F489143

General Info

Members Datasets Scaffolds Average Seq Length
1055 723 717 103

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1019435|JGI24736J21556_10194352
Length 110
Sequence MRLSVDMIENELFKALADPTRRAIFEKLASGSMNASALRDGMKISQPAMSQHLAVLRTARLVREERQGRFVNYEVDPEGLALIATWLTKYRAYWPARIDALKILLKDMDQ

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
16 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
17 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
18 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
19 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
20 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
21 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
22 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
23 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
24 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
25 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
26 2519899620 Rhizobium sp. Pop5 Isolate Nodule
27 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
30 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
31 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
32 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
33 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
34 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
35 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
36 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
37 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
38 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
39 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
40 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
41 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
42 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
43 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
44 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
45 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
46 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
47 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
48 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
49 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
50 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
51 2643221582 Rhizobium sp. Root651 Isolate Unclassified
52 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
53 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
54 2643221734 Bosea sp. Root670 Isolate Unclassified
55 2643221736 Bosea sp. Root483D1 Isolate Unclassified
56 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
57 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
58 2718217882 Rhizobium sp. N741 Isolate Nodule
59 2718217927 Rhizobium sp. N324 Isolate Nodule
60 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
61 2718218009 Rhizobium sp. N561 Isolate Nodule
62 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
63 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
64 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
65 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
66 2718218363 Rhizobium sp. N113 Isolate Nodule
67 2718218365 Rhizobium sp. N731 Isolate Nodule
68 2718218366 Rhizobium sp. N621 Isolate Nodule
69 2718218423 Rhizobium sp. N941 Isolate Nodule
70 2721755514 Rhizobium sp. N6212 Isolate Nodule
71 2721755523 Delftia sp. HK171 Isolate Unclassified
72 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
73 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
74 2721755809 Rhizobium sp. N541 Isolate Nodule
75 2721755810 Rhizobium sp. N871 Isolate Nodule
76 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
77 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
78 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
79 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
80 2728369365 Rhizobium sp. N1341 Isolate Nodule
81 2728369397 Rhizobium sp. N1314 Isolate Nodule
82 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
83 2791355256 Rhizobium sp. M10 Isolate Nodule
84 2791355261 Rhizobium sp. J15 Isolate Nodule
85 2791355262 Rhizobium sp. M1 Isolate Nodule
86 2791355264 Rhizobium sp. S9 Isolate Nodule
87 2791355265 Rhizobium sp. H4 Isolate Nodule
88 2791355266 Rhizobium sp. L43 Isolate Nodule
89 2791355267 Rhizobium sp. L18 Isolate Nodule
90 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
91 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
92 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
93 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
94 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
95 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
96 2802429633 Rhizobium anhuiense J3 Isolate Nodule
97 2802429634 Rhizobium anhuiense S10 Isolate Nodule
98 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
99 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
100 2802429637 Rhizobium anhuiense C15 Isolate Nodule
101 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
102 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
103 2818991467 Bosea vestrisii 3192 Isolate Unclassified
104 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
105 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
106 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
107 2838048938 Rhizobium pisi 27/80 Isolate Nodule
108 2838061910 Rhizobium phaseoli L15 Isolate Nodule
109 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
110 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
111 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
112 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
113 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
114 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
115 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
116 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
117 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
118 2841760612 Bosea sp. Tri-49 Isolate Nodule
119 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
120 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
121 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
122 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
123 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
124 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
125 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
126 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
127 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
128 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
129 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
130 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
131 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
132 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
133 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
134 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
135 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
136 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
137 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
138 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
139 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
140 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
141 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
142 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
143 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
144 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
145 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
146 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
147 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
148 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
149 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
150 2844104063 Bosea sp. Tri-39 Isolate Nodule
151 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
152 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
153 2851182111 Bosea sp. Tri-44 Isolate Nodule
154 2851246043 Bosea sp. Tri-54 Isolate Nodule
155 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
156 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
157 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
158 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
159 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
160 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
161 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
162 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
163 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
164 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
165 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
166 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
167 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
168 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
169 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
170 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
171 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
172 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
173 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
174 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
175 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
176 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
177 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
178 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
179 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
180 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
181 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
182 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
183 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
184 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
185 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
186 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
187 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
188 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
189 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
190 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
191 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
192 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
193 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
194 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
195 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
196 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
197 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
198 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
199 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
200 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
201 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
202 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
203 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
204 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
205 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
206 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
207 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
208 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
209 2922368715
210 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
211 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
212 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
213 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
214 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
215 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
216 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
217 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
218 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
219 2933599457 Rhizobium phaseoli M3 Isolate Nodule
220 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
221 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
222 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
223 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
224 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
225 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
226 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
227 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
228 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
229 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
230 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
231 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
232 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
233 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
234 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
235 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
236 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
237 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
238 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
239 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
240 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
241 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
242 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
243 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
244 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
245 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
246 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
247 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
248 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
249 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
250 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
251 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
252 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
253 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
254 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
255 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
256 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
257 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
258 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
259 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
260 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
261 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
262 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
263 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
264 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
265 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
266 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
267 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
268 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
269 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
270 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
271 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
272 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
273 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
274 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
275 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
276 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
277 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
278 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
279 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
280 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
281 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
282 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
283 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
284 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
285 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
286 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
287 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
288 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
289 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
290 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
291 2996893221 Rhizobium sp. R635 Isolate Nodule
292 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
293 3004167301 Mesorhizobium loti 582 Isolate Unclassified
294 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
295 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
296 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
297 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
298 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
299 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
300 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
301 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
302 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
303 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
304 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
305 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
306 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
307 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
308 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
309 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
310 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
311 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
312 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
313 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
314 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
315 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
316 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
317 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
318 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
319 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
320 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
321 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
322 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
323 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
324 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
325 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
326 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
327 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
328 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
329 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
330 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
331 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
332 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
333 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
334 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
335 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
336 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
337 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
338 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
339 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
340 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
341 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
342 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
343 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
344 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
345 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
346 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
347 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
348 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
349 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
350 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
351 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
352 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
353 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
354 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
355 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
356 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
357 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
358 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
359 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
360 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
361 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
362 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
363 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
364 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
365 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
366 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
367 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
368 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
369 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
370 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
371 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
372 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
373 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
374 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
375 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
376 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
377 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
378 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
379 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
380 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
381 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
382 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
383 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
384 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
385 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
386 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
387 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
388 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
389 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
390 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
391 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
392 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
393 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
394 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
395 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
396 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
397 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
398 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
399 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
400 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
401 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
402 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
403 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
404 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
406 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
407 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
408 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
409 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
410 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
411 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
412 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
413 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
414 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
415 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
417 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
418 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
419 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
421 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
422 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
423 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
425 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
426 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
428 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
467 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
468 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
469 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
470 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
472 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
473 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
474 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
475 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
476 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
477 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
478 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
479 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
480 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
481 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
482 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
483 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
484 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
485 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
486 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
487 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
488 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
489 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
490 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
491 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
492 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
493 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
494 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
495 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
496 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
497 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
498 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
499 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
500 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
501 3300041493 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaT Metatranscriptome Unclassified
502 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
503 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
504 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
505 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
506 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
507 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
508 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
509 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
510 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
511 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
512 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
513 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
514 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
515 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
516 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
517 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
518 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
519 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
520 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
521 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
522 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
523 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
524 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
525 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
526 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
527 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
528 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
529 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
530 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
531 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
532 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
533 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
534 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
535 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
536 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
537 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
538 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
539 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
540 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
541 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
542 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
543 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
544 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
545 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
546 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
547 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
548 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
549 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
550 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
551 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
552 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
553 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
554 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
555 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
556 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
557 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
558 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
559 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
560 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
561 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
562 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
563 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
564 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
565 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
566 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
567 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
568 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
569 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
570 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
571 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
572 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
573 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
574 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
575 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
576 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
577 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
578 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
579 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
580 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
581 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
582 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
583 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
584 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
585 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
586 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
587 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
588 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
589 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
590 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
591 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
592 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
593 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
594 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
595 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
596 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
597 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
598 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
599 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
600 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
601 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
602 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
603 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
604 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
605 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
606 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
607 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
608 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
609 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
610 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
611 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
612 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
613 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
614 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
615 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
616 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
617 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
618 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
619 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
620 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
622 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
623 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
624 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
625 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
627 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
630 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
631 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
632 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
633 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
634 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
635 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
636 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
637 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
638 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
639 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
640 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
641 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
642 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
643 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
644 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
645 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
646 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
647 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
648 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
649 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
650 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
651 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
652 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
653 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
654 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
655 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
656 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
657 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
658 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
659 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
660 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
661 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
662 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
663 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
664 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
665 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
666 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
667 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
668 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
669 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
670 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
671 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
672 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
673 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
674 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
675 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
676 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
677 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
678 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
679 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
680 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
681 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
682 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
683 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
684 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
685 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
686 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
687 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
688 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
689 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
690 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
691 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
692 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
693 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
694 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
695 8005275841 Rhizobium sp. N4311 Isolate Nodule
696 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
697 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
698 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
699 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
700 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
701 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
702 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
703 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
704 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
705 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
706 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
707 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
708 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
709 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
710 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
711 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
712 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
713 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
714 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
715 8018176218 Rhizobium sp. N122 Isolate Nodule
716 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
717 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
718 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
719 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
720 8056382006 Rhizobium croatiense 13T Isolate Nodule
721 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
722 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
723 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.36
Metatranscriptomes 0.66
Isolates 31.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.77
Nodule 27.49
Rhizoplane 2.75
Rhizosphere 39.91
Stem 0
Stem Tuber 0
Unclassified 11.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1019435 3300001904 Bacteria 1072
2 JGI24741J21665_1005468 3300001915 Bacteria 2645
3 JGI24740J21852_10026115 3300001979 Bacteria 1960
4 JGI24739J22299_10016293 3300001989 Bacteria 2692
5 JGI24737J22298_10004864 3300001990 Bacteria 4658
6 JGI24735J21928_10042336 3300002067 Bacteria 1326
7 JGI25162J39368_1003498 3300002737 Bacteria 4477
8 JGI25150J39212_1020269 3300002774 Bacteria 1028
9 JGI25159J45721_1000251 3300002987 Bacteria 25319
10 JGI25159J45721_1007150 3300002987 Bacteria 3238
11 JGI25151J46595_10001922 3300003187 Bacteria 13173
12 JGI25151J46595_10050591 3300003187 Bacteria 1414
13 JGI25165J46597_1000087 3300003214 Bacteria 170335
14 JGI25165J46597_1000139 3300003214 Bacteria 121216
15 JGI25165J46597_1000692 3300003214 Bacteria 26996
16 JGI25165J46597_1000752 3300003214 Bacteria 24944
17 JGI25165J46597_1001515 3300003214 Bacteria 11760
18 JGI25165J46597_1003764 3300003214 Bacteria 3573
19 JGI25153J46596_10000006 3300003215 Bacteria 447760
20 JGI25153J46596_10003398 3300003215 Bacteria 8924
21 JGI25153J46596_10010091 3300003215 Bacteria 4308
22 rootH1_10065014 3300003316 Bacteria 1398
23 rootH2_10034256 3300003320 Bacteria 1662
24 rootH2_10198485 3300003320 Bacteria 1295
25 rootH2_10202360 3300003320 Bacteria 1071
26 rootL2_10229689 3300003322 Bacteria 1979
27 rootH1_10187912 3300003323 Bacteria 1043
28 JGI25160J50197_1000001 3300003354 Bacteria 782301
29 JGI25160J50197_1001226 3300003354 Bacteria 13015
30 JGI25161J50226_1000001 3300003374 Bacteria 655036
31 Ga0006562J51391_1088000 3300003578 Bacteria 1810
32 Ga0055539_1025621 3300003752 Bacteria 686
33 Ga0055525_1000051 3300003759 Bacteria 240942
34 Ga0055542_1000020 3300003762 Bacteria 335745
35 Ga0055529_1000016 3300003763 Bacteria 364775
36 Ga0055526_1002636 3300003771 Bacteria 11984
37 Ga0055526_1013393 3300003771 Bacteria 3475
38 Ga0055526_1016661 3300003771 Bacteria 2859
39 Ga0055524_1001569 3300003775 Bacteria 12844
40 Ga0055524_1004990 3300003775 Bacteria 6011
41 Ga0055524_1011324 3300003775 Bacteria 3497
42 Ga0055524_1020763 3300003775 Bacteria 2201
43 Ga0055524_1045016 3300003775 Bacteria 1066
44 Ga0055528_1001064 3300003790 Bacteria 18132
45 Ga0055528_1005906 3300003790 Bacteria 5615
46 Ga0055528_1012070 3300003790 Bacteria 3381
47 Ga0055528_1022562 3300003790 Bacteria 1955
48 Ga0055540_1000197 3300003792 Bacteria 58449
49 Ga0055531_10039751 3300003794 Bacteria 1391
50 Ga0055543_1000089 3300004625 Bacteria 79924
51 Ga0055543_1000731 3300004625 Bacteria 16676
52 Ga0065165_1000008 3300005262 Bacteria 334429
53 Ga0065165_1000234 3300005262 Bacteria 96709
54 Ga0070658_10001558 3300005327 Bacteria 19439
55 Ga0070670_100478173 3300005331 Bacteria 1106
56 Ga0070660_100414672 3300005339 Bacteria 1115
57 Ga0070660_100528992 3300005339 Bacteria 982
58 Ga0070661_100061766 3300005344 Bacteria 2750
59 Ga0070661_100261681 3300005344 Bacteria 1338
60 Ga0070668_101038576 3300005347 Bacteria 738
61 Ga0070674_100047027 3300005356 Bacteria 2954
62 Ga0070659_100033678 3300005366 Bacteria 3981
63 Ga0070667_100194333 3300005367 Bacteria 1798
64 Ga0070667_100391516 3300005367 Bacteria 1264
65 Ga0070667_101003073 3300005367 Bacteria 779
66 Ga0070667_101101835 3300005367 Bacteria 742
67 Ga0070714_100022342 3300005435 Bacteria 5187
68 Ga0070700_102012017 3300005441 Bacteria 501
69 Ga0070663_101588758 3300005455 Bacteria 583
70 Ga0068867_100819322 3300005459 Bacteria 832
71 Ga0070679_100344403 3300005530 Bacteria 1438
72 Ga0068853_100071337 3300005539 Bacteria 3025
73 Ga0068853_100755317 3300005539 Bacteria 929
74 Ga0068853_101858919 3300005539 Bacteria 584
75 Ga0068853_102423834 3300005539 Bacteria 508
76 Ga0068853_102447775 3300005539 Bacteria 505
77 Ga0068853_102447776 3300005539 Bacteria 505
78 Ga0070672_100100895 3300005543 Bacteria 2341
79 Ga0070672_100927183 3300005543 Bacteria 770
80 Ga0070693_100840624 3300005547 Bacteria 683
81 Ga0070665_100000086 3300005548 Bacteria 178229
82 Ga0070665_100453703 3300005548 Bacteria 1292
83 Ga0068855_100412289 3300005563 Bacteria 1479
84 Ga0068855_100796856 3300005563 Bacteria 1004
85 Ga0070664_100056015 3300005564 Bacteria 3349
86 Ga0068857_100058913 3300005577 Bacteria 3411
87 Ga0068857_101087689 3300005577 Bacteria 772
88 Ga0068857_101811327 3300005577 Bacteria 597
89 Ga0068854_100999820 3300005578 Bacteria 740
90 Ga0068856_100480168 3300005614 Bacteria 1264
91 Ga0068856_101095222 3300005614 Bacteria 814
92 Ga0068852_100034890 3300005616 Bacteria 4190
93 Ga0068859_100351370 3300005617 Bacteria 1569
94 Ga0068851_10099165 3300005834 Bacteria 1543
95 Ga0068851_10476373 3300005834 Bacteria 745
96 Ga0068863_100074721 3300005841 Bacteria 3207
97 Ga0068863_100694677 3300005841 Bacteria 1011
98 Ga0068863_101601979 3300005841 Bacteria 660
99 Ga0068858_100461630 3300005842 Bacteria 1225
100 Ga0081540_1023244 3300005983 Bacteria 3632
101 Ga0081540_1197978 3300005983 Bacteria 733
102 Ga0070717_10385067 3300006028 Bacteria 1258
103 Ga0075368_10010589 3300006042 Bacteria 3338
104 Ga0075363_100072096 3300006048 Bacteria 1878
105 Ga0075363_100082230 3300006048 Bacteria 1762
106 Ga0075363_100836283 3300006048 Bacteria 561
107 Ga0070712_101499456 3300006175 Bacteria 589
108 Ga0075362_10015882 3300006177 Bacteria 3071
109 Ga0075362_10031824 3300006177 Bacteria 2286
110 Ga0075367_10011682 3300006178 Bacteria 4658
111 Ga0075367_10033196 3300006178 Bacteria 2974
112 Ga0075367_10038940 3300006178 Bacteria 2770
113 Ga0075367_10081850 3300006178 Bacteria 1954
114 Ga0075367_10101895 3300006178 Bacteria 1756
115 Ga0075367_10867946 3300006178 Bacteria 575
116 Ga0075369_10010802 3300006186 Bacteria 3577
117 Ga0075369_10327361 3300006186 Bacteria 717
118 Ga0075369_10513602 3300006186 Bacteria 570
119 Ga0075369_10643385 3300006186 Bacteria 509
120 Ga0075366_10070203 3300006195 Bacteria 2086
121 Ga0075366_10089398 3300006195 Bacteria 1845
122 Ga0075366_10095246 3300006195 Bacteria 1785
123 Ga0075366_10126059 3300006195 Bacteria 1544
124 Ga0075370_10027638 3300006353 Bacteria 3149
125 Ga0075370_10047574 3300006353 Bacteria 2429
126 Ga0075370_10055900 3300006353 Bacteria 2242
127 Ga0075370_10367944 3300006353 Bacteria 860
128 Ga0097620_100351368 3300006931 Bacteria 1569
129 Ga0079104_1014976 3300006946 Bacteria 2318
130 Ga0105251_10000369 3300009011 Bacteria 44159
131 Ga0105250_10491127 3300009092 Bacteria 556
132 Ga0105240_10000014 3300009093 Bacteria 482033
133 Ga0105240_11353322 3300009093 Bacteria 749
134 Ga0105240_11387494 3300009093 Bacteria 739
135 Ga0105247_10148108 3300009101 Bacteria 1544
136 Ga0105247_10735451 3300009101 Bacteria 746
137 Ga0105243_10000876 3300009148 Bacteria 28409
138 Ga0105243_10712602 3300009148 Bacteria 980
139 Ga0105241_10000002 3300009174 Bacteria 869480
140 Ga0105241_10005567 3300009174 Bacteria 9302
141 Ga0105241_10931017 3300009174 Bacteria 809
142 Ga0105241_11959877 3300009174 Bacteria 575
143 Ga0105241_12286651 3300009174 Bacteria 538
144 Ga0105248_10172269 3300009177 Bacteria 2440
145 Ga0105248_11014793 3300009177 Bacteria 937
146 Ga0105237_10003649 3300009545 Bacteria 18153
147 Ga0105237_10375797 3300009545 Bacteria 1426
148 Ga0105237_10796418 3300009545 Bacteria 952
149 Ga0105238_10636913 3300009551 Bacteria 1076
150 Ga0123340_1037936 3300009763 Bacteria 2422
151 Ga0123341_1049312 3300009765 Bacteria 2426
152 Ga0105029_100323 3300009984 Bacteria 2495
153 Ga0105239_10052947 3300010375 Bacteria 4452
154 Ga0105239_10354527 3300010375 Bacteria 1656
155 Ga0105239_11065166 3300010375 Bacteria 930
156 Ga0105246_10316872 3300011119 Bacteria 1266
157 Ga0105246_10455501 3300011119 Bacteria 1076
158 Ga0105246_11567229 3300011119 Bacteria 621
159 Ga0157313_1057172 3300012503 Bacteria 524
160 Ga0157324_1001390 3300012506 Bacteria 1329
161 Ga0157326_1005515 3300012513 Bacteria 1340
162 Ga0157373_10013901 3300013100 Bacteria 5903
163 Ga0157373_10277869 3300013100 Bacteria 1186
164 Ga0157373_10771616 3300013100 Bacteria 707
165 Ga0157373_10841490 3300013100 Bacteria 678
166 Ga0157371_10000030 3300013102 Bacteria 241585
167 Ga0157371_11060191 3300013102 Bacteria 620
168 Ga0157370_10002430 3300013104 Bacteria 22453
169 Ga0157370_12060347 3300013104 Bacteria 511
170 Ga0171462_1035 3300013250 Bacteria 84676
171 Ga0157374_10486250 3300013296 Bacteria 1238
172 Ga0157378_10088835 3300013297 Bacteria 2805
173 Ga0157378_10929244 3300013297 Bacteria 902
174 Ga0163162_10352820 3300013306 Bacteria 1603
175 Ga0157372_10438607 3300013307 Bacteria 1522
176 Ga0157375_11105277 3300013308 Bacteria 928
177 Ga0157375_12081801 3300013308 Bacteria 675
178 Ga0163163_10442110 3300014325 Bacteria 1360
179 Ga0157380_12305627 3300014326 Bacteria 603
180 Ga0182008_10023137 3300014497 Bacteria 3177
181 Ga0182008_10307180 3300014497 Bacteria 831
182 Ga0182007_10002682 3300015262 Bacteria 8718
183 Ga0182005_1005275 3300015265 Bacteria 4053
184 Ga0163161_10040465 3300017792 Bacteria 3348
185 Ga0228711_1000004 3300022739 Bacteria 250146
186 Ga0228710_1000002 3300022740 Bacteria 287279
187 Ga0209436_117339 3300025208 Bacteria 1056
188 Ga0209672_104167 3300025228 Bacteria 2754
189 Ga0209563_100019 3300025230 Bacteria 697828
190 Ga0207427_111812 3300025231 Bacteria 881
191 Ga0209437_100058 3300025233 Bacteria 357279
192 Ga0209437_100060 3300025233 Bacteria 355034
193 Ga0207425_1004668 3300025245 Bacteria 4050
194 Ga0209646_1004682 3300025246 Bacteria 2467
195 Ga0209646_1004880 3300025246 Bacteria 2402
196 Ga0209026_1020525 3300025250 Bacteria 1026
197 Ga0209026_1034944 3300025250 Bacteria 739
198 Ga0209677_100453 3300025253 Bacteria 23786
199 Ga0209148_1000017 3300025254 Bacteria 787064
200 Ga0209148_1012535 3300025254 Bacteria 1547
201 Ga0209129_1002947 3300025258 Bacteria 7777
202 Ga0209233_1000027 3300025261 Bacteria 652089
203 Ga0209233_1000137 3300025261 Bacteria 200314
204 Ga0209233_1000149 3300025261 Bacteria 181183
205 Ga0209233_1000160 3300025261 Bacteria 159035
206 Ga0209233_1002488 3300025261 Bacteria 6751
207 Ga0209455_1000005 3300025272 Bacteria 1416756
208 Ga0209455_1021243 3300025272 Bacteria 1265
209 Ga0209455_1033495 3300025272 Bacteria 843
210 Ga0209673_1000015 3300025273 Bacteria 530618
211 Ga0209673_1000444 3300025273 Bacteria 71044
212 Ga0209673_1000632 3300025273 Bacteria 53357
213 Ga0209673_1006484 3300025273 Bacteria 5642
214 Ga0209130_1000003 3300025284 Bacteria 677988
215 Ga0209130_1000279 3300025284 Bacteria 63145
216 Ga0209675_1020739 3300025291 Bacteria 1772
217 Ga0209676_1114489 3300025292 Bacteria 551
218 Ga0209025_1000082 3300025294 Bacteria 265613
219 Ga0209025_1000777 3300025294 Bacteria 52804
220 Ga0209025_1002215 3300025294 Bacteria 21453
221 Ga0209025_1017766 3300025294 Bacteria 4082
222 Ga0209564_1000128 3300025295 Bacteria 196532
223 Ga0209564_1000167 3300025295 Bacteria 159653
224 Ga0209564_1013250 3300025295 Bacteria 3522
225 Ga0209564_1021534 3300025295 Bacteria 2314
226 Ga0209758_1000001 3300025297 Bacteria 1981790
227 Ga0209758_1001112 3300025297 Bacteria 34604
228 Ga0209758_1004666 3300025297 Bacteria 11205
229 Ga0209050_1007726 3300025298 Bacteria 5936
230 Ga0209256_1000511 3300025299 Bacteria 57006
231 Ga0209256_1000698 3300025299 Bacteria 44613
232 Ga0209256_1000779 3300025299 Bacteria 41192
233 Ga0209256_1004380 3300025299 Bacteria 8921
234 Ga0209256_1044567 3300025299 Bacteria 1107
235 Ga0209256_1074329 3300025299 Bacteria 756
236 Ga0209256_1075637 3300025299 Bacteria 747
237 Ga0207426_1000011 3300025302 Bacteria 791203
238 Ga0207426_1000228 3300025302 Bacteria 129261
239 Ga0207426_1008474 3300025302 Bacteria 4147
240 Ga0209051_1000119 3300025303 Bacteria 148746
241 Ga0209051_1083750 3300025303 Bacteria 910
242 Ga0209257_1003041 3300025304 Bacteria 15130
243 Ga0207656_10068624 3300025321 Bacteria 1571
244 Ga0207656_10257658 3300025321 Bacteria 856
245 Ga0207713_1000433 3300025735 Bacteria 44170
246 Ga0207710_10129073 3300025900 Bacteria 1213
247 Ga0207710_10396137 3300025900 Bacteria 708
248 Ga0207688_10047044 3300025901 Bacteria 2409
249 Ga0207647_10007295 3300025904 Bacteria 8002
250 Ga0207645_10150696 3300025907 Bacteria 1518
251 Ga0207645_10524065 3300025907 Bacteria 803
252 Ga0207705_10000531 3300025909 Bacteria 32288
253 Ga0207654_10000005 3300025911 Bacteria 869492
254 Ga0207654_10000190 3300025911 Bacteria 37976
255 Ga0207695_10000037 3300025913 Bacteria 476303
256 Ga0207695_10651274 3300025913 Bacteria 934
257 Ga0207695_11612158 3300025913 Bacteria 530
258 Ga0207671_10001017 3300025914 Bacteria 34299
259 Ga0207671_10003175 3300025914 Bacteria 16591
260 Ga0207671_11229286 3300025914 Bacteria 585
261 Ga0207660_10768349 3300025917 Bacteria 786
262 Ga0207657_10250007 3300025919 Bacteria 1413
263 Ga0207657_11378601 3300025919 Bacteria 530
264 Ga0207649_10011496 3300025920 Bacteria 4882
265 Ga0207649_10187635 3300025920 Bacteria 1452
266 Ga0207652_10100447 3300025921 Bacteria 2554
267 Ga0207694_10014797 3300025924 Bacteria 5883
268 Ga0207650_10436379 3300025925 Bacteria 1088
269 Ga0207659_11630568 3300025926 Bacteria 550
270 Ga0207664_10017789 3300025929 Bacteria 5222
271 Ga0207644_10584291 3300025931 Bacteria 927
272 Ga0207690_10001685 3300025932 Bacteria 13618
273 Ga0207690_10230593 3300025932 Bacteria 1421
274 Ga0207706_10032436 3300025933 Bacteria 4652
275 Ga0207709_10000031 3300025935 Bacteria 329046
276 Ga0207669_10023094 3300025937 Bacteria 3315
277 Ga0207691_10123391 3300025940 Bacteria 2293
278 Ga0207711_11245183 3300025941 Bacteria 686
279 Ga0207667_10000004 3300025949 Bacteria 737718
280 Ga0207667_10374174 3300025949 Bacteria 1452
281 Ga0207667_10391968 3300025949 Bacteria 1414
282 Ga0207668_10201866 3300025972 Bacteria 1584
283 Ga0207640_10158806 3300025981 Bacteria 1670
284 Ga0207658_10178336 3300025986 Bacteria 1756
285 Ga0207639_10687954 3300026041 Bacteria 948
286 Ga0207639_11146090 3300026041 Bacteria 729
287 Ga0207678_10025795 3300026067 Bacteria 5130
288 Ga0207702_10000642 3300026078 Bacteria 38293
289 Ga0207702_10405162 3300026078 Bacteria 1316
290 Ga0207702_10911743 3300026078 Bacteria 871
291 Ga0207641_11131398 3300026088 Bacteria 782
292 Ga0207648_11612513 3300026089 Bacteria 610
293 Ga0207674_10039054 3300026116 Bacteria 4923
294 Ga0207674_10049988 3300026116 Bacteria 4274
295 Ga0207674_11681763 3300026116 Bacteria 603
296 Ga0207675_100430439 3300026118 Bacteria 1304
297 Ga0207683_10590757 3300026121 Bacteria 1027
298 Ga0207698_10098344 3300026142 Bacteria 2418
299 Ga0209281_1000027 3300027111 Bacteria 463409
300 Ga0209281_1000030 3300027111 Bacteria 425931
301 Ga0209281_1005132 3300027111 Bacteria 3708
302 Ga0209371_1003138 3300027312 Bacteria 8395
303 Ga0209371_1005523 3300027312 Bacteria 4990
304 Ga0209282_1000004 3300027666 Bacteria 425931
305 Ga0209813_10189206 3300027866 Bacteria 757
306 Ga0268266_10000002 3300028379 Bacteria 3059047
307 Ga0268266_10062390 3300028379 Bacteria 3217
308 Ga0307517_10035306 3300028786 Bacteria 5665
309 Ga0307515_10211918 3300028794 Bacteria 1779
310 Ga0307515_10278783 3300028794 Bacteria 1382
311 Ga0268256_1003000 3300030500 Bacteria 7971
312 Ga0268256_1005446 3300030500 Bacteria 4990
313 Ga0265316_10943025 3300031344 Bacteria 602
314 Ga0307513_10057611 3300031456 Bacteria 4137
315 Ga0307513_10121454 3300031456 Bacteria 2579
316 Ga0307408_101356032 3300031548 Bacteria 668
317 Ga0315914_1000001 3300031967 Bacteria 416633
318 Ga0307416_103218961 3300032002 Bacteria 546
319 Ga0307510_10000011 3300033180 Bacteria 355464
320 Ga0307510_10079312 3300033180 Bacteria 3203
321 Ga0315913_1000004 3300033430 Bacteria 192741
322 Ga0315915_1000002 3300033464 Bacteria 425854
323 Ga0395899_0000124 3300037312 Bacteria 122011
324 Ga0395899_0175133 3300037312 Bacteria 1509
325 Ga0395900_0000086 3300037418 Bacteria 171749
326 Ga0395900_0174189 3300037418 Bacteria 2189
327 Ga0395898_0000285 3300037466 Bacteria 122279
328 Ga0395898_0153809 3300037466 Bacteria 2201
329 Ga0395905_0000133 3300037471 Bacteria 123500
330 Ga0395905_0000708 3300037471 Bacteria 44246
331 Ga0395905_0052156 3300037471 Bacteria 3830
332 Ga0395905_0716144 3300037471 Bacteria 903
333 Ga0436364_1037496 3300037853 Bacteria 833
334 Ga0395901_0000092 3300038443 Bacteria 121976
335 Ga0395901_0231252 3300038443 Bacteria 1930
336 Ga0395901_0874728 3300038443 Bacteria 882
337 Ga0439436_0208714 3300041404 Bacteria 560
338 Ga0439439_0022183 3300041406 Bacteria 1585
339 Ga0439466_0054777 3300041411 Bacteria 1298
340 Ga0439465_0004865 3300041413 Bacteria 4318
341 Ga0451787_009036 3300041441 Bacteria 805
342 Ga0451789_0480782 3300041443 Bacteria 692
343 Ga0451789_1300095 3300041443 Bacteria 2032
344 Ga0451789_1366789 3300041443 Bacteria 518
345 Ga0451791_1927112 3300041451 Bacteria 1141
346 Ga0451793_1189160 3300041452 Bacteria 705
347 Ga0451793_1769180 3300041452 Bacteria 924
348 Ga0451797_0233108 3300041453 Bacteria 863
349 Ga0451798_0280811 3300041458 Bacteria 506
350 Ga0451807_2434329 3300041486 Bacteria 934
351 Ga0451833_0288120 3300041491 Bacteria 640
352 Ga0451833_1293662 3300041491 Bacteria 2567
353 Ga0451835_0115932 3300041492 Bacteria 4205
354 Ga0451836_15971 3300041493 Bacteria 636
355 Ga0451837_0858072 3300041494 Bacteria 2621
356 Ga0451839_1208629 3300041496 Bacteria 1621
357 Ga0451840_03790 3300041497 Bacteria 629
358 Ga0451841_1002243 3300041498 Bacteria 2201
359 Ga0451845_0135496 3300041501 Bacteria 3479
360 Ga0451846_47186 3300041502 Bacteria 1105
361 Ga0451847_0865164 3300041503 Bacteria 4896
362 Ga0451848_06124 3300041504 Bacteria 517
363 Ga0451849_0254647 3300041505 Bacteria 4644
364 Ga0451849_0818881 3300041505 Bacteria 1354
365 Ga0451851_0621237 3300041507 Bacteria 5201
366 Ga0451843_0438760 3300041509 Bacteria 744
367 Ga0451843_0855835 3300041509 Bacteria 1236
368 Ga0451854_23698 3300041510 Bacteria 957
369 Ga0451855_0075806 3300041511 Bacteria 4099
370 Ga0451855_0545569 3300041511 Bacteria 1242
371 Ga0451855_1285604 3300041511 Bacteria 653
372 Ga0451853_1332446 3300041512 Bacteria 3385
373 Ga0452271_32988 3300041916 Bacteria 1080
374 Ga0439432_027058 3300042006 Bacteria 1875
375 Ga0439449_0049692 3300042007 Bacteria 1551
376 Ga0439458_0084563 3300042157 Bacteria 812
377 Ga0466969_0117008 3300044656 Bacteria 1243
378 Ga0466965_0769203 3300044683 Bacteria 556
379 Ga0466966_0022293 3300044684 Bacteria 4156
380 Ga0466966_0391440 3300044684 Bacteria 835
381 Ga0466966_0414228 3300044684 Bacteria 810
382 Ga0466961_0493890 3300044693 Bacteria 739
383 Ga0466963_0013253 3300044694 Bacteria 5060
384 Ga0466971_0237453 3300044719 Bacteria 866
385 Ga0466970_0005599 3300044765 Bacteria 6241
386 Ga0466957_0921778 3300044842 Bacteria 625
387 Ga0466959_0025034 3300045049 Bacteria 4421
388 Ga0466959_0607522 3300045049 Bacteria 735
389 Ga0466958_0024660 3300045836 Bacteria 3539
390 Ga0466958_0161318 3300045836 Bacteria 1416
391 Ga0466967_0035126 3300045976 Bacteria 4263
392 Ga0466967_0716795 3300045976 Bacteria 991
393 Ga0466967_1214945 3300045976 Bacteria 751
394 Ga0495617_113010 3300046452 Bacteria 878
395 Ga0495592_0130418 3300046454 Bacteria 1759
396 Ga0495590_0022129 3300046457 Bacteria 2250
397 Ga0495629_0027370 3300046459 Bacteria 4047
398 Ga0495629_0119793 3300046459 Bacteria 1834
399 Ga0495638_0000093 3300046460 Bacteria 142356
400 Ga0495638_0263150 3300046460 Bacteria 945
401 Ga0495638_0333956 3300046460 Bacteria 806
402 Ga0495638_0481037 3300046460 Unclassified 629
403 Ga0495638_0510587 3300046460 Bacteria 604
404 Ga0495641_0495028 3300046461 Bacteria 557
405 Ga0495651_0609048 3300046462 Bacteria 688
406 Ga0495605_0008910 3300046474 Bacteria 5656
407 Ga0495605_0071440 3300046474 Bacteria 1639
408 Ga0495639_0147246 3300046475 Bacteria 1134
409 Ga0495662_0006422 3300046476 Bacteria 5870
410 Ga0495664_0258902 3300046477 Bacteria 1052
411 Ga0495584_0059752 3300046491 Bacteria 1917
412 Ga0495585_0007993 3300046492 Bacteria 6431
413 Ga0495585_0054170 3300046492 Bacteria 2218
414 Ga0495585_0178384 3300046492 Bacteria 1093
415 Ga0495585_0297485 3300046492 Bacteria 794
416 Ga0495596_0167059 3300046500 Bacteria 855
417 Ga0495607_0054379 3300046501 Bacteria 2307
418 Ga0495607_0079096 3300046501 Bacteria 1812
419 Ga0495583_0019150 3300046506 Bacteria 3580
420 Ga0495583_0032644 3300046506 Bacteria 2511
421 Ga0495583_0090028 3300046506 Bacteria 1322
422 Ga0495583_0309063 3300046506 Bacteria 627
423 Ga0495606_0000824 3300046507 Bacteria 47072
424 Ga0495606_0041886 3300046507 Bacteria 3068
425 Ga0495606_0059620 3300046507 Bacteria 2447
426 Ga0495606_0133747 3300046507 Bacteria 1471
427 Ga0495608_0346508 3300046511 Bacteria 915
428 Ga0495610_0034443 3300046512 Bacteria 2608
429 Ga0495610_0088790 3300046512 Bacteria 1404
430 Ga0495610_0172330 3300046512 Bacteria 906
431 Ga0495610_0248186 3300046512 Bacteria 706
432 Ga0495610_0387000 3300046512 Bacteria 519
433 Ga0495616_0061252 3300046513 Bacteria 1846
434 Ga0495616_0191163 3300046513 Bacteria 905
435 Ga0495618_0929597 3300046514 Bacteria 501
436 Ga0495620_0050209 3300046515 Bacteria 1781
437 Ga0495620_0099005 3300046515 Bacteria 1163
438 Ga0495620_0099772 3300046515 Bacteria 1158
439 Ga0495620_0267207 3300046515 Bacteria 651
440 Ga0495628_0701113 3300046516 Bacteria 715
441 Ga0495631_0022213 3300046518 Bacteria 2950
442 Ga0495631_0195983 3300046518 Bacteria 864
443 Ga0495631_0200943 3300046518 Bacteria 852
444 Ga0495632_0029196 3300046519 Bacteria 2874
445 Ga0495632_0094675 3300046519 Bacteria 1412
446 Ga0495632_0121635 3300046519 Bacteria 1220
447 Ga0495632_0165026 3300046519 Bacteria 1019
448 Ga0495637_0059138 3300046520 Bacteria 1578
449 Ga0495643_0008432 3300046522 Bacteria 6522
450 Ga0495643_0012592 3300046522 Bacteria 5096
451 Ga0495643_0040090 3300046522 Bacteria 2558
452 Ga0495643_0045805 3300046522 Bacteria 2373
453 Ga0495643_0054076 3300046522 Bacteria 2151
454 Ga0495643_0073033 3300046522 Bacteria 1798
455 Ga0495643_0167123 3300046522 Bacteria 1078
456 Ga0495644_0455622 3300046523 Bacteria 509
457 Ga0495648_0000303 3300046524 Bacteria 54717
458 Ga0495648_0018594 3300046524 Bacteria 4914
459 Ga0495648_0113568 3300046524 Bacteria 1469
460 Ga0495648_0127431 3300046524 Bacteria 1358
461 Ga0495648_0394044 3300046524 Bacteria 621
462 Ga0495663_0400426 3300046525 Bacteria 505
463 Ga0495642_0013708 3300046528 Bacteria 3139
464 Ga0495654_0045879 3300046530 Bacteria 2155
465 Ga0495587_0077273 3300046536 Bacteria 1933
466 Ga0495609_0043790 3300046538 Bacteria 2009
467 Ga0495597_0071578 3300046542 Bacteria 1493
468 Ga0495597_0208454 3300046542 Bacteria 780
469 Ga0495597_0303454 3300046542 Bacteria 619
470 Ga0495597_0329093 3300046542 Bacteria 589
471 Ga0495622_0048654 3300046557 Bacteria 1969
472 Ga0495622_0056197 3300046557 Bacteria 1825
473 Ga0495622_0119506 3300046557 Bacteria 1204
474 Ga0495622_0421421 3300046557 Bacteria 574
475 Ga0495633_0028150 3300046558 Bacteria 2741
476 Ga0495668_0000007 3300046616 Bacteria 552902
477 Ga0495668_0151877 3300046616 Bacteria 1268
478 Ga0495668_0499030 3300046616 Bacteria 671
479 Ga0495611_0110563 3300046648 Bacteria 1279
480 Ga0495611_0287785 3300046648 Bacteria 758
481 Ga0495625_0009233 3300046660 Bacteria 8278
482 Ga0495625_0025308 3300046660 Bacteria 4502
483 Ga0495625_0032058 3300046660 Bacteria 3902
484 Ga0495625_0056176 3300046660 Unclassified 2804
485 Ga0495625_0062794 3300046660 Bacteria 2624
486 Ga0495625_0101544 3300046660 Bacteria 1975
487 Ga0495625_0140798 3300046660 Bacteria 1627
488 Ga0495625_0259542 3300046660 Bacteria 1125
489 Ga0495625_0448971 3300046660 Bacteria 797
490 Ga0495625_0739344 3300046660 Bacteria 577
491 Ga0495635_0303968 3300046663 Bacteria 1069
492 Ga0495661_0071358 3300046665 Bacteria 2030
493 Ga0495588_0029503 3300046674 Bacteria 2752
494 Ga0495588_0416707 3300046674 Bacteria 705
495 Ga0495657_0069096 3300046675 Bacteria 2312
496 Ga0495623_0303680 3300046679 Bacteria 881
497 Ga0495658_0099167 3300046683 Bacteria 1736
498 Ga0495669_0000286 3300046684 Bacteria 28731
499 Ga0495669_0195018 3300046684 Bacteria 967
500 Ga0495670_0096288 3300046691 Bacteria 1519
501 Ga0495670_0254016 3300046691 Bacteria 937
502 Ga0495670_0356695 3300046691 Bacteria 787
503 Ga0495671_0067789 3300046692 Bacteria 1755
504 Ga0495671_0170616 3300046692 Bacteria 1058
505 Ga0495649_0041168 3300046694 Bacteria 2527
506 Ga0495649_0296285 3300046694 Bacteria 824
507 Ga0495649_0483903 3300046694 Bacteria 616
508 Ga0495589_0361816 3300046794 Bacteria 668
509 Ga0495600_0013303 3300046809 Bacteria 5167
510 Ga0495600_0158515 3300046809 Bacteria 1463
511 Ga0495660_0057164 3300046810 Bacteria 2105
512 Ga0495660_0081616 3300046810 Bacteria 1695
513 Ga0495660_0273399 3300046810 Bacteria 775
514 Ga0495604_0041874 3300047317 Bacteria 3590
515 Ga0495636_0028360 3300047318 Bacteria 2283
516 Ga0495674_0296225 3300047319 Bacteria 1322
517 Ga0495672_0010499 3300047320 Bacteria 6595
518 Ga0495672_0064415 3300047320 Bacteria 2099
519 Ga0495683_0030887 3300047323 Bacteria 2731
520 Ga0495683_0114590 3300047323 Bacteria 1284
521 Ga0495687_004439 3300047443 Bacteria 9474
522 Ga0495687_013793 3300047443 Bacteria 4194
523 Ga0495687_033771 3300047443 Bacteria 2317
524 Ga0495687_043138 3300047443 Bacteria 1966
525 Ga0495687_082838 3300047443 Bacteria 1251
526 Ga0495677_0003044 3300047445 Bacteria 6517
527 Ga0495685_125884 3300047447 Bacteria 840
528 Ga0495686_0006640 3300047472 Bacteria 8812
529 Ga0495686_0076698 3300047472 Bacteria 2048
530 Ga0495686_0229134 3300047472 Bacteria 1053
531 Ga0495615_0073288 3300048090 Bacteria 927
532 Ga0495615_0228566 3300048090 Bacteria 583
533 Ga0495626_0210280 3300048091 Bacteria 794
534 Ga0496100_0048000 3300048903 Bacteria 2754
535 Ga0496101_0210476 3300048904 Bacteria 1506
536 Ga0496102_0011729 3300048905 Bacteria 7563
537 Ga0496102_0013152 3300048905 Bacteria 7160
538 Ga0496103_0000836 3300048906 Bacteria 22508
539 Ga0496103_0029238 3300048906 Bacteria 3348
540 Ga0496104_0052957 3300048907 Bacteria 3834
541 Ga0496105_0114733 3300048908 Bacteria 2222
542 Ga0496105_0815701 3300048908 Bacteria 708
543 Ga0496106_0254693 3300048909 Bacteria 1404
544 Ga0496110_0070499 3300048913 Bacteria 3097
545 Ga0496110_0504698 3300048913 Bacteria 1101
546 Ga0496110_0620612 3300048913 Bacteria 980
547 Ga0496111_0007641 3300048914 Bacteria 7105
548 Ga0496113_0104885 3300048916 Bacteria 2194
549 Ga0496113_0522196 3300048916 Bacteria 953
550 Ga0496114_0137219 3300048917 Bacteria 2115
551 Ga0496115_0002445 3300048918 Bacteria 13344
552 Ga0496116_0017799 3300048919 Bacteria 5501
553 Ga0496116_0063997 3300048919 Bacteria 2365
554 Ga0496116_0148259 3300048919 Bacteria 1308
555 Ga0496117_0000182 3300048920 Bacteria 128076
556 Ga0496117_0017033 3300048920 Bacteria 6086
557 Ga0496117_0039544 3300048920 Bacteria 3480
558 Ga0496117_0223485 3300048920 Bacteria 1046
559 Ga0496117_0372493 3300048920 Bacteria 730
560 Ga0496118_0000125 3300048921 Bacteria 136422
561 Ga0496118_0010015 3300048921 Bacteria 9452
562 Ga0496118_0015441 3300048921 Bacteria 7067
563 Ga0496119_0010214 3300048922 Bacteria 7921
564 Ga0496119_0021565 3300048922 Bacteria 4650
565 Ga0496119_0058856 3300048922 Bacteria 2312
566 Ga0496119_0075305 3300048922 Bacteria 1962
567 Ga0496120_0009952 3300048923 Bacteria 6687
568 Ga0496120_0017730 3300048923 Bacteria 4604
569 Ga0496120_0276781 3300048923 Bacteria 777
570 Ga0496120_0356853 3300048923 Bacteria 655
571 Ga0496121_0007290 3300048924 Bacteria 13381
572 Ga0496121_0016095 3300048924 Bacteria 7749
573 Ga0496121_0137814 3300048924 Bacteria 1815
574 Ga0496121_0165013 3300048924 Bacteria 1615
575 Ga0496121_0431606 3300048924 Bacteria 854
576 Ga0496122_0015011 3300048925 Bacteria 7439
577 Ga0496122_0046216 3300048925 Bacteria 3374
578 Ga0496122_0160967 3300048925 Bacteria 1368
579 Ga0496123_0024694 3300048926 Bacteria 4559
580 Ga0496123_0025175 3300048926 Bacteria 4494
581 Ga0496123_0032283 3300048926 Bacteria 3794
582 Ga0496123_0055962 3300048926 Bacteria 2583
583 Ga0496123_0075063 3300048926 Bacteria 2088
584 Ga0496124_0000082 3300048927 Bacteria 208248
585 Ga0496124_0072586 3300048927 Bacteria 2850
586 Ga0496125_0002269 3300048928 Bacteria 25512
587 Ga0496125_0024814 3300048928 Bacteria 5504
588 Ga0496125_0135213 3300048928 Bacteria 1726
589 Ga0496125_0502145 3300048928 Bacteria 682
590 Ga0496125_0592916 3300048928 Bacteria 606
591 Ga0496126_0000221 3300048929 Bacteria 124193
592 Ga0496126_0188156 3300048929 Bacteria 1750
593 Ga0496126_0211504 3300048929 Bacteria 1632
594 Ga0496126_0314240 3300048929 Bacteria 1289
595 Ga0496126_0795984 3300048929 Bacteria 726
596 Ga0495678_067447 3300049459 Bacteria 1322
597 Ga0495678_069850 3300049459 Bacteria 1291
598 Ga0495678_164241 3300049459 Bacteria 707
599 Ga0495682_0037223 3300049460 Bacteria 1791
600 Ga0495682_0170892 3300049460 Bacteria 773
601 Ga0501032_0167109 3300049569 Bacteria 1443
602 Ga0501033_0227499 3300049570 Bacteria 1326
603 Ga0501034_0020130 3300049571 Bacteria 6812
604 Ga0501034_0096373 3300049571 Bacteria 2954
605 Ga0501036_0061122 3300049572 Bacteria 3191
606 Ga0501037_0077798 3300049573 Bacteria 2407
607 Ga0501037_0792895 3300049573 Bacteria 626
608 Ga0501038_0027079 3300049574 Bacteria 5103
609 Ga0501039_0140053 3300049575 Bacteria 1900
610 Ga0501043_0065196 3300049579 Bacteria 2860
611 Ga0501043_0856615 3300049579 Bacteria 654
612 Ga0501043_1249210 3300049579 Bacteria 520
613 Ga0501047_0013527 3300049581 Bacteria 7737
614 Ga0501047_0650773 3300049581 Bacteria 873
615 Ga0501068_0009640 3300049584 Bacteria 5407
616 Ga0501068_0209106 3300049584 Bacteria 1239
617 Ga0501070_0694987 3300049586 Bacteria 805
618 Ga0501073_0030504 3300049589 Bacteria 3850
619 Ga0501073_0033818 3300049589 Bacteria 3638
620 Ga0501073_0174433 3300049589 Bacteria 1488
621 Ga0501076_1610010 3300049592 Bacteria 533
622 Ga0501077_1109664 3300049593 Bacteria 509
623 Ga0501080_0016271 3300049742 Bacteria 6867
624 Ga0501080_0023538 3300049742 Bacteria 5708
625 Ga0501083_0022340 3300049744 Bacteria 4391
626 Ga0501083_0024787 3300049744 Bacteria 4155
627 Ga0501083_0166579 3300049744 Bacteria 1440
628 Ga0501035_0133623 3300049822 Bacteria 2162
629 Ga0501044_0052412 3300049823 Bacteria 4204
630 Ga0501044_0060567 3300049823 Bacteria 3875
631 nmdc:mga03683_558269_c1 3300050489 Bacteria 558
632 nmdc:mga03n38_117565_c1 3300050490 Bacteria 1303
633 nmdc:mga03n38_177718_c1 3300050490 Bacteria 1088
634 nmdc:mga03n38_2491_c1 3300050490 Bacteria 5697
635 nmdc:mga00v17_708607_c1 3300050491 Bacteria 645
636 nmdc:mga0yw44_400772_c1 3300050492 Bacteria 928
637 nmdc:mga0k408_35607_c1 3300050493 Bacteria 2274
638 nmdc:mga06z11_369289_c1 3300050494 Bacteria 861
639 nmdc:mga06z11_54721_c1 3300050494 Bacteria 2058
640 nmdc:mga06z11_578319_c1 3300050494 Bacteria 683
641 nmdc:mga06z11_868650_c1 3300050494 Bacteria 550
642 nmdc:mga04h51_103694_c1 3300050495 Bacteria 1040
643 nmdc:mga07m45_26717_c1 3300050496 Bacteria 3174
644 nmdc:mga07m45_338095_c1 3300050496 Bacteria 875
645 nmdc:mga07m45_3505_c3 3300050496 Bacteria 2463
646 nmdc:mga07m45_375506_c1 3300050496 Bacteria 826
647 nmdc:mga0sz30_18519_c1 3300050516 Bacteria 2788
648 nmdc:mga0sz30_279812_c1 3300050516 Bacteria 743
649 nmdc:mga0sz30_329384_c1 3300050516 Bacteria 682
650 nmdc:mga0sz30_414583_c1 3300050516 Bacteria 604
651 nmdc:mga0sz30_457670_c1 3300050516 Bacteria 573
652 Ga0500610_0000140 3300053079 Bacteria 21620
653 Ga0500635_0252205 3300053080 Bacteria 692
654 Ga0495655_0034011 3300053083 Bacteria 1258
655 Ga0495619_0305738 3300053085 Bacteria 1101
656 Ga0500578_0125959 3300053086 Bacteria 1608
657 Ga0500578_0164851 3300053086 Bacteria 1373
658 Ga0500643_043167 3300053087 Bacteria 1316
659 Ga0500643_102037 3300053087 Bacteria 778
660 Ga0500646_0034593 3300053090 Bacteria 1401
661 Ga0500651_0117980 3300053093 Bacteria 1614
662 Ga0500650_0047243 3300053098 Unclassified 1995
663 Ga0500650_0262282 3300053098 Bacteria 772
664 Ga0500654_192564 3300053099 Bacteria 629
665 Ga0500562_012573 3300053108 Bacteria 2155
666 Ga0500569_129751 3300053109 Bacteria 843
667 Ga0500569_318291 3300053109 Bacteria 521
668 Ga0500594_0007898 3300053118 Bacteria 2414
669 Ga0500594_0186761 3300053118 Bacteria 678
670 Ga0500594_0292815 3300053118 Unclassified 545
671 Ga0500595_004282 3300053119 Bacteria 6429
672 Ga0500595_010172 3300053119 Bacteria 3750
673 Ga0500607_053714 3300053121 Bacteria 2135
674 Ga0500607_141440 3300053121 Bacteria 1131
675 Ga0500618_005797 3300053125 Bacteria 3711
676 Ga0500642_0000153 3300053130 Bacteria 28618
677 Ga0500642_0058487 3300053130 Unclassified 1723
678 Ga0500655_095453 3300053133 Unclassified 620
679 Ga0500658_0003673 3300053134 Bacteria 5785
680 Ga0500568_0000137 3300053139 Bacteria 65882
681 Ga0500568_0000825 3300053139 Bacteria 21796
682 Ga0500568_0114173 3300053139 Bacteria 1008
683 Ga0500577_0097706 3300053142 Bacteria 1196
684 Ga0500577_0111971 3300053142 Bacteria 1127
685 Ga0500577_0120812 3300053142 Bacteria 1090
686 Ga0500588_0115528 3300053146 Bacteria 941
687 Ga0500588_0385465 3300053146 Unclassified 533
688 Ga0500590_010218 3300053148 Bacteria 4734
689 Ga0500604_0000014 3300053151 Bacteria 92128
690 Ga0500604_0002631 3300053151 Bacteria 4886
691 Ga0500616_0003922 3300053153 Bacteria 10926
692 Ga0500616_0005323 3300053153 Bacteria 8770
693 Ga0500616_0051437 3300053153 Bacteria 2171
694 Ga0500616_0107076 3300053153 Bacteria 1356
695 Ga0500622_0008480 3300053156 Bacteria 5749
696 Ga0500624_129640 3300053157 Bacteria 534
697 Ga0500627_0066565 3300053158 Bacteria 1591
698 Ga0500627_0128507 3300053158 Bacteria 1144
699 Ga0500627_0150025 3300053158 Bacteria 1053
700 Ga0500627_0426509 3300053158 Bacteria 561
701 Ga0500627_0452675 3300053158 Bacteria 540
702 Ga0500633_0202629 3300053160 Bacteria 743
703 Ga0500633_0340232 3300053160 Unclassified 548
704 Ga0500634_0039678 3300053161 Bacteria 2559
705 Ga0500636_0028586 3300053177 Bacteria 3292
706 Ga0500636_0209036 3300053177 Bacteria 1026
707 Ga0500611_153152 3300053727 Unclassified 634
708 Ga0500645_000080 3300053730 Bacteria 76756
709 Ga0500645_060522 3300053730 Bacteria 1096
710 Ga0500645_125620 3300053730 Bacteria 714
711 Ga0500596_002571 3300053735 Bacteria 3566
712 Ga0500601_004212 3300053737 Bacteria 1561
713 Ga0501084_0198155 3300054114 Bacteria 1694
714 Ga0501084_1795822 3300054114 Bacteria 512
715 Ga0500661_059991 3300055283 Bacteria 686
716 Ga0501082_0091705 3300060353 Bacteria 2624
717 Ga0501082_1371466 3300060353 Bacteria 618

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0792895 Ga0501037_0792895_346_612 84
2 3300049592 Ga0501076_1610010 Ga0501076_1610010_250_516 84
3 iso_pu_bacteria 2838029111 2838033299 91
4 iso_pu_bacteria 2842475841 2842480036 91
5 iso_pu_bacteria 2842482326 2842483774 91
6 iso_pu_bacteria 2842502639 2842505179 91
7 iso_pu_bacteria 2919408235 2919410300 91
8 3300005616 Ga0068852_100034890 Ga0068852_1000348902 95
9 3300025253 Ga0209677_100453 Ga0209677_10045320 95
10 3300025261 Ga0209233_1000137 Ga0209233_1000137200 95
11 3300025913 Ga0207695_10000037 Ga0207695_10000037219 95
12 3300025914 Ga0207671_10001017 Ga0207671_1000101719 95
13 3300041443 Ga0451789_1300095 Ga0451789_1300095_1726_2013 95
14 3300041486 Ga0451807_2434329 Ga0451807_2434329_630_917 95
15 3300041493 Ga0451836_15971 Ga0451836_15971_16_303 95
16 3300041497 Ga0451840_03790 Ga0451840_03790_326_613 95
17 3300041502 Ga0451846_47186 Ga0451846_47186_14_301 95
18 3300041504 Ga0451848_06124 Ga0451848_06124_215_502 95
19 3300041510 Ga0451854_23698 Ga0451854_23698_18_305 95
20 3300046507 Ga0495606_0041886 Ga0495606_0041886_21_308 95
21 3300048913 Ga0496110_0504698 Ga0496110_0504698_552_875 96
22 3300053087 Ga0500643_102037 Ga0500643_102037_70_384 98
23 3300053130 Ga0500642_0058487 Ga0500642_0058487_1162_1476 98
24 3300005530 Ga0070679_100344403 Ga0070679_1003444031 99
25 3300006186 Ga0075369_10643385 Ga0075369_106433852 99
26 3300025921 Ga0207652_10100447 Ga0207652_101004473 99
27 3300046460 Ga0495638_0481037 Ga0495638_0481037_302_619 99
28 3300046660 Ga0495625_0056176 Ga0495625_0056176_2345_2662 99
29 3300049579 Ga0501043_0065196 Ga0501043_0065196_346_663 99
30 3300049581 Ga0501047_0013527 Ga0501047_0013527_3610_3927 99
31 3300049584 Ga0501068_0009640 Ga0501068_0009640_4954_5271 99
32 3300049589 Ga0501073_0033818 Ga0501073_0033818_2711_3028 99
33 3300049593 Ga0501077_1109664 Ga0501077_1109664_158_475 99
34 3300049742 Ga0501080_0016271 Ga0501080_0016271_3925_4242 99
35 3300049744 Ga0501083_0024787 Ga0501083_0024787_579_896 99
36 3300049823 Ga0501044_0060567 Ga0501044_0060567_3422_3739 99
37 3300053090 Ga0500646_0034593 Ga0500646_0034593_936_1253 99
38 3300053098 Ga0500650_0047243 Ga0500650_0047243_149_466 99
39 3300053108 Ga0500562_012573 Ga0500562_012573_569_886 99
40 3300053118 Ga0500594_0292815 Ga0500594_0292815_214_531 99
41 3300053133 Ga0500655_095453 Ga0500655_095453_265_582 99
42 3300053139 Ga0500568_0114173 Ga0500568_0114173_392_709 99
43 3300053142 Ga0500577_0097706 Ga0500577_0097706_659_976 99
44 3300053146 Ga0500588_0385465 Ga0500588_0385465_149_466 99
45 3300053151 Ga0500604_0002631 Ga0500604_0002631_2805_3122 99
46 3300053160 Ga0500633_0340232 Ga0500633_0340232_64_381 99
47 3300053727 Ga0500611_153152 Ga0500611_153152_141_458 99
48 3300054114 Ga0501084_0198155 Ga0501084_0198155_501_818 99
49 3300060353 Ga0501082_0091705 Ga0501082_0091705_875_1192 99
50 iso_pu_bacteria 2643221736 2644743279 99
51 iso_pu_bacteria 8057529695 8057530629 99
52 iso_pu_bacteria 2509276018 2509370700 100
53 iso_pu_bacteria 2510065019 2510131849 100
54 iso_pu_bacteria 2510065059 2510317491 100
55 iso_pu_bacteria 2510461076 2510898174 100
56 iso_pu_bacteria 2510917022 2511133157 100
57 iso_pu_bacteria 2510917026 2511174944 100
58 iso_pu_bacteria 2512875026 2512973570 100
59 iso_pu_bacteria 2513237084 2513573517 100
60 iso_pu_bacteria 2513237085 2513581012 100
61 iso_pu_bacteria 2513237089 2513601911 100
62 iso_pu_bacteria 2513237093 2513636619 100
63 iso_pu_bacteria 2513237103 2513711861 100
64 iso_pu_bacteria 2513237156 2513988048 100
65 iso_pu_bacteria 2513237160 2514003489 100
66 iso_pu_bacteria 2513237162 2514023968 100
67 iso_pu_bacteria 2515075009 2515110784 100
68 iso_pu_bacteria 2515154113 2515638863 100
69 iso_pu_bacteria 2515154114 2515645691 100
70 iso_pu_bacteria 2515154116 2515661403 100
71 iso_pu_bacteria 2515154134 2515743234 100
72 iso_pu_bacteria 2516653077 2517039483 100
73 iso_pu_bacteria 2516653085 2517075014 100
74 iso_pu_bacteria 2517093000 2517093650 100
75 iso_pu_bacteria 2517287029 2517405403 100
76 iso_pu_bacteria 2517487022 2517571426 100
77 iso_pu_bacteria 2519899620 2520377108 100
78 iso_pu_bacteria 2524023209 2524458939 100
79 iso_pu_bacteria 2529292951 2530644804 100
80 iso_pu_bacteria 2582581298 2585222512 100
81 iso_pu_bacteria 2582581306 2585266530 100
82 iso_pu_bacteria 2582581307 2585271897 100
83 iso_pu_bacteria 2582581308 2585279367 100
84 iso_pu_bacteria 2582581316 2585331141 100
85 iso_pu_bacteria 2582581865 2585387546 100
86 iso_pu_bacteria 2582581867 2585402696 100
87 iso_pu_bacteria 2585427526 2585525181 100
88 iso_pu_bacteria 2585427527 2585531148 100
89 iso_pu_bacteria 2585427528 2585538647 100
90 iso_pu_bacteria 2585427529 2585545095 100
91 iso_pu_bacteria 2585427530 2585552928 100
92 iso_pu_bacteria 2585427531 2585563740 100
93 iso_pu_bacteria 2585427590 2585820391 100
94 iso_pu_bacteria 2585427593 2585836600 100
95 iso_pu_bacteria 2585427608 2585897064 100
96 iso_pu_bacteria 2585427609 2585907078 100
97 iso_pu_bacteria 2585428125 2587982928 100
98 iso_pu_bacteria 2597489875 2597814085 100
99 iso_pu_bacteria 2615840626 2616311110 100
100 iso_pu_bacteria 2615840698 2616554549 100
101 iso_pu_bacteria 2617270742 2617385389 100
102 iso_pu_bacteria 2643221582 2643917188 100
103 iso_pu_bacteria 2643221595 2643989399 100
104 iso_pu_bacteria 2643221627 2644152971 100
105 iso_pu_bacteria 2643221734 2644735643 100
106 iso_pu_bacteria 2667528174 2671111134 100
107 iso_pu_bacteria 2687453392 2688599415 100
108 iso_pu_bacteria 2718217882 2719180261 100
109 iso_pu_bacteria 2718217927 2719388689 100
110 iso_pu_bacteria 2718217997 2719666106 100
111 iso_pu_bacteria 2718218009 2719731010 100
112 iso_pu_bacteria 2718218199 2720492526 100
113 iso_pu_bacteria 2718218232 2720613961 100
114 iso_pu_bacteria 2718218235 2720632088 100
115 iso_pu_bacteria 2718218269 2720775816 100
116 iso_pu_bacteria 2718218363 2721146355 100
117 iso_pu_bacteria 2718218365 2721157875 100
118 iso_pu_bacteria 2718218366 2721163234 100
119 iso_pu_bacteria 2718218423 2721403315 100
120 iso_pu_bacteria 2721755514 2722839404 100
121 iso_pu_bacteria 2721755523 2722885257 100
122 iso_pu_bacteria 2721755684 2723561042 100
123 iso_pu_bacteria 2721755685 2723567635 100
124 iso_pu_bacteria 2721755809 2724035672 100
125 iso_pu_bacteria 2721755810 2724043766 100
126 iso_pu_bacteria 2721755819 2724090423 100
127 iso_pu_bacteria 2721755822 2724104900 100
128 iso_pu_bacteria 2721755823 2724110761 100
129 iso_pu_bacteria 2724679232 2725948246 100
130 iso_pu_bacteria 2728369365 2730163498 100
131 iso_pu_bacteria 2728369397 2730297507 100
132 iso_pu_bacteria 2738541333 2739034077 100
133 iso_pu_bacteria 2791355256 2793295966 100
134 iso_pu_bacteria 2791355261 2793331908 100
135 iso_pu_bacteria 2791355262 2793336352 100
136 iso_pu_bacteria 2791355264 2793347902 100
137 iso_pu_bacteria 2791355265 2793354135 100
138 iso_pu_bacteria 2791355266 2793358594 100
139 iso_pu_bacteria 2791355267 2793366793 100
140 iso_pu_bacteria 2802428858 2802717207 100
141 iso_pu_bacteria 2802428859 2802724804 100
142 iso_pu_bacteria 2802428860 2802729555 100
143 iso_pu_bacteria 2802428861 2802736901 100
144 iso_pu_bacteria 2802428862 2802743306 100
145 iso_pu_bacteria 2802428863 2802749568 100
146 iso_pu_bacteria 2802429633 2806042874 100
147 iso_pu_bacteria 2802429634 2806050825 100
148 iso_pu_bacteria 2802429635 2806058007 100
149 iso_pu_bacteria 2802429636 2806065280 100
150 iso_pu_bacteria 2802429637 2806076766 100
151 iso_pu_bacteria 2818991448 2819609436 100
152 iso_pu_bacteria 2818991453 2819641253 100
153 iso_pu_bacteria 2818991467 2819717657 100
154 iso_pu_bacteria 2837678835 2837682149 100
155 iso_pu_bacteria 2838022645 2838023190 100
156 iso_pu_bacteria 2838048938 2838052003 100
157 iso_pu_bacteria 2838061910 2838067379 100
158 iso_pu_bacteria 2838068647 2838070197 100
159 iso_pu_bacteria 2838680041 2838685522 100
160 iso_pu_bacteria 2838686498 2838693953 100
161 iso_pu_bacteria 2838694306 2838696022 100
162 iso_pu_bacteria 2838707686 2838713421 100
163 iso_pu_bacteria 2838729681 2838736621 100
164 iso_pu_bacteria 2838742623 2838749476 100
165 iso_pu_bacteria 2839138175 2839142089 100
166 iso_pu_bacteria 2841734538 2841740024 100
167 iso_pu_bacteria 2841760612 2841761159 100
168 iso_pu_bacteria 2841851746 2841858741 100
169 iso_pu_bacteria 2842077413 2842082655 100
170 iso_pu_bacteria 2842118031 2842123786 100
171 iso_pu_bacteria 2842156927 2842163553 100
172 iso_pu_bacteria 2842163707 2842169532 100
173 iso_pu_bacteria 2842180545 2842187174 100
174 iso_pu_bacteria 2842198810 2842199618 100
175 iso_pu_bacteria 2842205361 2842208757 100
176 iso_pu_bacteria 2842217011 2842221021 100
177 iso_pu_bacteria 2842229732 2842236790 100
178 iso_pu_bacteria 2842237096 2842242841 100
179 iso_pu_bacteria 2842243621 2842250535 100
180 iso_pu_bacteria 2842257432 2842264385 100
181 iso_pu_bacteria 2842271015 2842278445 100
182 iso_pu_bacteria 2842278818 2842281898 100
183 iso_pu_bacteria 2842291075 2842296914 100
184 iso_pu_bacteria 2842298080 2842298291 100
185 iso_pu_bacteria 2842304105 2842307231 100
186 iso_pu_bacteria 2842357229 2842360109 100
187 iso_pu_bacteria 2842363717 2842368144 100
188 iso_pu_bacteria 2842370503 2842376092 100
189 iso_pu_bacteria 2842377471 2842383302 100
190 iso_pu_bacteria 2842384541 2842390435 100
191 iso_pu_bacteria 2842395702 2842396633 100
192 iso_pu_bacteria 2842422224 2842423811 100
193 iso_pu_bacteria 2842447887 2842453167 100
194 iso_pu_bacteria 2844009547 2844014693 100
195 iso_pu_bacteria 2844104063 2844104184 100
196 iso_pu_bacteria 2844454524 2844455599 100
197 iso_pu_bacteria 2847686936 2847692958 100
198 iso_pu_bacteria 2851182111 2851184182 100
199 iso_pu_bacteria 2851246043 2851247172 100
200 iso_pu_bacteria 2854896431 2854901828 100
201 iso_pu_bacteria 2856328259 2856328967 100
202 iso_pu_bacteria 2856334872 2856340035 100
203 iso_pu_bacteria 2857367948 2857368567 100
204 iso_pu_bacteria 2869169390 2869174780 100
205 iso_pu_bacteria 2869234852 2869239591 100
206 iso_pu_bacteria 2869242130 2869248316 100
207 iso_pu_bacteria 2869249662 2869253170 100
208 iso_pu_bacteria 2869256925 2869262524 100
209 iso_pu_bacteria 2869264136 2869266560 100
210 iso_pu_bacteria 2869271264 2869276168 100
211 iso_pu_bacteria 2871435913 2871438316 100
212 iso_pu_bacteria 2871444079 2871449095 100
213 iso_pu_bacteria 2871451962 2871458157 100
214 iso_pu_bacteria 2871459585 2871462365 100
215 iso_pu_bacteria 2871474448 2871475318 100
216 iso_pu_bacteria 2871481445 2871487717 100
217 iso_pu_bacteria 2874102143 2874107133 100
218 iso_pu_bacteria 2874109183 2874114687 100
219 iso_pu_bacteria 2874116593 2874117788 100
220 iso_pu_bacteria 2874123672 2874125986 100
221 iso_pu_bacteria 2874131515 2874137983 100
222 iso_pu_bacteria 2874162495 2874167267 100
223 iso_pu_bacteria 2876386047 2876386070 100
224 iso_pu_bacteria 2876399893 2876405872 100
225 iso_pu_bacteria 2876406927 2876407645 100
226 iso_pu_bacteria 2876420981 2876423749 100
227 iso_pu_bacteria 2878774303 2878774803 100
228 iso_pu_bacteria 2878781027 2878788449 100
229 iso_pu_bacteria 2878788777 2878794257 100
230 iso_pu_bacteria 2881147464 2881152852 100
231 iso_pu_bacteria 2885312484 2885317127 100
232 iso_pu_bacteria 2885409591 2885416243 100
233 iso_pu_bacteria 2888343758 2888347475 100
234 iso_pu_bacteria 2903513507 2903516673 100
235 iso_pu_bacteria 2906328253 2906335294 100
236 iso_pu_bacteria 2906363423 2906365855 100
237 iso_pu_bacteria 2906370794 2906373936 100
238 iso_pu_bacteria 2906378014 2906383367 100
239 iso_pu_bacteria 2906386501 2906389295 100
240 iso_pu_bacteria 2906393657 2906399257 100
241 iso_pu_bacteria 2906401398 2906402756 100
242 iso_pu_bacteria 2906408224 2906412653 100
243 iso_pu_bacteria 2906427513 2906428530 100
244 iso_pu_bacteria 2915650412 2915651184 100
245 iso_pu_bacteria 2915980308 2915982420 100
246 iso_pu_bacteria 2916061851 2916065006 100
247 iso_pu_bacteria 2917699015 2917699917 100
248 iso_pu_bacteria 2921250672 2921252930 100
249 iso_pu_bacteria 2922151315 2922157459 100
250 iso_pu_bacteria 2922158528 2922164148 100
251 iso_pu_bacteria 2922172374 2922177096 100
252 iso_pu_bacteria 2922178524 2922179094 100
253 iso_pu_bacteria 2922368715 2922368912 100
254 iso_pu_bacteria 2923556063 2923562993 100
255 iso_pu_bacteria 2924710171 2924711481 100
256 iso_pu_bacteria 2924726620 2924733109 100
257 iso_pu_bacteria 2924733363 2924736240 100
258 iso_pu_bacteria 2924741084 2924745200 100
259 iso_pu_bacteria 2924748358 2924750718 100
260 iso_pu_bacteria 2924754689 2924759549 100
261 iso_pu_bacteria 2924762789 2924768971 100
262 iso_pu_bacteria 2933570622 2933572656 100
263 iso_pu_bacteria 2933599457 2933601002 100
264 iso_pu_bacteria 2935894831 2935900041 100
265 iso_pu_bacteria 2935901341 2935906761 100
266 iso_pu_bacteria 2937029754 2937031850 100
267 iso_pu_bacteria 2937036028 2937036219 100
268 iso_pu_bacteria 2937078374 2937082055 100
269 iso_pu_bacteria 2937084907 2937089993 100
270 iso_pu_bacteria 2937836603 2937837779 100
271 iso_pu_bacteria 2937843397 2937846861 100
272 iso_pu_bacteria 2937861824 2937866860 100
273 iso_pu_bacteria 2937868953 2937869715 100
274 iso_pu_bacteria 2937891427 2937892881 100
275 iso_pu_bacteria 2937980651 2937981198 100
276 iso_pu_bacteria 2941499720 2941506307 100
277 iso_pu_bacteria 2957375807 2957381820 100
278 iso_pu_bacteria 2957437181 2957442079 100
279 iso_pu_bacteria 2958071322 2958077518 100
280 iso_pu_bacteria 2958108152 2958115114 100
281 iso_pu_bacteria 2958115193 2958122263 100
282 iso_pu_bacteria 2958122699 2958123129 100
283 iso_pu_bacteria 2958137437 2958142067 100
284 iso_pu_bacteria 2958158011 2958160337 100
285 iso_pu_bacteria 2960591022 2960592243 100
286 iso_pu_bacteria 2960631154 2960633805 100
287 iso_pu_bacteria 2960680706 2960682350 100
288 iso_pu_bacteria 2960693952 2960698224 100
289 iso_pu_bacteria 2961136820 2961137642 100
290 iso_pu_bacteria 2961183825 2961189104 100
291 iso_pu_bacteria 2965025482 2965029516 100
292 iso_pu_bacteria 2965032056 2965037791 100
293 iso_pu_bacteria 2965040258 2965043889 100
294 iso_pu_bacteria 2965047637 2965053806 100
295 iso_pu_bacteria 2965062239 2965065579 100
296 iso_pu_bacteria 2965089291 2965095807 100
297 iso_pu_bacteria 2965102966 2965109162 100
298 iso_pu_bacteria 2965110997 2965117101 100
299 iso_pu_bacteria 2967686174 2967690240 100
300 iso_pu_bacteria 2967728569 2967730833 100
301 iso_pu_bacteria 2968091066 2968091802 100
302 iso_pu_bacteria 2968097103 2968103161 100
303 iso_pu_bacteria 2968128360 2968129864 100
304 iso_pu_bacteria 2968138860 2968143941 100
305 iso_pu_bacteria 2970026789 2970029545 100
306 iso_pu_bacteria 2970122695 2970128922 100
307 iso_pu_bacteria 2970143518 2970143594 100
308 iso_pu_bacteria 2970489779 2970495832 100
309 iso_pu_bacteria 2970510686 2970512680 100
310 iso_pu_bacteria 2970524798 2970531723 100
311 iso_pu_bacteria 2970532167 2970538465 100
312 iso_pu_bacteria 2970540015 2970544281 100
313 iso_pu_bacteria 2970547951 2970550046 100
314 iso_pu_bacteria 2970619444 2970621102 100
315 iso_pu_bacteria 2970627176 2970631150 100
316 iso_pu_bacteria 2977530762 2977535074 100
317 iso_pu_bacteria 2977544691 2977550619 100
318 iso_pu_bacteria 2977851361 2977858084 100
319 iso_pu_bacteria 2977858184 2977863505 100
320 iso_pu_bacteria 2977898635 2977905830 100
321 iso_pu_bacteria 2977907340 2977915018 100
322 iso_pu_bacteria 2977915119 2977919635 100
323 iso_pu_bacteria 2977935797 2977941415 100
324 iso_pu_bacteria 2977950692 2977952625 100
325 iso_pu_bacteria 2977957713 2977958991 100
326 iso_pu_bacteria 2979764755 2979770528 100
327 iso_pu_bacteria 2979772303 2979776714 100
328 iso_pu_bacteria 2979779861 2979780310 100
329 iso_pu_bacteria 2979793036 2979798418 100
330 iso_pu_bacteria 2987645492 2987648697 100
331 iso_pu_bacteria 2987666974 2987670649 100
332 iso_pu_bacteria 2987673487 2987675130 100
333 iso_pu_bacteria 2996341866 2996345253 100
334 iso_pu_bacteria 2996386984 2996392576 100
335 iso_pu_bacteria 2996893221 2996894123 100
336 iso_pu_bacteria 3004167301 3004169598 100
337 iso_pu_bacteria 3004195979 3004196866 100
338 iso_pu_bacteria 3004232784 3004238884 100
339 iso_pu_bacteria 3004239961 3004242641 100
340 iso_pu_bacteria 3004248173 3004254303 100
341 iso_pu_bacteria 3004268573 3004275210 100
342 iso_pu_bacteria 3005416602 3005418879 100
343 iso_pu_bacteria 649633066 649873919 100
344 iso_pu_bacteria 8003999396 8004003088 100
345 iso_pu_bacteria 8004300914 8004303254 100
346 iso_pu_bacteria 8004312739 8004314620 100
347 iso_pu_bacteria 8004395343 8004403553 100
348 iso_pu_bacteria 8004445564 8004445767 100
349 iso_pu_bacteria 8004633249 8004634065 100
350 iso_pu_bacteria 8004695233 8004699785 100
351 iso_pu_bacteria 8004703790 8004713697 100
352 iso_pu_bacteria 8004727605 8004733072 100
353 iso_pu_bacteria 8005275841 8005277412 100
354 iso_pu_bacteria 8005282627 8005283312 100
355 iso_pu_bacteria 8005301065 8005304570 100
356 iso_pu_bacteria 8005307578 8005312249 100
357 iso_pu_bacteria 8005314921 8005318229 100
358 iso_pu_bacteria 8005430974 8005435102 100
359 iso_pu_bacteria 8005460587 8005461426 100
360 iso_pu_bacteria 8005484373 8005488893 100
361 iso_pu_bacteria 8005497431 8005500841 100
362 iso_pu_bacteria 8005556819 8005562700 100
363 iso_pu_bacteria 8005563573 8005569975 100
364 iso_pu_bacteria 8005570704 8005575727 100
365 iso_pu_bacteria 8005626139 8005632306 100
366 iso_pu_bacteria 8005645114 8005645977 100
367 iso_pu_bacteria 8005668836 8005672258 100
368 iso_pu_bacteria 8005682033 8005682584 100
369 iso_pu_bacteria 8005688590 8005690993 100
370 iso_pu_bacteria 8005695170 8005701658 100
371 iso_pu_bacteria 8018127388 8018133176 100
372 iso_pu_bacteria 8018163183 8018168613 100
373 iso_pu_bacteria 8018176218 8018182977 100
374 iso_pu_bacteria 8023680758 8023683540 100
375 iso_pu_bacteria 8024486573 8024490061 100
376 iso_pu_bacteria 8055617313 8055621541 100
377 iso_pu_bacteria 8056375014 8056375413 100
378 iso_pu_bacteria 8056382006 8056382863 100
379 iso_pu_bacteria 8057575449 8057576654 100
380 iso_pu_bacteria 8057874678 8057881545 100
381 3300005547 Ga0070693_100840624 Ga0070693_1008406241 101
382 3300005841 Ga0068863_100074721 Ga0068863_1000747216 101
383 3300025917 Ga0207660_10768349 Ga0207660_107683491 101
384 3300046522 Ga0495643_0073033 Ga0495643_0073033_522_830 102
385 iso_pu_bacteria 2844002411 2844006449 102
386 3300001990 JGI24737J22298_10004864 JGI24737J22298_100048643 103
387 3300002987 JGI25159J45721_1007150 JGI25159J45721_10071502 103
388 3300003187 JGI25151J46595_10050591 JGI25151J46595_100505912 103
389 3300005262 Ga0065165_1000234 Ga0065165_100023472 103
390 3300005367 Ga0070667_101101835 Ga0070667_1011018351 103
391 3300005435 Ga0070714_100022342 Ga0070714_1000223427 103
392 3300005441 Ga0070700_102012017 Ga0070700_1020120171 103
393 3300005539 Ga0068853_102423834 Ga0068853_1024238341 103
394 3300005548 Ga0070665_100453703 Ga0070665_1004537033 103
395 3300005614 Ga0068856_101095222 Ga0068856_1010952221 103
396 3300006028 Ga0070717_10385067 Ga0070717_103850672 103
397 3300009093 Ga0105240_11387494 Ga0105240_113874942 103
398 3300009174 Ga0105241_12286651 Ga0105241_122866512 103
399 3300009545 Ga0105237_10796418 Ga0105237_107964182 103
400 3300014326 Ga0157380_12305627 Ga0157380_123056272 103
401 3300025284 Ga0209130_1000279 Ga0209130_100027928 103
402 3300025294 Ga0209025_1002215 Ga0209025_100221513 103
403 3300025299 Ga0209256_1075637 Ga0209256_10756371 103
404 3300025302 Ga0207426_1008474 Ga0207426_10084747 103
405 3300025929 Ga0207664_10017789 Ga0207664_100177897 103
406 3300026078 Ga0207702_10911743 Ga0207702_109117431 103
407 3300028379 Ga0268266_10062390 Ga0268266_100623902 103
408 3300031344 Ga0265316_10943025 Ga0265316_109430252 103
409 3300037853 Ga0436364_1037496 Ga0436364_1037496_331_642 103
410 3300038443 Ga0395901_0874728 Ga0395901_0874728_170_484 103
411 3300044656 Ga0466969_0117008 Ga0466969_0117008_578_889 103
412 3300044683 Ga0466965_0769203 Ga0466965_0769203_170_481 103
413 3300044684 Ga0466966_0391440 Ga0466966_0391440_208_519 103
414 3300044693 Ga0466961_0493890 Ga0466961_0493890_196_507 103
415 3300044719 Ga0466971_0237453 Ga0466971_0237453_115_426 103
416 3300044842 Ga0466957_0921778 Ga0466957_0921778_168_479 103
417 3300045049 Ga0466959_0025034 Ga0466959_0025034_3554_3865 103
418 3300045836 Ga0466958_0161318 Ga0466958_0161318_325_636 103
419 3300045976 Ga0466967_1214945 Ga0466967_1214945_402_713 103
420 3300046542 Ga0495597_0071578 Ga0495597_0071578_1091_1402 103
421 3300048908 Ga0496105_0815701 Ga0496105_0815701_154_465 103
422 3300048913 Ga0496110_0620612 Ga0496110_0620612_600_911 103
423 3300049571 Ga0501034_0020130 Ga0501034_0020130_6238_6549 103
424 3300053158 Ga0500627_0066565 Ga0500627_0066565_646_957 103
425 3300053158 Ga0500627_0426509 Ga0500627_0426509_22_333 103
426 3300053158 Ga0500627_0452675 Ga0500627_0452675_43_354 103
427 3300001915 JGI24741J21665_1005468 JGI24741J21665_10054683 104
428 3300001979 JGI24740J21852_10026115 JGI24740J21852_100261153 104
429 3300001989 JGI24739J22299_10016293 JGI24739J22299_100162932 104
430 3300002067 JGI24735J21928_10042336 JGI24735J21928_100423362 104
431 3300002737 JGI25162J39368_1003498 JGI25162J39368_10034982 104
432 3300002774 JGI25150J39212_1020269 JGI25150J39212_10202691 104
433 3300002987 JGI25159J45721_1000251 JGI25159J45721_100025114 104
434 3300003187 JGI25151J46595_10001922 JGI25151J46595_100019224 104
435 3300003214 JGI25165J46597_1000087 JGI25165J46597_100008762 104
436 3300003214 JGI25165J46597_1000139 JGI25165J46597_100013943 104
437 3300003214 JGI25165J46597_1000692 JGI25165J46597_100069215 104
438 3300003214 JGI25165J46597_1000752 JGI25165J46597_100075223 104
439 3300003214 JGI25165J46597_1001515 JGI25165J46597_10015154 104
440 3300003214 JGI25165J46597_1003764 JGI25165J46597_10037644 104
441 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006208 104
442 3300003215 JGI25153J46596_10003398 JGI25153J46596_100033985 104
443 3300003215 JGI25153J46596_10010091 JGI25153J46596_100100917 104
444 3300003316 rootH1_10065014 rootH1_100650142 104
445 3300003320 rootH2_10034256 rootH2_100342563 104
446 3300003320 rootH2_10198485 rootH2_101984852 104
447 3300003320 rootH2_10202360 rootH2_102023602 104
448 3300003322 rootL2_10229689 rootL2_102296892 104
449 3300003323 rootH1_10187912 rootH1_101879122 104
450 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001301 104
451 3300003354 JGI25160J50197_1001226 JGI25160J50197_100122610 104
452 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001460 104
453 3300003578 Ga0006562J51391_1088000 Ga0006562J51391_10880002 104
454 3300003752 Ga0055539_1025621 Ga0055539_10256212 104
455 3300003759 Ga0055525_1000051 Ga0055525_100005140 104
456 3300003762 Ga0055542_1000020 Ga0055542_1000020154 104
457 3300003763 Ga0055529_1000016 Ga0055529_1000016193 104
458 3300003771 Ga0055526_1002636 Ga0055526_10026364 104
459 3300003771 Ga0055526_1013393 Ga0055526_10133935 104
460 3300003771 Ga0055526_1016661 Ga0055526_10166615 104
461 3300003775 Ga0055524_1001569 Ga0055524_10015699 104
462 3300003775 Ga0055524_1004990 Ga0055524_10049904 104
463 3300003775 Ga0055524_1011324 Ga0055524_10113244 104
464 3300003775 Ga0055524_1020763 Ga0055524_10207632 104
465 3300003775 Ga0055524_1045016 Ga0055524_10450163 104
466 3300003790 Ga0055528_1001064 Ga0055528_10010646 104
467 3300003790 Ga0055528_1005906 Ga0055528_10059064 104
468 3300003790 Ga0055528_1012070 Ga0055528_10120702 104
469 3300003790 Ga0055528_1022562 Ga0055528_10225624 104
470 3300003792 Ga0055540_1000197 Ga0055540_100019749 104
471 3300003794 Ga0055531_10039751 Ga0055531_100397512 104
472 3300004625 Ga0055543_1000089 Ga0055543_100008960 104
473 3300004625 Ga0055543_1000731 Ga0055543_100073113 104
474 3300005262 Ga0065165_1000008 Ga0065165_1000008155 104
475 3300005327 Ga0070658_10001558 Ga0070658_1000155820 104
476 3300005339 Ga0070660_100414672 Ga0070660_1004146722 104
477 3300005339 Ga0070660_100528992 Ga0070660_1005289921 104
478 3300005344 Ga0070661_100061766 Ga0070661_1000617663 104
479 3300005344 Ga0070661_100261681 Ga0070661_1002616813 104
480 3300005347 Ga0070668_101038576 Ga0070668_1010385762 104
481 3300005356 Ga0070674_100047027 Ga0070674_1000470273 104
482 3300005366 Ga0070659_100033678 Ga0070659_1000336783 104
483 3300005367 Ga0070667_100194333 Ga0070667_1001943332 104
484 3300005367 Ga0070667_100391516 Ga0070667_1003915162 104
485 3300005367 Ga0070667_101003073 Ga0070667_1010030731 104
486 3300005455 Ga0070663_101588758 Ga0070663_1015887582 104
487 3300005459 Ga0068867_100819322 Ga0068867_1008193221 104
488 3300005539 Ga0068853_100071337 Ga0068853_1000713374 104
489 3300005539 Ga0068853_101858919 Ga0068853_1018589191 104
490 3300005539 Ga0068853_102447775 Ga0068853_1024477751 104
491 3300005539 Ga0068853_102447776 Ga0068853_1024477761 104
492 3300005543 Ga0070672_100100895 Ga0070672_1001008954 104
493 3300005543 Ga0070672_100927183 Ga0070672_1009271832 104
494 3300005548 Ga0070665_100000086 Ga0070665_1000000863 104
495 3300005563 Ga0068855_100412289 Ga0068855_1004122892 104
496 3300005563 Ga0068855_100796856 Ga0068855_1007968561 104
497 3300005564 Ga0070664_100056015 Ga0070664_1000560153 104
498 3300005577 Ga0068857_100058913 Ga0068857_1000589133 104
499 3300005577 Ga0068857_101087689 Ga0068857_1010876892 104
500 3300005577 Ga0068857_101811327 Ga0068857_1018113271 104
501 3300005578 Ga0068854_100999820 Ga0068854_1009998202 104
502 3300005614 Ga0068856_100480168 Ga0068856_1004801682 104
503 3300005617 Ga0068859_100351370 Ga0068859_1003513703 104
504 3300005834 Ga0068851_10099165 Ga0068851_100991652 104
505 3300005834 Ga0068851_10476373 Ga0068851_104763732 104
506 3300005841 Ga0068863_100694677 Ga0068863_1006946772 104
507 3300005841 Ga0068863_101601979 Ga0068863_1016019792 104
508 3300005842 Ga0068858_100461630 Ga0068858_1004616302 104
509 3300005983 Ga0081540_1023244 Ga0081540_10232446 104
510 3300005983 Ga0081540_1197978 Ga0081540_11979781 104
511 3300006042 Ga0075368_10010589 Ga0075368_100105893 104
512 3300006048 Ga0075363_100072096 Ga0075363_1000720962 104
513 3300006048 Ga0075363_100082230 Ga0075363_1000822302 104
514 3300006048 Ga0075363_100836283 Ga0075363_1008362831 104
515 3300006175 Ga0070712_101499456 Ga0070712_1014994562 104
516 3300006177 Ga0075362_10015882 Ga0075362_100158823 104
517 3300006177 Ga0075362_10031824 Ga0075362_100318244 104
518 3300006178 Ga0075367_10011682 Ga0075367_100116821 104
519 3300006178 Ga0075367_10033196 Ga0075367_100331964 104
520 3300006178 Ga0075367_10038940 Ga0075367_100389402 104
521 3300006178 Ga0075367_10081850 Ga0075367_100818501 104
522 3300006178 Ga0075367_10101895 Ga0075367_101018954 104
523 3300006178 Ga0075367_10867946 Ga0075367_108679461 104
524 3300006186 Ga0075369_10010802 Ga0075369_100108024 104
525 3300006186 Ga0075369_10327361 Ga0075369_103273612 104
526 3300006186 Ga0075369_10513602 Ga0075369_105136021 104
527 3300006195 Ga0075366_10070203 Ga0075366_100702033 104
528 3300006195 Ga0075366_10089398 Ga0075366_100893982 104
529 3300006195 Ga0075366_10095246 Ga0075366_100952462 104
530 3300006195 Ga0075366_10126059 Ga0075366_101260592 104
531 3300006353 Ga0075370_10027638 Ga0075370_100276384 104
532 3300006353 Ga0075370_10047574 Ga0075370_100475744 104
533 3300006353 Ga0075370_10055900 Ga0075370_100559002 104
534 3300006353 Ga0075370_10367944 Ga0075370_103679442 104
535 3300006931 Ga0097620_100351368 Ga0097620_1003513682 104
536 3300006946 Ga0079104_1014976 Ga0079104_10149762 104
537 3300009011 Ga0105251_10000369 Ga0105251_100003697 104
538 3300009092 Ga0105250_10491127 Ga0105250_104911272 104
539 3300009093 Ga0105240_10000014 Ga0105240_10000014218 104
540 3300009093 Ga0105240_11353322 Ga0105240_113533222 104
541 3300009101 Ga0105247_10148108 Ga0105247_101481082 104
542 3300009101 Ga0105247_10735451 Ga0105247_107354512 104
543 3300009148 Ga0105243_10000876 Ga0105243_100008763 104
544 3300009148 Ga0105243_10712602 Ga0105243_107126022 104
545 3300009174 Ga0105241_10000002 Ga0105241_10000002738 104
546 3300009174 Ga0105241_10005567 Ga0105241_100055675 104
547 3300009174 Ga0105241_10931017 Ga0105241_109310172 104
548 3300009174 Ga0105241_11959877 Ga0105241_119598772 104
549 3300009177 Ga0105248_10172269 Ga0105248_101722694 104
550 3300009177 Ga0105248_11014793 Ga0105248_110147932 104
551 3300009545 Ga0105237_10003649 Ga0105237_1000364911 104
552 3300009545 Ga0105237_10375797 Ga0105237_103757973 104
553 3300009551 Ga0105238_10636913 Ga0105238_106369132 104
554 3300009763 Ga0123340_1037936 Ga0123340_10379362 104
555 3300009765 Ga0123341_1049312 Ga0123341_10493124 104
556 3300009984 Ga0105029_100323 Ga0105029_1003234 104
557 3300010375 Ga0105239_10052947 Ga0105239_100529476 104
558 3300010375 Ga0105239_10354527 Ga0105239_103545273 104
559 3300010375 Ga0105239_11065166 Ga0105239_110651662 104
560 3300011119 Ga0105246_10316872 Ga0105246_103168722 104
561 3300011119 Ga0105246_10455501 Ga0105246_104555012 104
562 3300011119 Ga0105246_11567229 Ga0105246_115672291 104
563 3300012503 Ga0157313_1057172 Ga0157313_10571721 104
564 3300012506 Ga0157324_1001390 Ga0157324_10013902 104
565 3300013100 Ga0157373_10013901 Ga0157373_100139013 104
566 3300013100 Ga0157373_10277869 Ga0157373_102778692 104
567 3300013100 Ga0157373_10771616 Ga0157373_107716162 104
568 3300013100 Ga0157373_10841490 Ga0157373_108414901 104
569 3300013102 Ga0157371_10000030 Ga0157371_10000030220 104
570 3300013104 Ga0157370_10002430 Ga0157370_1000243015 104
571 3300013104 Ga0157370_12060347 Ga0157370_120603471 104
572 3300013250 Ga0171462_1035 Ga0171462_103527 104
573 3300013296 Ga0157374_10486250 Ga0157374_104862502 104
574 3300013297 Ga0157378_10088835 Ga0157378_100888352 104
575 3300013297 Ga0157378_10929244 Ga0157378_109292442 104
576 3300013306 Ga0163162_10352820 Ga0163162_103528201 104
577 3300013307 Ga0157372_10438607 Ga0157372_104386072 104
578 3300013308 Ga0157375_11105277 Ga0157375_111052771 104
579 3300013308 Ga0157375_12081801 Ga0157375_120818011 104
580 3300014325 Ga0163163_10442110 Ga0163163_104421102 104
581 3300014497 Ga0182008_10023137 Ga0182008_100231372 104
582 3300014497 Ga0182008_10307180 Ga0182008_103071802 104
583 3300015262 Ga0182007_10002682 Ga0182007_100026825 104
584 3300015265 Ga0182005_1005275 Ga0182005_10052755 104
585 3300017792 Ga0163161_10040465 Ga0163161_100404652 104
586 3300022739 Ga0228711_1000004 Ga0228711_1000004110 104
587 3300022740 Ga0228710_1000002 Ga0228710_100000258 104
588 3300025208 Ga0209436_117339 Ga0209436_1173391 104
589 3300025228 Ga0209672_104167 Ga0209672_1041673 104
590 3300025230 Ga0209563_100019 Ga0209563_100019466 104
591 3300025231 Ga0207427_111812 Ga0207427_1118121 104
592 3300025233 Ga0209437_100058 Ga0209437_10005812 104
593 3300025233 Ga0209437_100060 Ga0209437_100060216 104
594 3300025245 Ga0207425_1004668 Ga0207425_10046683 104
595 3300025246 Ga0209646_1004682 Ga0209646_10046822 104
596 3300025246 Ga0209646_1004880 Ga0209646_10048803 104
597 3300025250 Ga0209026_1034944 Ga0209026_10349442 104
598 3300025254 Ga0209148_1000017 Ga0209148_1000017555 104
599 3300025254 Ga0209148_1012535 Ga0209148_10125353 104
600 3300025258 Ga0209129_1002947 Ga0209129_10029474 104
601 3300025261 Ga0209233_1000027 Ga0209233_1000027322 104
602 3300025261 Ga0209233_1000149 Ga0209233_1000149171 104
603 3300025261 Ga0209233_1000160 Ga0209233_100016014 104
604 3300025261 Ga0209233_1002488 Ga0209233_10024884 104
605 3300025272 Ga0209455_1000005 Ga0209455_1000005555 104
606 3300025272 Ga0209455_1021243 Ga0209455_10212432 104
607 3300025272 Ga0209455_1033495 Ga0209455_10334952 104
608 3300025273 Ga0209673_1000015 Ga0209673_1000015135 104
609 3300025273 Ga0209673_1000444 Ga0209673_100044467 104
610 3300025273 Ga0209673_1000632 Ga0209673_100063229 104
611 3300025273 Ga0209673_1006484 Ga0209673_10064845 104
612 3300025284 Ga0209130_1000003 Ga0209130_1000003474 104
613 3300025291 Ga0209675_1020739 Ga0209675_10207391 104
614 3300025292 Ga0209676_1114489 Ga0209676_11144891 104
615 3300025294 Ga0209025_1000082 Ga0209025_100008223 104
616 3300025294 Ga0209025_1000777 Ga0209025_10007772 104
617 3300025294 Ga0209025_1017766 Ga0209025_10177664 104
618 3300025295 Ga0209564_1000128 Ga0209564_100012825 104
619 3300025295 Ga0209564_1000167 Ga0209564_100016756 104
620 3300025295 Ga0209564_1013250 Ga0209564_10132505 104
621 3300025295 Ga0209564_1021534 Ga0209564_10215344 104
622 3300025297 Ga0209758_1000001 Ga0209758_10000011617 104
623 3300025297 Ga0209758_1001112 Ga0209758_100111211 104
624 3300025297 Ga0209758_1004666 Ga0209758_100466613 104
625 3300025298 Ga0209050_1007726 Ga0209050_10077263 104
626 3300025299 Ga0209256_1000511 Ga0209256_100051155 104
627 3300025299 Ga0209256_1000698 Ga0209256_100069825 104
628 3300025299 Ga0209256_1000779 Ga0209256_100077917 104
629 3300025299 Ga0209256_1004380 Ga0209256_10043808 104
630 3300025299 Ga0209256_1044567 Ga0209256_10445671 104
631 3300025299 Ga0209256_1074329 Ga0209256_10743292 104
632 3300025302 Ga0207426_1000011 Ga0207426_1000011302 104
633 3300025302 Ga0207426_1000228 Ga0207426_100022830 104
634 3300025303 Ga0209051_1000119 Ga0209051_100011951 104
635 3300025303 Ga0209051_1083750 Ga0209051_10837502 104
636 3300025304 Ga0209257_1003041 Ga0209257_10030415 104
637 3300025321 Ga0207656_10068624 Ga0207656_100686242 104
638 3300025321 Ga0207656_10257658 Ga0207656_102576582 104
639 3300025735 Ga0207713_1000433 Ga0207713_100043338 104
640 3300025900 Ga0207710_10129073 Ga0207710_101290732 104
641 3300025900 Ga0207710_10396137 Ga0207710_103961372 104
642 3300025901 Ga0207688_10047044 Ga0207688_100470442 104
643 3300025904 Ga0207647_10007295 Ga0207647_100072955 104
644 3300025907 Ga0207645_10150696 Ga0207645_101506962 104
645 3300025907 Ga0207645_10524065 Ga0207645_105240651 104
646 3300025909 Ga0207705_10000531 Ga0207705_1000053110 104
647 3300025911 Ga0207654_10000005 Ga0207654_10000005736 104
648 3300025911 Ga0207654_10000190 Ga0207654_100001906 104
649 3300025913 Ga0207695_10651274 Ga0207695_106512742 104
650 3300025913 Ga0207695_11612158 Ga0207695_116121581 104
651 3300025914 Ga0207671_10003175 Ga0207671_100031754 104
652 3300025914 Ga0207671_11229286 Ga0207671_112292862 104
653 3300025919 Ga0207657_10250007 Ga0207657_102500072 104
654 3300025920 Ga0207649_10011496 Ga0207649_100114963 104
655 3300025920 Ga0207649_10187635 Ga0207649_101876352 104
656 3300025924 Ga0207694_10014797 Ga0207694_100147974 104
657 3300025925 Ga0207650_10436379 Ga0207650_104363792 104
658 3300025926 Ga0207659_11630568 Ga0207659_116305682 104
659 3300025931 Ga0207644_10584291 Ga0207644_105842912 104
660 3300025932 Ga0207690_10001685 Ga0207690_100016857 104
661 3300025932 Ga0207690_10230593 Ga0207690_102305932 104
662 3300025933 Ga0207706_10032436 Ga0207706_100324363 104
663 3300025935 Ga0207709_10000031 Ga0207709_1000003180 104
664 3300025937 Ga0207669_10023094 Ga0207669_100230943 104
665 3300025940 Ga0207691_10123391 Ga0207691_101233913 104
666 3300025941 Ga0207711_11245183 Ga0207711_112451831 104
667 3300025949 Ga0207667_10000004 Ga0207667_10000004365 104
668 3300025949 Ga0207667_10374174 Ga0207667_103741742 104
669 3300025949 Ga0207667_10391968 Ga0207667_103919683 104
670 3300025972 Ga0207668_10201866 Ga0207668_102018662 104
671 3300025981 Ga0207640_10158806 Ga0207640_101588062 104
672 3300025986 Ga0207658_10178336 Ga0207658_101783362 104
673 3300026041 Ga0207639_10687954 Ga0207639_106879541 104
674 3300026041 Ga0207639_11146090 Ga0207639_111460902 104
675 3300026067 Ga0207678_10025795 Ga0207678_100257953 104
676 3300026078 Ga0207702_10000642 Ga0207702_1000064215 104
677 3300026078 Ga0207702_10405162 Ga0207702_104051623 104
678 3300026088 Ga0207641_11131398 Ga0207641_111313982 104
679 3300026089 Ga0207648_11612513 Ga0207648_116125132 104
680 3300026116 Ga0207674_10039054 Ga0207674_100390543 104
681 3300026116 Ga0207674_10049988 Ga0207674_100499886 104
682 3300026116 Ga0207674_11681763 Ga0207674_116817632 104
683 3300026118 Ga0207675_100430439 Ga0207675_1004304391 104
684 3300026121 Ga0207683_10590757 Ga0207683_105907572 104
685 3300026142 Ga0207698_10098344 Ga0207698_100983442 104
686 3300027111 Ga0209281_1000027 Ga0209281_100002751 104
687 3300027111 Ga0209281_1000030 Ga0209281_1000030201 104
688 3300027111 Ga0209281_1005132 Ga0209281_10051322 104
689 3300027312 Ga0209371_1003138 Ga0209371_10031384 104
690 3300027312 Ga0209371_1005523 Ga0209371_10055232 104
691 3300027666 Ga0209282_1000004 Ga0209282_1000004201 104
692 3300027866 Ga0209813_10189206 Ga0209813_101892062 104
693 3300028379 Ga0268266_10000002 Ga0268266_100000022556 104
694 3300028786 Ga0307517_10035306 Ga0307517_100353065 104
695 3300028794 Ga0307515_10211918 Ga0307515_102119181 104
696 3300028794 Ga0307515_10278783 Ga0307515_102787833 104
697 3300030500 Ga0268256_1003000 Ga0268256_10030004 104
698 3300030500 Ga0268256_1005446 Ga0268256_10054462 104
699 3300031456 Ga0307513_10057611 Ga0307513_100576113 104
700 3300031456 Ga0307513_10121454 Ga0307513_101214544 104
701 3300031548 Ga0307408_101356032 Ga0307408_1013560321 104
702 3300031967 Ga0315914_1000001 Ga0315914_1000001182 104
703 3300032002 Ga0307416_103218961 Ga0307416_1032189612 104
704 3300033180 Ga0307510_10000011 Ga0307510_1000001155 104
705 3300033180 Ga0307510_10079312 Ga0307510_100793121 104
706 3300033430 Ga0315913_1000004 Ga0315913_1000004118 104
707 3300033464 Ga0315915_1000002 Ga0315915_1000002202 104
708 3300037312 Ga0395899_0000124 Ga0395899_0000124_12078_12392 104
709 3300037312 Ga0395899_0175133 Ga0395899_0175133_97_411 104
710 3300037418 Ga0395900_0000086 Ga0395900_0000086_159358_159672 104
711 3300037418 Ga0395900_0174189 Ga0395900_0174189_1217_1531 104
712 3300037466 Ga0395898_0000285 Ga0395898_0000285_12078_12392 104
713 3300037466 Ga0395898_0153809 Ga0395898_0153809_470_784 104
714 3300037471 Ga0395905_0000133 Ga0395905_0000133_111109_111423 104
715 3300037471 Ga0395905_0000708 Ga0395905_0000708_28633_28947 104
716 3300037471 Ga0395905_0052156 Ga0395905_0052156_430_744 104
717 3300037471 Ga0395905_0716144 Ga0395905_0716144_389_703 104
718 3300038443 Ga0395901_0000092 Ga0395901_0000092_109585_109899 104
719 3300038443 Ga0395901_0231252 Ga0395901_0231252_906_1220 104
720 3300041404 Ga0439436_0208714 Ga0439436_0208714_58_372 104
721 3300041406 Ga0439439_0022183 Ga0439439_0022183_157_471 104
722 3300041411 Ga0439466_0054777 Ga0439466_0054777_948_1262 104
723 3300041413 Ga0439465_0004865 Ga0439465_0004865_3357_3671 104
724 3300041441 Ga0451787_009036 Ga0451787_009036_54_368 104
725 3300041443 Ga0451789_0480782 Ga0451789_0480782_170_484 104
726 3300041443 Ga0451789_1366789 Ga0451789_1366789_28_342 104
727 3300041451 Ga0451791_1927112 Ga0451791_1927112_772_1086 104
728 3300041452 Ga0451793_1189160 Ga0451793_1189160_293_607 104
729 3300041452 Ga0451793_1769180 Ga0451793_1769180_27_341 104
730 3300041453 Ga0451797_0233108 Ga0451797_0233108_191_505 104
731 3300041458 Ga0451798_0280811 Ga0451798_0280811_153_467 104
732 3300041491 Ga0451833_0288120 Ga0451833_0288120_97_411 104
733 3300041491 Ga0451833_1293662 Ga0451833_1293662_569_883 104
734 3300041492 Ga0451835_0115932 Ga0451835_0115932_2169_2483 104
735 3300041494 Ga0451837_0858072 Ga0451837_0858072_2010_2324 104
736 3300041496 Ga0451839_1208629 Ga0451839_1208629_635_949 104
737 3300041498 Ga0451841_1002243 Ga0451841_1002243_1376_1690 104
738 3300041501 Ga0451845_0135496 Ga0451845_0135496_531_845 104
739 3300041503 Ga0451847_0865164 Ga0451847_0865164_2010_2324 104
740 3300041505 Ga0451849_0254647 Ga0451849_0254647_710_1024 104
741 3300041505 Ga0451849_0818881 Ga0451849_0818881_719_1033 104
742 3300041507 Ga0451851_0621237 Ga0451851_0621237_4295_4609 104
743 3300041509 Ga0451843_0438760 Ga0451843_0438760_383_697 104
744 3300041509 Ga0451843_0855835 Ga0451843_0855835_709_1023 104
745 3300041511 Ga0451855_0075806 Ga0451855_0075806_1877_2191 104
746 3300041511 Ga0451855_0545569 Ga0451855_0545569_298_612 104
747 3300041511 Ga0451855_1285604 Ga0451855_1285604_326_640 104
748 3300041512 Ga0451853_1332446 Ga0451853_1332446_1823_2137 104
749 3300041916 Ga0452271_32988 Ga0452271_32988_679_993 104
750 3300042006 Ga0439432_027058 Ga0439432_027058_1372_1686 104
751 3300042007 Ga0439449_0049692 Ga0439449_0049692_53_367 104
752 3300042157 Ga0439458_0084563 Ga0439458_0084563_181_495 104
753 3300044684 Ga0466966_0022293 Ga0466966_0022293_1185_1499 104
754 3300044684 Ga0466966_0414228 Ga0466966_0414228_294_608 104
755 3300044694 Ga0466963_0013253 Ga0466963_0013253_1661_1975 104
756 3300044765 Ga0466970_0005599 Ga0466970_0005599_2742_3056 104
757 3300045049 Ga0466959_0607522 Ga0466959_0607522_392_706 104
758 3300045836 Ga0466958_0024660 Ga0466958_0024660_360_674 104
759 3300045976 Ga0466967_0035126 Ga0466967_0035126_2879_3193 104
760 3300045976 Ga0466967_0716795 Ga0466967_0716795_241_555 104
761 3300046452 Ga0495617_113010 Ga0495617_113010_481_795 104
762 3300046454 Ga0495592_0130418 Ga0495592_0130418_1325_1639 104
763 3300046457 Ga0495590_0022129 Ga0495590_0022129_424_738 104
764 3300046459 Ga0495629_0027370 Ga0495629_0027370_3254_3568 104
765 3300046459 Ga0495629_0119793 Ga0495629_0119793_1201_1515 104
766 3300046460 Ga0495638_0000093 Ga0495638_0000093_102046_102360 104
767 3300046460 Ga0495638_0263150 Ga0495638_0263150_457_771 104
768 3300046460 Ga0495638_0333956 Ga0495638_0333956_192_506 104
769 3300046460 Ga0495638_0510587 Ga0495638_0510587_226_540 104
770 3300046461 Ga0495641_0495028 Ga0495641_0495028_167_481 104
771 3300046462 Ga0495651_0609048 Ga0495651_0609048_166_480 104
772 3300046474 Ga0495605_0008910 Ga0495605_0008910_4403_4717 104
773 3300046474 Ga0495605_0071440 Ga0495605_0071440_282_596 104
774 3300046476 Ga0495662_0006422 Ga0495662_0006422_2120_2434 104
775 3300046477 Ga0495664_0258902 Ga0495664_0258902_250_564 104
776 3300046491 Ga0495584_0059752 Ga0495584_0059752_199_513 104
777 3300046492 Ga0495585_0007993 Ga0495585_0007993_1880_2194 104
778 3300046492 Ga0495585_0054170 Ga0495585_0054170_889_1203 104
779 3300046492 Ga0495585_0178384 Ga0495585_0178384_50_364 104
780 3300046492 Ga0495585_0297485 Ga0495585_0297485_257_571 104
781 3300046500 Ga0495596_0167059 Ga0495596_0167059_500_814 104
782 3300046501 Ga0495607_0054379 Ga0495607_0054379_289_603 104
783 3300046501 Ga0495607_0079096 Ga0495607_0079096_1161_1475 104
784 3300046506 Ga0495583_0019150 Ga0495583_0019150_1172_1486 104
785 3300046506 Ga0495583_0032644 Ga0495583_0032644_1722_2036 104
786 3300046506 Ga0495583_0090028 Ga0495583_0090028_977_1291 104
787 3300046506 Ga0495583_0309063 Ga0495583_0309063_287_601 104
788 3300046507 Ga0495606_0000824 Ga0495606_0000824_8897_9211 104
789 3300046507 Ga0495606_0059620 Ga0495606_0059620_398_712 104
790 3300046507 Ga0495606_0133747 Ga0495606_0133747_94_408 104
791 3300046511 Ga0495608_0346508 Ga0495608_0346508_197_511 104
792 3300046512 Ga0495610_0034443 Ga0495610_0034443_11_325 104
793 3300046512 Ga0495610_0088790 Ga0495610_0088790_22_336 104
794 3300046512 Ga0495610_0172330 Ga0495610_0172330_11_325 104
795 3300046512 Ga0495610_0248186 Ga0495610_0248186_358_672 104
796 3300046512 Ga0495610_0387000 Ga0495610_0387000_132_446 104
797 3300046513 Ga0495616_0061252 Ga0495616_0061252_1038_1352 104
798 3300046513 Ga0495616_0191163 Ga0495616_0191163_49_363 104
799 3300046514 Ga0495618_0929597 Ga0495618_0929597_86_400 104
800 3300046515 Ga0495620_0050209 Ga0495620_0050209_857_1171 104
801 3300046515 Ga0495620_0099005 Ga0495620_0099005_489_803 104
802 3300046515 Ga0495620_0099772 Ga0495620_0099772_202_516 104
803 3300046515 Ga0495620_0267207 Ga0495620_0267207_324_638 104
804 3300046516 Ga0495628_0701113 Ga0495628_0701113_229_543 104
805 3300046518 Ga0495631_0022213 Ga0495631_0022213_1652_1966 104
806 3300046518 Ga0495631_0195983 Ga0495631_0195983_242_556 104
807 3300046518 Ga0495631_0200943 Ga0495631_0200943_164_478 104
808 3300046519 Ga0495632_0029196 Ga0495632_0029196_314_628 104
809 3300046519 Ga0495632_0094675 Ga0495632_0094675_254_568 104
810 3300046519 Ga0495632_0121635 Ga0495632_0121635_427_741 104
811 3300046519 Ga0495632_0165026 Ga0495632_0165026_319_633 104
812 3300046520 Ga0495637_0059138 Ga0495637_0059138_523_837 104
813 3300046522 Ga0495643_0008432 Ga0495643_0008432_3983_4297 104
814 3300046522 Ga0495643_0012592 Ga0495643_0012592_1733_2047 104
815 3300046522 Ga0495643_0040090 Ga0495643_0040090_1754_2068 104
816 3300046522 Ga0495643_0045805 Ga0495643_0045805_126_440 104
817 3300046522 Ga0495643_0054076 Ga0495643_0054076_1208_1522 104
818 3300046522 Ga0495643_0167123 Ga0495643_0167123_435_749 104
819 3300046523 Ga0495644_0455622 Ga0495644_0455622_20_334 104
820 3300046524 Ga0495648_0018594 Ga0495648_0018594_930_1244 104
821 3300046524 Ga0495648_0113568 Ga0495648_0113568_271_585 104
822 3300046524 Ga0495648_0127431 Ga0495648_0127431_74_388 104
823 3300046524 Ga0495648_0394044 Ga0495648_0394044_277_591 104
824 3300046525 Ga0495663_0400426 Ga0495663_0400426_83_397 104
825 3300046528 Ga0495642_0013708 Ga0495642_0013708_1570_1884 104
826 3300046530 Ga0495654_0045879 Ga0495654_0045879_1246_1560 104
827 3300046536 Ga0495587_0077273 Ga0495587_0077273_506_820 104
828 3300046538 Ga0495609_0043790 Ga0495609_0043790_667_981 104
829 3300046542 Ga0495597_0208454 Ga0495597_0208454_144_458 104
830 3300046542 Ga0495597_0303454 Ga0495597_0303454_251_565 104
831 3300046542 Ga0495597_0329093 Ga0495597_0329093_179_493 104
832 3300046557 Ga0495622_0048654 Ga0495622_0048654_1309_1623 104
833 3300046557 Ga0495622_0056197 Ga0495622_0056197_318_632 104
834 3300046557 Ga0495622_0421421 Ga0495622_0421421_247_561 104
835 3300046558 Ga0495633_0028150 Ga0495633_0028150_345_659 104
836 3300046616 Ga0495668_0000007 Ga0495668_0000007_205836_206150 104
837 3300046616 Ga0495668_0151877 Ga0495668_0151877_600_914 104
838 3300046616 Ga0495668_0499030 Ga0495668_0499030_62_376 104
839 3300046648 Ga0495611_0110563 Ga0495611_0110563_562_876 104
840 3300046648 Ga0495611_0287785 Ga0495611_0287785_180_494 104
841 3300046660 Ga0495625_0009233 Ga0495625_0009233_1954_2268 104
842 3300046660 Ga0495625_0025308 Ga0495625_0025308_2216_2530 104
843 3300046660 Ga0495625_0032058 Ga0495625_0032058_2920_3234 104
844 3300046660 Ga0495625_0062794 Ga0495625_0062794_1044_1358 104
845 3300046660 Ga0495625_0101544 Ga0495625_0101544_1141_1455 104
846 3300046660 Ga0495625_0140798 Ga0495625_0140798_952_1266 104
847 3300046660 Ga0495625_0259542 Ga0495625_0259542_160_474 104
848 3300046660 Ga0495625_0448971 Ga0495625_0448971_182_496 104
849 3300046660 Ga0495625_0739344 Ga0495625_0739344_229_543 104
850 3300046663 Ga0495635_0303968 Ga0495635_0303968_462_776 104
851 3300046665 Ga0495661_0071358 Ga0495661_0071358_1212_1526 104
852 3300046674 Ga0495588_0029503 Ga0495588_0029503_2209_2523 104
853 3300046675 Ga0495657_0069096 Ga0495657_0069096_335_649 104
854 3300046679 Ga0495623_0303680 Ga0495623_0303680_297_611 104
855 3300046683 Ga0495658_0099167 Ga0495658_0099167_442_756 104
856 3300046684 Ga0495669_0000286 Ga0495669_0000286_1172_1486 104
857 3300046684 Ga0495669_0195018 Ga0495669_0195018_55_369 104
858 3300046691 Ga0495670_0096288 Ga0495670_0096288_1158_1472 104
859 3300046691 Ga0495670_0254016 Ga0495670_0254016_370_684 104
860 3300046691 Ga0495670_0356695 Ga0495670_0356695_307_621 104
861 3300046692 Ga0495671_0067789 Ga0495671_0067789_89_403 104
862 3300046692 Ga0495671_0170616 Ga0495671_0170616_409_723 104
863 3300046694 Ga0495649_0041168 Ga0495649_0041168_451_765 104
864 3300046694 Ga0495649_0296285 Ga0495649_0296285_252_566 104
865 3300046694 Ga0495649_0483903 Ga0495649_0483903_199_513 104
866 3300046794 Ga0495589_0361816 Ga0495589_0361816_73_387 104
867 3300046809 Ga0495600_0013303 Ga0495600_0013303_3752_4066 104
868 3300046809 Ga0495600_0158515 Ga0495600_0158515_561_875 104
869 3300046810 Ga0495660_0057164 Ga0495660_0057164_1628_1942 104
870 3300046810 Ga0495660_0081616 Ga0495660_0081616_101_415 104
871 3300046810 Ga0495660_0273399 Ga0495660_0273399_151_465 104
872 3300047317 Ga0495604_0041874 Ga0495604_0041874_1013_1327 104
873 3300047318 Ga0495636_0028360 Ga0495636_0028360_1202_1516 104
874 3300047319 Ga0495674_0296225 Ga0495674_0296225_276_590 104
875 3300047320 Ga0495672_0010499 Ga0495672_0010499_6046_6360 104
876 3300047320 Ga0495672_0064415 Ga0495672_0064415_167_481 104
877 3300047323 Ga0495683_0030887 Ga0495683_0030887_192_506 104
878 3300047323 Ga0495683_0114590 Ga0495683_0114590_473_787 104
879 3300047443 Ga0495687_004439 Ga0495687_004439_1993_2307 104
880 3300047443 Ga0495687_033771 Ga0495687_033771_89_403 104
881 3300047443 Ga0495687_043138 Ga0495687_043138_512_826 104
882 3300047443 Ga0495687_082838 Ga0495687_082838_177_491 104
883 3300047445 Ga0495677_0003044 Ga0495677_0003044_3250_3564 104
884 3300047447 Ga0495685_125884 Ga0495685_125884_383_697 104
885 3300047472 Ga0495686_0006640 Ga0495686_0006640_1432_1746 104
886 3300047472 Ga0495686_0076698 Ga0495686_0076698_1042_1356 104
887 3300047472 Ga0495686_0229134 Ga0495686_0229134_72_386 104
888 3300048090 Ga0495615_0073288 Ga0495615_0073288_123_437 104
889 3300048090 Ga0495615_0228566 Ga0495615_0228566_220_534 104
890 3300048091 Ga0495626_0210280 Ga0495626_0210280_384_698 104
891 3300048903 Ga0496100_0048000 Ga0496100_0048000_1986_2300 104
892 3300048904 Ga0496101_0210476 Ga0496101_0210476_469_783 104
893 3300048905 Ga0496102_0013152 Ga0496102_0013152_2809_3123 104
894 3300048906 Ga0496103_0029238 Ga0496103_0029238_2516_2830 104
895 3300048909 Ga0496106_0254693 Ga0496106_0254693_248_562 104
896 3300048916 Ga0496113_0104885 Ga0496113_0104885_1816_2130 104
897 3300048916 Ga0496113_0522196 Ga0496113_0522196_180_494 104
898 3300048917 Ga0496114_0137219 Ga0496114_0137219_1785_2099 104
899 3300048919 Ga0496116_0063997 Ga0496116_0063997_750_1064 104
900 3300048919 Ga0496116_0148259 Ga0496116_0148259_619_933 104
901 3300048920 Ga0496117_0017033 Ga0496117_0017033_2879_3193 104
902 3300048920 Ga0496117_0039544 Ga0496117_0039544_1388_1702 104
903 3300048920 Ga0496117_0223485 Ga0496117_0223485_146_460 104
904 3300048920 Ga0496117_0372493 Ga0496117_0372493_229_543 104
905 3300048921 Ga0496118_0010015 Ga0496118_0010015_3850_4164 104
906 3300048921 Ga0496118_0015441 Ga0496118_0015441_2939_3253 104
907 3300048922 Ga0496119_0021565 Ga0496119_0021565_1651_1965 104
908 3300048922 Ga0496119_0058856 Ga0496119_0058856_1095_1409 104
909 3300048922 Ga0496119_0075305 Ga0496119_0075305_1337_1651 104
910 3300048923 Ga0496120_0009952 Ga0496120_0009952_1592_1906 104
911 3300048923 Ga0496120_0017730 Ga0496120_0017730_3756_4070 104
912 3300048923 Ga0496120_0276781 Ga0496120_0276781_332_646 104
913 3300048923 Ga0496120_0356853 Ga0496120_0356853_244_558 104
914 3300048924 Ga0496121_0016095 Ga0496121_0016095_2882_3196 104
915 3300048924 Ga0496121_0137814 Ga0496121_0137814_575_889 104
916 3300048924 Ga0496121_0165013 Ga0496121_0165013_375_689 104
917 3300048924 Ga0496121_0431606 Ga0496121_0431606_33_347 104
918 3300048925 Ga0496122_0015011 Ga0496122_0015011_2782_3096 104
919 3300048925 Ga0496122_0046216 Ga0496122_0046216_2856_3170 104
920 3300048925 Ga0496122_0160967 Ga0496122_0160967_713_1027 104
921 3300048926 Ga0496123_0025175 Ga0496123_0025175_2095_2409 104
922 3300048926 Ga0496123_0032283 Ga0496123_0032283_2702_3016 104
923 3300048926 Ga0496123_0055962 Ga0496123_0055962_17_331 104
924 3300048926 Ga0496123_0075063 Ga0496123_0075063_1117_1431 104
925 3300048927 Ga0496124_0072586 Ga0496124_0072586_1633_1947 104
926 3300048928 Ga0496125_0024814 Ga0496125_0024814_2728_3042 104
927 3300048928 Ga0496125_0135213 Ga0496125_0135213_568_882 104
928 3300048928 Ga0496125_0502145 Ga0496125_0502145_178_492 104
929 3300048928 Ga0496125_0592916 Ga0496125_0592916_43_357 104
930 3300048929 Ga0496126_0188156 Ga0496126_0188156_1040_1354 104
931 3300048929 Ga0496126_0211504 Ga0496126_0211504_355_669 104
932 3300048929 Ga0496126_0314240 Ga0496126_0314240_466_780 104
933 3300048929 Ga0496126_0795984 Ga0496126_0795984_248_562 104
934 3300049459 Ga0495678_067447 Ga0495678_067447_366_680 104
935 3300049459 Ga0495678_069850 Ga0495678_069850_459_773 104
936 3300049459 Ga0495678_164241 Ga0495678_164241_152_466 104
937 3300049460 Ga0495682_0037223 Ga0495682_0037223_878_1192 104
938 3300049460 Ga0495682_0170892 Ga0495682_0170892_142_456 104
939 3300049569 Ga0501032_0167109 Ga0501032_0167109_1086_1400 104
940 3300049570 Ga0501033_0227499 Ga0501033_0227499_421_735 104
941 3300049571 Ga0501034_0096373 Ga0501034_0096373_1649_1963 104
942 3300049572 Ga0501036_0061122 Ga0501036_0061122_2697_3011 104
943 3300049573 Ga0501037_0077798 Ga0501037_0077798_405_719 104
944 3300049574 Ga0501038_0027079 Ga0501038_0027079_1243_1557 104
945 3300049575 Ga0501039_0140053 Ga0501039_0140053_1544_1858 104
946 3300049579 Ga0501043_0856615 Ga0501043_0856615_49_363 104
947 3300049579 Ga0501043_1249210 Ga0501043_1249210_91_405 104
948 3300049581 Ga0501047_0650773 Ga0501047_0650773_531_845 104
949 3300049584 Ga0501068_0209106 Ga0501068_0209106_388_702 104
950 3300049586 Ga0501070_0694987 Ga0501070_0694987_255_569 104
951 3300049589 Ga0501073_0030504 Ga0501073_0030504_351_665 104
952 3300049589 Ga0501073_0174433 Ga0501073_0174433_678_992 104
953 3300049742 Ga0501080_0023538 Ga0501080_0023538_4030_4344 104
954 3300049744 Ga0501083_0022340 Ga0501083_0022340_2020_2334 104
955 3300049744 Ga0501083_0166579 Ga0501083_0166579_1102_1416 104
956 3300049822 Ga0501035_0133623 Ga0501035_0133623_802_1116 104
957 3300049823 Ga0501044_0052412 Ga0501044_0052412_127_441 104
958 3300050489 nmdc:mga03683_558269_c1 nmdc:mga03683_558269_c1_48_362 104
959 3300050490 nmdc:mga03n38_117565_c1 nmdc:mga03n38_117565_c1_793_1107 104
960 3300050490 nmdc:mga03n38_177718_c1 nmdc:mga03n38_177718_c1_235_549 104
961 3300050490 nmdc:mga03n38_2491_c1 nmdc:mga03n38_2491_c1_4212_4526 104
962 3300050491 nmdc:mga00v17_708607_c1 nmdc:mga00v17_708607_c1_52_366 104
963 3300050492 nmdc:mga0yw44_400772_c1 nmdc:mga0yw44_400772_c1_594_908 104
964 3300050493 nmdc:mga0k408_35607_c1 nmdc:mga0k408_35607_c1_913_1227 104
965 3300050494 nmdc:mga06z11_369289_c1 nmdc:mga06z11_369289_c1_494_808 104
966 3300050494 nmdc:mga06z11_54721_c1 nmdc:mga06z11_54721_c1_1142_1456 104
967 3300050494 nmdc:mga06z11_578319_c1 nmdc:mga06z11_578319_c1_108_422 104
968 3300050494 nmdc:mga06z11_868650_c1 nmdc:mga06z11_868650_c1_80_394 104
969 3300050495 nmdc:mga04h51_103694_c1 nmdc:mga04h51_103694_c1_529_843 104
970 3300050496 nmdc:mga07m45_26717_c1 nmdc:mga07m45_26717_c1_551_865 104
971 3300050496 nmdc:mga07m45_338095_c1 nmdc:mga07m45_338095_c1_43_357 104
972 3300050496 nmdc:mga07m45_3505_c3 nmdc:mga07m45_3505_c3_677_991 104
973 3300050496 nmdc:mga07m45_375506_c1 nmdc:mga07m45_375506_c1_193_507 104
974 3300050516 nmdc:mga0sz30_18519_c1 nmdc:mga0sz30_18519_c1_202_516 104
975 3300050516 nmdc:mga0sz30_279812_c1 nmdc:mga0sz30_279812_c1_144_458 104
976 3300050516 nmdc:mga0sz30_329384_c1 nmdc:mga0sz30_329384_c1_44_358 104
977 3300050516 nmdc:mga0sz30_414583_c1 nmdc:mga0sz30_414583_c1_21_335 104
978 3300050516 nmdc:mga0sz30_457670_c1 nmdc:mga0sz30_457670_c1_181_495 104
979 3300053079 Ga0500610_0000140 Ga0500610_0000140_13268_13582 104
980 3300053080 Ga0500635_0252205 Ga0500635_0252205_287_601 104
981 3300053083 Ga0495655_0034011 Ga0495655_0034011_845_1159 104
982 3300053085 Ga0495619_0305738 Ga0495619_0305738_477_791 104
983 3300053086 Ga0500578_0125959 Ga0500578_0125959_914_1228 104
984 3300053086 Ga0500578_0164851 Ga0500578_0164851_201_515 104
985 3300053087 Ga0500643_043167 Ga0500643_043167_184_498 104
986 3300053093 Ga0500651_0117980 Ga0500651_0117980_510_824 104
987 3300053098 Ga0500650_0262282 Ga0500650_0262282_120_434 104
988 3300053099 Ga0500654_192564 Ga0500654_192564_156_470 104
989 3300053109 Ga0500569_129751 Ga0500569_129751_399_713 104
990 3300053109 Ga0500569_318291 Ga0500569_318291_27_341 104
991 3300053118 Ga0500594_0007898 Ga0500594_0007898_859_1173 104
992 3300053118 Ga0500594_0186761 Ga0500594_0186761_133_447 104
993 3300053119 Ga0500595_004282 Ga0500595_004282_5983_6297 104
994 3300053119 Ga0500595_010172 Ga0500595_010172_2919_3233 104
995 3300053121 Ga0500607_053714 Ga0500607_053714_923_1237 104
996 3300053121 Ga0500607_141440 Ga0500607_141440_156_470 104
997 3300053125 Ga0500618_005797 Ga0500618_005797_2648_2962 104
998 3300053130 Ga0500642_0000153 Ga0500642_0000153_2075_2389 104
999 3300053134 Ga0500658_0003673 Ga0500658_0003673_2379_2693 104
1000 3300053139 Ga0500568_0000137 Ga0500568_0000137_11748_12062 104
1001 3300053139 Ga0500568_0000825 Ga0500568_0000825_17680_17994 104
1002 3300053142 Ga0500577_0111971 Ga0500577_0111971_332_646 104
1003 3300053142 Ga0500577_0120812 Ga0500577_0120812_682_996 104
1004 3300053146 Ga0500588_0115528 Ga0500588_0115528_327_641 104
1005 3300053148 Ga0500590_010218 Ga0500590_010218_1338_1652 104
1006 3300053151 Ga0500604_0000014 Ga0500604_0000014_85738_86052 104
1007 3300053153 Ga0500616_0003922 Ga0500616_0003922_6364_6678 104
1008 3300053153 Ga0500616_0005323 Ga0500616_0005323_3908_4222 104
1009 3300053153 Ga0500616_0051437 Ga0500616_0051437_1208_1522 104
1010 3300053153 Ga0500616_0107076 Ga0500616_0107076_1032_1346 104
1011 3300053156 Ga0500622_0008480 Ga0500622_0008480_4625_4939 104
1012 3300053157 Ga0500624_129640 Ga0500624_129640_168_482 104
1013 3300053158 Ga0500627_0128507 Ga0500627_0128507_384_698 104
1014 3300053158 Ga0500627_0150025 Ga0500627_0150025_140_454 104
1015 3300053160 Ga0500633_0202629 Ga0500633_0202629_161_475 104
1016 3300053161 Ga0500634_0039678 Ga0500634_0039678_1236_1550 104
1017 3300053177 Ga0500636_0028586 Ga0500636_0028586_779_1093 104
1018 3300053177 Ga0500636_0209036 Ga0500636_0209036_404_718 104
1019 3300053730 Ga0500645_000080 Ga0500645_000080_27546_27860 104
1020 3300053730 Ga0500645_060522 Ga0500645_060522_680_994 104
1021 3300053730 Ga0500645_125620 Ga0500645_125620_379_693 104
1022 3300053735 Ga0500596_002571 Ga0500596_002571_1133_1447 104
1023 3300053737 Ga0500601_004212 Ga0500601_004212_568_882 104
1024 3300054114 Ga0501084_1795822 Ga0501084_1795822_113_427 104
1025 3300055283 Ga0500661_059991 Ga0500661_059991_257_571 104
1026 3300060353 Ga0501082_1371466 Ga0501082_1371466_44_358 104
1027 iso_pu_bacteria 3000135777 3000138478 104
1028 3300001904 JGI24736J21556_1019435 JGI24736J21556_10194352 110
1029 3300005331 Ga0070670_100478173 Ga0070670_1004781732 110
1030 3300005539 Ga0068853_100755317 Ga0068853_1007553171 110
1031 3300012513 Ga0157326_1005515 Ga0157326_10055152 110
1032 3300013102 Ga0157371_11060191 Ga0157371_110601912 110
1033 3300025250 Ga0209026_1020525 Ga0209026_10205251 110
1034 3300025919 Ga0207657_11378601 Ga0207657_113786012 110
1035 3300046475 Ga0495639_0147246 Ga0495639_0147246_625_957 110
1036 3300046524 Ga0495648_0000303 Ga0495648_0000303_50168_50500 110
1037 3300046557 Ga0495622_0119506 Ga0495622_0119506_348_680 110
1038 3300046674 Ga0495588_0416707 Ga0495588_0416707_218_550 110
1039 3300047443 Ga0495687_013793 Ga0495687_013793_1960_2292 110
1040 3300048905 Ga0496102_0011729 Ga0496102_0011729_2528_2860 110
1041 3300048906 Ga0496103_0000836 Ga0496103_0000836_4410_4742 110
1042 3300048907 Ga0496104_0052957 Ga0496104_0052957_1144_1476 110
1043 3300048908 Ga0496105_0114733 Ga0496105_0114733_807_1139 110
1044 3300048913 Ga0496110_0070499 Ga0496110_0070499_714_1046 110
1045 3300048914 Ga0496111_0007641 Ga0496111_0007641_2598_2930 110
1046 3300048918 Ga0496115_0002445 Ga0496115_0002445_8497_8829 110
1047 3300048919 Ga0496116_0017799 Ga0496116_0017799_4659_4991 110
1048 3300048920 Ga0496117_0000182 Ga0496117_0000182_60001_60333 110
1049 3300048921 Ga0496118_0000125 Ga0496118_0000125_67704_68036 110
1050 3300048922 Ga0496119_0010214 Ga0496119_0010214_3742_4074 110
1051 3300048924 Ga0496121_0007290 Ga0496121_0007290_4644_4976 110
1052 3300048926 Ga0496123_0024694 Ga0496123_0024694_2033_2365 110
1053 3300048927 Ga0496124_0000082 Ga0496124_0000082_68372_68704 110
1054 3300048928 Ga0496125_0002269 Ga0496125_0002269_3687_4019 110
1055 3300048929 Ga0496126_0000221 Ga0496126_0000221_56162_56494 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

18

64

0.98

PF12840

HTH_20

Helix-turn-helix domain

16

65

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9273 6 86
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9192 18 75
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9164 20 77
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9138 6 85
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9016 5 92
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9498 18 74 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9419 16 80 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9363 18 75 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9351 14 77 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9338 6 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1S2J3F8-F1-model_v4 deleted 0.9701 6 91
AF-A0A1G7HSF5-F1-model_v4 Transcriptional regulator, ArsR family 0.9696 7 89 GO:0003700
AF-A0A3D5I9A4-F1-model_v4 Transcriptional regulator 0.9648 3 91 GO:0003700
AF-A0A0R2IM56-F1-model_v4 deleted 0.9625 7 90
AF-K2AR67-F1-model_v4 HTH arsR-type domain-containing protein 0.9607 7 93 GO:0003700

Feature Viewer

pLDDT pTM Quality
90.85 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map