||
| 1138 | Ga0075363_100023482 | |||
| 1139 | Ga0075363_100059151 | |||
| 1140 | Ga0075364_10042363 | |||
| 1141 | Ga0075362_10001417 | |||
| 1142 | Ga0075362_10092727 | |||
| 1143 | Ga0075367_10004267 | |||
| 1144 | Ga0075367_10010325 | |||
| 1145 | Ga0075367_10018946 | |||
| 1146 | Ga0075367_10089976 | |||
| 1147 | Ga0075367_10204296 | |||
| 1148 | Ga0075369_10044665 | |||
| 1149 | Ga0075366_10024153 | |||
| 1150 | Ga0075370_10000842 | |||
| 1151 | Ga0075370_10037597 | |||
| 1152 | Ga0075370_10039345 | |||
| 1153 | Ga0079104_1000082 | |||
| 1154 | Ga0099826_10006060 | |||
| 1155 | Ga0099826_10097192 | |||
| 1156 | Ga0105240_10001468 | |||
| 1157 | Ga0105240_10249736 | |||
| 1158 | Ga0105240_10398866 | |||
| 1159 | Ga0105240_10563129 | |||
| 1160 | Ga0105245_10672793 | |||
| 1161 | Ga0105243_10003711 | |||
| 1162 | Ga0105248_10054876 | |||
| 1163 | Ga0105237_10004445 | |||
| 1164 | Ga0105237_10011413 | |||
| 1165 | Ga0105238_10307068 | |||
| 1166 | Ga0105249_10365413 | |||
| 1167 | Ga0123341_1000642 | |||
| 1168 | Ga0123341_1057766 | |||
| 1169 | Ga0123342_1010090 | |||
| 1170 | Ga0123342_1021055 | |||
| 1171 | Ga0105239_10046215 | |||
| 1172 | Ga0105239_10048662 | |||
| 1173 | Ga0105239_10328115 | |||
| 1174 | Ga0105246_10185777 | |||
| 1175 | Ga0157373_10018682 | |||
| 1176 | Ga0157371_10000004 | |||
| 1177 | Ga0157370_10001047 | |||
| 1178 | Ga0157370_10001796 | |||
| 1179 | Ga0182008_10087338 | |||
| 1180 | Ga0182008_10095812 | |||
| 1181 | Ga0182006_1020401 | |||
| 1182 | Ga0163161_10396032 | |||
| 1183 | Ga0209435_100087 | |||
| 1184 | Ga0209436_100268 | |||
| 1185 | Ga0209436_112679 | |||
| 1186 | Ga0209672_105109 | |||
| 1187 | Ga0209563_107279 | |||
| 1188 | Ga0209437_100050 | |||
| 1189 | Ga0209437_100205 | |||
| 1190 | Ga0207425_1001736 | |||
| 1191 | Ga0209646_1000285 | |||
| 1192 | Ga0209026_1000029 | |||
| 1193 | Ga0209026_1000347 | |||
| 1194 | Ga0209677_109715 | |||
| 1195 | Ga0209148_1000069 | |||
| 1196 | Ga0209759_1000482 | |||
| 1197 | Ga0209759_1000637 | |||
| 1198 | Ga0209129_1000066 | |||
| 1199 | Ga0209129_1001099 | |||
| 1200 | Ga0209129_1001848 | |||
| 1201 | Ga0209129_1002246 | |||
| 1202 | Ga0209129_1006820 | |||
| 1203 | Ga0209233_1000028 | |||
| 1204 | Ga0209233_1000037 | |||
| 1205 | Ga0209233_1000187 | |||
| 1206 | Ga0209233_1000232 | |||
| 1207 | Ga0209565_1035287 | |||
| 1208 | Ga0209455_1000219 | |||
| 1209 | Ga0209673_1000024 | |||
| 1210 | Ga0209673_1000911 | |||
| 1211 | Ga0209673_1002137 | |||
| 1212 | Ga0209673_1002283 | |||
| 1213 | Ga0209673_1003397 | |||
| 1214 | Ga0209673_1013102 | |||
| 1215 | Ga0209673_1034216 | |||
| 1216 | Ga0209130_1000002 | |||
| 1217 | Ga0209130_1000093 | |||
| 1218 | Ga0209025_1000274 | |||
| 1219 | Ga0209025_1000275 | |||
| 1220 | Ga0209025_1000377 | |||
| 1221 | Ga0209025_1000553 | |||
| 1222 | Ga0209025_1008610 | |||
| 1223 | Ga0209025_1015100 | |||
| 1224 | Ga0209564_1000262 | |||
| 1225 | Ga0209564_1000474 | |||
| 1226 | Ga0209564_1000486 | |||
| 1227 | Ga0209758_1000466 | |||
| 1228 | Ga0209758_1000971 | |||
| 1229 | Ga0209758_1003684 | |||
| 1230 | Ga0209758_1009079 | |||
| 1231 | Ga0209758_1009179 | |||
| 1232 | Ga0209758_1025882 | |||
| 1233 | Ga0209050_1006063 | |||
| 1234 | Ga0209256_1000868 | |||
| 1235 | Ga0209256_1003327 | |||
| 1236 | Ga0209256_1011210 | |||
| 1237 | Ga0209256_1038435 | |||
| 1238 | Ga0207426_1000012 | |||
| 1239 | Ga0207426_1000013 | |||
| 1240 | Ga0207426_1000142 | |||
| 1241 | Ga0209051_1000170 | |||
| 1242 | Ga0209051_1002082 | |||
| 1243 | Ga0209051_1027111 | |||
| 1244 | Ga0209051_1037438 | |||
| 1245 | Ga0209257_1007148 | |||
| 1246 | Ga0207688_10199146 | |||
| 1247 | Ga0207647_10058319 | |||
| 1248 | Ga0207695_10000427 | |||
| 1249 | Ga0207695_10635585 | |||
| 1250 | Ga0207671_10002841 | |||
| 1251 | Ga0207671_10023638 | |||
| 1252 | Ga0207671_10500607 | |||
| 1253 | Ga0207657_10211893 | |||
| 1254 | Ga0207650_10000302 | |||
| 1255 | Ga0207709_10231419 | |||
| 1256 | Ga0207711_10077431 | |||
| 1257 | Ga0207667_10214924 | |||
| 1258 | Ga0207667_10529655 | |||
| 1259 | Ga0207640_10650010 | |||
| 1260 | Ga0207658_10519032 | |||
| 1261 | Ga0207639_10242013 | |||
| 1262 | Ga0207639_10473614 | |||
| 1263 | Ga0207678_10046447 | |||
| 1264 | Ga0207702_10034141 | |||
| 1265 | Ga0207702_10257221 | |||
| 1266 | Ga0207674_10144852 | |||
| 1267 | Ga0207674_10877123 | |||
| 1268 | Ga0207698_10087512 | |||
| 1269 | Ga0209281_1000043 | |||
| 1270 | Ga0209371_1000009 | |||
| 1271 | Ga0209371_1000569 | |||
| 1272 | Ga0209371_1000597 | |||
| 1273 | Ga0209371_1002100 | |||
| 1274 | Ga0209282_1015117 | |||
| 1275 | Ga0209813_10015632 | |||
| 1276 | Ga0268266_10085620 | |||
| 1277 | Ga0268266_10204443 | |||
| 1278 | Ga0307515_10070922 | |||
| 1279 | Ga0307515_10316134 | |||
| 1280 | Ga0268256_1000010 | |||
| 1281 | Ga0268256_1003765 | |||
| 1282 | Ga0268256_1003954 | |||
| 1283 | Ga0307416_100409987 | |||
| 1284 | Ga0395900_0293062 | |||
| 1285 | Ga0395900_0318882 | |||
| 1286 | Ga0395898_0214279 | |||
| 1287 | Ga0395905_0473627 | |||
| 1288 | Ga0395901_0040590 | |||
| 1289 | Ga0395901_0102150 | |||
| 1290 | Ga0395901_0525704 | |||
| 1291 | Ga0439465_0004289 | |||
| 1292 | Ga0439465_0094693 | |||
| 1293 | Ga0439465_0115285 | |||
| 1294 | Ga0451798_0437084 | |||
| 1295 | Ga0451833_0309501 | |||
| 1296 | Ga0451839_1518067 | |||
| 1297 | Ga0451841_0823007 | |||
| 1298 | Ga0451845_0491534 | |||
| 1299 | Ga0451847_0530648 | |||
| 1300 | Ga0451849_1413814 | |||
| 1301 | Ga0439445_0067743 | |||
| 1302 | Ga0439449_0036973 | |||
| 1303 | Ga0466972_0069426 | |||
| 1304 | Ga0466960_0034427 | |||
| 1305 | Ga0466967_0785893 | |||
| 1306 | Ga0495617_013045 | |||
| 1307 | Ga0495627_028697 | |||
| 1308 | Ga0495590_0029742 | |||
| 1309 | Ga0495638_0000566 | |||
| 1310 | Ga0495638_0043090 | |||
| 1311 | Ga0495650_0027816 | |||
| 1312 | Ga0495605_0009235 | |||
| 1313 | Ga0495605_0041550 | |||
| 1314 | Ga0495585_0018694 | |||
| 1315 | Ga0495585_0047303 | |||
| 1316 | Ga0495585_0048677 | |||
| 1317 | Ga0495607_0022489 | |||
| 1318 | Ga0495607_0024783 | |||
| 1319 | Ga0495607_0191834 | |||
| 1320 | Ga0495583_0003929 | |||
| 1321 | Ga0495583_0019864 | |||
| 1322 | Ga0495606_0005067 | |||
| 1323 | Ga0495606_0049724 | |||
| 1324 | Ga0495606_0055336 | |||
| 1325 | Ga0495606_0077288 | |||
| 1326 | Ga0495610_0037953 | |||
| 1327 | Ga0495616_0025367 | |||
| 1328 | Ga0495620_0041131 | |||
| 1329 | Ga0495631_0003763 | |||
| 1330 | Ga0495632_0012650 | |||
| 1331 | Ga0495632_0024308 | |||
| 1332 | Ga0495643_0036691 | |||
| 1333 | Ga0495643_0109703 | |||
| 1334 | Ga0495654_0000314 | |||
| 1335 | Ga0495609_0022681 | |||
| 1336 | Ga0495597_0148905 | |||
| 1337 | Ga0495633_0016834 | |||
| 1338 | Ga0495633_0036013 | |||
| 1339 | Ga0495656_0007518 | |||
| 1340 | Ga0495668_0011736 | |||
| 1341 | Ga0495668_0210932 | |||
| 1342 | Ga0495611_0009426 | |||
| 1343 | Ga0495625_0023496 | |||
| 1344 | Ga0495625_0049188 | |||
| 1345 | Ga0495625_0091282 | |||
| 1346 | Ga0495625_0095479 | |||
| 1347 | Ga0495661_0014352 | |||
| 1348 | Ga0495661_0270325 | |||
| 1349 | Ga0495670_0032614 | |||
| 1350 | Ga0495670_0071710 | |||
| 1351 | Ga0495671_0014249 | |||
| 1352 | Ga0495671_0106694 | |||
| 1353 | Ga0495649_0023374 | |||
| 1354 | Ga0495636_0114020 | |||
| 1355 | Ga0495681_0009496 | |||
| 1356 | Ga0495686_0002334 | |||
| 1357 | Ga0495686_0020721 | |||
| 1358 | Ga0495686_0182194 | |||
| 1359 | Ga0496101_0192646 | |||
| 1360 | Ga0496102_0169134 | |||
| 1361 | Ga0496103_0188830 | |||
| 1362 | Ga0496106_0006761 | |||
| 1363 | Ga0496108_0453277 | |||
| 1364 | Ga0496112_0004626 | |||
| 1365 | Ga0496113_0037980 | |||
| 1366 | Ga0496116_0018149 | |||
| 1367 | Ga0496116_0141976 | |||
| 1368 | Ga0496117_0000002 | |||
| 1369 | Ga0496117_0002038 | |||
| 1370 | Ga0496117_0005456 | |||
| 1371 | Ga0496117_0023070 | |||
| 1372 | Ga0496117_0031006 | |||
| 1373 | Ga0496117_0045021 | |||
| 1374 | Ga0496117_0070695 | |||
| 1375 | Ga0496118_0001167 | |||
| 1376 | Ga0496118_0017956 | |||
| 1377 | Ga0496118_0060628 | |||
| 1378 | Ga0496118_0109751 | |||
| 1379 | Ga0496118_0122183 | |||
| 1380 | Ga0496119_0014974 | |||
| 1381 | Ga0496119_0026777 | |||
| 1382 | Ga0496119_0047803 | |||
| 1383 | Ga0496119_0099572 | |||
| 1384 | Ga0496119_0171840 | |||
| 1385 | Ga0496119_0240112 | |||
| 1386 | Ga0496120_0002729 | |||
| 1387 | Ga0496120_0015943 | |||
| 1388 | Ga0496120_0017924 | |||
| 1389 | Ga0496120_0020218 | |||
| 1390 | Ga0496121_0000001 | |||
| 1391 | Ga0496121_0023381 | |||
| 1392 | Ga0496121_0044238 | |||
| 1393 | Ga0496121_0056726 | |||
| 1394 | Ga0496121_0107387 | |||
| 1395 | Ga0496121_0139533 | |||
| 1396 | Ga0496122_0000001 | |||
| 1397 | Ga0496122_0000018 | |||
| 1398 | Ga0496122_0000321 | |||
| 1399 | Ga0496122_0025714 | |||
| 1400 | Ga0496122_0126865 | |||
| 1401 | Ga0496122_0141991 | |||
| 1402 | Ga0496123_0000001 | |||
| 1403 | Ga0496123_0000015 | |||
| 1404 | Ga0496123_0000454 | |||
| 1405 | Ga0496123_0004823 | |||
| 1406 | Ga0496123_0139316 | |||
| 1407 | Ga0496124_0000558 | |||
| 1408 | Ga0496124_0006480 | |||
| 1409 | Ga0496124_0043463 | |||
| 1410 | Ga0496124_0046082 | |||
| 1411 | Ga0496124_0046414 | |||
| 1412 | Ga0496124_0131850 | |||
| 1413 | Ga0496125_0000001 | |||
| 1414 | Ga0496125_0000628 | |||
| 1415 | Ga0496125_0006658 | |||
| 1416 | Ga0496125_0037411 | |||
| 1417 | Ga0496125_0049883 | |||
| 1418 | Ga0496125_0085026 | |||
| 1419 | Ga0496125_0090571 | |||
| 1420 | Ga0496125_0197038 | |||
| 1421 | Ga0496126_0000378 | |||
| 1422 | Ga0496126_0063882 | |||
| 1423 | Ga0496126_0177821 | |||
| 1424 | Ga0496126_0243423 | |||
| 1425 | Ga0496126_0306012 | |||
| 1426 | Ga0496126_0421783 | |||
| 1427 | Ga0495678_047945 | |||
| 1428 | Ga0501031_0004927 | |||
| 1429 | Ga0501031_0085938 | |||
| 1430 | Ga0501032_0000019 | |||
| 1431 | Ga0501032_0051426 | |||
| 1432 | Ga0501032_0055436 | |||
| 1433 | Ga0501032_0374855 | |||
| 1434 | Ga0501033_0000260 | |||
| 1435 | Ga0501033_0000461 | |||
| 1436 | Ga0501033_0013860 | |||
| 1437 | Ga0501033_0034352 | |||
| 1438 | Ga0501033_0071969 | |||
| 1439 | Ga0501033_0149740 | |||
| 1440 | Ga0501033_0181834 | |||
| 1441 | Ga0501034_0002910 | |||
| 1442 | Ga0501034_0411430 | |||
| 1443 | Ga0501034_0636201 | |||
| 1444 | Ga0501036_0001517 | |||
| 1445 | Ga0501036_0086723 | |||
| 1446 | Ga0501037_0000154 | |||
| 1447 | Ga0501037_0000870 | |||
| 1448 | Ga0501037_0040577 | |||
| 1449 | Ga0501037_0042753 | |||
| 1450 | Ga0501037_0082837 | |||
| 1451 | Ga0501038_0001781 | |||
| 1452 | Ga0501038_0088163 | |||
| 1453 | Ga0501038_0101706 | |||
| 1454 | Ga0501038_0576400 | |||
| 1455 | Ga0501039_0001074 | |||
| 1456 | Ga0501039_0139292 | |||
| 1457 | Ga0501039_0438841 | |||
| 1458 | Ga0501043_0000007 | |||
| 1459 | Ga0501043_0000113 | |||
| 1460 | Ga0501043_0048312 | |||
| 1461 | Ga0501043_0069942 | |||
| 1462 | Ga0501043_0159911 | |||
| 1463 | Ga0501046_0191544 | |||
| 1464 | Ga0501047_0037568 | |||
| 1465 | Ga0501047_0092531 | |||
| 1466 | Ga0501047_0127106 | |||
| 1467 | Ga0501047_0186069 | |||
| 1468 | Ga0501047_0319073 | |||
| 1469 | Ga0501067_0176497 | |||
| 1470 | Ga0501068_0021893 | |||
| 1471 | Ga0501068_0109855 | |||
| 1472 | Ga0501068_0342680 | |||
| 1473 | Ga0501069_0000027 | |||
| 1474 | Ga0501069_0052485 | |||
| 1475 | Ga0501069_0115122 | |||
| 1476 | Ga0501069_0137725 | |||
| 1477 | Ga0501070_0000231 | |||
| 1478 | Ga0501070_0000822 | |||
| 1479 | Ga0501070_0000825 | |||
| 1480 | Ga0501070_0034270 | |||
| 1481 | Ga0501070_0041305 | |||
| 1482 | Ga0501070_0162893 | |||
| 1483 | Ga0501070_0250959 | |||
| 1484 | Ga0501070_0493250 | |||
| 1485 | Ga0501071_0035260 | |||
| 1486 | Ga0501073_0038563 | |||
| 1487 | Ga0501074_0000023 | |||
| 1488 | Ga0501074_0016561 | |||
| 1489 | Ga0501076_0217993 | |||
| 1490 | Ga0501080_0000300 | |||
| 1491 | Ga0501080_0122112 | |||
| 1492 | Ga0501080_0164697 | |||
| 1493 | Ga0501083_0000012 | |||
| 1494 | Ga0501083_0042127 | |||
| 1495 | Ga0501035_0000073 | |||
| 1496 | Ga0501035_0000201 | |||
| 1497 | Ga0501035_0000709 | |||
| 1498 | Ga0501035_0001226 | |||
| 1499 | Ga0501035_0001287 | |||
| 1500 | Ga0501035_0066684 | |||
| 1501 | Ga0501035_0071499 | |||
| 1502 | Ga0501035_0455009 | |||
| 1503 | Ga0501044_0000118 | |||
| 1504 | Ga0501044_0019989 | |||
| 1505 | Ga0501044_0054362 | |||
| 1506 | Ga0501044_0068483 | |||
| 1507 | Ga0501044_0176352 | |||
| 1508 | Ga0501044_0306819 | |||
| 1509 | Ga0501044_0364578 | |||
| 1510 | Ga0501044_0462262 | |||
| 1511 | nmdc:mga03683_203753_c1 | |||
| 1512 | nmdc:mga03683_6637_c1 | |||
| 1513 | nmdc:mga03n38_168995_c1 | |||
| 1514 | nmdc:mga03n38_234855_c1 | |||
| 1515 | nmdc:mga00v17_611_c1 | |||
| 1516 | nmdc:mga0yw44_16789_c1 | |||
| 1517 | nmdc:mga0yw44_2319_c1 | |||
| 1518 | nmdc:mga0yw44_24863_c1 | |||
| 1519 | nmdc:mga0yw44_55086_c1 | |||
| 1520 | nmdc:mga0yw44_60256_c1 | |||
| 1521 | nmdc:mga0k408_10280_c1 | |||
| 1522 | nmdc:mga06z11_12773_c1 | |||
| 1523 | nmdc:mga06z11_271014_c1 | |||
| 1524 | nmdc:mga06z11_36763_c1 | |||
| 1525 | nmdc:mga06z11_91619_c1 | |||
| 1526 | nmdc:mga04h51_13917_c1 | |||
| 1527 | nmdc:mga07m45_11183_c1 | |||
| 1528 | nmdc:mga0sz30_11473_c1 | |||
| 1529 | nmdc:mga0sz30_42457_c1 | |||
| 1530 | Ga0500610_0039841 | |||
| 1531 | Ga0500578_0035296 | |||
| 1532 | Ga0500578_0072312 | |||
| 1533 | Ga0500643_012418 | |||
| 1534 | Ga0500557_042031 | |||
| 1535 | Ga0500618_000203 | |||
| 1536 | Ga0500618_001739 | |||
| 1537 | Ga0500618_021138 | |||
| 1538 | Ga0500658_0009920 | |||
| 1539 | Ga0500561_0000139 | |||
| 1540 | Ga0500568_0001169 | |||
| 1541 | Ga0500568_0006185 | |||
| 1542 | Ga0500568_0053805 | |||
| 1543 | Ga0500577_0044998 | |||
| 1544 | Ga0500616_0007056 | |||
| 1545 | Ga0500616_0009183 | |||
| 1546 | Ga0500616_0070165 | |||
| 1547 | Ga0500616_0164888 | |||
| 1548 | Ga0500620_007279 | |||
| 1549 | Ga0500622_0009636 | |||
| 1550 | Ga0500624_002343 | |||
| 1551 | Ga0500627_0037793 | |||
| 1552 | Ga0500627_0055473 | |||
| 1553 | Ga0500634_0049682 | |||
| 1554 | Ga0500636_0000022 | |||
| 1555 | Ga0500636_0001307 | |||
| 1556 | 2996897599 | |||
| 1557 | 2509114670 | |||
| 1558 | 2509369674 | |||
| 1559 | 2509388994 | |||
| 1560 | 2509394771 | |||
| 1561 | 2509444584 | |||
| 1562 | 2510135669 | |||
| 1563 | 2510318629 | |||
| 1564 | 2510838861 | |||
| 1565 | 2510897142 | |||
| 1566 | 2511136857 | |||
| 1567 | 2511185326 | |||
| 1568 | 2511200522 | |||
| 1569 | 2512932689 | |||
| 1570 | 2512960746 | |||
| 1571 | 2513570830 | |||
| 1572 | 2513574955 | |||
| 1573 | 2513595613 | |||
| 1574 | 2513608777 | |||
| 1575 | 2513633739 | |||
| 1576 | 2513707586 | |||
| 1577 | 2513865362 | |||
| 1578 | 2513910998 | |||
| 1579 | 2513924306 | |||
| 1580 | 2514023680 | |||
| 1581 | 2515114833 | |||
| 1582 | 2515635810 | |||
| 1583 | 2515641424 | |||
| 1584 | 2515659313 | |||
| 1585 | 2515741182 | |||
| 1586 | 2517038451 | |||
| 1587 | 2517078727 | |||
| 1588 | 2517097469 | |||
| 1589 | 2517408925 | |||
| 1590 | 2520379181 | |||
| 1591 | 2523467759 | |||
| 1592 | 2524461871 | |||
| 1593 | 2530648344 | |||
| 1594 | 2535514574 | |||
| 1595 | 2537877273 | |||
| 1596 | 2554246169 | |||
| 1597 | 2559293392 | |||
| 1598 | 2585164442 | |||
| 1599 | 2585201281 | |||
| 1600 | 2585223259 | |||
| 1601 | 2585230949 | |||
| 1602 | 2585256424 | |||
| 1603 | 2585273458 | |||
| 1604 | 2585283170 | |||
| 1605 | 2585328201 | |||
| 1606 | 2585330613 | |||
| 1607 | 2585399100 | |||
| 1608 | 2585523958 | |||
| 1609 | 2585536018 | |||
| 1610 | 2585542102 | |||
| 1611 | 2585546145 | |||
| 1612 | 2585556654 | |||
| 1613 | 2585564014 | |||
| 1614 | 2585818750 | |||
| 1615 | 2585840688 | |||
| 1616 | 2585900316 | |||
| 1617 | 2585909278 | |||
| 1618 | 2587984620 | |||
| 1619 | 2588518775 | |||
| 1620 | 2597810915 | |||
| 1621 | 2599419736 | |||
| 1622 | 2599604276 | |||
| 1623 | 2599718716 | |||
| 1624 | 2599936522 | |||
| 1625 | 2601609588 | |||
| 1626 | 2601746363 | |||
| 1627 | 2616293961 | |||
| 1628 | 2616311187 | |||
| 1629 | 2616556079 | |||
| 1630 | 2617380722 | |||
| 1631 | 2643776674 | |||
| 1632 | 2643795122 | |||
| 1633 | 2643920549 | |||
| 1634 | 2643987466 | |||
| 1635 | 2644004417 | |||
| 1636 | 2644133877 | |||
| 1637 | 2644158014 | |||
| 1638 | 2644191215 | |||
| 1639 | 2644237665 | |||
| 1640 | 2644298211 | |||
| 1641 | 2644498800 | |||
| 1642 | 2644519642 | |||
| 1643 | 2644656463 | |||
| 1644 | 2671115836 | |||
| 1645 | 2688597107 | |||
| 1646 | 2694628810 | |||
| 1647 | 2694637276 | |||
| 1648 | 2719183332 | |||
| 1649 | 2719388092 | |||
| 1650 | 2719667715 | |||
| 1651 | 2719734049 | |||
| 1652 | 2720494135 | |||
| 1653 | 2720615598 | |||
| 1654 | 2720622381 | |||
| 1655 | 2720633735 | |||
| 1656 | 2720777435 | |||
| 1657 | 2721149444 | |||
| 1658 | 2721160847 | |||
| 1659 | 2721166281 | |||
| 1660 | 2721401725 | |||
| 1661 | 2722842451 | |||
| 1662 | 2723029032 | |||
| 1663 | 2723562649 | |||
| 1664 | 2723569342 | |||
| 1665 | 2724040539 | |||
| 1666 | 2724046805 | |||
| 1667 | 2724092042 | |||
| 1668 | 2724106607 | |||
| 1669 | 2724112415 | |||
| 1670 | 2725949667 | |||
| 1671 | 2730109968 | |||
| 1672 | 2730166567 | |||
| 1673 | 2730300479 | |||
| 1674 | 2738800769 | |||
| 1675 | 2739037351 | |||
| 1676 | 2739349209 | |||
| 1677 | 2756671181 | |||
| 1678 | 2766067161 | |||
| 1679 | 2776915980 | |||
| 1680 | 2778179507 | |||
| 1681 | 2792748138 | |||
| 1682 | 2793298460 | |||
| 1683 | 2793315700 | |||
| 1684 | 2793323483 | |||
| 1685 | 2793327571 | |||
| 1686 | 2793335642 | |||
| 1687 | 2793341036 | |||
| 1688 | 2793350287 | |||
| 1689 | 2793354772 | |||
| 1690 | 2793358531 | |||
| 1691 | 2793368983 | |||
| 1692 | 2805928907 | |||
| 1693 | 2805934528 | |||
| 1694 | 2806047078 | |||
| 1695 | 2806054923 | |||
| 1696 | 2806061849 | |||
| 1697 | 2806069628 | |||
| 1698 | 2806076001 | |||
| 1699 | 2808986839 | |||
| 1700 | 2819244208 | |||
| 1701 | 2819556911 | |||
| 1702 | 2819608880 | |||
| 1703 | 2819643305 | |||
| 1704 | 2819685822 | |||
| 1705 | 2821123231 | |||
| 1706 | 2837651500 | |||
| 1707 | 2837679257 | |||
| 1708 | 2838020942 | |||
| 1709 | 2838026845 | |||
| 1710 | 2838033955 | |||
| 1711 | 2838039731 | |||
| 1712 | 2838044856 | |||
| 1713 | 2838052909 | |||
| 1714 | 2838064702 | |||
| 1715 | 2838070521 | |||
| 1716 | 2838664009 | |||
| 1717 | 2838672531 | |||
| 1718 | 2838677647 | |||
| 1719 | 2838685584 | |||
| 1720 | 2838689840 | |||
| 1721 | 2838695960 | |||
| 1722 | 2838705146 | |||
| 1723 | 2838713359 | |||
| 1724 | 2838716536 | |||
| 1725 | 2838719664 | |||
| 1726 | 2838727287 | |||
| 1727 | 2838731464 | |||
| 1728 | 2838739746 | |||
| 1729 | 2838744405 | |||
| 1730 | 2841738025 | |||
| 1731 | 2841844130 | |||
| 1732 | 2841846595 | |||
| 1733 | 2841852945 | |||
| 1734 | 2841860876 | |||
| 1735 | 2841870210 | |||
| 1736 | 2842082593 | |||
| 1737 | 2842112748 | |||
| 1738 | 2842123848 | |||
| 1739 | 2842127376 | |||
| 1740 | 2842132540 | |||
| 1741 | 2842143851 | |||
| 1742 | 2842150140 | |||
| 1743 | 2842152291 | |||
| 1744 | 2842160272 | |||
| 1745 | 2842165750 | |||
| 1746 | 2842172782 | |||
| 1747 | 2842175910 | |||
| 1748 | 2842184062 | |||
| 1749 | 2842189644 | |||
| 1750 | 2842196364 | |||
| 1751 | 2842202438 | |||
| 1752 | 2842208910 | |||
| 1753 | 2842213958 | |||
| 1754 | 2842219426 | |||
| 1755 | 2842224424 | |||
| 1756 | 2842231644 | |||
| 1757 | 2842242903 | |||
| 1758 | 2842245887 | |||
| 1759 | 2842254826 | |||
| 1760 | 2842260265 | |||
| 1761 | 2842267153 | |||
| 1762 | 2842273676 | |||
| 1763 | 2842282400 | |||
| 1764 | 2842290060 | |||
| 1765 | 2842296976 | |||
| 1766 | 2842299937 | |||
| 1767 | 2842308472 | |||
| 1768 | 2842312224 | |||
| 1769 | 2842321818 | |||
| 1770 | 2842344656 | |||
| 1771 | 2842359541 | |||
| 1772 | 2842367769 | |||
| 1773 | 2842376030 | |||
| 1774 | 2842383240 | |||
| 1775 | 2842390373 | |||
| 1776 | 2842397841 | |||
| 1777 | 2842407670 | |||
| 1778 | 2842414301 | |||
| 1779 | 2842420839 | |||
| 1780 | 2842424135 | |||
| 1781 | 2842431151 | |||
| 1782 | 2842437486 | |||
| 1783 | 2842444301 | |||
| 1784 | 2842451272 | |||
| 1785 | 2842465294 | |||
| 1786 | 2842472237 | |||
| 1787 | 2842480701 | |||
| 1788 | 2842487255 | |||
| 1789 | 2842494108 | |||
| 1790 | 2842501247 | |||
| 1791 | 2842507256 | |||
| 1792 | 2842514530 | |||
| 1793 | 2842517661 | |||
| 1794 | 2844008825 | |||
| 1795 | 2844012463 | |||
| 1796 | 2844456588 | |||
| 1797 | 2847674926 | |||
| 1798 | 2852387864 | |||
| 1799 | 2856320645 | |||
| 1800 | 2856322952 | |||
| 1801 | 2856334727 | |||
| 1802 | 2856339617 | |||
| 1803 | 2856345883 | |||
| 1804 | 2856349430 | |||
| 1805 | 2856367940 | |||
| 1806 | 2857351937 | |||
| 1807 | 2857520884 | |||
| 1808 | 2857533817 | |||
| 1809 | 2869164779 | |||
| 1810 | 2869173043 | |||
| 1811 | 2869241470 | |||
| 1812 | 2869244879 | |||
| 1813 | 2869254131 | |||
| 1814 | 2869259748 | |||
| 1815 | 2869271105 | |||
| 1816 | 2869276576 | |||
| 1817 | 2869282504 | |||
| 1818 | 2869290441 | |||
| 1819 | 2871432725 | |||
| 1820 | 2871437390 | |||
| 1821 | 2871454229 | |||
| 1822 | 2871466490 | |||
| 1823 | 2871474301 | |||
| 1824 | 2871477418 | |||
| 1825 | 2871484905 | |||
| 1826 | 2871493335 | |||
| 1827 | 2871499075 | |||
| 1828 | 2874106505 | |||
| 1829 | 2874111837 | |||
| 1830 | 2874117156 | |||
| 1831 | 2874126707 | |||
| 1832 | 2874134939 | |||
| 1833 | 2874142159 | |||
| 1834 | 2874152692 | |||
| 1835 | 2874160092 | |||
| 1836 | 2874168095 | |||
| 1837 | 2874174925 | |||
| 1838 | 2876365059 | |||
| 1839 | 2876374434 | |||
| 1840 | 2876379857 | |||
| 1841 | 2876386761 | |||
| 1842 | 2876397913 | |||
| 1843 | 2876402721 | |||
| 1844 | 2876407866 | |||
| 1845 | 2876418608 | |||
| 1846 | 2876423015 | |||
| 1847 | 2878036052 | |||
| 1848 | 2878733980 | |||
| 1849 | 2878744655 | |||
| 1850 | 2878750339 | |||
| 1851 | 2878757379 | |||
| 1852 | 2878763274 | |||
| 1853 | 2878770262 | |||
| 1854 | 2878779744 | |||
| 1855 | 2878785281 | |||
| 1856 | 2878789503 | |||
| 1857 | 2881149806 | |||
| 1858 | 2881160951 | |||
| 1859 | 2881166691 | |||
| 1860 | 2881848451 | |||
| 1861 | 2881857243 | |||
| 1862 | 2881868938 | |||
| 1863 | 2882912660 | |||
| 1864 | 2885308210 | |||
| 1865 | 2885312981 | |||
| 1866 | 2885321870 | |||
| 1867 | 2885332741 | |||
| 1868 | 2885334613 | |||
| 1869 | 2885342853 | |||
| 1870 | 2885353513 | |||
| 1871 | 2888338186 | |||
| 1872 | 2888345782 | |||
| 1873 | 2888355042 | |||
| 1874 | 2891374796 | |||
| 1875 | 2899794299 | |||
| 1876 | 2899805886 | |||
| 1877 | 2899845679 | |||
| 1878 | 2903450069 | |||
| 1879 | 2903499993 | |||
| 1880 | 2903501107 | |||
| 1881 | 2903520815 | |||
| 1882 | 2903522206 | |||
| 1883 | 2903528584 | |||
| 1884 | 2903543877 | |||
| 1885 | 2904664564 | |||
| 1886 | 2906312697 | |||
| 1887 | 2906325406 | |||
| 1888 | 2906330790 | |||
| 1889 | 2906360034 | |||
| 1890 | 2906367501 | |||
| 1891 | 2906373657 | |||
| 1892 | 2906384463 | |||
| 1893 | 2906391219 | |||
| 1894 | 2906399469 | |||
| 1895 | 2906401458 | |||
| 1896 | 2906411007 | |||
| 1897 | 2906419906 | |||
| 1898 | 2906432720 | |||
| 1899 | 2919101862 | |||
| 1900 | 2919116753 | |||
| 1901 | 2919408328 | |||
| 1902 | 2922138713 | |||
| 1903 | 2922157139 | |||
| 1904 | 2922172874 | |||
| 1905 | 2922179713 | |||
| 1906 | 2922192928 | |||
| 1907 | 2923556181 | |||
| 1908 | 2924714854 | |||
| 1909 | 2924725453 | |||
| 1910 | 2924738036 | |||
| 1911 | 2924749758 | |||
| 1912 | 2924767074 | |||
| 1913 | 2924782685 | |||
| 1914 | 2924786685 | |||
| 1915 | 2926754763 | |||
| 1916 | 2926761931 | |||
| 1917 | 2929138880 | |||
| 1918 | 2933006938 | |||
| 1919 | 2933015472 | |||
| 1920 | 2933574921 | |||
| 1921 | 2933588363 | |||
| 1922 | 2933594141 | |||
| 1923 | 2933601326 | |||
| 1924 | 2935899978 | |||
| 1925 | 2935902325 | |||
| 1926 | 2936369541 | |||
| 1927 | 2936380282 | |||
| 1928 | 2936385261 | |||
| 1929 | 2937819158 | |||
| 1930 | 2937827704 | |||
| 1931 | 2937837329 | |||
| 1932 | 2937852167 | |||
| 1933 | 2937863095 | |||
| 1934 | 2937873092 | |||
| 1935 | 2937881330 | |||
| 1936 | 2937893357 | |||
| 1937 | 2937977422 | |||
| 1938 | 2937984508 | |||
| 1939 | 2937997726 | |||
| 1940 | 2958039286 | |||
| 1941 | 2958053084 | |||
| 1942 | 2958070482 | |||
| 1943 | 2958073918 | |||
| 1944 | 2958088113 | |||
| 1945 | 2958094120 | |||
| 1946 | 2958110099 | |||
| 1947 | 2958121086 | |||
| 1948 | 2958127419 | |||
| 1949 | 2958134829 | |||
| 1950 | 2958143081 | |||
| 1951 | 2958148863 | |||
| 1952 | 2958164469 | |||
| 1953 | 2958168199 | |||
| 1954 | 2958186391 | |||
| 1955 | 2961084890 | |||
| 1956 | 2961119563 | |||
| 1957 | 2961130872 | |||
| 1958 | 2961140618 | |||
| 1959 | 2961166665 | |||
| 1960 | 2961175292 | |||
| 1961 | 2961186024 | |||
| 1962 | 2963646514 | |||
| 1963 | 2965021488 | |||
| 1964 | 2965027482 | |||
| 1965 | 2965037944 | |||
| 1966 | 2965042159 | |||
| 1967 | 2965049605 | |||
| 1968 | 2965064599 | |||
| 1969 | 2965091980 | |||
| 1970 | 2965114393 | |||
| 1971 | 2967999707 | |||
| 1972 | 2968008065 | |||
| 1973 | 2968020611 | |||
| 1974 | 2968090684 | |||
| 1975 | 2968094664 | |||
| 1976 | 2968098042 | |||
| 1977 | 2968115818 | |||
| 1978 | 2968119182 | |||
| 1979 | 2968140370 | |||
| 1980 | 2968175070 | |||
| 1981 | 2970473908 | |||
| 1982 | 2970490569 | |||
| 1983 | 2970507880 | |||
| 1984 | 2970514364 | |||
| 1985 | 2970527254 | |||
| 1986 | 2970535922 | |||
| 1987 | 2970541874 | |||
| 1988 | 2970548545 | |||
| 1989 | 2970558119 | |||
| 1990 | 2970597113 | |||
| 1991 | 2970623537 | |||
| 1992 | 2970627662 | |||
| 1993 | 2977826538 | |||
| 1994 | 2977848485 | |||
| 1995 | 2977856009 | |||
| 1996 | 2977864440 | |||
| 1997 | 2977865066 | |||
| 1998 | 2977880146 | |||
| 1999 | 2977899149 | |||
| 2000 | 2977912292 | |||
| 2001 | 2977916494 | |||
| 2002 | 2977926138 | |||
| 2003 | 2977938052 | |||
| 2004 | 2977944893 | |||
| 2005 | 2977956074 | |||
| 2006 | 2977963302 | |||
| 2007 | 2977977942 | |||
| 2008 | 2977988620 | |||
| 2009 | 2979092802 | |||
| 2010 | 2979099809 | |||
| 2011 | 2979104774 | |||
| 2012 | 2979771804 | |||
| 2013 | 2979774721 | |||
| 2014 | 2979786486 | |||
| 2015 | 2979798947 | |||
| 2016 | 2979813064 | |||
| 2017 | 2984513426 | |||
| 2018 | 2984520206 | |||
| 2019 | 2984539502 | |||
| 2020 | 2984601729 | |||
| 2021 | 2987639121 | |||
| 2022 | 2987651163 | |||
| 2023 | 2987662677 | |||
| 2024 | 2987671560 | |||
| 2025 | 2987679866 | |||
| 2026 | 2989774544 | |||
| 2027 | 2989776831 | |||
| 2028 | 2996311896 | |||
| 2029 | 2996336884 | |||
| 2030 | 2996352771 | |||
| 2031 | 2996387326 | |||
| 2032 | 2996887968 | |||
| 2033 | 3004167502 | |||
| 2034 | 3004191727 | |||
| 2035 | 3004196234 | |||
| 2036 | 3004204636 | |||
| 2037 | 3004217921 | |||
| 2038 | 3004221031 | |||
| 2039 | 3004238621 | |||
| 2040 | 3004253093 | |||
| 2041 | 3004274057 | |||
| 2042 | 3004279453 | |||
| 2043 | 3004293411 | |||
| 2044 | 3004335901 | |||
| 2045 | 3005410635 | |||
| 2046 | 3005423299 | |||
| 2047 | 3005450096 | |||
| 2048 | 3005456332 | |||
| 2049 | 637075773 | |||
| 2050 | 639646068 | |||
| 2051 | 649871663 | |||
| 2052 | 650738628 | |||
| 2053 | 8003572174 | |||
| 2054 | 8004301519 | |||
| 2055 | 8004319265 | |||
| 2056 | 8004367006 | |||
| 2057 | 8004378954 | |||
| 2058 | 8004392647 | |||
| 2059 | 8004396203 | |||
| 2060 | 8004445985 | |||
| 2061 | 8004636501 | |||
| 2062 | 8004645254 | |||
| 2063 | 8004701560 | |||
| 2064 | 8004712161 | |||
| 2065 | 8004718956 | |||
| 2066 | 8005247886 | |||
| 2067 | 8005261466 | |||
| 2068 | 8005278294 | |||
| 2069 | 8005282672 | |||
| 2070 | 8005291648 | |||
| 2071 | 8005305479 | |||
| 2072 | 8005310255 | |||
| 2073 | 8005315626 | |||
| 2074 | 8005322495 | |||
| 2075 | 8005378098 | |||
| 2076 | 8005384108 | |||
| 2077 | 8005399614 | |||
| 2078 | 8005433793 | |||
| 2079 | 8005465529 | |||
| 2080 | 8005484467 | |||
| 2081 | 8005498112 | |||
| 2082 | 8005543234 | |||
| 2083 | 8005559979 | |||
| 2084 | 8005564527 | |||
| 2085 | 8005571213 | |||
| 2086 | 8005619321 | |||
| 2087 | 8005627886 | |||
| 2088 | 8005647387 | |||
| 2089 | 8005661545 | |||
| 2090 | 8005669520 | |||
| 2091 | 8005687457 | |||
| 2092 | 8005692769 | |||
| 2093 | 8005701457 | |||
| 2094 | 8018132537 | |||
| 2095 | 8018167603 | |||
| 2096 | 8018176616 | |||
| 2097 | 8023681268 | |||
| 2098 | 8024481901 | |||
| 2099 | 8024488591 | |||
| 2100 | 8024506337 | |||
| 2101 | 8046768681 | |||
| 2102 | 8054463958 | |||
| 2103 | 8055619338 | |||
| 2104 | 8056381186 | |||
| 2105 | 8056382679 | |||
| 2106 | 8056878653 | |||
| 2107 | 8057582456 | |||
| 2108 | 8057878697 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yqq-assembly1.cif.gz_A | escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene | 0.8424 | 2 | 248 |
| 3odg-assembly1.cif.gz_A-3 | crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis | 0.8359 | 2 | 249 |
| 8swt-assembly1.cif.gz_A | structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate | 0.8316 | 2 | 248 |
| 4m1e-assembly1.cif.gz_B | crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. | 0.8264 | 2 | 245 |
| 1fxu-assembly1.cif.gz_A | purine nucleoside phosphorylase from calf spleen in complex with n(7)-acycloguanosine inhibitor and a phosphate ion | 0.8241 | 2 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yqqA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8424 | 2 | 248 | 3.40.50.1580 |
| 1yqqA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8204 | 2 | 248 | 3.40.50.1580 |
| af_U4PSA1_35_317_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8183 | 2 | 248 | 3.40.50.1580 |
| af_A0A1D8PJL8_4_307_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8151 | 2 | 248 | 3.40.50.1580 |
| 1td1C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8107 | 2 | 247 | 3.40.50.1580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527GD43-F1-model_v4 | Purine-nucleoside phosphorylase | 0.9849 | 1 | 111 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A527GD43-F1-model_v4 | Purine-nucleoside phosphorylase | 0.9762 | 1 | 111 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A536QTZ5-F1-model_v4 | purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9576 | 1 | 128 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A2T3XJJ4-F1-model_v4 | purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9557 | 2 | 124 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A358PKT2-F1-model_v4 | purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.955 | 2 | 124 |
GO:0004731
GO:0005737 GO:0009116 |