F489143
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 723 | 717 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1019435|JGI24736J21556_10194352 |
| Length | 110 |
| Sequence | MRLSVDMIENELFKALADPTRRAIFEKLASGSMNASALRDGMKISQPAMSQHLAVLRTARLVREERQGRFVNYEVDPEGLALIATWLTKYRAYWPARIDALKILLKDMDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 2 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 3 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 4 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 5 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 6 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 7 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 8 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 9 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 10 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 11 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 12 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 13 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 14 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 15 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 16 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 17 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 18 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 19 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 20 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 21 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 22 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 23 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 24 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 25 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 26 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 27 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 28 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 29 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 30 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 31 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 32 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 33 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 34 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 35 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 36 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 37 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 38 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 39 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 40 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 41 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 42 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 43 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 44 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 45 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 46 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 47 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 48 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 49 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 50 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 51 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 52 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 53 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 54 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 55 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 56 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 57 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 58 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 59 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 60 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 61 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 62 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 63 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 64 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 65 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 66 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 67 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 68 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 69 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 70 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 71 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 72 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 73 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 74 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 75 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 76 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 77 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 78 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 79 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 80 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 81 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 82 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 83 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 84 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 85 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 86 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 87 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 88 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 89 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 90 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 91 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 92 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 93 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 94 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 95 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 96 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 97 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 98 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 99 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 100 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 101 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 102 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 103 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 104 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 105 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 106 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 107 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 108 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 109 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 110 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 111 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 112 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 113 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 114 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 115 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 116 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 117 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 118 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 119 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 120 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 121 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 122 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 123 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 124 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 125 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 126 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 127 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 128 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 129 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 130 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 131 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 132 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 133 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 134 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 135 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 136 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 137 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 138 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 139 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 140 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 141 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 142 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 143 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 144 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 145 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 146 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 147 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 148 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 149 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 150 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 151 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 152 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 153 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 154 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 155 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 156 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 157 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 158 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 159 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 160 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 161 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 162 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 163 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 164 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 165 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 166 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 167 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 168 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 169 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 170 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 171 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 172 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 173 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 174 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 175 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 176 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 177 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 178 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 179 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 180 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 181 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 182 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 183 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 184 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 185 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 186 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 187 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 188 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 189 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 190 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 191 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 192 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 193 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 194 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 195 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 196 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 197 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 198 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 199 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 200 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 201 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 202 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 203 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 204 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 205 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 206 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 207 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 208 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 209 | 2922368715 | |||
| 210 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 211 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 212 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 213 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 214 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 215 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 216 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 217 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 218 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 219 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 220 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 221 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 222 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 223 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 224 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 225 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 226 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 227 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 228 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 229 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 230 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 231 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 232 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 233 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 234 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 235 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 236 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 237 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 238 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 239 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 240 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 241 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 242 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 243 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 244 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 245 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 246 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 247 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 248 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 249 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 250 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 251 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 252 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 253 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 254 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 255 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 256 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 257 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 258 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 259 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 260 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 261 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 262 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 263 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 264 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 265 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 266 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 267 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 268 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 269 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 270 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 271 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 272 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 273 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 274 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 275 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 276 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 277 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 278 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 279 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 280 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 281 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 282 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 283 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 284 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 285 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 286 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 287 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 288 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 289 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 290 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 291 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 292 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 293 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 294 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 295 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 296 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 297 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 298 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 299 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 300 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 301 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 302 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 303 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 304 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 305 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 306 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 307 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 308 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 309 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 310 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 311 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 312 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 313 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 314 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 315 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 316 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 317 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 318 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 319 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 320 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 321 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 322 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 323 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 324 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 325 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 326 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 327 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 328 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 329 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 330 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 331 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 332 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 335 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 337 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 340 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 341 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 342 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 343 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 344 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 345 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 347 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 348 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 350 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 351 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 352 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 353 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 354 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 355 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 356 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 357 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 358 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 360 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 361 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 362 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 363 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 364 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 365 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 366 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 367 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 369 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 370 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 371 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 372 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 373 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 374 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 375 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 376 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 377 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 378 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 379 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 380 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 381 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 384 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 385 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 386 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 387 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 388 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 389 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 390 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 391 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 392 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 393 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 395 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 396 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 397 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 398 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 399 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 400 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 401 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 402 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 403 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 404 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 405 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 406 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 407 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 408 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 409 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 410 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 411 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 413 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 414 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 415 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 417 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 419 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 421 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 422 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 425 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 467 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 469 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 470 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 472 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 473 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 474 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 475 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 476 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 477 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 478 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 479 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 480 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 481 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 482 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 483 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 484 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 485 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 486 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 487 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 488 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 489 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 490 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 491 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 492 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 493 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 494 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 495 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 496 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 497 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 498 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 499 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 500 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 501 | 3300041493 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaT | Metatranscriptome | Unclassified |
| 502 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 503 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 504 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 505 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 506 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 507 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 508 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 509 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 510 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 511 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 512 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 513 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 514 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 515 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 516 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 517 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 518 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 519 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 520 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 521 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 522 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 523 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 524 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 525 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 526 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 527 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 528 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 529 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 530 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 531 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 596 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 597 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 598 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 599 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 600 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 601 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 602 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 603 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 604 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 605 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 606 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 607 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 608 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 609 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 610 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 611 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 612 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 613 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 614 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 615 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 616 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 617 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 618 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 621 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 622 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 623 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 624 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 625 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 627 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 628 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 630 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 631 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 632 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 633 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 634 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 635 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 636 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 637 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 638 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 639 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 640 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 641 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 642 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 643 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 644 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 645 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 646 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 647 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 648 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 649 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 652 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 653 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 654 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 655 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 656 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 657 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 658 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 659 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 660 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 661 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 662 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 663 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 664 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 665 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 666 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 667 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 668 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 669 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 670 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 671 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 672 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 673 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 674 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 675 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 676 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 677 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 678 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 679 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 680 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 681 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 682 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 684 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 685 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 686 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 687 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 688 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 689 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 690 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 691 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 692 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 693 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 694 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 695 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 696 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 697 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 698 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 699 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 700 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 701 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 702 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 703 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 704 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 705 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 706 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 707 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 708 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 709 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 710 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 711 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 712 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 713 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 714 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 715 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 716 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 717 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 718 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 719 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 720 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 721 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 722 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 723 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 67.36 |
| Metatranscriptomes | 0.66 |
| Isolates | 31.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.77 |
| Nodule | 27.49 |
| Rhizoplane | 2.75 |
| Rhizosphere | 39.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1019435 | 3300001904 | Bacteria | 1072 |
| 2 | JGI24741J21665_1005468 | 3300001915 | Bacteria | 2645 |
| 3 | JGI24740J21852_10026115 | 3300001979 | Bacteria | 1960 |
| 4 | JGI24739J22299_10016293 | 3300001989 | Bacteria | 2692 |
| 5 | JGI24737J22298_10004864 | 3300001990 | Bacteria | 4658 |
| 6 | JGI24735J21928_10042336 | 3300002067 | Bacteria | 1326 |
| 7 | JGI25162J39368_1003498 | 3300002737 | Bacteria | 4477 |
| 8 | JGI25150J39212_1020269 | 3300002774 | Bacteria | 1028 |
| 9 | JGI25159J45721_1000251 | 3300002987 | Bacteria | 25319 |
| 10 | JGI25159J45721_1007150 | 3300002987 | Bacteria | 3238 |
| 11 | JGI25151J46595_10001922 | 3300003187 | Bacteria | 13173 |
| 12 | JGI25151J46595_10050591 | 3300003187 | Bacteria | 1414 |
| 13 | JGI25165J46597_1000087 | 3300003214 | Bacteria | 170335 |
| 14 | JGI25165J46597_1000139 | 3300003214 | Bacteria | 121216 |
| 15 | JGI25165J46597_1000692 | 3300003214 | Bacteria | 26996 |
| 16 | JGI25165J46597_1000752 | 3300003214 | Bacteria | 24944 |
| 17 | JGI25165J46597_1001515 | 3300003214 | Bacteria | 11760 |
| 18 | JGI25165J46597_1003764 | 3300003214 | Bacteria | 3573 |
| 19 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 20 | JGI25153J46596_10003398 | 3300003215 | Bacteria | 8924 |
| 21 | JGI25153J46596_10010091 | 3300003215 | Bacteria | 4308 |
| 22 | rootH1_10065014 | 3300003316 | Bacteria | 1398 |
| 23 | rootH2_10034256 | 3300003320 | Bacteria | 1662 |
| 24 | rootH2_10198485 | 3300003320 | Bacteria | 1295 |
| 25 | rootH2_10202360 | 3300003320 | Bacteria | 1071 |
| 26 | rootL2_10229689 | 3300003322 | Bacteria | 1979 |
| 27 | rootH1_10187912 | 3300003323 | Bacteria | 1043 |
| 28 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 29 | JGI25160J50197_1001226 | 3300003354 | Bacteria | 13015 |
| 30 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 31 | Ga0006562J51391_1088000 | 3300003578 | Bacteria | 1810 |
| 32 | Ga0055539_1025621 | 3300003752 | Bacteria | 686 |
| 33 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 34 | Ga0055542_1000020 | 3300003762 | Bacteria | 335745 |
| 35 | Ga0055529_1000016 | 3300003763 | Bacteria | 364775 |
| 36 | Ga0055526_1002636 | 3300003771 | Bacteria | 11984 |
| 37 | Ga0055526_1013393 | 3300003771 | Bacteria | 3475 |
| 38 | Ga0055526_1016661 | 3300003771 | Bacteria | 2859 |
| 39 | Ga0055524_1001569 | 3300003775 | Bacteria | 12844 |
| 40 | Ga0055524_1004990 | 3300003775 | Bacteria | 6011 |
| 41 | Ga0055524_1011324 | 3300003775 | Bacteria | 3497 |
| 42 | Ga0055524_1020763 | 3300003775 | Bacteria | 2201 |
| 43 | Ga0055524_1045016 | 3300003775 | Bacteria | 1066 |
| 44 | Ga0055528_1001064 | 3300003790 | Bacteria | 18132 |
| 45 | Ga0055528_1005906 | 3300003790 | Bacteria | 5615 |
| 46 | Ga0055528_1012070 | 3300003790 | Bacteria | 3381 |
| 47 | Ga0055528_1022562 | 3300003790 | Bacteria | 1955 |
| 48 | Ga0055540_1000197 | 3300003792 | Bacteria | 58449 |
| 49 | Ga0055531_10039751 | 3300003794 | Bacteria | 1391 |
| 50 | Ga0055543_1000089 | 3300004625 | Bacteria | 79924 |
| 51 | Ga0055543_1000731 | 3300004625 | Bacteria | 16676 |
| 52 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 53 | Ga0065165_1000234 | 3300005262 | Bacteria | 96709 |
| 54 | Ga0070658_10001558 | 3300005327 | Bacteria | 19439 |
| 55 | Ga0070670_100478173 | 3300005331 | Bacteria | 1106 |
| 56 | Ga0070660_100414672 | 3300005339 | Bacteria | 1115 |
| 57 | Ga0070660_100528992 | 3300005339 | Bacteria | 982 |
| 58 | Ga0070661_100061766 | 3300005344 | Bacteria | 2750 |
| 59 | Ga0070661_100261681 | 3300005344 | Bacteria | 1338 |
| 60 | Ga0070668_101038576 | 3300005347 | Bacteria | 738 |
| 61 | Ga0070674_100047027 | 3300005356 | Bacteria | 2954 |
| 62 | Ga0070659_100033678 | 3300005366 | Bacteria | 3981 |
| 63 | Ga0070667_100194333 | 3300005367 | Bacteria | 1798 |
| 64 | Ga0070667_100391516 | 3300005367 | Bacteria | 1264 |
| 65 | Ga0070667_101003073 | 3300005367 | Bacteria | 779 |
| 66 | Ga0070667_101101835 | 3300005367 | Bacteria | 742 |
| 67 | Ga0070714_100022342 | 3300005435 | Bacteria | 5187 |
| 68 | Ga0070700_102012017 | 3300005441 | Bacteria | 501 |
| 69 | Ga0070663_101588758 | 3300005455 | Bacteria | 583 |
| 70 | Ga0068867_100819322 | 3300005459 | Bacteria | 832 |
| 71 | Ga0070679_100344403 | 3300005530 | Bacteria | 1438 |
| 72 | Ga0068853_100071337 | 3300005539 | Bacteria | 3025 |
| 73 | Ga0068853_100755317 | 3300005539 | Bacteria | 929 |
| 74 | Ga0068853_101858919 | 3300005539 | Bacteria | 584 |
| 75 | Ga0068853_102423834 | 3300005539 | Bacteria | 508 |
| 76 | Ga0068853_102447775 | 3300005539 | Bacteria | 505 |
| 77 | Ga0068853_102447776 | 3300005539 | Bacteria | 505 |
| 78 | Ga0070672_100100895 | 3300005543 | Bacteria | 2341 |
| 79 | Ga0070672_100927183 | 3300005543 | Bacteria | 770 |
| 80 | Ga0070693_100840624 | 3300005547 | Bacteria | 683 |
| 81 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 82 | Ga0070665_100453703 | 3300005548 | Bacteria | 1292 |
| 83 | Ga0068855_100412289 | 3300005563 | Bacteria | 1479 |
| 84 | Ga0068855_100796856 | 3300005563 | Bacteria | 1004 |
| 85 | Ga0070664_100056015 | 3300005564 | Bacteria | 3349 |
| 86 | Ga0068857_100058913 | 3300005577 | Bacteria | 3411 |
| 87 | Ga0068857_101087689 | 3300005577 | Bacteria | 772 |
| 88 | Ga0068857_101811327 | 3300005577 | Bacteria | 597 |
| 89 | Ga0068854_100999820 | 3300005578 | Bacteria | 740 |
| 90 | Ga0068856_100480168 | 3300005614 | Bacteria | 1264 |
| 91 | Ga0068856_101095222 | 3300005614 | Bacteria | 814 |
| 92 | Ga0068852_100034890 | 3300005616 | Bacteria | 4190 |
| 93 | Ga0068859_100351370 | 3300005617 | Bacteria | 1569 |
| 94 | Ga0068851_10099165 | 3300005834 | Bacteria | 1543 |
| 95 | Ga0068851_10476373 | 3300005834 | Bacteria | 745 |
| 96 | Ga0068863_100074721 | 3300005841 | Bacteria | 3207 |
| 97 | Ga0068863_100694677 | 3300005841 | Bacteria | 1011 |
| 98 | Ga0068863_101601979 | 3300005841 | Bacteria | 660 |
| 99 | Ga0068858_100461630 | 3300005842 | Bacteria | 1225 |
| 100 | Ga0081540_1023244 | 3300005983 | Bacteria | 3632 |
| 101 | Ga0081540_1197978 | 3300005983 | Bacteria | 733 |
| 102 | Ga0070717_10385067 | 3300006028 | Bacteria | 1258 |
| 103 | Ga0075368_10010589 | 3300006042 | Bacteria | 3338 |
| 104 | Ga0075363_100072096 | 3300006048 | Bacteria | 1878 |
| 105 | Ga0075363_100082230 | 3300006048 | Bacteria | 1762 |
| 106 | Ga0075363_100836283 | 3300006048 | Bacteria | 561 |
| 107 | Ga0070712_101499456 | 3300006175 | Bacteria | 589 |
| 108 | Ga0075362_10015882 | 3300006177 | Bacteria | 3071 |
| 109 | Ga0075362_10031824 | 3300006177 | Bacteria | 2286 |
| 110 | Ga0075367_10011682 | 3300006178 | Bacteria | 4658 |
| 111 | Ga0075367_10033196 | 3300006178 | Bacteria | 2974 |
| 112 | Ga0075367_10038940 | 3300006178 | Bacteria | 2770 |
| 113 | Ga0075367_10081850 | 3300006178 | Bacteria | 1954 |
| 114 | Ga0075367_10101895 | 3300006178 | Bacteria | 1756 |
| 115 | Ga0075367_10867946 | 3300006178 | Bacteria | 575 |
| 116 | Ga0075369_10010802 | 3300006186 | Bacteria | 3577 |
| 117 | Ga0075369_10327361 | 3300006186 | Bacteria | 717 |
| 118 | Ga0075369_10513602 | 3300006186 | Bacteria | 570 |
| 119 | Ga0075369_10643385 | 3300006186 | Bacteria | 509 |
| 120 | Ga0075366_10070203 | 3300006195 | Bacteria | 2086 |
| 121 | Ga0075366_10089398 | 3300006195 | Bacteria | 1845 |
| 122 | Ga0075366_10095246 | 3300006195 | Bacteria | 1785 |
| 123 | Ga0075366_10126059 | 3300006195 | Bacteria | 1544 |
| 124 | Ga0075370_10027638 | 3300006353 | Bacteria | 3149 |
| 125 | Ga0075370_10047574 | 3300006353 | Bacteria | 2429 |
| 126 | Ga0075370_10055900 | 3300006353 | Bacteria | 2242 |
| 127 | Ga0075370_10367944 | 3300006353 | Bacteria | 860 |
| 128 | Ga0097620_100351368 | 3300006931 | Bacteria | 1569 |
| 129 | Ga0079104_1014976 | 3300006946 | Bacteria | 2318 |
| 130 | Ga0105251_10000369 | 3300009011 | Bacteria | 44159 |
| 131 | Ga0105250_10491127 | 3300009092 | Bacteria | 556 |
| 132 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 133 | Ga0105240_11353322 | 3300009093 | Bacteria | 749 |
| 134 | Ga0105240_11387494 | 3300009093 | Bacteria | 739 |
| 135 | Ga0105247_10148108 | 3300009101 | Bacteria | 1544 |
| 136 | Ga0105247_10735451 | 3300009101 | Bacteria | 746 |
| 137 | Ga0105243_10000876 | 3300009148 | Bacteria | 28409 |
| 138 | Ga0105243_10712602 | 3300009148 | Bacteria | 980 |
| 139 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 140 | Ga0105241_10005567 | 3300009174 | Bacteria | 9302 |
| 141 | Ga0105241_10931017 | 3300009174 | Bacteria | 809 |
| 142 | Ga0105241_11959877 | 3300009174 | Bacteria | 575 |
| 143 | Ga0105241_12286651 | 3300009174 | Bacteria | 538 |
| 144 | Ga0105248_10172269 | 3300009177 | Bacteria | 2440 |
| 145 | Ga0105248_11014793 | 3300009177 | Bacteria | 937 |
| 146 | Ga0105237_10003649 | 3300009545 | Bacteria | 18153 |
| 147 | Ga0105237_10375797 | 3300009545 | Bacteria | 1426 |
| 148 | Ga0105237_10796418 | 3300009545 | Bacteria | 952 |
| 149 | Ga0105238_10636913 | 3300009551 | Bacteria | 1076 |
| 150 | Ga0123340_1037936 | 3300009763 | Bacteria | 2422 |
| 151 | Ga0123341_1049312 | 3300009765 | Bacteria | 2426 |
| 152 | Ga0105029_100323 | 3300009984 | Bacteria | 2495 |
| 153 | Ga0105239_10052947 | 3300010375 | Bacteria | 4452 |
| 154 | Ga0105239_10354527 | 3300010375 | Bacteria | 1656 |
| 155 | Ga0105239_11065166 | 3300010375 | Bacteria | 930 |
| 156 | Ga0105246_10316872 | 3300011119 | Bacteria | 1266 |
| 157 | Ga0105246_10455501 | 3300011119 | Bacteria | 1076 |
| 158 | Ga0105246_11567229 | 3300011119 | Bacteria | 621 |
| 159 | Ga0157313_1057172 | 3300012503 | Bacteria | 524 |
| 160 | Ga0157324_1001390 | 3300012506 | Bacteria | 1329 |
| 161 | Ga0157326_1005515 | 3300012513 | Bacteria | 1340 |
| 162 | Ga0157373_10013901 | 3300013100 | Bacteria | 5903 |
| 163 | Ga0157373_10277869 | 3300013100 | Bacteria | 1186 |
| 164 | Ga0157373_10771616 | 3300013100 | Bacteria | 707 |
| 165 | Ga0157373_10841490 | 3300013100 | Bacteria | 678 |
| 166 | Ga0157371_10000030 | 3300013102 | Bacteria | 241585 |
| 167 | Ga0157371_11060191 | 3300013102 | Bacteria | 620 |
| 168 | Ga0157370_10002430 | 3300013104 | Bacteria | 22453 |
| 169 | Ga0157370_12060347 | 3300013104 | Bacteria | 511 |
| 170 | Ga0171462_1035 | 3300013250 | Bacteria | 84676 |
| 171 | Ga0157374_10486250 | 3300013296 | Bacteria | 1238 |
| 172 | Ga0157378_10088835 | 3300013297 | Bacteria | 2805 |
| 173 | Ga0157378_10929244 | 3300013297 | Bacteria | 902 |
| 174 | Ga0163162_10352820 | 3300013306 | Bacteria | 1603 |
| 175 | Ga0157372_10438607 | 3300013307 | Bacteria | 1522 |
| 176 | Ga0157375_11105277 | 3300013308 | Bacteria | 928 |
| 177 | Ga0157375_12081801 | 3300013308 | Bacteria | 675 |
| 178 | Ga0163163_10442110 | 3300014325 | Bacteria | 1360 |
| 179 | Ga0157380_12305627 | 3300014326 | Bacteria | 603 |
| 180 | Ga0182008_10023137 | 3300014497 | Bacteria | 3177 |
| 181 | Ga0182008_10307180 | 3300014497 | Bacteria | 831 |
| 182 | Ga0182007_10002682 | 3300015262 | Bacteria | 8718 |
| 183 | Ga0182005_1005275 | 3300015265 | Bacteria | 4053 |
| 184 | Ga0163161_10040465 | 3300017792 | Bacteria | 3348 |
| 185 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 186 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 187 | Ga0209436_117339 | 3300025208 | Bacteria | 1056 |
| 188 | Ga0209672_104167 | 3300025228 | Bacteria | 2754 |
| 189 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 190 | Ga0207427_111812 | 3300025231 | Bacteria | 881 |
| 191 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 192 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 193 | Ga0207425_1004668 | 3300025245 | Bacteria | 4050 |
| 194 | Ga0209646_1004682 | 3300025246 | Bacteria | 2467 |
| 195 | Ga0209646_1004880 | 3300025246 | Bacteria | 2402 |
| 196 | Ga0209026_1020525 | 3300025250 | Bacteria | 1026 |
| 197 | Ga0209026_1034944 | 3300025250 | Bacteria | 739 |
| 198 | Ga0209677_100453 | 3300025253 | Bacteria | 23786 |
| 199 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 200 | Ga0209148_1012535 | 3300025254 | Bacteria | 1547 |
| 201 | Ga0209129_1002947 | 3300025258 | Bacteria | 7777 |
| 202 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 203 | Ga0209233_1000137 | 3300025261 | Bacteria | 200314 |
| 204 | Ga0209233_1000149 | 3300025261 | Bacteria | 181183 |
| 205 | Ga0209233_1000160 | 3300025261 | Bacteria | 159035 |
| 206 | Ga0209233_1002488 | 3300025261 | Bacteria | 6751 |
| 207 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 208 | Ga0209455_1021243 | 3300025272 | Bacteria | 1265 |
| 209 | Ga0209455_1033495 | 3300025272 | Bacteria | 843 |
| 210 | Ga0209673_1000015 | 3300025273 | Bacteria | 530618 |
| 211 | Ga0209673_1000444 | 3300025273 | Bacteria | 71044 |
| 212 | Ga0209673_1000632 | 3300025273 | Bacteria | 53357 |
| 213 | Ga0209673_1006484 | 3300025273 | Bacteria | 5642 |
| 214 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 215 | Ga0209130_1000279 | 3300025284 | Bacteria | 63145 |
| 216 | Ga0209675_1020739 | 3300025291 | Bacteria | 1772 |
| 217 | Ga0209676_1114489 | 3300025292 | Bacteria | 551 |
| 218 | Ga0209025_1000082 | 3300025294 | Bacteria | 265613 |
| 219 | Ga0209025_1000777 | 3300025294 | Bacteria | 52804 |
| 220 | Ga0209025_1002215 | 3300025294 | Bacteria | 21453 |
| 221 | Ga0209025_1017766 | 3300025294 | Bacteria | 4082 |
| 222 | Ga0209564_1000128 | 3300025295 | Bacteria | 196532 |
| 223 | Ga0209564_1000167 | 3300025295 | Bacteria | 159653 |
| 224 | Ga0209564_1013250 | 3300025295 | Bacteria | 3522 |
| 225 | Ga0209564_1021534 | 3300025295 | Bacteria | 2314 |
| 226 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 227 | Ga0209758_1001112 | 3300025297 | Bacteria | 34604 |
| 228 | Ga0209758_1004666 | 3300025297 | Bacteria | 11205 |
| 229 | Ga0209050_1007726 | 3300025298 | Bacteria | 5936 |
| 230 | Ga0209256_1000511 | 3300025299 | Bacteria | 57006 |
| 231 | Ga0209256_1000698 | 3300025299 | Bacteria | 44613 |
| 232 | Ga0209256_1000779 | 3300025299 | Bacteria | 41192 |
| 233 | Ga0209256_1004380 | 3300025299 | Bacteria | 8921 |
| 234 | Ga0209256_1044567 | 3300025299 | Bacteria | 1107 |
| 235 | Ga0209256_1074329 | 3300025299 | Bacteria | 756 |
| 236 | Ga0209256_1075637 | 3300025299 | Bacteria | 747 |
| 237 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 238 | Ga0207426_1000228 | 3300025302 | Bacteria | 129261 |
| 239 | Ga0207426_1008474 | 3300025302 | Bacteria | 4147 |
| 240 | Ga0209051_1000119 | 3300025303 | Bacteria | 148746 |
| 241 | Ga0209051_1083750 | 3300025303 | Bacteria | 910 |
| 242 | Ga0209257_1003041 | 3300025304 | Bacteria | 15130 |
| 243 | Ga0207656_10068624 | 3300025321 | Bacteria | 1571 |
| 244 | Ga0207656_10257658 | 3300025321 | Bacteria | 856 |
| 245 | Ga0207713_1000433 | 3300025735 | Bacteria | 44170 |
| 246 | Ga0207710_10129073 | 3300025900 | Bacteria | 1213 |
| 247 | Ga0207710_10396137 | 3300025900 | Bacteria | 708 |
| 248 | Ga0207688_10047044 | 3300025901 | Bacteria | 2409 |
| 249 | Ga0207647_10007295 | 3300025904 | Bacteria | 8002 |
| 250 | Ga0207645_10150696 | 3300025907 | Bacteria | 1518 |
| 251 | Ga0207645_10524065 | 3300025907 | Bacteria | 803 |
| 252 | Ga0207705_10000531 | 3300025909 | Bacteria | 32288 |
| 253 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 254 | Ga0207654_10000190 | 3300025911 | Bacteria | 37976 |
| 255 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 256 | Ga0207695_10651274 | 3300025913 | Bacteria | 934 |
| 257 | Ga0207695_11612158 | 3300025913 | Bacteria | 530 |
| 258 | Ga0207671_10001017 | 3300025914 | Bacteria | 34299 |
| 259 | Ga0207671_10003175 | 3300025914 | Bacteria | 16591 |
| 260 | Ga0207671_11229286 | 3300025914 | Bacteria | 585 |
| 261 | Ga0207660_10768349 | 3300025917 | Bacteria | 786 |
| 262 | Ga0207657_10250007 | 3300025919 | Bacteria | 1413 |
| 263 | Ga0207657_11378601 | 3300025919 | Bacteria | 530 |
| 264 | Ga0207649_10011496 | 3300025920 | Bacteria | 4882 |
| 265 | Ga0207649_10187635 | 3300025920 | Bacteria | 1452 |
| 266 | Ga0207652_10100447 | 3300025921 | Bacteria | 2554 |
| 267 | Ga0207694_10014797 | 3300025924 | Bacteria | 5883 |
| 268 | Ga0207650_10436379 | 3300025925 | Bacteria | 1088 |
| 269 | Ga0207659_11630568 | 3300025926 | Bacteria | 550 |
| 270 | Ga0207664_10017789 | 3300025929 | Bacteria | 5222 |
| 271 | Ga0207644_10584291 | 3300025931 | Bacteria | 927 |
| 272 | Ga0207690_10001685 | 3300025932 | Bacteria | 13618 |
| 273 | Ga0207690_10230593 | 3300025932 | Bacteria | 1421 |
| 274 | Ga0207706_10032436 | 3300025933 | Bacteria | 4652 |
| 275 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 276 | Ga0207669_10023094 | 3300025937 | Bacteria | 3315 |
| 277 | Ga0207691_10123391 | 3300025940 | Bacteria | 2293 |
| 278 | Ga0207711_11245183 | 3300025941 | Bacteria | 686 |
| 279 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 280 | Ga0207667_10374174 | 3300025949 | Bacteria | 1452 |
| 281 | Ga0207667_10391968 | 3300025949 | Bacteria | 1414 |
| 282 | Ga0207668_10201866 | 3300025972 | Bacteria | 1584 |
| 283 | Ga0207640_10158806 | 3300025981 | Bacteria | 1670 |
| 284 | Ga0207658_10178336 | 3300025986 | Bacteria | 1756 |
| 285 | Ga0207639_10687954 | 3300026041 | Bacteria | 948 |
| 286 | Ga0207639_11146090 | 3300026041 | Bacteria | 729 |
| 287 | Ga0207678_10025795 | 3300026067 | Bacteria | 5130 |
| 288 | Ga0207702_10000642 | 3300026078 | Bacteria | 38293 |
| 289 | Ga0207702_10405162 | 3300026078 | Bacteria | 1316 |
| 290 | Ga0207702_10911743 | 3300026078 | Bacteria | 871 |
| 291 | Ga0207641_11131398 | 3300026088 | Bacteria | 782 |
| 292 | Ga0207648_11612513 | 3300026089 | Bacteria | 610 |
| 293 | Ga0207674_10039054 | 3300026116 | Bacteria | 4923 |
| 294 | Ga0207674_10049988 | 3300026116 | Bacteria | 4274 |
| 295 | Ga0207674_11681763 | 3300026116 | Bacteria | 603 |
| 296 | Ga0207675_100430439 | 3300026118 | Bacteria | 1304 |
| 297 | Ga0207683_10590757 | 3300026121 | Bacteria | 1027 |
| 298 | Ga0207698_10098344 | 3300026142 | Bacteria | 2418 |
| 299 | Ga0209281_1000027 | 3300027111 | Bacteria | 463409 |
| 300 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 301 | Ga0209281_1005132 | 3300027111 | Bacteria | 3708 |
| 302 | Ga0209371_1003138 | 3300027312 | Bacteria | 8395 |
| 303 | Ga0209371_1005523 | 3300027312 | Bacteria | 4990 |
| 304 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 305 | Ga0209813_10189206 | 3300027866 | Bacteria | 757 |
| 306 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 307 | Ga0268266_10062390 | 3300028379 | Bacteria | 3217 |
| 308 | Ga0307517_10035306 | 3300028786 | Bacteria | 5665 |
| 309 | Ga0307515_10211918 | 3300028794 | Bacteria | 1779 |
| 310 | Ga0307515_10278783 | 3300028794 | Bacteria | 1382 |
| 311 | Ga0268256_1003000 | 3300030500 | Bacteria | 7971 |
| 312 | Ga0268256_1005446 | 3300030500 | Bacteria | 4990 |
| 313 | Ga0265316_10943025 | 3300031344 | Bacteria | 602 |
| 314 | Ga0307513_10057611 | 3300031456 | Bacteria | 4137 |
| 315 | Ga0307513_10121454 | 3300031456 | Bacteria | 2579 |
| 316 | Ga0307408_101356032 | 3300031548 | Bacteria | 668 |
| 317 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 318 | Ga0307416_103218961 | 3300032002 | Bacteria | 546 |
| 319 | Ga0307510_10000011 | 3300033180 | Bacteria | 355464 |
| 320 | Ga0307510_10079312 | 3300033180 | Bacteria | 3203 |
| 321 | Ga0315913_1000004 | 3300033430 | Bacteria | 192741 |
| 322 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 323 | Ga0395899_0000124 | 3300037312 | Bacteria | 122011 |
| 324 | Ga0395899_0175133 | 3300037312 | Bacteria | 1509 |
| 325 | Ga0395900_0000086 | 3300037418 | Bacteria | 171749 |
| 326 | Ga0395900_0174189 | 3300037418 | Bacteria | 2189 |
| 327 | Ga0395898_0000285 | 3300037466 | Bacteria | 122279 |
| 328 | Ga0395898_0153809 | 3300037466 | Bacteria | 2201 |
| 329 | Ga0395905_0000133 | 3300037471 | Bacteria | 123500 |
| 330 | Ga0395905_0000708 | 3300037471 | Bacteria | 44246 |
| 331 | Ga0395905_0052156 | 3300037471 | Bacteria | 3830 |
| 332 | Ga0395905_0716144 | 3300037471 | Bacteria | 903 |
| 333 | Ga0436364_1037496 | 3300037853 | Bacteria | 833 |
| 334 | Ga0395901_0000092 | 3300038443 | Bacteria | 121976 |
| 335 | Ga0395901_0231252 | 3300038443 | Bacteria | 1930 |
| 336 | Ga0395901_0874728 | 3300038443 | Bacteria | 882 |
| 337 | Ga0439436_0208714 | 3300041404 | Bacteria | 560 |
| 338 | Ga0439439_0022183 | 3300041406 | Bacteria | 1585 |
| 339 | Ga0439466_0054777 | 3300041411 | Bacteria | 1298 |
| 340 | Ga0439465_0004865 | 3300041413 | Bacteria | 4318 |
| 341 | Ga0451787_009036 | 3300041441 | Bacteria | 805 |
| 342 | Ga0451789_0480782 | 3300041443 | Bacteria | 692 |
| 343 | Ga0451789_1300095 | 3300041443 | Bacteria | 2032 |
| 344 | Ga0451789_1366789 | 3300041443 | Bacteria | 518 |
| 345 | Ga0451791_1927112 | 3300041451 | Bacteria | 1141 |
| 346 | Ga0451793_1189160 | 3300041452 | Bacteria | 705 |
| 347 | Ga0451793_1769180 | 3300041452 | Bacteria | 924 |
| 348 | Ga0451797_0233108 | 3300041453 | Bacteria | 863 |
| 349 | Ga0451798_0280811 | 3300041458 | Bacteria | 506 |
| 350 | Ga0451807_2434329 | 3300041486 | Bacteria | 934 |
| 351 | Ga0451833_0288120 | 3300041491 | Bacteria | 640 |
| 352 | Ga0451833_1293662 | 3300041491 | Bacteria | 2567 |
| 353 | Ga0451835_0115932 | 3300041492 | Bacteria | 4205 |
| 354 | Ga0451836_15971 | 3300041493 | Bacteria | 636 |
| 355 | Ga0451837_0858072 | 3300041494 | Bacteria | 2621 |
| 356 | Ga0451839_1208629 | 3300041496 | Bacteria | 1621 |
| 357 | Ga0451840_03790 | 3300041497 | Bacteria | 629 |
| 358 | Ga0451841_1002243 | 3300041498 | Bacteria | 2201 |
| 359 | Ga0451845_0135496 | 3300041501 | Bacteria | 3479 |
| 360 | Ga0451846_47186 | 3300041502 | Bacteria | 1105 |
| 361 | Ga0451847_0865164 | 3300041503 | Bacteria | 4896 |
| 362 | Ga0451848_06124 | 3300041504 | Bacteria | 517 |
| 363 | Ga0451849_0254647 | 3300041505 | Bacteria | 4644 |
| 364 | Ga0451849_0818881 | 3300041505 | Bacteria | 1354 |
| 365 | Ga0451851_0621237 | 3300041507 | Bacteria | 5201 |
| 366 | Ga0451843_0438760 | 3300041509 | Bacteria | 744 |
| 367 | Ga0451843_0855835 | 3300041509 | Bacteria | 1236 |
| 368 | Ga0451854_23698 | 3300041510 | Bacteria | 957 |
| 369 | Ga0451855_0075806 | 3300041511 | Bacteria | 4099 |
| 370 | Ga0451855_0545569 | 3300041511 | Bacteria | 1242 |
| 371 | Ga0451855_1285604 | 3300041511 | Bacteria | 653 |
| 372 | Ga0451853_1332446 | 3300041512 | Bacteria | 3385 |
| 373 | Ga0452271_32988 | 3300041916 | Bacteria | 1080 |
| 374 | Ga0439432_027058 | 3300042006 | Bacteria | 1875 |
| 375 | Ga0439449_0049692 | 3300042007 | Bacteria | 1551 |
| 376 | Ga0439458_0084563 | 3300042157 | Bacteria | 812 |
| 377 | Ga0466969_0117008 | 3300044656 | Bacteria | 1243 |
| 378 | Ga0466965_0769203 | 3300044683 | Bacteria | 556 |
| 379 | Ga0466966_0022293 | 3300044684 | Bacteria | 4156 |
| 380 | Ga0466966_0391440 | 3300044684 | Bacteria | 835 |
| 381 | Ga0466966_0414228 | 3300044684 | Bacteria | 810 |
| 382 | Ga0466961_0493890 | 3300044693 | Bacteria | 739 |
| 383 | Ga0466963_0013253 | 3300044694 | Bacteria | 5060 |
| 384 | Ga0466971_0237453 | 3300044719 | Bacteria | 866 |
| 385 | Ga0466970_0005599 | 3300044765 | Bacteria | 6241 |
| 386 | Ga0466957_0921778 | 3300044842 | Bacteria | 625 |
| 387 | Ga0466959_0025034 | 3300045049 | Bacteria | 4421 |
| 388 | Ga0466959_0607522 | 3300045049 | Bacteria | 735 |
| 389 | Ga0466958_0024660 | 3300045836 | Bacteria | 3539 |
| 390 | Ga0466958_0161318 | 3300045836 | Bacteria | 1416 |
| 391 | Ga0466967_0035126 | 3300045976 | Bacteria | 4263 |
| 392 | Ga0466967_0716795 | 3300045976 | Bacteria | 991 |
| 393 | Ga0466967_1214945 | 3300045976 | Bacteria | 751 |
| 394 | Ga0495617_113010 | 3300046452 | Bacteria | 878 |
| 395 | Ga0495592_0130418 | 3300046454 | Bacteria | 1759 |
| 396 | Ga0495590_0022129 | 3300046457 | Bacteria | 2250 |
| 397 | Ga0495629_0027370 | 3300046459 | Bacteria | 4047 |
| 398 | Ga0495629_0119793 | 3300046459 | Bacteria | 1834 |
| 399 | Ga0495638_0000093 | 3300046460 | Bacteria | 142356 |
| 400 | Ga0495638_0263150 | 3300046460 | Bacteria | 945 |
| 401 | Ga0495638_0333956 | 3300046460 | Bacteria | 806 |
| 402 | Ga0495638_0481037 | 3300046460 | Unclassified | 629 |
| 403 | Ga0495638_0510587 | 3300046460 | Bacteria | 604 |
| 404 | Ga0495641_0495028 | 3300046461 | Bacteria | 557 |
| 405 | Ga0495651_0609048 | 3300046462 | Bacteria | 688 |
| 406 | Ga0495605_0008910 | 3300046474 | Bacteria | 5656 |
| 407 | Ga0495605_0071440 | 3300046474 | Bacteria | 1639 |
| 408 | Ga0495639_0147246 | 3300046475 | Bacteria | 1134 |
| 409 | Ga0495662_0006422 | 3300046476 | Bacteria | 5870 |
| 410 | Ga0495664_0258902 | 3300046477 | Bacteria | 1052 |
| 411 | Ga0495584_0059752 | 3300046491 | Bacteria | 1917 |
| 412 | Ga0495585_0007993 | 3300046492 | Bacteria | 6431 |
| 413 | Ga0495585_0054170 | 3300046492 | Bacteria | 2218 |
| 414 | Ga0495585_0178384 | 3300046492 | Bacteria | 1093 |
| 415 | Ga0495585_0297485 | 3300046492 | Bacteria | 794 |
| 416 | Ga0495596_0167059 | 3300046500 | Bacteria | 855 |
| 417 | Ga0495607_0054379 | 3300046501 | Bacteria | 2307 |
| 418 | Ga0495607_0079096 | 3300046501 | Bacteria | 1812 |
| 419 | Ga0495583_0019150 | 3300046506 | Bacteria | 3580 |
| 420 | Ga0495583_0032644 | 3300046506 | Bacteria | 2511 |
| 421 | Ga0495583_0090028 | 3300046506 | Bacteria | 1322 |
| 422 | Ga0495583_0309063 | 3300046506 | Bacteria | 627 |
| 423 | Ga0495606_0000824 | 3300046507 | Bacteria | 47072 |
| 424 | Ga0495606_0041886 | 3300046507 | Bacteria | 3068 |
| 425 | Ga0495606_0059620 | 3300046507 | Bacteria | 2447 |
| 426 | Ga0495606_0133747 | 3300046507 | Bacteria | 1471 |
| 427 | Ga0495608_0346508 | 3300046511 | Bacteria | 915 |
| 428 | Ga0495610_0034443 | 3300046512 | Bacteria | 2608 |
| 429 | Ga0495610_0088790 | 3300046512 | Bacteria | 1404 |
| 430 | Ga0495610_0172330 | 3300046512 | Bacteria | 906 |
| 431 | Ga0495610_0248186 | 3300046512 | Bacteria | 706 |
| 432 | Ga0495610_0387000 | 3300046512 | Bacteria | 519 |
| 433 | Ga0495616_0061252 | 3300046513 | Bacteria | 1846 |
| 434 | Ga0495616_0191163 | 3300046513 | Bacteria | 905 |
| 435 | Ga0495618_0929597 | 3300046514 | Bacteria | 501 |
| 436 | Ga0495620_0050209 | 3300046515 | Bacteria | 1781 |
| 437 | Ga0495620_0099005 | 3300046515 | Bacteria | 1163 |
| 438 | Ga0495620_0099772 | 3300046515 | Bacteria | 1158 |
| 439 | Ga0495620_0267207 | 3300046515 | Bacteria | 651 |
| 440 | Ga0495628_0701113 | 3300046516 | Bacteria | 715 |
| 441 | Ga0495631_0022213 | 3300046518 | Bacteria | 2950 |
| 442 | Ga0495631_0195983 | 3300046518 | Bacteria | 864 |
| 443 | Ga0495631_0200943 | 3300046518 | Bacteria | 852 |
| 444 | Ga0495632_0029196 | 3300046519 | Bacteria | 2874 |
| 445 | Ga0495632_0094675 | 3300046519 | Bacteria | 1412 |
| 446 | Ga0495632_0121635 | 3300046519 | Bacteria | 1220 |
| 447 | Ga0495632_0165026 | 3300046519 | Bacteria | 1019 |
| 448 | Ga0495637_0059138 | 3300046520 | Bacteria | 1578 |
| 449 | Ga0495643_0008432 | 3300046522 | Bacteria | 6522 |
| 450 | Ga0495643_0012592 | 3300046522 | Bacteria | 5096 |
| 451 | Ga0495643_0040090 | 3300046522 | Bacteria | 2558 |
| 452 | Ga0495643_0045805 | 3300046522 | Bacteria | 2373 |
| 453 | Ga0495643_0054076 | 3300046522 | Bacteria | 2151 |
| 454 | Ga0495643_0073033 | 3300046522 | Bacteria | 1798 |
| 455 | Ga0495643_0167123 | 3300046522 | Bacteria | 1078 |
| 456 | Ga0495644_0455622 | 3300046523 | Bacteria | 509 |
| 457 | Ga0495648_0000303 | 3300046524 | Bacteria | 54717 |
| 458 | Ga0495648_0018594 | 3300046524 | Bacteria | 4914 |
| 459 | Ga0495648_0113568 | 3300046524 | Bacteria | 1469 |
| 460 | Ga0495648_0127431 | 3300046524 | Bacteria | 1358 |
| 461 | Ga0495648_0394044 | 3300046524 | Bacteria | 621 |
| 462 | Ga0495663_0400426 | 3300046525 | Bacteria | 505 |
| 463 | Ga0495642_0013708 | 3300046528 | Bacteria | 3139 |
| 464 | Ga0495654_0045879 | 3300046530 | Bacteria | 2155 |
| 465 | Ga0495587_0077273 | 3300046536 | Bacteria | 1933 |
| 466 | Ga0495609_0043790 | 3300046538 | Bacteria | 2009 |
| 467 | Ga0495597_0071578 | 3300046542 | Bacteria | 1493 |
| 468 | Ga0495597_0208454 | 3300046542 | Bacteria | 780 |
| 469 | Ga0495597_0303454 | 3300046542 | Bacteria | 619 |
| 470 | Ga0495597_0329093 | 3300046542 | Bacteria | 589 |
| 471 | Ga0495622_0048654 | 3300046557 | Bacteria | 1969 |
| 472 | Ga0495622_0056197 | 3300046557 | Bacteria | 1825 |
| 473 | Ga0495622_0119506 | 3300046557 | Bacteria | 1204 |
| 474 | Ga0495622_0421421 | 3300046557 | Bacteria | 574 |
| 475 | Ga0495633_0028150 | 3300046558 | Bacteria | 2741 |
| 476 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 477 | Ga0495668_0151877 | 3300046616 | Bacteria | 1268 |
| 478 | Ga0495668_0499030 | 3300046616 | Bacteria | 671 |
| 479 | Ga0495611_0110563 | 3300046648 | Bacteria | 1279 |
| 480 | Ga0495611_0287785 | 3300046648 | Bacteria | 758 |
| 481 | Ga0495625_0009233 | 3300046660 | Bacteria | 8278 |
| 482 | Ga0495625_0025308 | 3300046660 | Bacteria | 4502 |
| 483 | Ga0495625_0032058 | 3300046660 | Bacteria | 3902 |
| 484 | Ga0495625_0056176 | 3300046660 | Unclassified | 2804 |
| 485 | Ga0495625_0062794 | 3300046660 | Bacteria | 2624 |
| 486 | Ga0495625_0101544 | 3300046660 | Bacteria | 1975 |
| 487 | Ga0495625_0140798 | 3300046660 | Bacteria | 1627 |
| 488 | Ga0495625_0259542 | 3300046660 | Bacteria | 1125 |
| 489 | Ga0495625_0448971 | 3300046660 | Bacteria | 797 |
| 490 | Ga0495625_0739344 | 3300046660 | Bacteria | 577 |
| 491 | Ga0495635_0303968 | 3300046663 | Bacteria | 1069 |
| 492 | Ga0495661_0071358 | 3300046665 | Bacteria | 2030 |
| 493 | Ga0495588_0029503 | 3300046674 | Bacteria | 2752 |
| 494 | Ga0495588_0416707 | 3300046674 | Bacteria | 705 |
| 495 | Ga0495657_0069096 | 3300046675 | Bacteria | 2312 |
| 496 | Ga0495623_0303680 | 3300046679 | Bacteria | 881 |
| 497 | Ga0495658_0099167 | 3300046683 | Bacteria | 1736 |
| 498 | Ga0495669_0000286 | 3300046684 | Bacteria | 28731 |
| 499 | Ga0495669_0195018 | 3300046684 | Bacteria | 967 |
| 500 | Ga0495670_0096288 | 3300046691 | Bacteria | 1519 |
| 501 | Ga0495670_0254016 | 3300046691 | Bacteria | 937 |
| 502 | Ga0495670_0356695 | 3300046691 | Bacteria | 787 |
| 503 | Ga0495671_0067789 | 3300046692 | Bacteria | 1755 |
| 504 | Ga0495671_0170616 | 3300046692 | Bacteria | 1058 |
| 505 | Ga0495649_0041168 | 3300046694 | Bacteria | 2527 |
| 506 | Ga0495649_0296285 | 3300046694 | Bacteria | 824 |
| 507 | Ga0495649_0483903 | 3300046694 | Bacteria | 616 |
| 508 | Ga0495589_0361816 | 3300046794 | Bacteria | 668 |
| 509 | Ga0495600_0013303 | 3300046809 | Bacteria | 5167 |
| 510 | Ga0495600_0158515 | 3300046809 | Bacteria | 1463 |
| 511 | Ga0495660_0057164 | 3300046810 | Bacteria | 2105 |
| 512 | Ga0495660_0081616 | 3300046810 | Bacteria | 1695 |
| 513 | Ga0495660_0273399 | 3300046810 | Bacteria | 775 |
| 514 | Ga0495604_0041874 | 3300047317 | Bacteria | 3590 |
| 515 | Ga0495636_0028360 | 3300047318 | Bacteria | 2283 |
| 516 | Ga0495674_0296225 | 3300047319 | Bacteria | 1322 |
| 517 | Ga0495672_0010499 | 3300047320 | Bacteria | 6595 |
| 518 | Ga0495672_0064415 | 3300047320 | Bacteria | 2099 |
| 519 | Ga0495683_0030887 | 3300047323 | Bacteria | 2731 |
| 520 | Ga0495683_0114590 | 3300047323 | Bacteria | 1284 |
| 521 | Ga0495687_004439 | 3300047443 | Bacteria | 9474 |
| 522 | Ga0495687_013793 | 3300047443 | Bacteria | 4194 |
| 523 | Ga0495687_033771 | 3300047443 | Bacteria | 2317 |
| 524 | Ga0495687_043138 | 3300047443 | Bacteria | 1966 |
| 525 | Ga0495687_082838 | 3300047443 | Bacteria | 1251 |
| 526 | Ga0495677_0003044 | 3300047445 | Bacteria | 6517 |
| 527 | Ga0495685_125884 | 3300047447 | Bacteria | 840 |
| 528 | Ga0495686_0006640 | 3300047472 | Bacteria | 8812 |
| 529 | Ga0495686_0076698 | 3300047472 | Bacteria | 2048 |
| 530 | Ga0495686_0229134 | 3300047472 | Bacteria | 1053 |
| 531 | Ga0495615_0073288 | 3300048090 | Bacteria | 927 |
| 532 | Ga0495615_0228566 | 3300048090 | Bacteria | 583 |
| 533 | Ga0495626_0210280 | 3300048091 | Bacteria | 794 |
| 534 | Ga0496100_0048000 | 3300048903 | Bacteria | 2754 |
| 535 | Ga0496101_0210476 | 3300048904 | Bacteria | 1506 |
| 536 | Ga0496102_0011729 | 3300048905 | Bacteria | 7563 |
| 537 | Ga0496102_0013152 | 3300048905 | Bacteria | 7160 |
| 538 | Ga0496103_0000836 | 3300048906 | Bacteria | 22508 |
| 539 | Ga0496103_0029238 | 3300048906 | Bacteria | 3348 |
| 540 | Ga0496104_0052957 | 3300048907 | Bacteria | 3834 |
| 541 | Ga0496105_0114733 | 3300048908 | Bacteria | 2222 |
| 542 | Ga0496105_0815701 | 3300048908 | Bacteria | 708 |
| 543 | Ga0496106_0254693 | 3300048909 | Bacteria | 1404 |
| 544 | Ga0496110_0070499 | 3300048913 | Bacteria | 3097 |
| 545 | Ga0496110_0504698 | 3300048913 | Bacteria | 1101 |
| 546 | Ga0496110_0620612 | 3300048913 | Bacteria | 980 |
| 547 | Ga0496111_0007641 | 3300048914 | Bacteria | 7105 |
| 548 | Ga0496113_0104885 | 3300048916 | Bacteria | 2194 |
| 549 | Ga0496113_0522196 | 3300048916 | Bacteria | 953 |
| 550 | Ga0496114_0137219 | 3300048917 | Bacteria | 2115 |
| 551 | Ga0496115_0002445 | 3300048918 | Bacteria | 13344 |
| 552 | Ga0496116_0017799 | 3300048919 | Bacteria | 5501 |
| 553 | Ga0496116_0063997 | 3300048919 | Bacteria | 2365 |
| 554 | Ga0496116_0148259 | 3300048919 | Bacteria | 1308 |
| 555 | Ga0496117_0000182 | 3300048920 | Bacteria | 128076 |
| 556 | Ga0496117_0017033 | 3300048920 | Bacteria | 6086 |
| 557 | Ga0496117_0039544 | 3300048920 | Bacteria | 3480 |
| 558 | Ga0496117_0223485 | 3300048920 | Bacteria | 1046 |
| 559 | Ga0496117_0372493 | 3300048920 | Bacteria | 730 |
| 560 | Ga0496118_0000125 | 3300048921 | Bacteria | 136422 |
| 561 | Ga0496118_0010015 | 3300048921 | Bacteria | 9452 |
| 562 | Ga0496118_0015441 | 3300048921 | Bacteria | 7067 |
| 563 | Ga0496119_0010214 | 3300048922 | Bacteria | 7921 |
| 564 | Ga0496119_0021565 | 3300048922 | Bacteria | 4650 |
| 565 | Ga0496119_0058856 | 3300048922 | Bacteria | 2312 |
| 566 | Ga0496119_0075305 | 3300048922 | Bacteria | 1962 |
| 567 | Ga0496120_0009952 | 3300048923 | Bacteria | 6687 |
| 568 | Ga0496120_0017730 | 3300048923 | Bacteria | 4604 |
| 569 | Ga0496120_0276781 | 3300048923 | Bacteria | 777 |
| 570 | Ga0496120_0356853 | 3300048923 | Bacteria | 655 |
| 571 | Ga0496121_0007290 | 3300048924 | Bacteria | 13381 |
| 572 | Ga0496121_0016095 | 3300048924 | Bacteria | 7749 |
| 573 | Ga0496121_0137814 | 3300048924 | Bacteria | 1815 |
| 574 | Ga0496121_0165013 | 3300048924 | Bacteria | 1615 |
| 575 | Ga0496121_0431606 | 3300048924 | Bacteria | 854 |
| 576 | Ga0496122_0015011 | 3300048925 | Bacteria | 7439 |
| 577 | Ga0496122_0046216 | 3300048925 | Bacteria | 3374 |
| 578 | Ga0496122_0160967 | 3300048925 | Bacteria | 1368 |
| 579 | Ga0496123_0024694 | 3300048926 | Bacteria | 4559 |
| 580 | Ga0496123_0025175 | 3300048926 | Bacteria | 4494 |
| 581 | Ga0496123_0032283 | 3300048926 | Bacteria | 3794 |
| 582 | Ga0496123_0055962 | 3300048926 | Bacteria | 2583 |
| 583 | Ga0496123_0075063 | 3300048926 | Bacteria | 2088 |
| 584 | Ga0496124_0000082 | 3300048927 | Bacteria | 208248 |
| 585 | Ga0496124_0072586 | 3300048927 | Bacteria | 2850 |
| 586 | Ga0496125_0002269 | 3300048928 | Bacteria | 25512 |
| 587 | Ga0496125_0024814 | 3300048928 | Bacteria | 5504 |
| 588 | Ga0496125_0135213 | 3300048928 | Bacteria | 1726 |
| 589 | Ga0496125_0502145 | 3300048928 | Bacteria | 682 |
| 590 | Ga0496125_0592916 | 3300048928 | Bacteria | 606 |
| 591 | Ga0496126_0000221 | 3300048929 | Bacteria | 124193 |
| 592 | Ga0496126_0188156 | 3300048929 | Bacteria | 1750 |
| 593 | Ga0496126_0211504 | 3300048929 | Bacteria | 1632 |
| 594 | Ga0496126_0314240 | 3300048929 | Bacteria | 1289 |
| 595 | Ga0496126_0795984 | 3300048929 | Bacteria | 726 |
| 596 | Ga0495678_067447 | 3300049459 | Bacteria | 1322 |
| 597 | Ga0495678_069850 | 3300049459 | Bacteria | 1291 |
| 598 | Ga0495678_164241 | 3300049459 | Bacteria | 707 |
| 599 | Ga0495682_0037223 | 3300049460 | Bacteria | 1791 |
| 600 | Ga0495682_0170892 | 3300049460 | Bacteria | 773 |
| 601 | Ga0501032_0167109 | 3300049569 | Bacteria | 1443 |
| 602 | Ga0501033_0227499 | 3300049570 | Bacteria | 1326 |
| 603 | Ga0501034_0020130 | 3300049571 | Bacteria | 6812 |
| 604 | Ga0501034_0096373 | 3300049571 | Bacteria | 2954 |
| 605 | Ga0501036_0061122 | 3300049572 | Bacteria | 3191 |
| 606 | Ga0501037_0077798 | 3300049573 | Bacteria | 2407 |
| 607 | Ga0501037_0792895 | 3300049573 | Bacteria | 626 |
| 608 | Ga0501038_0027079 | 3300049574 | Bacteria | 5103 |
| 609 | Ga0501039_0140053 | 3300049575 | Bacteria | 1900 |
| 610 | Ga0501043_0065196 | 3300049579 | Bacteria | 2860 |
| 611 | Ga0501043_0856615 | 3300049579 | Bacteria | 654 |
| 612 | Ga0501043_1249210 | 3300049579 | Bacteria | 520 |
| 613 | Ga0501047_0013527 | 3300049581 | Bacteria | 7737 |
| 614 | Ga0501047_0650773 | 3300049581 | Bacteria | 873 |
| 615 | Ga0501068_0009640 | 3300049584 | Bacteria | 5407 |
| 616 | Ga0501068_0209106 | 3300049584 | Bacteria | 1239 |
| 617 | Ga0501070_0694987 | 3300049586 | Bacteria | 805 |
| 618 | Ga0501073_0030504 | 3300049589 | Bacteria | 3850 |
| 619 | Ga0501073_0033818 | 3300049589 | Bacteria | 3638 |
| 620 | Ga0501073_0174433 | 3300049589 | Bacteria | 1488 |
| 621 | Ga0501076_1610010 | 3300049592 | Bacteria | 533 |
| 622 | Ga0501077_1109664 | 3300049593 | Bacteria | 509 |
| 623 | Ga0501080_0016271 | 3300049742 | Bacteria | 6867 |
| 624 | Ga0501080_0023538 | 3300049742 | Bacteria | 5708 |
| 625 | Ga0501083_0022340 | 3300049744 | Bacteria | 4391 |
| 626 | Ga0501083_0024787 | 3300049744 | Bacteria | 4155 |
| 627 | Ga0501083_0166579 | 3300049744 | Bacteria | 1440 |
| 628 | Ga0501035_0133623 | 3300049822 | Bacteria | 2162 |
| 629 | Ga0501044_0052412 | 3300049823 | Bacteria | 4204 |
| 630 | Ga0501044_0060567 | 3300049823 | Bacteria | 3875 |
| 631 | nmdc:mga03683_558269_c1 | 3300050489 | Bacteria | 558 |
| 632 | nmdc:mga03n38_117565_c1 | 3300050490 | Bacteria | 1303 |
| 633 | nmdc:mga03n38_177718_c1 | 3300050490 | Bacteria | 1088 |
| 634 | nmdc:mga03n38_2491_c1 | 3300050490 | Bacteria | 5697 |
| 635 | nmdc:mga00v17_708607_c1 | 3300050491 | Bacteria | 645 |
| 636 | nmdc:mga0yw44_400772_c1 | 3300050492 | Bacteria | 928 |
| 637 | nmdc:mga0k408_35607_c1 | 3300050493 | Bacteria | 2274 |
| 638 | nmdc:mga06z11_369289_c1 | 3300050494 | Bacteria | 861 |
| 639 | nmdc:mga06z11_54721_c1 | 3300050494 | Bacteria | 2058 |
| 640 | nmdc:mga06z11_578319_c1 | 3300050494 | Bacteria | 683 |
| 641 | nmdc:mga06z11_868650_c1 | 3300050494 | Bacteria | 550 |
| 642 | nmdc:mga04h51_103694_c1 | 3300050495 | Bacteria | 1040 |
| 643 | nmdc:mga07m45_26717_c1 | 3300050496 | Bacteria | 3174 |
| 644 | nmdc:mga07m45_338095_c1 | 3300050496 | Bacteria | 875 |
| 645 | nmdc:mga07m45_3505_c3 | 3300050496 | Bacteria | 2463 |
| 646 | nmdc:mga07m45_375506_c1 | 3300050496 | Bacteria | 826 |
| 647 | nmdc:mga0sz30_18519_c1 | 3300050516 | Bacteria | 2788 |
| 648 | nmdc:mga0sz30_279812_c1 | 3300050516 | Bacteria | 743 |
| 649 | nmdc:mga0sz30_329384_c1 | 3300050516 | Bacteria | 682 |
| 650 | nmdc:mga0sz30_414583_c1 | 3300050516 | Bacteria | 604 |
| 651 | nmdc:mga0sz30_457670_c1 | 3300050516 | Bacteria | 573 |
| 652 | Ga0500610_0000140 | 3300053079 | Bacteria | 21620 |
| 653 | Ga0500635_0252205 | 3300053080 | Bacteria | 692 |
| 654 | Ga0495655_0034011 | 3300053083 | Bacteria | 1258 |
| 655 | Ga0495619_0305738 | 3300053085 | Bacteria | 1101 |
| 656 | Ga0500578_0125959 | 3300053086 | Bacteria | 1608 |
| 657 | Ga0500578_0164851 | 3300053086 | Bacteria | 1373 |
| 658 | Ga0500643_043167 | 3300053087 | Bacteria | 1316 |
| 659 | Ga0500643_102037 | 3300053087 | Bacteria | 778 |
| 660 | Ga0500646_0034593 | 3300053090 | Bacteria | 1401 |
| 661 | Ga0500651_0117980 | 3300053093 | Bacteria | 1614 |
| 662 | Ga0500650_0047243 | 3300053098 | Unclassified | 1995 |
| 663 | Ga0500650_0262282 | 3300053098 | Bacteria | 772 |
| 664 | Ga0500654_192564 | 3300053099 | Bacteria | 629 |
| 665 | Ga0500562_012573 | 3300053108 | Bacteria | 2155 |
| 666 | Ga0500569_129751 | 3300053109 | Bacteria | 843 |
| 667 | Ga0500569_318291 | 3300053109 | Bacteria | 521 |
| 668 | Ga0500594_0007898 | 3300053118 | Bacteria | 2414 |
| 669 | Ga0500594_0186761 | 3300053118 | Bacteria | 678 |
| 670 | Ga0500594_0292815 | 3300053118 | Unclassified | 545 |
| 671 | Ga0500595_004282 | 3300053119 | Bacteria | 6429 |
| 672 | Ga0500595_010172 | 3300053119 | Bacteria | 3750 |
| 673 | Ga0500607_053714 | 3300053121 | Bacteria | 2135 |
| 674 | Ga0500607_141440 | 3300053121 | Bacteria | 1131 |
| 675 | Ga0500618_005797 | 3300053125 | Bacteria | 3711 |
| 676 | Ga0500642_0000153 | 3300053130 | Bacteria | 28618 |
| 677 | Ga0500642_0058487 | 3300053130 | Unclassified | 1723 |
| 678 | Ga0500655_095453 | 3300053133 | Unclassified | 620 |
| 679 | Ga0500658_0003673 | 3300053134 | Bacteria | 5785 |
| 680 | Ga0500568_0000137 | 3300053139 | Bacteria | 65882 |
| 681 | Ga0500568_0000825 | 3300053139 | Bacteria | 21796 |
| 682 | Ga0500568_0114173 | 3300053139 | Bacteria | 1008 |
| 683 | Ga0500577_0097706 | 3300053142 | Bacteria | 1196 |
| 684 | Ga0500577_0111971 | 3300053142 | Bacteria | 1127 |
| 685 | Ga0500577_0120812 | 3300053142 | Bacteria | 1090 |
| 686 | Ga0500588_0115528 | 3300053146 | Bacteria | 941 |
| 687 | Ga0500588_0385465 | 3300053146 | Unclassified | 533 |
| 688 | Ga0500590_010218 | 3300053148 | Bacteria | 4734 |
| 689 | Ga0500604_0000014 | 3300053151 | Bacteria | 92128 |
| 690 | Ga0500604_0002631 | 3300053151 | Bacteria | 4886 |
| 691 | Ga0500616_0003922 | 3300053153 | Bacteria | 10926 |
| 692 | Ga0500616_0005323 | 3300053153 | Bacteria | 8770 |
| 693 | Ga0500616_0051437 | 3300053153 | Bacteria | 2171 |
| 694 | Ga0500616_0107076 | 3300053153 | Bacteria | 1356 |
| 695 | Ga0500622_0008480 | 3300053156 | Bacteria | 5749 |
| 696 | Ga0500624_129640 | 3300053157 | Bacteria | 534 |
| 697 | Ga0500627_0066565 | 3300053158 | Bacteria | 1591 |
| 698 | Ga0500627_0128507 | 3300053158 | Bacteria | 1144 |
| 699 | Ga0500627_0150025 | 3300053158 | Bacteria | 1053 |
| 700 | Ga0500627_0426509 | 3300053158 | Bacteria | 561 |
| 701 | Ga0500627_0452675 | 3300053158 | Bacteria | 540 |
| 702 | Ga0500633_0202629 | 3300053160 | Bacteria | 743 |
| 703 | Ga0500633_0340232 | 3300053160 | Unclassified | 548 |
| 704 | Ga0500634_0039678 | 3300053161 | Bacteria | 2559 |
| 705 | Ga0500636_0028586 | 3300053177 | Bacteria | 3292 |
| 706 | Ga0500636_0209036 | 3300053177 | Bacteria | 1026 |
| 707 | Ga0500611_153152 | 3300053727 | Unclassified | 634 |
| 708 | Ga0500645_000080 | 3300053730 | Bacteria | 76756 |
| 709 | Ga0500645_060522 | 3300053730 | Bacteria | 1096 |
| 710 | Ga0500645_125620 | 3300053730 | Bacteria | 714 |
| 711 | Ga0500596_002571 | 3300053735 | Bacteria | 3566 |
| 712 | Ga0500601_004212 | 3300053737 | Bacteria | 1561 |
| 713 | Ga0501084_0198155 | 3300054114 | Bacteria | 1694 |
| 714 | Ga0501084_1795822 | 3300054114 | Bacteria | 512 |
| 715 | Ga0500661_059991 | 3300055283 | Bacteria | 686 |
| 716 | Ga0501082_0091705 | 3300060353 | Bacteria | 2624 |
| 717 | Ga0501082_1371466 | 3300060353 | Bacteria | 618 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049573 | Ga0501037_0792895 | Ga0501037_0792895_346_612 | 84 |
| 2 | 3300049592 | Ga0501076_1610010 | Ga0501076_1610010_250_516 | 84 |
| 3 | iso_pu_bacteria | 2838029111 | 2838033299 | 91 |
| 4 | iso_pu_bacteria | 2842475841 | 2842480036 | 91 |
| 5 | iso_pu_bacteria | 2842482326 | 2842483774 | 91 |
| 6 | iso_pu_bacteria | 2842502639 | 2842505179 | 91 |
| 7 | iso_pu_bacteria | 2919408235 | 2919410300 | 91 |
| 8 | 3300005616 | Ga0068852_100034890 | Ga0068852_1000348902 | 95 |
| 9 | 3300025253 | Ga0209677_100453 | Ga0209677_10045320 | 95 |
| 10 | 3300025261 | Ga0209233_1000137 | Ga0209233_1000137200 | 95 |
| 11 | 3300025913 | Ga0207695_10000037 | Ga0207695_10000037219 | 95 |
| 12 | 3300025914 | Ga0207671_10001017 | Ga0207671_1000101719 | 95 |
| 13 | 3300041443 | Ga0451789_1300095 | Ga0451789_1300095_1726_2013 | 95 |
| 14 | 3300041486 | Ga0451807_2434329 | Ga0451807_2434329_630_917 | 95 |
| 15 | 3300041493 | Ga0451836_15971 | Ga0451836_15971_16_303 | 95 |
| 16 | 3300041497 | Ga0451840_03790 | Ga0451840_03790_326_613 | 95 |
| 17 | 3300041502 | Ga0451846_47186 | Ga0451846_47186_14_301 | 95 |
| 18 | 3300041504 | Ga0451848_06124 | Ga0451848_06124_215_502 | 95 |
| 19 | 3300041510 | Ga0451854_23698 | Ga0451854_23698_18_305 | 95 |
| 20 | 3300046507 | Ga0495606_0041886 | Ga0495606_0041886_21_308 | 95 |
| 21 | 3300048913 | Ga0496110_0504698 | Ga0496110_0504698_552_875 | 96 |
| 22 | 3300053087 | Ga0500643_102037 | Ga0500643_102037_70_384 | 98 |
| 23 | 3300053130 | Ga0500642_0058487 | Ga0500642_0058487_1162_1476 | 98 |
| 24 | 3300005530 | Ga0070679_100344403 | Ga0070679_1003444031 | 99 |
| 25 | 3300006186 | Ga0075369_10643385 | Ga0075369_106433852 | 99 |
| 26 | 3300025921 | Ga0207652_10100447 | Ga0207652_101004473 | 99 |
| 27 | 3300046460 | Ga0495638_0481037 | Ga0495638_0481037_302_619 | 99 |
| 28 | 3300046660 | Ga0495625_0056176 | Ga0495625_0056176_2345_2662 | 99 |
| 29 | 3300049579 | Ga0501043_0065196 | Ga0501043_0065196_346_663 | 99 |
| 30 | 3300049581 | Ga0501047_0013527 | Ga0501047_0013527_3610_3927 | 99 |
| 31 | 3300049584 | Ga0501068_0009640 | Ga0501068_0009640_4954_5271 | 99 |
| 32 | 3300049589 | Ga0501073_0033818 | Ga0501073_0033818_2711_3028 | 99 |
| 33 | 3300049593 | Ga0501077_1109664 | Ga0501077_1109664_158_475 | 99 |
| 34 | 3300049742 | Ga0501080_0016271 | Ga0501080_0016271_3925_4242 | 99 |
| 35 | 3300049744 | Ga0501083_0024787 | Ga0501083_0024787_579_896 | 99 |
| 36 | 3300049823 | Ga0501044_0060567 | Ga0501044_0060567_3422_3739 | 99 |
| 37 | 3300053090 | Ga0500646_0034593 | Ga0500646_0034593_936_1253 | 99 |
| 38 | 3300053098 | Ga0500650_0047243 | Ga0500650_0047243_149_466 | 99 |
| 39 | 3300053108 | Ga0500562_012573 | Ga0500562_012573_569_886 | 99 |
| 40 | 3300053118 | Ga0500594_0292815 | Ga0500594_0292815_214_531 | 99 |
| 41 | 3300053133 | Ga0500655_095453 | Ga0500655_095453_265_582 | 99 |
| 42 | 3300053139 | Ga0500568_0114173 | Ga0500568_0114173_392_709 | 99 |
| 43 | 3300053142 | Ga0500577_0097706 | Ga0500577_0097706_659_976 | 99 |
| 44 | 3300053146 | Ga0500588_0385465 | Ga0500588_0385465_149_466 | 99 |
| 45 | 3300053151 | Ga0500604_0002631 | Ga0500604_0002631_2805_3122 | 99 |
| 46 | 3300053160 | Ga0500633_0340232 | Ga0500633_0340232_64_381 | 99 |
| 47 | 3300053727 | Ga0500611_153152 | Ga0500611_153152_141_458 | 99 |
| 48 | 3300054114 | Ga0501084_0198155 | Ga0501084_0198155_501_818 | 99 |
| 49 | 3300060353 | Ga0501082_0091705 | Ga0501082_0091705_875_1192 | 99 |
| 50 | iso_pu_bacteria | 2643221736 | 2644743279 | 99 |
| 51 | iso_pu_bacteria | 8057529695 | 8057530629 | 99 |
| 52 | iso_pu_bacteria | 2509276018 | 2509370700 | 100 |
| 53 | iso_pu_bacteria | 2510065019 | 2510131849 | 100 |
| 54 | iso_pu_bacteria | 2510065059 | 2510317491 | 100 |
| 55 | iso_pu_bacteria | 2510461076 | 2510898174 | 100 |
| 56 | iso_pu_bacteria | 2510917022 | 2511133157 | 100 |
| 57 | iso_pu_bacteria | 2510917026 | 2511174944 | 100 |
| 58 | iso_pu_bacteria | 2512875026 | 2512973570 | 100 |
| 59 | iso_pu_bacteria | 2513237084 | 2513573517 | 100 |
| 60 | iso_pu_bacteria | 2513237085 | 2513581012 | 100 |
| 61 | iso_pu_bacteria | 2513237089 | 2513601911 | 100 |
| 62 | iso_pu_bacteria | 2513237093 | 2513636619 | 100 |
| 63 | iso_pu_bacteria | 2513237103 | 2513711861 | 100 |
| 64 | iso_pu_bacteria | 2513237156 | 2513988048 | 100 |
| 65 | iso_pu_bacteria | 2513237160 | 2514003489 | 100 |
| 66 | iso_pu_bacteria | 2513237162 | 2514023968 | 100 |
| 67 | iso_pu_bacteria | 2515075009 | 2515110784 | 100 |
| 68 | iso_pu_bacteria | 2515154113 | 2515638863 | 100 |
| 69 | iso_pu_bacteria | 2515154114 | 2515645691 | 100 |
| 70 | iso_pu_bacteria | 2515154116 | 2515661403 | 100 |
| 71 | iso_pu_bacteria | 2515154134 | 2515743234 | 100 |
| 72 | iso_pu_bacteria | 2516653077 | 2517039483 | 100 |
| 73 | iso_pu_bacteria | 2516653085 | 2517075014 | 100 |
| 74 | iso_pu_bacteria | 2517093000 | 2517093650 | 100 |
| 75 | iso_pu_bacteria | 2517287029 | 2517405403 | 100 |
| 76 | iso_pu_bacteria | 2517487022 | 2517571426 | 100 |
| 77 | iso_pu_bacteria | 2519899620 | 2520377108 | 100 |
| 78 | iso_pu_bacteria | 2524023209 | 2524458939 | 100 |
| 79 | iso_pu_bacteria | 2529292951 | 2530644804 | 100 |
| 80 | iso_pu_bacteria | 2582581298 | 2585222512 | 100 |
| 81 | iso_pu_bacteria | 2582581306 | 2585266530 | 100 |
| 82 | iso_pu_bacteria | 2582581307 | 2585271897 | 100 |
| 83 | iso_pu_bacteria | 2582581308 | 2585279367 | 100 |
| 84 | iso_pu_bacteria | 2582581316 | 2585331141 | 100 |
| 85 | iso_pu_bacteria | 2582581865 | 2585387546 | 100 |
| 86 | iso_pu_bacteria | 2582581867 | 2585402696 | 100 |
| 87 | iso_pu_bacteria | 2585427526 | 2585525181 | 100 |
| 88 | iso_pu_bacteria | 2585427527 | 2585531148 | 100 |
| 89 | iso_pu_bacteria | 2585427528 | 2585538647 | 100 |
| 90 | iso_pu_bacteria | 2585427529 | 2585545095 | 100 |
| 91 | iso_pu_bacteria | 2585427530 | 2585552928 | 100 |
| 92 | iso_pu_bacteria | 2585427531 | 2585563740 | 100 |
| 93 | iso_pu_bacteria | 2585427590 | 2585820391 | 100 |
| 94 | iso_pu_bacteria | 2585427593 | 2585836600 | 100 |
| 95 | iso_pu_bacteria | 2585427608 | 2585897064 | 100 |
| 96 | iso_pu_bacteria | 2585427609 | 2585907078 | 100 |
| 97 | iso_pu_bacteria | 2585428125 | 2587982928 | 100 |
| 98 | iso_pu_bacteria | 2597489875 | 2597814085 | 100 |
| 99 | iso_pu_bacteria | 2615840626 | 2616311110 | 100 |
| 100 | iso_pu_bacteria | 2615840698 | 2616554549 | 100 |
| 101 | iso_pu_bacteria | 2617270742 | 2617385389 | 100 |
| 102 | iso_pu_bacteria | 2643221582 | 2643917188 | 100 |
| 103 | iso_pu_bacteria | 2643221595 | 2643989399 | 100 |
| 104 | iso_pu_bacteria | 2643221627 | 2644152971 | 100 |
| 105 | iso_pu_bacteria | 2643221734 | 2644735643 | 100 |
| 106 | iso_pu_bacteria | 2667528174 | 2671111134 | 100 |
| 107 | iso_pu_bacteria | 2687453392 | 2688599415 | 100 |
| 108 | iso_pu_bacteria | 2718217882 | 2719180261 | 100 |
| 109 | iso_pu_bacteria | 2718217927 | 2719388689 | 100 |
| 110 | iso_pu_bacteria | 2718217997 | 2719666106 | 100 |
| 111 | iso_pu_bacteria | 2718218009 | 2719731010 | 100 |
| 112 | iso_pu_bacteria | 2718218199 | 2720492526 | 100 |
| 113 | iso_pu_bacteria | 2718218232 | 2720613961 | 100 |
| 114 | iso_pu_bacteria | 2718218235 | 2720632088 | 100 |
| 115 | iso_pu_bacteria | 2718218269 | 2720775816 | 100 |
| 116 | iso_pu_bacteria | 2718218363 | 2721146355 | 100 |
| 117 | iso_pu_bacteria | 2718218365 | 2721157875 | 100 |
| 118 | iso_pu_bacteria | 2718218366 | 2721163234 | 100 |
| 119 | iso_pu_bacteria | 2718218423 | 2721403315 | 100 |
| 120 | iso_pu_bacteria | 2721755514 | 2722839404 | 100 |
| 121 | iso_pu_bacteria | 2721755523 | 2722885257 | 100 |
| 122 | iso_pu_bacteria | 2721755684 | 2723561042 | 100 |
| 123 | iso_pu_bacteria | 2721755685 | 2723567635 | 100 |
| 124 | iso_pu_bacteria | 2721755809 | 2724035672 | 100 |
| 125 | iso_pu_bacteria | 2721755810 | 2724043766 | 100 |
| 126 | iso_pu_bacteria | 2721755819 | 2724090423 | 100 |
| 127 | iso_pu_bacteria | 2721755822 | 2724104900 | 100 |
| 128 | iso_pu_bacteria | 2721755823 | 2724110761 | 100 |
| 129 | iso_pu_bacteria | 2724679232 | 2725948246 | 100 |
| 130 | iso_pu_bacteria | 2728369365 | 2730163498 | 100 |
| 131 | iso_pu_bacteria | 2728369397 | 2730297507 | 100 |
| 132 | iso_pu_bacteria | 2738541333 | 2739034077 | 100 |
| 133 | iso_pu_bacteria | 2791355256 | 2793295966 | 100 |
| 134 | iso_pu_bacteria | 2791355261 | 2793331908 | 100 |
| 135 | iso_pu_bacteria | 2791355262 | 2793336352 | 100 |
| 136 | iso_pu_bacteria | 2791355264 | 2793347902 | 100 |
| 137 | iso_pu_bacteria | 2791355265 | 2793354135 | 100 |
| 138 | iso_pu_bacteria | 2791355266 | 2793358594 | 100 |
| 139 | iso_pu_bacteria | 2791355267 | 2793366793 | 100 |
| 140 | iso_pu_bacteria | 2802428858 | 2802717207 | 100 |
| 141 | iso_pu_bacteria | 2802428859 | 2802724804 | 100 |
| 142 | iso_pu_bacteria | 2802428860 | 2802729555 | 100 |
| 143 | iso_pu_bacteria | 2802428861 | 2802736901 | 100 |
| 144 | iso_pu_bacteria | 2802428862 | 2802743306 | 100 |
| 145 | iso_pu_bacteria | 2802428863 | 2802749568 | 100 |
| 146 | iso_pu_bacteria | 2802429633 | 2806042874 | 100 |
| 147 | iso_pu_bacteria | 2802429634 | 2806050825 | 100 |
| 148 | iso_pu_bacteria | 2802429635 | 2806058007 | 100 |
| 149 | iso_pu_bacteria | 2802429636 | 2806065280 | 100 |
| 150 | iso_pu_bacteria | 2802429637 | 2806076766 | 100 |
| 151 | iso_pu_bacteria | 2818991448 | 2819609436 | 100 |
| 152 | iso_pu_bacteria | 2818991453 | 2819641253 | 100 |
| 153 | iso_pu_bacteria | 2818991467 | 2819717657 | 100 |
| 154 | iso_pu_bacteria | 2837678835 | 2837682149 | 100 |
| 155 | iso_pu_bacteria | 2838022645 | 2838023190 | 100 |
| 156 | iso_pu_bacteria | 2838048938 | 2838052003 | 100 |
| 157 | iso_pu_bacteria | 2838061910 | 2838067379 | 100 |
| 158 | iso_pu_bacteria | 2838068647 | 2838070197 | 100 |
| 159 | iso_pu_bacteria | 2838680041 | 2838685522 | 100 |
| 160 | iso_pu_bacteria | 2838686498 | 2838693953 | 100 |
| 161 | iso_pu_bacteria | 2838694306 | 2838696022 | 100 |
| 162 | iso_pu_bacteria | 2838707686 | 2838713421 | 100 |
| 163 | iso_pu_bacteria | 2838729681 | 2838736621 | 100 |
| 164 | iso_pu_bacteria | 2838742623 | 2838749476 | 100 |
| 165 | iso_pu_bacteria | 2839138175 | 2839142089 | 100 |
| 166 | iso_pu_bacteria | 2841734538 | 2841740024 | 100 |
| 167 | iso_pu_bacteria | 2841760612 | 2841761159 | 100 |
| 168 | iso_pu_bacteria | 2841851746 | 2841858741 | 100 |
| 169 | iso_pu_bacteria | 2842077413 | 2842082655 | 100 |
| 170 | iso_pu_bacteria | 2842118031 | 2842123786 | 100 |
| 171 | iso_pu_bacteria | 2842156927 | 2842163553 | 100 |
| 172 | iso_pu_bacteria | 2842163707 | 2842169532 | 100 |
| 173 | iso_pu_bacteria | 2842180545 | 2842187174 | 100 |
| 174 | iso_pu_bacteria | 2842198810 | 2842199618 | 100 |
| 175 | iso_pu_bacteria | 2842205361 | 2842208757 | 100 |
| 176 | iso_pu_bacteria | 2842217011 | 2842221021 | 100 |
| 177 | iso_pu_bacteria | 2842229732 | 2842236790 | 100 |
| 178 | iso_pu_bacteria | 2842237096 | 2842242841 | 100 |
| 179 | iso_pu_bacteria | 2842243621 | 2842250535 | 100 |
| 180 | iso_pu_bacteria | 2842257432 | 2842264385 | 100 |
| 181 | iso_pu_bacteria | 2842271015 | 2842278445 | 100 |
| 182 | iso_pu_bacteria | 2842278818 | 2842281898 | 100 |
| 183 | iso_pu_bacteria | 2842291075 | 2842296914 | 100 |
| 184 | iso_pu_bacteria | 2842298080 | 2842298291 | 100 |
| 185 | iso_pu_bacteria | 2842304105 | 2842307231 | 100 |
| 186 | iso_pu_bacteria | 2842357229 | 2842360109 | 100 |
| 187 | iso_pu_bacteria | 2842363717 | 2842368144 | 100 |
| 188 | iso_pu_bacteria | 2842370503 | 2842376092 | 100 |
| 189 | iso_pu_bacteria | 2842377471 | 2842383302 | 100 |
| 190 | iso_pu_bacteria | 2842384541 | 2842390435 | 100 |
| 191 | iso_pu_bacteria | 2842395702 | 2842396633 | 100 |
| 192 | iso_pu_bacteria | 2842422224 | 2842423811 | 100 |
| 193 | iso_pu_bacteria | 2842447887 | 2842453167 | 100 |
| 194 | iso_pu_bacteria | 2844009547 | 2844014693 | 100 |
| 195 | iso_pu_bacteria | 2844104063 | 2844104184 | 100 |
| 196 | iso_pu_bacteria | 2844454524 | 2844455599 | 100 |
| 197 | iso_pu_bacteria | 2847686936 | 2847692958 | 100 |
| 198 | iso_pu_bacteria | 2851182111 | 2851184182 | 100 |
| 199 | iso_pu_bacteria | 2851246043 | 2851247172 | 100 |
| 200 | iso_pu_bacteria | 2854896431 | 2854901828 | 100 |
| 201 | iso_pu_bacteria | 2856328259 | 2856328967 | 100 |
| 202 | iso_pu_bacteria | 2856334872 | 2856340035 | 100 |
| 203 | iso_pu_bacteria | 2857367948 | 2857368567 | 100 |
| 204 | iso_pu_bacteria | 2869169390 | 2869174780 | 100 |
| 205 | iso_pu_bacteria | 2869234852 | 2869239591 | 100 |
| 206 | iso_pu_bacteria | 2869242130 | 2869248316 | 100 |
| 207 | iso_pu_bacteria | 2869249662 | 2869253170 | 100 |
| 208 | iso_pu_bacteria | 2869256925 | 2869262524 | 100 |
| 209 | iso_pu_bacteria | 2869264136 | 2869266560 | 100 |
| 210 | iso_pu_bacteria | 2869271264 | 2869276168 | 100 |
| 211 | iso_pu_bacteria | 2871435913 | 2871438316 | 100 |
| 212 | iso_pu_bacteria | 2871444079 | 2871449095 | 100 |
| 213 | iso_pu_bacteria | 2871451962 | 2871458157 | 100 |
| 214 | iso_pu_bacteria | 2871459585 | 2871462365 | 100 |
| 215 | iso_pu_bacteria | 2871474448 | 2871475318 | 100 |
| 216 | iso_pu_bacteria | 2871481445 | 2871487717 | 100 |
| 217 | iso_pu_bacteria | 2874102143 | 2874107133 | 100 |
| 218 | iso_pu_bacteria | 2874109183 | 2874114687 | 100 |
| 219 | iso_pu_bacteria | 2874116593 | 2874117788 | 100 |
| 220 | iso_pu_bacteria | 2874123672 | 2874125986 | 100 |
| 221 | iso_pu_bacteria | 2874131515 | 2874137983 | 100 |
| 222 | iso_pu_bacteria | 2874162495 | 2874167267 | 100 |
| 223 | iso_pu_bacteria | 2876386047 | 2876386070 | 100 |
| 224 | iso_pu_bacteria | 2876399893 | 2876405872 | 100 |
| 225 | iso_pu_bacteria | 2876406927 | 2876407645 | 100 |
| 226 | iso_pu_bacteria | 2876420981 | 2876423749 | 100 |
| 227 | iso_pu_bacteria | 2878774303 | 2878774803 | 100 |
| 228 | iso_pu_bacteria | 2878781027 | 2878788449 | 100 |
| 229 | iso_pu_bacteria | 2878788777 | 2878794257 | 100 |
| 230 | iso_pu_bacteria | 2881147464 | 2881152852 | 100 |
| 231 | iso_pu_bacteria | 2885312484 | 2885317127 | 100 |
| 232 | iso_pu_bacteria | 2885409591 | 2885416243 | 100 |
| 233 | iso_pu_bacteria | 2888343758 | 2888347475 | 100 |
| 234 | iso_pu_bacteria | 2903513507 | 2903516673 | 100 |
| 235 | iso_pu_bacteria | 2906328253 | 2906335294 | 100 |
| 236 | iso_pu_bacteria | 2906363423 | 2906365855 | 100 |
| 237 | iso_pu_bacteria | 2906370794 | 2906373936 | 100 |
| 238 | iso_pu_bacteria | 2906378014 | 2906383367 | 100 |
| 239 | iso_pu_bacteria | 2906386501 | 2906389295 | 100 |
| 240 | iso_pu_bacteria | 2906393657 | 2906399257 | 100 |
| 241 | iso_pu_bacteria | 2906401398 | 2906402756 | 100 |
| 242 | iso_pu_bacteria | 2906408224 | 2906412653 | 100 |
| 243 | iso_pu_bacteria | 2906427513 | 2906428530 | 100 |
| 244 | iso_pu_bacteria | 2915650412 | 2915651184 | 100 |
| 245 | iso_pu_bacteria | 2915980308 | 2915982420 | 100 |
| 246 | iso_pu_bacteria | 2916061851 | 2916065006 | 100 |
| 247 | iso_pu_bacteria | 2917699015 | 2917699917 | 100 |
| 248 | iso_pu_bacteria | 2921250672 | 2921252930 | 100 |
| 249 | iso_pu_bacteria | 2922151315 | 2922157459 | 100 |
| 250 | iso_pu_bacteria | 2922158528 | 2922164148 | 100 |
| 251 | iso_pu_bacteria | 2922172374 | 2922177096 | 100 |
| 252 | iso_pu_bacteria | 2922178524 | 2922179094 | 100 |
| 253 | iso_pu_bacteria | 2922368715 | 2922368912 | 100 |
| 254 | iso_pu_bacteria | 2923556063 | 2923562993 | 100 |
| 255 | iso_pu_bacteria | 2924710171 | 2924711481 | 100 |
| 256 | iso_pu_bacteria | 2924726620 | 2924733109 | 100 |
| 257 | iso_pu_bacteria | 2924733363 | 2924736240 | 100 |
| 258 | iso_pu_bacteria | 2924741084 | 2924745200 | 100 |
| 259 | iso_pu_bacteria | 2924748358 | 2924750718 | 100 |
| 260 | iso_pu_bacteria | 2924754689 | 2924759549 | 100 |
| 261 | iso_pu_bacteria | 2924762789 | 2924768971 | 100 |
| 262 | iso_pu_bacteria | 2933570622 | 2933572656 | 100 |
| 263 | iso_pu_bacteria | 2933599457 | 2933601002 | 100 |
| 264 | iso_pu_bacteria | 2935894831 | 2935900041 | 100 |
| 265 | iso_pu_bacteria | 2935901341 | 2935906761 | 100 |
| 266 | iso_pu_bacteria | 2937029754 | 2937031850 | 100 |
| 267 | iso_pu_bacteria | 2937036028 | 2937036219 | 100 |
| 268 | iso_pu_bacteria | 2937078374 | 2937082055 | 100 |
| 269 | iso_pu_bacteria | 2937084907 | 2937089993 | 100 |
| 270 | iso_pu_bacteria | 2937836603 | 2937837779 | 100 |
| 271 | iso_pu_bacteria | 2937843397 | 2937846861 | 100 |
| 272 | iso_pu_bacteria | 2937861824 | 2937866860 | 100 |
| 273 | iso_pu_bacteria | 2937868953 | 2937869715 | 100 |
| 274 | iso_pu_bacteria | 2937891427 | 2937892881 | 100 |
| 275 | iso_pu_bacteria | 2937980651 | 2937981198 | 100 |
| 276 | iso_pu_bacteria | 2941499720 | 2941506307 | 100 |
| 277 | iso_pu_bacteria | 2957375807 | 2957381820 | 100 |
| 278 | iso_pu_bacteria | 2957437181 | 2957442079 | 100 |
| 279 | iso_pu_bacteria | 2958071322 | 2958077518 | 100 |
| 280 | iso_pu_bacteria | 2958108152 | 2958115114 | 100 |
| 281 | iso_pu_bacteria | 2958115193 | 2958122263 | 100 |
| 282 | iso_pu_bacteria | 2958122699 | 2958123129 | 100 |
| 283 | iso_pu_bacteria | 2958137437 | 2958142067 | 100 |
| 284 | iso_pu_bacteria | 2958158011 | 2958160337 | 100 |
| 285 | iso_pu_bacteria | 2960591022 | 2960592243 | 100 |
| 286 | iso_pu_bacteria | 2960631154 | 2960633805 | 100 |
| 287 | iso_pu_bacteria | 2960680706 | 2960682350 | 100 |
| 288 | iso_pu_bacteria | 2960693952 | 2960698224 | 100 |
| 289 | iso_pu_bacteria | 2961136820 | 2961137642 | 100 |
| 290 | iso_pu_bacteria | 2961183825 | 2961189104 | 100 |
| 291 | iso_pu_bacteria | 2965025482 | 2965029516 | 100 |
| 292 | iso_pu_bacteria | 2965032056 | 2965037791 | 100 |
| 293 | iso_pu_bacteria | 2965040258 | 2965043889 | 100 |
| 294 | iso_pu_bacteria | 2965047637 | 2965053806 | 100 |
| 295 | iso_pu_bacteria | 2965062239 | 2965065579 | 100 |
| 296 | iso_pu_bacteria | 2965089291 | 2965095807 | 100 |
| 297 | iso_pu_bacteria | 2965102966 | 2965109162 | 100 |
| 298 | iso_pu_bacteria | 2965110997 | 2965117101 | 100 |
| 299 | iso_pu_bacteria | 2967686174 | 2967690240 | 100 |
| 300 | iso_pu_bacteria | 2967728569 | 2967730833 | 100 |
| 301 | iso_pu_bacteria | 2968091066 | 2968091802 | 100 |
| 302 | iso_pu_bacteria | 2968097103 | 2968103161 | 100 |
| 303 | iso_pu_bacteria | 2968128360 | 2968129864 | 100 |
| 304 | iso_pu_bacteria | 2968138860 | 2968143941 | 100 |
| 305 | iso_pu_bacteria | 2970026789 | 2970029545 | 100 |
| 306 | iso_pu_bacteria | 2970122695 | 2970128922 | 100 |
| 307 | iso_pu_bacteria | 2970143518 | 2970143594 | 100 |
| 308 | iso_pu_bacteria | 2970489779 | 2970495832 | 100 |
| 309 | iso_pu_bacteria | 2970510686 | 2970512680 | 100 |
| 310 | iso_pu_bacteria | 2970524798 | 2970531723 | 100 |
| 311 | iso_pu_bacteria | 2970532167 | 2970538465 | 100 |
| 312 | iso_pu_bacteria | 2970540015 | 2970544281 | 100 |
| 313 | iso_pu_bacteria | 2970547951 | 2970550046 | 100 |
| 314 | iso_pu_bacteria | 2970619444 | 2970621102 | 100 |
| 315 | iso_pu_bacteria | 2970627176 | 2970631150 | 100 |
| 316 | iso_pu_bacteria | 2977530762 | 2977535074 | 100 |
| 317 | iso_pu_bacteria | 2977544691 | 2977550619 | 100 |
| 318 | iso_pu_bacteria | 2977851361 | 2977858084 | 100 |
| 319 | iso_pu_bacteria | 2977858184 | 2977863505 | 100 |
| 320 | iso_pu_bacteria | 2977898635 | 2977905830 | 100 |
| 321 | iso_pu_bacteria | 2977907340 | 2977915018 | 100 |
| 322 | iso_pu_bacteria | 2977915119 | 2977919635 | 100 |
| 323 | iso_pu_bacteria | 2977935797 | 2977941415 | 100 |
| 324 | iso_pu_bacteria | 2977950692 | 2977952625 | 100 |
| 325 | iso_pu_bacteria | 2977957713 | 2977958991 | 100 |
| 326 | iso_pu_bacteria | 2979764755 | 2979770528 | 100 |
| 327 | iso_pu_bacteria | 2979772303 | 2979776714 | 100 |
| 328 | iso_pu_bacteria | 2979779861 | 2979780310 | 100 |
| 329 | iso_pu_bacteria | 2979793036 | 2979798418 | 100 |
| 330 | iso_pu_bacteria | 2987645492 | 2987648697 | 100 |
| 331 | iso_pu_bacteria | 2987666974 | 2987670649 | 100 |
| 332 | iso_pu_bacteria | 2987673487 | 2987675130 | 100 |
| 333 | iso_pu_bacteria | 2996341866 | 2996345253 | 100 |
| 334 | iso_pu_bacteria | 2996386984 | 2996392576 | 100 |
| 335 | iso_pu_bacteria | 2996893221 | 2996894123 | 100 |
| 336 | iso_pu_bacteria | 3004167301 | 3004169598 | 100 |
| 337 | iso_pu_bacteria | 3004195979 | 3004196866 | 100 |
| 338 | iso_pu_bacteria | 3004232784 | 3004238884 | 100 |
| 339 | iso_pu_bacteria | 3004239961 | 3004242641 | 100 |
| 340 | iso_pu_bacteria | 3004248173 | 3004254303 | 100 |
| 341 | iso_pu_bacteria | 3004268573 | 3004275210 | 100 |
| 342 | iso_pu_bacteria | 3005416602 | 3005418879 | 100 |
| 343 | iso_pu_bacteria | 649633066 | 649873919 | 100 |
| 344 | iso_pu_bacteria | 8003999396 | 8004003088 | 100 |
| 345 | iso_pu_bacteria | 8004300914 | 8004303254 | 100 |
| 346 | iso_pu_bacteria | 8004312739 | 8004314620 | 100 |
| 347 | iso_pu_bacteria | 8004395343 | 8004403553 | 100 |
| 348 | iso_pu_bacteria | 8004445564 | 8004445767 | 100 |
| 349 | iso_pu_bacteria | 8004633249 | 8004634065 | 100 |
| 350 | iso_pu_bacteria | 8004695233 | 8004699785 | 100 |
| 351 | iso_pu_bacteria | 8004703790 | 8004713697 | 100 |
| 352 | iso_pu_bacteria | 8004727605 | 8004733072 | 100 |
| 353 | iso_pu_bacteria | 8005275841 | 8005277412 | 100 |
| 354 | iso_pu_bacteria | 8005282627 | 8005283312 | 100 |
| 355 | iso_pu_bacteria | 8005301065 | 8005304570 | 100 |
| 356 | iso_pu_bacteria | 8005307578 | 8005312249 | 100 |
| 357 | iso_pu_bacteria | 8005314921 | 8005318229 | 100 |
| 358 | iso_pu_bacteria | 8005430974 | 8005435102 | 100 |
| 359 | iso_pu_bacteria | 8005460587 | 8005461426 | 100 |
| 360 | iso_pu_bacteria | 8005484373 | 8005488893 | 100 |
| 361 | iso_pu_bacteria | 8005497431 | 8005500841 | 100 |
| 362 | iso_pu_bacteria | 8005556819 | 8005562700 | 100 |
| 363 | iso_pu_bacteria | 8005563573 | 8005569975 | 100 |
| 364 | iso_pu_bacteria | 8005570704 | 8005575727 | 100 |
| 365 | iso_pu_bacteria | 8005626139 | 8005632306 | 100 |
| 366 | iso_pu_bacteria | 8005645114 | 8005645977 | 100 |
| 367 | iso_pu_bacteria | 8005668836 | 8005672258 | 100 |
| 368 | iso_pu_bacteria | 8005682033 | 8005682584 | 100 |
| 369 | iso_pu_bacteria | 8005688590 | 8005690993 | 100 |
| 370 | iso_pu_bacteria | 8005695170 | 8005701658 | 100 |
| 371 | iso_pu_bacteria | 8018127388 | 8018133176 | 100 |
| 372 | iso_pu_bacteria | 8018163183 | 8018168613 | 100 |
| 373 | iso_pu_bacteria | 8018176218 | 8018182977 | 100 |
| 374 | iso_pu_bacteria | 8023680758 | 8023683540 | 100 |
| 375 | iso_pu_bacteria | 8024486573 | 8024490061 | 100 |
| 376 | iso_pu_bacteria | 8055617313 | 8055621541 | 100 |
| 377 | iso_pu_bacteria | 8056375014 | 8056375413 | 100 |
| 378 | iso_pu_bacteria | 8056382006 | 8056382863 | 100 |
| 379 | iso_pu_bacteria | 8057575449 | 8057576654 | 100 |
| 380 | iso_pu_bacteria | 8057874678 | 8057881545 | 100 |
| 381 | 3300005547 | Ga0070693_100840624 | Ga0070693_1008406241 | 101 |
| 382 | 3300005841 | Ga0068863_100074721 | Ga0068863_1000747216 | 101 |
| 383 | 3300025917 | Ga0207660_10768349 | Ga0207660_107683491 | 101 |
| 384 | 3300046522 | Ga0495643_0073033 | Ga0495643_0073033_522_830 | 102 |
| 385 | iso_pu_bacteria | 2844002411 | 2844006449 | 102 |
| 386 | 3300001990 | JGI24737J22298_10004864 | JGI24737J22298_100048643 | 103 |
| 387 | 3300002987 | JGI25159J45721_1007150 | JGI25159J45721_10071502 | 103 |
| 388 | 3300003187 | JGI25151J46595_10050591 | JGI25151J46595_100505912 | 103 |
| 389 | 3300005262 | Ga0065165_1000234 | Ga0065165_100023472 | 103 |
| 390 | 3300005367 | Ga0070667_101101835 | Ga0070667_1011018351 | 103 |
| 391 | 3300005435 | Ga0070714_100022342 | Ga0070714_1000223427 | 103 |
| 392 | 3300005441 | Ga0070700_102012017 | Ga0070700_1020120171 | 103 |
| 393 | 3300005539 | Ga0068853_102423834 | Ga0068853_1024238341 | 103 |
| 394 | 3300005548 | Ga0070665_100453703 | Ga0070665_1004537033 | 103 |
| 395 | 3300005614 | Ga0068856_101095222 | Ga0068856_1010952221 | 103 |
| 396 | 3300006028 | Ga0070717_10385067 | Ga0070717_103850672 | 103 |
| 397 | 3300009093 | Ga0105240_11387494 | Ga0105240_113874942 | 103 |
| 398 | 3300009174 | Ga0105241_12286651 | Ga0105241_122866512 | 103 |
| 399 | 3300009545 | Ga0105237_10796418 | Ga0105237_107964182 | 103 |
| 400 | 3300014326 | Ga0157380_12305627 | Ga0157380_123056272 | 103 |
| 401 | 3300025284 | Ga0209130_1000279 | Ga0209130_100027928 | 103 |
| 402 | 3300025294 | Ga0209025_1002215 | Ga0209025_100221513 | 103 |
| 403 | 3300025299 | Ga0209256_1075637 | Ga0209256_10756371 | 103 |
| 404 | 3300025302 | Ga0207426_1008474 | Ga0207426_10084747 | 103 |
| 405 | 3300025929 | Ga0207664_10017789 | Ga0207664_100177897 | 103 |
| 406 | 3300026078 | Ga0207702_10911743 | Ga0207702_109117431 | 103 |
| 407 | 3300028379 | Ga0268266_10062390 | Ga0268266_100623902 | 103 |
| 408 | 3300031344 | Ga0265316_10943025 | Ga0265316_109430252 | 103 |
| 409 | 3300037853 | Ga0436364_1037496 | Ga0436364_1037496_331_642 | 103 |
| 410 | 3300038443 | Ga0395901_0874728 | Ga0395901_0874728_170_484 | 103 |
| 411 | 3300044656 | Ga0466969_0117008 | Ga0466969_0117008_578_889 | 103 |
| 412 | 3300044683 | Ga0466965_0769203 | Ga0466965_0769203_170_481 | 103 |
| 413 | 3300044684 | Ga0466966_0391440 | Ga0466966_0391440_208_519 | 103 |
| 414 | 3300044693 | Ga0466961_0493890 | Ga0466961_0493890_196_507 | 103 |
| 415 | 3300044719 | Ga0466971_0237453 | Ga0466971_0237453_115_426 | 103 |
| 416 | 3300044842 | Ga0466957_0921778 | Ga0466957_0921778_168_479 | 103 |
| 417 | 3300045049 | Ga0466959_0025034 | Ga0466959_0025034_3554_3865 | 103 |
| 418 | 3300045836 | Ga0466958_0161318 | Ga0466958_0161318_325_636 | 103 |
| 419 | 3300045976 | Ga0466967_1214945 | Ga0466967_1214945_402_713 | 103 |
| 420 | 3300046542 | Ga0495597_0071578 | Ga0495597_0071578_1091_1402 | 103 |
| 421 | 3300048908 | Ga0496105_0815701 | Ga0496105_0815701_154_465 | 103 |
| 422 | 3300048913 | Ga0496110_0620612 | Ga0496110_0620612_600_911 | 103 |
| 423 | 3300049571 | Ga0501034_0020130 | Ga0501034_0020130_6238_6549 | 103 |
| 424 | 3300053158 | Ga0500627_0066565 | Ga0500627_0066565_646_957 | 103 |
| 425 | 3300053158 | Ga0500627_0426509 | Ga0500627_0426509_22_333 | 103 |
| 426 | 3300053158 | Ga0500627_0452675 | Ga0500627_0452675_43_354 | 103 |
| 427 | 3300001915 | JGI24741J21665_1005468 | JGI24741J21665_10054683 | 104 |
| 428 | 3300001979 | JGI24740J21852_10026115 | JGI24740J21852_100261153 | 104 |
| 429 | 3300001989 | JGI24739J22299_10016293 | JGI24739J22299_100162932 | 104 |
| 430 | 3300002067 | JGI24735J21928_10042336 | JGI24735J21928_100423362 | 104 |
| 431 | 3300002737 | JGI25162J39368_1003498 | JGI25162J39368_10034982 | 104 |
| 432 | 3300002774 | JGI25150J39212_1020269 | JGI25150J39212_10202691 | 104 |
| 433 | 3300002987 | JGI25159J45721_1000251 | JGI25159J45721_100025114 | 104 |
| 434 | 3300003187 | JGI25151J46595_10001922 | JGI25151J46595_100019224 | 104 |
| 435 | 3300003214 | JGI25165J46597_1000087 | JGI25165J46597_100008762 | 104 |
| 436 | 3300003214 | JGI25165J46597_1000139 | JGI25165J46597_100013943 | 104 |
| 437 | 3300003214 | JGI25165J46597_1000692 | JGI25165J46597_100069215 | 104 |
| 438 | 3300003214 | JGI25165J46597_1000752 | JGI25165J46597_100075223 | 104 |
| 439 | 3300003214 | JGI25165J46597_1001515 | JGI25165J46597_10015154 | 104 |
| 440 | 3300003214 | JGI25165J46597_1003764 | JGI25165J46597_10037644 | 104 |
| 441 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006208 | 104 |
| 442 | 3300003215 | JGI25153J46596_10003398 | JGI25153J46596_100033985 | 104 |
| 443 | 3300003215 | JGI25153J46596_10010091 | JGI25153J46596_100100917 | 104 |
| 444 | 3300003316 | rootH1_10065014 | rootH1_100650142 | 104 |
| 445 | 3300003320 | rootH2_10034256 | rootH2_100342563 | 104 |
| 446 | 3300003320 | rootH2_10198485 | rootH2_101984852 | 104 |
| 447 | 3300003320 | rootH2_10202360 | rootH2_102023602 | 104 |
| 448 | 3300003322 | rootL2_10229689 | rootL2_102296892 | 104 |
| 449 | 3300003323 | rootH1_10187912 | rootH1_101879122 | 104 |
| 450 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001301 | 104 |
| 451 | 3300003354 | JGI25160J50197_1001226 | JGI25160J50197_100122610 | 104 |
| 452 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001460 | 104 |
| 453 | 3300003578 | Ga0006562J51391_1088000 | Ga0006562J51391_10880002 | 104 |
| 454 | 3300003752 | Ga0055539_1025621 | Ga0055539_10256212 | 104 |
| 455 | 3300003759 | Ga0055525_1000051 | Ga0055525_100005140 | 104 |
| 456 | 3300003762 | Ga0055542_1000020 | Ga0055542_1000020154 | 104 |
| 457 | 3300003763 | Ga0055529_1000016 | Ga0055529_1000016193 | 104 |
| 458 | 3300003771 | Ga0055526_1002636 | Ga0055526_10026364 | 104 |
| 459 | 3300003771 | Ga0055526_1013393 | Ga0055526_10133935 | 104 |
| 460 | 3300003771 | Ga0055526_1016661 | Ga0055526_10166615 | 104 |
| 461 | 3300003775 | Ga0055524_1001569 | Ga0055524_10015699 | 104 |
| 462 | 3300003775 | Ga0055524_1004990 | Ga0055524_10049904 | 104 |
| 463 | 3300003775 | Ga0055524_1011324 | Ga0055524_10113244 | 104 |
| 464 | 3300003775 | Ga0055524_1020763 | Ga0055524_10207632 | 104 |
| 465 | 3300003775 | Ga0055524_1045016 | Ga0055524_10450163 | 104 |
| 466 | 3300003790 | Ga0055528_1001064 | Ga0055528_10010646 | 104 |
| 467 | 3300003790 | Ga0055528_1005906 | Ga0055528_10059064 | 104 |
| 468 | 3300003790 | Ga0055528_1012070 | Ga0055528_10120702 | 104 |
| 469 | 3300003790 | Ga0055528_1022562 | Ga0055528_10225624 | 104 |
| 470 | 3300003792 | Ga0055540_1000197 | Ga0055540_100019749 | 104 |
| 471 | 3300003794 | Ga0055531_10039751 | Ga0055531_100397512 | 104 |
| 472 | 3300004625 | Ga0055543_1000089 | Ga0055543_100008960 | 104 |
| 473 | 3300004625 | Ga0055543_1000731 | Ga0055543_100073113 | 104 |
| 474 | 3300005262 | Ga0065165_1000008 | Ga0065165_1000008155 | 104 |
| 475 | 3300005327 | Ga0070658_10001558 | Ga0070658_1000155820 | 104 |
| 476 | 3300005339 | Ga0070660_100414672 | Ga0070660_1004146722 | 104 |
| 477 | 3300005339 | Ga0070660_100528992 | Ga0070660_1005289921 | 104 |
| 478 | 3300005344 | Ga0070661_100061766 | Ga0070661_1000617663 | 104 |
| 479 | 3300005344 | Ga0070661_100261681 | Ga0070661_1002616813 | 104 |
| 480 | 3300005347 | Ga0070668_101038576 | Ga0070668_1010385762 | 104 |
| 481 | 3300005356 | Ga0070674_100047027 | Ga0070674_1000470273 | 104 |
| 482 | 3300005366 | Ga0070659_100033678 | Ga0070659_1000336783 | 104 |
| 483 | 3300005367 | Ga0070667_100194333 | Ga0070667_1001943332 | 104 |
| 484 | 3300005367 | Ga0070667_100391516 | Ga0070667_1003915162 | 104 |
| 485 | 3300005367 | Ga0070667_101003073 | Ga0070667_1010030731 | 104 |
| 486 | 3300005455 | Ga0070663_101588758 | Ga0070663_1015887582 | 104 |
| 487 | 3300005459 | Ga0068867_100819322 | Ga0068867_1008193221 | 104 |
| 488 | 3300005539 | Ga0068853_100071337 | Ga0068853_1000713374 | 104 |
| 489 | 3300005539 | Ga0068853_101858919 | Ga0068853_1018589191 | 104 |
| 490 | 3300005539 | Ga0068853_102447775 | Ga0068853_1024477751 | 104 |
| 491 | 3300005539 | Ga0068853_102447776 | Ga0068853_1024477761 | 104 |
| 492 | 3300005543 | Ga0070672_100100895 | Ga0070672_1001008954 | 104 |
| 493 | 3300005543 | Ga0070672_100927183 | Ga0070672_1009271832 | 104 |
| 494 | 3300005548 | Ga0070665_100000086 | Ga0070665_1000000863 | 104 |
| 495 | 3300005563 | Ga0068855_100412289 | Ga0068855_1004122892 | 104 |
| 496 | 3300005563 | Ga0068855_100796856 | Ga0068855_1007968561 | 104 |
| 497 | 3300005564 | Ga0070664_100056015 | Ga0070664_1000560153 | 104 |
| 498 | 3300005577 | Ga0068857_100058913 | Ga0068857_1000589133 | 104 |
| 499 | 3300005577 | Ga0068857_101087689 | Ga0068857_1010876892 | 104 |
| 500 | 3300005577 | Ga0068857_101811327 | Ga0068857_1018113271 | 104 |
| 501 | 3300005578 | Ga0068854_100999820 | Ga0068854_1009998202 | 104 |
| 502 | 3300005614 | Ga0068856_100480168 | Ga0068856_1004801682 | 104 |
| 503 | 3300005617 | Ga0068859_100351370 | Ga0068859_1003513703 | 104 |
| 504 | 3300005834 | Ga0068851_10099165 | Ga0068851_100991652 | 104 |
| 505 | 3300005834 | Ga0068851_10476373 | Ga0068851_104763732 | 104 |
| 506 | 3300005841 | Ga0068863_100694677 | Ga0068863_1006946772 | 104 |
| 507 | 3300005841 | Ga0068863_101601979 | Ga0068863_1016019792 | 104 |
| 508 | 3300005842 | Ga0068858_100461630 | Ga0068858_1004616302 | 104 |
| 509 | 3300005983 | Ga0081540_1023244 | Ga0081540_10232446 | 104 |
| 510 | 3300005983 | Ga0081540_1197978 | Ga0081540_11979781 | 104 |
| 511 | 3300006042 | Ga0075368_10010589 | Ga0075368_100105893 | 104 |
| 512 | 3300006048 | Ga0075363_100072096 | Ga0075363_1000720962 | 104 |
| 513 | 3300006048 | Ga0075363_100082230 | Ga0075363_1000822302 | 104 |
| 514 | 3300006048 | Ga0075363_100836283 | Ga0075363_1008362831 | 104 |
| 515 | 3300006175 | Ga0070712_101499456 | Ga0070712_1014994562 | 104 |
| 516 | 3300006177 | Ga0075362_10015882 | Ga0075362_100158823 | 104 |
| 517 | 3300006177 | Ga0075362_10031824 | Ga0075362_100318244 | 104 |
| 518 | 3300006178 | Ga0075367_10011682 | Ga0075367_100116821 | 104 |
| 519 | 3300006178 | Ga0075367_10033196 | Ga0075367_100331964 | 104 |
| 520 | 3300006178 | Ga0075367_10038940 | Ga0075367_100389402 | 104 |
| 521 | 3300006178 | Ga0075367_10081850 | Ga0075367_100818501 | 104 |
| 522 | 3300006178 | Ga0075367_10101895 | Ga0075367_101018954 | 104 |
| 523 | 3300006178 | Ga0075367_10867946 | Ga0075367_108679461 | 104 |
| 524 | 3300006186 | Ga0075369_10010802 | Ga0075369_100108024 | 104 |
| 525 | 3300006186 | Ga0075369_10327361 | Ga0075369_103273612 | 104 |
| 526 | 3300006186 | Ga0075369_10513602 | Ga0075369_105136021 | 104 |
| 527 | 3300006195 | Ga0075366_10070203 | Ga0075366_100702033 | 104 |
| 528 | 3300006195 | Ga0075366_10089398 | Ga0075366_100893982 | 104 |
| 529 | 3300006195 | Ga0075366_10095246 | Ga0075366_100952462 | 104 |
| 530 | 3300006195 | Ga0075366_10126059 | Ga0075366_101260592 | 104 |
| 531 | 3300006353 | Ga0075370_10027638 | Ga0075370_100276384 | 104 |
| 532 | 3300006353 | Ga0075370_10047574 | Ga0075370_100475744 | 104 |
| 533 | 3300006353 | Ga0075370_10055900 | Ga0075370_100559002 | 104 |
| 534 | 3300006353 | Ga0075370_10367944 | Ga0075370_103679442 | 104 |
| 535 | 3300006931 | Ga0097620_100351368 | Ga0097620_1003513682 | 104 |
| 536 | 3300006946 | Ga0079104_1014976 | Ga0079104_10149762 | 104 |
| 537 | 3300009011 | Ga0105251_10000369 | Ga0105251_100003697 | 104 |
| 538 | 3300009092 | Ga0105250_10491127 | Ga0105250_104911272 | 104 |
| 539 | 3300009093 | Ga0105240_10000014 | Ga0105240_10000014218 | 104 |
| 540 | 3300009093 | Ga0105240_11353322 | Ga0105240_113533222 | 104 |
| 541 | 3300009101 | Ga0105247_10148108 | Ga0105247_101481082 | 104 |
| 542 | 3300009101 | Ga0105247_10735451 | Ga0105247_107354512 | 104 |
| 543 | 3300009148 | Ga0105243_10000876 | Ga0105243_100008763 | 104 |
| 544 | 3300009148 | Ga0105243_10712602 | Ga0105243_107126022 | 104 |
| 545 | 3300009174 | Ga0105241_10000002 | Ga0105241_10000002738 | 104 |
| 546 | 3300009174 | Ga0105241_10005567 | Ga0105241_100055675 | 104 |
| 547 | 3300009174 | Ga0105241_10931017 | Ga0105241_109310172 | 104 |
| 548 | 3300009174 | Ga0105241_11959877 | Ga0105241_119598772 | 104 |
| 549 | 3300009177 | Ga0105248_10172269 | Ga0105248_101722694 | 104 |
| 550 | 3300009177 | Ga0105248_11014793 | Ga0105248_110147932 | 104 |
| 551 | 3300009545 | Ga0105237_10003649 | Ga0105237_1000364911 | 104 |
| 552 | 3300009545 | Ga0105237_10375797 | Ga0105237_103757973 | 104 |
| 553 | 3300009551 | Ga0105238_10636913 | Ga0105238_106369132 | 104 |
| 554 | 3300009763 | Ga0123340_1037936 | Ga0123340_10379362 | 104 |
| 555 | 3300009765 | Ga0123341_1049312 | Ga0123341_10493124 | 104 |
| 556 | 3300009984 | Ga0105029_100323 | Ga0105029_1003234 | 104 |
| 557 | 3300010375 | Ga0105239_10052947 | Ga0105239_100529476 | 104 |
| 558 | 3300010375 | Ga0105239_10354527 | Ga0105239_103545273 | 104 |
| 559 | 3300010375 | Ga0105239_11065166 | Ga0105239_110651662 | 104 |
| 560 | 3300011119 | Ga0105246_10316872 | Ga0105246_103168722 | 104 |
| 561 | 3300011119 | Ga0105246_10455501 | Ga0105246_104555012 | 104 |
| 562 | 3300011119 | Ga0105246_11567229 | Ga0105246_115672291 | 104 |
| 563 | 3300012503 | Ga0157313_1057172 | Ga0157313_10571721 | 104 |
| 564 | 3300012506 | Ga0157324_1001390 | Ga0157324_10013902 | 104 |
| 565 | 3300013100 | Ga0157373_10013901 | Ga0157373_100139013 | 104 |
| 566 | 3300013100 | Ga0157373_10277869 | Ga0157373_102778692 | 104 |
| 567 | 3300013100 | Ga0157373_10771616 | Ga0157373_107716162 | 104 |
| 568 | 3300013100 | Ga0157373_10841490 | Ga0157373_108414901 | 104 |
| 569 | 3300013102 | Ga0157371_10000030 | Ga0157371_10000030220 | 104 |
| 570 | 3300013104 | Ga0157370_10002430 | Ga0157370_1000243015 | 104 |
| 571 | 3300013104 | Ga0157370_12060347 | Ga0157370_120603471 | 104 |
| 572 | 3300013250 | Ga0171462_1035 | Ga0171462_103527 | 104 |
| 573 | 3300013296 | Ga0157374_10486250 | Ga0157374_104862502 | 104 |
| 574 | 3300013297 | Ga0157378_10088835 | Ga0157378_100888352 | 104 |
| 575 | 3300013297 | Ga0157378_10929244 | Ga0157378_109292442 | 104 |
| 576 | 3300013306 | Ga0163162_10352820 | Ga0163162_103528201 | 104 |
| 577 | 3300013307 | Ga0157372_10438607 | Ga0157372_104386072 | 104 |
| 578 | 3300013308 | Ga0157375_11105277 | Ga0157375_111052771 | 104 |
| 579 | 3300013308 | Ga0157375_12081801 | Ga0157375_120818011 | 104 |
| 580 | 3300014325 | Ga0163163_10442110 | Ga0163163_104421102 | 104 |
| 581 | 3300014497 | Ga0182008_10023137 | Ga0182008_100231372 | 104 |
| 582 | 3300014497 | Ga0182008_10307180 | Ga0182008_103071802 | 104 |
| 583 | 3300015262 | Ga0182007_10002682 | Ga0182007_100026825 | 104 |
| 584 | 3300015265 | Ga0182005_1005275 | Ga0182005_10052755 | 104 |
| 585 | 3300017792 | Ga0163161_10040465 | Ga0163161_100404652 | 104 |
| 586 | 3300022739 | Ga0228711_1000004 | Ga0228711_1000004110 | 104 |
| 587 | 3300022740 | Ga0228710_1000002 | Ga0228710_100000258 | 104 |
| 588 | 3300025208 | Ga0209436_117339 | Ga0209436_1173391 | 104 |
| 589 | 3300025228 | Ga0209672_104167 | Ga0209672_1041673 | 104 |
| 590 | 3300025230 | Ga0209563_100019 | Ga0209563_100019466 | 104 |
| 591 | 3300025231 | Ga0207427_111812 | Ga0207427_1118121 | 104 |
| 592 | 3300025233 | Ga0209437_100058 | Ga0209437_10005812 | 104 |
| 593 | 3300025233 | Ga0209437_100060 | Ga0209437_100060216 | 104 |
| 594 | 3300025245 | Ga0207425_1004668 | Ga0207425_10046683 | 104 |
| 595 | 3300025246 | Ga0209646_1004682 | Ga0209646_10046822 | 104 |
| 596 | 3300025246 | Ga0209646_1004880 | Ga0209646_10048803 | 104 |
| 597 | 3300025250 | Ga0209026_1034944 | Ga0209026_10349442 | 104 |
| 598 | 3300025254 | Ga0209148_1000017 | Ga0209148_1000017555 | 104 |
| 599 | 3300025254 | Ga0209148_1012535 | Ga0209148_10125353 | 104 |
| 600 | 3300025258 | Ga0209129_1002947 | Ga0209129_10029474 | 104 |
| 601 | 3300025261 | Ga0209233_1000027 | Ga0209233_1000027322 | 104 |
| 602 | 3300025261 | Ga0209233_1000149 | Ga0209233_1000149171 | 104 |
| 603 | 3300025261 | Ga0209233_1000160 | Ga0209233_100016014 | 104 |
| 604 | 3300025261 | Ga0209233_1002488 | Ga0209233_10024884 | 104 |
| 605 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005555 | 104 |
| 606 | 3300025272 | Ga0209455_1021243 | Ga0209455_10212432 | 104 |
| 607 | 3300025272 | Ga0209455_1033495 | Ga0209455_10334952 | 104 |
| 608 | 3300025273 | Ga0209673_1000015 | Ga0209673_1000015135 | 104 |
| 609 | 3300025273 | Ga0209673_1000444 | Ga0209673_100044467 | 104 |
| 610 | 3300025273 | Ga0209673_1000632 | Ga0209673_100063229 | 104 |
| 611 | 3300025273 | Ga0209673_1006484 | Ga0209673_10064845 | 104 |
| 612 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003474 | 104 |
| 613 | 3300025291 | Ga0209675_1020739 | Ga0209675_10207391 | 104 |
| 614 | 3300025292 | Ga0209676_1114489 | Ga0209676_11144891 | 104 |
| 615 | 3300025294 | Ga0209025_1000082 | Ga0209025_100008223 | 104 |
| 616 | 3300025294 | Ga0209025_1000777 | Ga0209025_10007772 | 104 |
| 617 | 3300025294 | Ga0209025_1017766 | Ga0209025_10177664 | 104 |
| 618 | 3300025295 | Ga0209564_1000128 | Ga0209564_100012825 | 104 |
| 619 | 3300025295 | Ga0209564_1000167 | Ga0209564_100016756 | 104 |
| 620 | 3300025295 | Ga0209564_1013250 | Ga0209564_10132505 | 104 |
| 621 | 3300025295 | Ga0209564_1021534 | Ga0209564_10215344 | 104 |
| 622 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011617 | 104 |
| 623 | 3300025297 | Ga0209758_1001112 | Ga0209758_100111211 | 104 |
| 624 | 3300025297 | Ga0209758_1004666 | Ga0209758_100466613 | 104 |
| 625 | 3300025298 | Ga0209050_1007726 | Ga0209050_10077263 | 104 |
| 626 | 3300025299 | Ga0209256_1000511 | Ga0209256_100051155 | 104 |
| 627 | 3300025299 | Ga0209256_1000698 | Ga0209256_100069825 | 104 |
| 628 | 3300025299 | Ga0209256_1000779 | Ga0209256_100077917 | 104 |
| 629 | 3300025299 | Ga0209256_1004380 | Ga0209256_10043808 | 104 |
| 630 | 3300025299 | Ga0209256_1044567 | Ga0209256_10445671 | 104 |
| 631 | 3300025299 | Ga0209256_1074329 | Ga0209256_10743292 | 104 |
| 632 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011302 | 104 |
| 633 | 3300025302 | Ga0207426_1000228 | Ga0207426_100022830 | 104 |
| 634 | 3300025303 | Ga0209051_1000119 | Ga0209051_100011951 | 104 |
| 635 | 3300025303 | Ga0209051_1083750 | Ga0209051_10837502 | 104 |
| 636 | 3300025304 | Ga0209257_1003041 | Ga0209257_10030415 | 104 |
| 637 | 3300025321 | Ga0207656_10068624 | Ga0207656_100686242 | 104 |
| 638 | 3300025321 | Ga0207656_10257658 | Ga0207656_102576582 | 104 |
| 639 | 3300025735 | Ga0207713_1000433 | Ga0207713_100043338 | 104 |
| 640 | 3300025900 | Ga0207710_10129073 | Ga0207710_101290732 | 104 |
| 641 | 3300025900 | Ga0207710_10396137 | Ga0207710_103961372 | 104 |
| 642 | 3300025901 | Ga0207688_10047044 | Ga0207688_100470442 | 104 |
| 643 | 3300025904 | Ga0207647_10007295 | Ga0207647_100072955 | 104 |
| 644 | 3300025907 | Ga0207645_10150696 | Ga0207645_101506962 | 104 |
| 645 | 3300025907 | Ga0207645_10524065 | Ga0207645_105240651 | 104 |
| 646 | 3300025909 | Ga0207705_10000531 | Ga0207705_1000053110 | 104 |
| 647 | 3300025911 | Ga0207654_10000005 | Ga0207654_10000005736 | 104 |
| 648 | 3300025911 | Ga0207654_10000190 | Ga0207654_100001906 | 104 |
| 649 | 3300025913 | Ga0207695_10651274 | Ga0207695_106512742 | 104 |
| 650 | 3300025913 | Ga0207695_11612158 | Ga0207695_116121581 | 104 |
| 651 | 3300025914 | Ga0207671_10003175 | Ga0207671_100031754 | 104 |
| 652 | 3300025914 | Ga0207671_11229286 | Ga0207671_112292862 | 104 |
| 653 | 3300025919 | Ga0207657_10250007 | Ga0207657_102500072 | 104 |
| 654 | 3300025920 | Ga0207649_10011496 | Ga0207649_100114963 | 104 |
| 655 | 3300025920 | Ga0207649_10187635 | Ga0207649_101876352 | 104 |
| 656 | 3300025924 | Ga0207694_10014797 | Ga0207694_100147974 | 104 |
| 657 | 3300025925 | Ga0207650_10436379 | Ga0207650_104363792 | 104 |
| 658 | 3300025926 | Ga0207659_11630568 | Ga0207659_116305682 | 104 |
| 659 | 3300025931 | Ga0207644_10584291 | Ga0207644_105842912 | 104 |
| 660 | 3300025932 | Ga0207690_10001685 | Ga0207690_100016857 | 104 |
| 661 | 3300025932 | Ga0207690_10230593 | Ga0207690_102305932 | 104 |
| 662 | 3300025933 | Ga0207706_10032436 | Ga0207706_100324363 | 104 |
| 663 | 3300025935 | Ga0207709_10000031 | Ga0207709_1000003180 | 104 |
| 664 | 3300025937 | Ga0207669_10023094 | Ga0207669_100230943 | 104 |
| 665 | 3300025940 | Ga0207691_10123391 | Ga0207691_101233913 | 104 |
| 666 | 3300025941 | Ga0207711_11245183 | Ga0207711_112451831 | 104 |
| 667 | 3300025949 | Ga0207667_10000004 | Ga0207667_10000004365 | 104 |
| 668 | 3300025949 | Ga0207667_10374174 | Ga0207667_103741742 | 104 |
| 669 | 3300025949 | Ga0207667_10391968 | Ga0207667_103919683 | 104 |
| 670 | 3300025972 | Ga0207668_10201866 | Ga0207668_102018662 | 104 |
| 671 | 3300025981 | Ga0207640_10158806 | Ga0207640_101588062 | 104 |
| 672 | 3300025986 | Ga0207658_10178336 | Ga0207658_101783362 | 104 |
| 673 | 3300026041 | Ga0207639_10687954 | Ga0207639_106879541 | 104 |
| 674 | 3300026041 | Ga0207639_11146090 | Ga0207639_111460902 | 104 |
| 675 | 3300026067 | Ga0207678_10025795 | Ga0207678_100257953 | 104 |
| 676 | 3300026078 | Ga0207702_10000642 | Ga0207702_1000064215 | 104 |
| 677 | 3300026078 | Ga0207702_10405162 | Ga0207702_104051623 | 104 |
| 678 | 3300026088 | Ga0207641_11131398 | Ga0207641_111313982 | 104 |
| 679 | 3300026089 | Ga0207648_11612513 | Ga0207648_116125132 | 104 |
| 680 | 3300026116 | Ga0207674_10039054 | Ga0207674_100390543 | 104 |
| 681 | 3300026116 | Ga0207674_10049988 | Ga0207674_100499886 | 104 |
| 682 | 3300026116 | Ga0207674_11681763 | Ga0207674_116817632 | 104 |
| 683 | 3300026118 | Ga0207675_100430439 | Ga0207675_1004304391 | 104 |
| 684 | 3300026121 | Ga0207683_10590757 | Ga0207683_105907572 | 104 |
| 685 | 3300026142 | Ga0207698_10098344 | Ga0207698_100983442 | 104 |
| 686 | 3300027111 | Ga0209281_1000027 | Ga0209281_100002751 | 104 |
| 687 | 3300027111 | Ga0209281_1000030 | Ga0209281_1000030201 | 104 |
| 688 | 3300027111 | Ga0209281_1005132 | Ga0209281_10051322 | 104 |
| 689 | 3300027312 | Ga0209371_1003138 | Ga0209371_10031384 | 104 |
| 690 | 3300027312 | Ga0209371_1005523 | Ga0209371_10055232 | 104 |
| 691 | 3300027666 | Ga0209282_1000004 | Ga0209282_1000004201 | 104 |
| 692 | 3300027866 | Ga0209813_10189206 | Ga0209813_101892062 | 104 |
| 693 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022556 | 104 |
| 694 | 3300028786 | Ga0307517_10035306 | Ga0307517_100353065 | 104 |
| 695 | 3300028794 | Ga0307515_10211918 | Ga0307515_102119181 | 104 |
| 696 | 3300028794 | Ga0307515_10278783 | Ga0307515_102787833 | 104 |
| 697 | 3300030500 | Ga0268256_1003000 | Ga0268256_10030004 | 104 |
| 698 | 3300030500 | Ga0268256_1005446 | Ga0268256_10054462 | 104 |
| 699 | 3300031456 | Ga0307513_10057611 | Ga0307513_100576113 | 104 |
| 700 | 3300031456 | Ga0307513_10121454 | Ga0307513_101214544 | 104 |
| 701 | 3300031548 | Ga0307408_101356032 | Ga0307408_1013560321 | 104 |
| 702 | 3300031967 | Ga0315914_1000001 | Ga0315914_1000001182 | 104 |
| 703 | 3300032002 | Ga0307416_103218961 | Ga0307416_1032189612 | 104 |
| 704 | 3300033180 | Ga0307510_10000011 | Ga0307510_1000001155 | 104 |
| 705 | 3300033180 | Ga0307510_10079312 | Ga0307510_100793121 | 104 |
| 706 | 3300033430 | Ga0315913_1000004 | Ga0315913_1000004118 | 104 |
| 707 | 3300033464 | Ga0315915_1000002 | Ga0315915_1000002202 | 104 |
| 708 | 3300037312 | Ga0395899_0000124 | Ga0395899_0000124_12078_12392 | 104 |
| 709 | 3300037312 | Ga0395899_0175133 | Ga0395899_0175133_97_411 | 104 |
| 710 | 3300037418 | Ga0395900_0000086 | Ga0395900_0000086_159358_159672 | 104 |
| 711 | 3300037418 | Ga0395900_0174189 | Ga0395900_0174189_1217_1531 | 104 |
| 712 | 3300037466 | Ga0395898_0000285 | Ga0395898_0000285_12078_12392 | 104 |
| 713 | 3300037466 | Ga0395898_0153809 | Ga0395898_0153809_470_784 | 104 |
| 714 | 3300037471 | Ga0395905_0000133 | Ga0395905_0000133_111109_111423 | 104 |
| 715 | 3300037471 | Ga0395905_0000708 | Ga0395905_0000708_28633_28947 | 104 |
| 716 | 3300037471 | Ga0395905_0052156 | Ga0395905_0052156_430_744 | 104 |
| 717 | 3300037471 | Ga0395905_0716144 | Ga0395905_0716144_389_703 | 104 |
| 718 | 3300038443 | Ga0395901_0000092 | Ga0395901_0000092_109585_109899 | 104 |
| 719 | 3300038443 | Ga0395901_0231252 | Ga0395901_0231252_906_1220 | 104 |
| 720 | 3300041404 | Ga0439436_0208714 | Ga0439436_0208714_58_372 | 104 |
| 721 | 3300041406 | Ga0439439_0022183 | Ga0439439_0022183_157_471 | 104 |
| 722 | 3300041411 | Ga0439466_0054777 | Ga0439466_0054777_948_1262 | 104 |
| 723 | 3300041413 | Ga0439465_0004865 | Ga0439465_0004865_3357_3671 | 104 |
| 724 | 3300041441 | Ga0451787_009036 | Ga0451787_009036_54_368 | 104 |
| 725 | 3300041443 | Ga0451789_0480782 | Ga0451789_0480782_170_484 | 104 |
| 726 | 3300041443 | Ga0451789_1366789 | Ga0451789_1366789_28_342 | 104 |
| 727 | 3300041451 | Ga0451791_1927112 | Ga0451791_1927112_772_1086 | 104 |
| 728 | 3300041452 | Ga0451793_1189160 | Ga0451793_1189160_293_607 | 104 |
| 729 | 3300041452 | Ga0451793_1769180 | Ga0451793_1769180_27_341 | 104 |
| 730 | 3300041453 | Ga0451797_0233108 | Ga0451797_0233108_191_505 | 104 |
| 731 | 3300041458 | Ga0451798_0280811 | Ga0451798_0280811_153_467 | 104 |
| 732 | 3300041491 | Ga0451833_0288120 | Ga0451833_0288120_97_411 | 104 |
| 733 | 3300041491 | Ga0451833_1293662 | Ga0451833_1293662_569_883 | 104 |
| 734 | 3300041492 | Ga0451835_0115932 | Ga0451835_0115932_2169_2483 | 104 |
| 735 | 3300041494 | Ga0451837_0858072 | Ga0451837_0858072_2010_2324 | 104 |
| 736 | 3300041496 | Ga0451839_1208629 | Ga0451839_1208629_635_949 | 104 |
| 737 | 3300041498 | Ga0451841_1002243 | Ga0451841_1002243_1376_1690 | 104 |
| 738 | 3300041501 | Ga0451845_0135496 | Ga0451845_0135496_531_845 | 104 |
| 739 | 3300041503 | Ga0451847_0865164 | Ga0451847_0865164_2010_2324 | 104 |
| 740 | 3300041505 | Ga0451849_0254647 | Ga0451849_0254647_710_1024 | 104 |
| 741 | 3300041505 | Ga0451849_0818881 | Ga0451849_0818881_719_1033 | 104 |
| 742 | 3300041507 | Ga0451851_0621237 | Ga0451851_0621237_4295_4609 | 104 |
| 743 | 3300041509 | Ga0451843_0438760 | Ga0451843_0438760_383_697 | 104 |
| 744 | 3300041509 | Ga0451843_0855835 | Ga0451843_0855835_709_1023 | 104 |
| 745 | 3300041511 | Ga0451855_0075806 | Ga0451855_0075806_1877_2191 | 104 |
| 746 | 3300041511 | Ga0451855_0545569 | Ga0451855_0545569_298_612 | 104 |
| 747 | 3300041511 | Ga0451855_1285604 | Ga0451855_1285604_326_640 | 104 |
| 748 | 3300041512 | Ga0451853_1332446 | Ga0451853_1332446_1823_2137 | 104 |
| 749 | 3300041916 | Ga0452271_32988 | Ga0452271_32988_679_993 | 104 |
| 750 | 3300042006 | Ga0439432_027058 | Ga0439432_027058_1372_1686 | 104 |
| 751 | 3300042007 | Ga0439449_0049692 | Ga0439449_0049692_53_367 | 104 |
| 752 | 3300042157 | Ga0439458_0084563 | Ga0439458_0084563_181_495 | 104 |
| 753 | 3300044684 | Ga0466966_0022293 | Ga0466966_0022293_1185_1499 | 104 |
| 754 | 3300044684 | Ga0466966_0414228 | Ga0466966_0414228_294_608 | 104 |
| 755 | 3300044694 | Ga0466963_0013253 | Ga0466963_0013253_1661_1975 | 104 |
| 756 | 3300044765 | Ga0466970_0005599 | Ga0466970_0005599_2742_3056 | 104 |
| 757 | 3300045049 | Ga0466959_0607522 | Ga0466959_0607522_392_706 | 104 |
| 758 | 3300045836 | Ga0466958_0024660 | Ga0466958_0024660_360_674 | 104 |
| 759 | 3300045976 | Ga0466967_0035126 | Ga0466967_0035126_2879_3193 | 104 |
| 760 | 3300045976 | Ga0466967_0716795 | Ga0466967_0716795_241_555 | 104 |
| 761 | 3300046452 | Ga0495617_113010 | Ga0495617_113010_481_795 | 104 |
| 762 | 3300046454 | Ga0495592_0130418 | Ga0495592_0130418_1325_1639 | 104 |
| 763 | 3300046457 | Ga0495590_0022129 | Ga0495590_0022129_424_738 | 104 |
| 764 | 3300046459 | Ga0495629_0027370 | Ga0495629_0027370_3254_3568 | 104 |
| 765 | 3300046459 | Ga0495629_0119793 | Ga0495629_0119793_1201_1515 | 104 |
| 766 | 3300046460 | Ga0495638_0000093 | Ga0495638_0000093_102046_102360 | 104 |
| 767 | 3300046460 | Ga0495638_0263150 | Ga0495638_0263150_457_771 | 104 |
| 768 | 3300046460 | Ga0495638_0333956 | Ga0495638_0333956_192_506 | 104 |
| 769 | 3300046460 | Ga0495638_0510587 | Ga0495638_0510587_226_540 | 104 |
| 770 | 3300046461 | Ga0495641_0495028 | Ga0495641_0495028_167_481 | 104 |
| 771 | 3300046462 | Ga0495651_0609048 | Ga0495651_0609048_166_480 | 104 |
| 772 | 3300046474 | Ga0495605_0008910 | Ga0495605_0008910_4403_4717 | 104 |
| 773 | 3300046474 | Ga0495605_0071440 | Ga0495605_0071440_282_596 | 104 |
| 774 | 3300046476 | Ga0495662_0006422 | Ga0495662_0006422_2120_2434 | 104 |
| 775 | 3300046477 | Ga0495664_0258902 | Ga0495664_0258902_250_564 | 104 |
| 776 | 3300046491 | Ga0495584_0059752 | Ga0495584_0059752_199_513 | 104 |
| 777 | 3300046492 | Ga0495585_0007993 | Ga0495585_0007993_1880_2194 | 104 |
| 778 | 3300046492 | Ga0495585_0054170 | Ga0495585_0054170_889_1203 | 104 |
| 779 | 3300046492 | Ga0495585_0178384 | Ga0495585_0178384_50_364 | 104 |
| 780 | 3300046492 | Ga0495585_0297485 | Ga0495585_0297485_257_571 | 104 |
| 781 | 3300046500 | Ga0495596_0167059 | Ga0495596_0167059_500_814 | 104 |
| 782 | 3300046501 | Ga0495607_0054379 | Ga0495607_0054379_289_603 | 104 |
| 783 | 3300046501 | Ga0495607_0079096 | Ga0495607_0079096_1161_1475 | 104 |
| 784 | 3300046506 | Ga0495583_0019150 | Ga0495583_0019150_1172_1486 | 104 |
| 785 | 3300046506 | Ga0495583_0032644 | Ga0495583_0032644_1722_2036 | 104 |
| 786 | 3300046506 | Ga0495583_0090028 | Ga0495583_0090028_977_1291 | 104 |
| 787 | 3300046506 | Ga0495583_0309063 | Ga0495583_0309063_287_601 | 104 |
| 788 | 3300046507 | Ga0495606_0000824 | Ga0495606_0000824_8897_9211 | 104 |
| 789 | 3300046507 | Ga0495606_0059620 | Ga0495606_0059620_398_712 | 104 |
| 790 | 3300046507 | Ga0495606_0133747 | Ga0495606_0133747_94_408 | 104 |
| 791 | 3300046511 | Ga0495608_0346508 | Ga0495608_0346508_197_511 | 104 |
| 792 | 3300046512 | Ga0495610_0034443 | Ga0495610_0034443_11_325 | 104 |
| 793 | 3300046512 | Ga0495610_0088790 | Ga0495610_0088790_22_336 | 104 |
| 794 | 3300046512 | Ga0495610_0172330 | Ga0495610_0172330_11_325 | 104 |
| 795 | 3300046512 | Ga0495610_0248186 | Ga0495610_0248186_358_672 | 104 |
| 796 | 3300046512 | Ga0495610_0387000 | Ga0495610_0387000_132_446 | 104 |
| 797 | 3300046513 | Ga0495616_0061252 | Ga0495616_0061252_1038_1352 | 104 |
| 798 | 3300046513 | Ga0495616_0191163 | Ga0495616_0191163_49_363 | 104 |
| 799 | 3300046514 | Ga0495618_0929597 | Ga0495618_0929597_86_400 | 104 |
| 800 | 3300046515 | Ga0495620_0050209 | Ga0495620_0050209_857_1171 | 104 |
| 801 | 3300046515 | Ga0495620_0099005 | Ga0495620_0099005_489_803 | 104 |
| 802 | 3300046515 | Ga0495620_0099772 | Ga0495620_0099772_202_516 | 104 |
| 803 | 3300046515 | Ga0495620_0267207 | Ga0495620_0267207_324_638 | 104 |
| 804 | 3300046516 | Ga0495628_0701113 | Ga0495628_0701113_229_543 | 104 |
| 805 | 3300046518 | Ga0495631_0022213 | Ga0495631_0022213_1652_1966 | 104 |
| 806 | 3300046518 | Ga0495631_0195983 | Ga0495631_0195983_242_556 | 104 |
| 807 | 3300046518 | Ga0495631_0200943 | Ga0495631_0200943_164_478 | 104 |
| 808 | 3300046519 | Ga0495632_0029196 | Ga0495632_0029196_314_628 | 104 |
| 809 | 3300046519 | Ga0495632_0094675 | Ga0495632_0094675_254_568 | 104 |
| 810 | 3300046519 | Ga0495632_0121635 | Ga0495632_0121635_427_741 | 104 |
| 811 | 3300046519 | Ga0495632_0165026 | Ga0495632_0165026_319_633 | 104 |
| 812 | 3300046520 | Ga0495637_0059138 | Ga0495637_0059138_523_837 | 104 |
| 813 | 3300046522 | Ga0495643_0008432 | Ga0495643_0008432_3983_4297 | 104 |
| 814 | 3300046522 | Ga0495643_0012592 | Ga0495643_0012592_1733_2047 | 104 |
| 815 | 3300046522 | Ga0495643_0040090 | Ga0495643_0040090_1754_2068 | 104 |
| 816 | 3300046522 | Ga0495643_0045805 | Ga0495643_0045805_126_440 | 104 |
| 817 | 3300046522 | Ga0495643_0054076 | Ga0495643_0054076_1208_1522 | 104 |
| 818 | 3300046522 | Ga0495643_0167123 | Ga0495643_0167123_435_749 | 104 |
| 819 | 3300046523 | Ga0495644_0455622 | Ga0495644_0455622_20_334 | 104 |
| 820 | 3300046524 | Ga0495648_0018594 | Ga0495648_0018594_930_1244 | 104 |
| 821 | 3300046524 | Ga0495648_0113568 | Ga0495648_0113568_271_585 | 104 |
| 822 | 3300046524 | Ga0495648_0127431 | Ga0495648_0127431_74_388 | 104 |
| 823 | 3300046524 | Ga0495648_0394044 | Ga0495648_0394044_277_591 | 104 |
| 824 | 3300046525 | Ga0495663_0400426 | Ga0495663_0400426_83_397 | 104 |
| 825 | 3300046528 | Ga0495642_0013708 | Ga0495642_0013708_1570_1884 | 104 |
| 826 | 3300046530 | Ga0495654_0045879 | Ga0495654_0045879_1246_1560 | 104 |
| 827 | 3300046536 | Ga0495587_0077273 | Ga0495587_0077273_506_820 | 104 |
| 828 | 3300046538 | Ga0495609_0043790 | Ga0495609_0043790_667_981 | 104 |
| 829 | 3300046542 | Ga0495597_0208454 | Ga0495597_0208454_144_458 | 104 |
| 830 | 3300046542 | Ga0495597_0303454 | Ga0495597_0303454_251_565 | 104 |
| 831 | 3300046542 | Ga0495597_0329093 | Ga0495597_0329093_179_493 | 104 |
| 832 | 3300046557 | Ga0495622_0048654 | Ga0495622_0048654_1309_1623 | 104 |
| 833 | 3300046557 | Ga0495622_0056197 | Ga0495622_0056197_318_632 | 104 |
| 834 | 3300046557 | Ga0495622_0421421 | Ga0495622_0421421_247_561 | 104 |
| 835 | 3300046558 | Ga0495633_0028150 | Ga0495633_0028150_345_659 | 104 |
| 836 | 3300046616 | Ga0495668_0000007 | Ga0495668_0000007_205836_206150 | 104 |
| 837 | 3300046616 | Ga0495668_0151877 | Ga0495668_0151877_600_914 | 104 |
| 838 | 3300046616 | Ga0495668_0499030 | Ga0495668_0499030_62_376 | 104 |
| 839 | 3300046648 | Ga0495611_0110563 | Ga0495611_0110563_562_876 | 104 |
| 840 | 3300046648 | Ga0495611_0287785 | Ga0495611_0287785_180_494 | 104 |
| 841 | 3300046660 | Ga0495625_0009233 | Ga0495625_0009233_1954_2268 | 104 |
| 842 | 3300046660 | Ga0495625_0025308 | Ga0495625_0025308_2216_2530 | 104 |
| 843 | 3300046660 | Ga0495625_0032058 | Ga0495625_0032058_2920_3234 | 104 |
| 844 | 3300046660 | Ga0495625_0062794 | Ga0495625_0062794_1044_1358 | 104 |
| 845 | 3300046660 | Ga0495625_0101544 | Ga0495625_0101544_1141_1455 | 104 |
| 846 | 3300046660 | Ga0495625_0140798 | Ga0495625_0140798_952_1266 | 104 |
| 847 | 3300046660 | Ga0495625_0259542 | Ga0495625_0259542_160_474 | 104 |
| 848 | 3300046660 | Ga0495625_0448971 | Ga0495625_0448971_182_496 | 104 |
| 849 | 3300046660 | Ga0495625_0739344 | Ga0495625_0739344_229_543 | 104 |
| 850 | 3300046663 | Ga0495635_0303968 | Ga0495635_0303968_462_776 | 104 |
| 851 | 3300046665 | Ga0495661_0071358 | Ga0495661_0071358_1212_1526 | 104 |
| 852 | 3300046674 | Ga0495588_0029503 | Ga0495588_0029503_2209_2523 | 104 |
| 853 | 3300046675 | Ga0495657_0069096 | Ga0495657_0069096_335_649 | 104 |
| 854 | 3300046679 | Ga0495623_0303680 | Ga0495623_0303680_297_611 | 104 |
| 855 | 3300046683 | Ga0495658_0099167 | Ga0495658_0099167_442_756 | 104 |
| 856 | 3300046684 | Ga0495669_0000286 | Ga0495669_0000286_1172_1486 | 104 |
| 857 | 3300046684 | Ga0495669_0195018 | Ga0495669_0195018_55_369 | 104 |
| 858 | 3300046691 | Ga0495670_0096288 | Ga0495670_0096288_1158_1472 | 104 |
| 859 | 3300046691 | Ga0495670_0254016 | Ga0495670_0254016_370_684 | 104 |
| 860 | 3300046691 | Ga0495670_0356695 | Ga0495670_0356695_307_621 | 104 |
| 861 | 3300046692 | Ga0495671_0067789 | Ga0495671_0067789_89_403 | 104 |
| 862 | 3300046692 | Ga0495671_0170616 | Ga0495671_0170616_409_723 | 104 |
| 863 | 3300046694 | Ga0495649_0041168 | Ga0495649_0041168_451_765 | 104 |
| 864 | 3300046694 | Ga0495649_0296285 | Ga0495649_0296285_252_566 | 104 |
| 865 | 3300046694 | Ga0495649_0483903 | Ga0495649_0483903_199_513 | 104 |
| 866 | 3300046794 | Ga0495589_0361816 | Ga0495589_0361816_73_387 | 104 |
| 867 | 3300046809 | Ga0495600_0013303 | Ga0495600_0013303_3752_4066 | 104 |
| 868 | 3300046809 | Ga0495600_0158515 | Ga0495600_0158515_561_875 | 104 |
| 869 | 3300046810 | Ga0495660_0057164 | Ga0495660_0057164_1628_1942 | 104 |
| 870 | 3300046810 | Ga0495660_0081616 | Ga0495660_0081616_101_415 | 104 |
| 871 | 3300046810 | Ga0495660_0273399 | Ga0495660_0273399_151_465 | 104 |
| 872 | 3300047317 | Ga0495604_0041874 | Ga0495604_0041874_1013_1327 | 104 |
| 873 | 3300047318 | Ga0495636_0028360 | Ga0495636_0028360_1202_1516 | 104 |
| 874 | 3300047319 | Ga0495674_0296225 | Ga0495674_0296225_276_590 | 104 |
| 875 | 3300047320 | Ga0495672_0010499 | Ga0495672_0010499_6046_6360 | 104 |
| 876 | 3300047320 | Ga0495672_0064415 | Ga0495672_0064415_167_481 | 104 |
| 877 | 3300047323 | Ga0495683_0030887 | Ga0495683_0030887_192_506 | 104 |
| 878 | 3300047323 | Ga0495683_0114590 | Ga0495683_0114590_473_787 | 104 |
| 879 | 3300047443 | Ga0495687_004439 | Ga0495687_004439_1993_2307 | 104 |
| 880 | 3300047443 | Ga0495687_033771 | Ga0495687_033771_89_403 | 104 |
| 881 | 3300047443 | Ga0495687_043138 | Ga0495687_043138_512_826 | 104 |
| 882 | 3300047443 | Ga0495687_082838 | Ga0495687_082838_177_491 | 104 |
| 883 | 3300047445 | Ga0495677_0003044 | Ga0495677_0003044_3250_3564 | 104 |
| 884 | 3300047447 | Ga0495685_125884 | Ga0495685_125884_383_697 | 104 |
| 885 | 3300047472 | Ga0495686_0006640 | Ga0495686_0006640_1432_1746 | 104 |
| 886 | 3300047472 | Ga0495686_0076698 | Ga0495686_0076698_1042_1356 | 104 |
| 887 | 3300047472 | Ga0495686_0229134 | Ga0495686_0229134_72_386 | 104 |
| 888 | 3300048090 | Ga0495615_0073288 | Ga0495615_0073288_123_437 | 104 |
| 889 | 3300048090 | Ga0495615_0228566 | Ga0495615_0228566_220_534 | 104 |
| 890 | 3300048091 | Ga0495626_0210280 | Ga0495626_0210280_384_698 | 104 |
| 891 | 3300048903 | Ga0496100_0048000 | Ga0496100_0048000_1986_2300 | 104 |
| 892 | 3300048904 | Ga0496101_0210476 | Ga0496101_0210476_469_783 | 104 |
| 893 | 3300048905 | Ga0496102_0013152 | Ga0496102_0013152_2809_3123 | 104 |
| 894 | 3300048906 | Ga0496103_0029238 | Ga0496103_0029238_2516_2830 | 104 |
| 895 | 3300048909 | Ga0496106_0254693 | Ga0496106_0254693_248_562 | 104 |
| 896 | 3300048916 | Ga0496113_0104885 | Ga0496113_0104885_1816_2130 | 104 |
| 897 | 3300048916 | Ga0496113_0522196 | Ga0496113_0522196_180_494 | 104 |
| 898 | 3300048917 | Ga0496114_0137219 | Ga0496114_0137219_1785_2099 | 104 |
| 899 | 3300048919 | Ga0496116_0063997 | Ga0496116_0063997_750_1064 | 104 |
| 900 | 3300048919 | Ga0496116_0148259 | Ga0496116_0148259_619_933 | 104 |
| 901 | 3300048920 | Ga0496117_0017033 | Ga0496117_0017033_2879_3193 | 104 |
| 902 | 3300048920 | Ga0496117_0039544 | Ga0496117_0039544_1388_1702 | 104 |
| 903 | 3300048920 | Ga0496117_0223485 | Ga0496117_0223485_146_460 | 104 |
| 904 | 3300048920 | Ga0496117_0372493 | Ga0496117_0372493_229_543 | 104 |
| 905 | 3300048921 | Ga0496118_0010015 | Ga0496118_0010015_3850_4164 | 104 |
| 906 | 3300048921 | Ga0496118_0015441 | Ga0496118_0015441_2939_3253 | 104 |
| 907 | 3300048922 | Ga0496119_0021565 | Ga0496119_0021565_1651_1965 | 104 |
| 908 | 3300048922 | Ga0496119_0058856 | Ga0496119_0058856_1095_1409 | 104 |
| 909 | 3300048922 | Ga0496119_0075305 | Ga0496119_0075305_1337_1651 | 104 |
| 910 | 3300048923 | Ga0496120_0009952 | Ga0496120_0009952_1592_1906 | 104 |
| 911 | 3300048923 | Ga0496120_0017730 | Ga0496120_0017730_3756_4070 | 104 |
| 912 | 3300048923 | Ga0496120_0276781 | Ga0496120_0276781_332_646 | 104 |
| 913 | 3300048923 | Ga0496120_0356853 | Ga0496120_0356853_244_558 | 104 |
| 914 | 3300048924 | Ga0496121_0016095 | Ga0496121_0016095_2882_3196 | 104 |
| 915 | 3300048924 | Ga0496121_0137814 | Ga0496121_0137814_575_889 | 104 |
| 916 | 3300048924 | Ga0496121_0165013 | Ga0496121_0165013_375_689 | 104 |
| 917 | 3300048924 | Ga0496121_0431606 | Ga0496121_0431606_33_347 | 104 |
| 918 | 3300048925 | Ga0496122_0015011 | Ga0496122_0015011_2782_3096 | 104 |
| 919 | 3300048925 | Ga0496122_0046216 | Ga0496122_0046216_2856_3170 | 104 |
| 920 | 3300048925 | Ga0496122_0160967 | Ga0496122_0160967_713_1027 | 104 |
| 921 | 3300048926 | Ga0496123_0025175 | Ga0496123_0025175_2095_2409 | 104 |
| 922 | 3300048926 | Ga0496123_0032283 | Ga0496123_0032283_2702_3016 | 104 |
| 923 | 3300048926 | Ga0496123_0055962 | Ga0496123_0055962_17_331 | 104 |
| 924 | 3300048926 | Ga0496123_0075063 | Ga0496123_0075063_1117_1431 | 104 |
| 925 | 3300048927 | Ga0496124_0072586 | Ga0496124_0072586_1633_1947 | 104 |
| 926 | 3300048928 | Ga0496125_0024814 | Ga0496125_0024814_2728_3042 | 104 |
| 927 | 3300048928 | Ga0496125_0135213 | Ga0496125_0135213_568_882 | 104 |
| 928 | 3300048928 | Ga0496125_0502145 | Ga0496125_0502145_178_492 | 104 |
| 929 | 3300048928 | Ga0496125_0592916 | Ga0496125_0592916_43_357 | 104 |
| 930 | 3300048929 | Ga0496126_0188156 | Ga0496126_0188156_1040_1354 | 104 |
| 931 | 3300048929 | Ga0496126_0211504 | Ga0496126_0211504_355_669 | 104 |
| 932 | 3300048929 | Ga0496126_0314240 | Ga0496126_0314240_466_780 | 104 |
| 933 | 3300048929 | Ga0496126_0795984 | Ga0496126_0795984_248_562 | 104 |
| 934 | 3300049459 | Ga0495678_067447 | Ga0495678_067447_366_680 | 104 |
| 935 | 3300049459 | Ga0495678_069850 | Ga0495678_069850_459_773 | 104 |
| 936 | 3300049459 | Ga0495678_164241 | Ga0495678_164241_152_466 | 104 |
| 937 | 3300049460 | Ga0495682_0037223 | Ga0495682_0037223_878_1192 | 104 |
| 938 | 3300049460 | Ga0495682_0170892 | Ga0495682_0170892_142_456 | 104 |
| 939 | 3300049569 | Ga0501032_0167109 | Ga0501032_0167109_1086_1400 | 104 |
| 940 | 3300049570 | Ga0501033_0227499 | Ga0501033_0227499_421_735 | 104 |
| 941 | 3300049571 | Ga0501034_0096373 | Ga0501034_0096373_1649_1963 | 104 |
| 942 | 3300049572 | Ga0501036_0061122 | Ga0501036_0061122_2697_3011 | 104 |
| 943 | 3300049573 | Ga0501037_0077798 | Ga0501037_0077798_405_719 | 104 |
| 944 | 3300049574 | Ga0501038_0027079 | Ga0501038_0027079_1243_1557 | 104 |
| 945 | 3300049575 | Ga0501039_0140053 | Ga0501039_0140053_1544_1858 | 104 |
| 946 | 3300049579 | Ga0501043_0856615 | Ga0501043_0856615_49_363 | 104 |
| 947 | 3300049579 | Ga0501043_1249210 | Ga0501043_1249210_91_405 | 104 |
| 948 | 3300049581 | Ga0501047_0650773 | Ga0501047_0650773_531_845 | 104 |
| 949 | 3300049584 | Ga0501068_0209106 | Ga0501068_0209106_388_702 | 104 |
| 950 | 3300049586 | Ga0501070_0694987 | Ga0501070_0694987_255_569 | 104 |
| 951 | 3300049589 | Ga0501073_0030504 | Ga0501073_0030504_351_665 | 104 |
| 952 | 3300049589 | Ga0501073_0174433 | Ga0501073_0174433_678_992 | 104 |
| 953 | 3300049742 | Ga0501080_0023538 | Ga0501080_0023538_4030_4344 | 104 |
| 954 | 3300049744 | Ga0501083_0022340 | Ga0501083_0022340_2020_2334 | 104 |
| 955 | 3300049744 | Ga0501083_0166579 | Ga0501083_0166579_1102_1416 | 104 |
| 956 | 3300049822 | Ga0501035_0133623 | Ga0501035_0133623_802_1116 | 104 |
| 957 | 3300049823 | Ga0501044_0052412 | Ga0501044_0052412_127_441 | 104 |
| 958 | 3300050489 | nmdc:mga03683_558269_c1 | nmdc:mga03683_558269_c1_48_362 | 104 |
| 959 | 3300050490 | nmdc:mga03n38_117565_c1 | nmdc:mga03n38_117565_c1_793_1107 | 104 |
| 960 | 3300050490 | nmdc:mga03n38_177718_c1 | nmdc:mga03n38_177718_c1_235_549 | 104 |
| 961 | 3300050490 | nmdc:mga03n38_2491_c1 | nmdc:mga03n38_2491_c1_4212_4526 | 104 |
| 962 | 3300050491 | nmdc:mga00v17_708607_c1 | nmdc:mga00v17_708607_c1_52_366 | 104 |
| 963 | 3300050492 | nmdc:mga0yw44_400772_c1 | nmdc:mga0yw44_400772_c1_594_908 | 104 |
| 964 | 3300050493 | nmdc:mga0k408_35607_c1 | nmdc:mga0k408_35607_c1_913_1227 | 104 |
| 965 | 3300050494 | nmdc:mga06z11_369289_c1 | nmdc:mga06z11_369289_c1_494_808 | 104 |
| 966 | 3300050494 | nmdc:mga06z11_54721_c1 | nmdc:mga06z11_54721_c1_1142_1456 | 104 |
| 967 | 3300050494 | nmdc:mga06z11_578319_c1 | nmdc:mga06z11_578319_c1_108_422 | 104 |
| 968 | 3300050494 | nmdc:mga06z11_868650_c1 | nmdc:mga06z11_868650_c1_80_394 | 104 |
| 969 | 3300050495 | nmdc:mga04h51_103694_c1 | nmdc:mga04h51_103694_c1_529_843 | 104 |
| 970 | 3300050496 | nmdc:mga07m45_26717_c1 | nmdc:mga07m45_26717_c1_551_865 | 104 |
| 971 | 3300050496 | nmdc:mga07m45_338095_c1 | nmdc:mga07m45_338095_c1_43_357 | 104 |
| 972 | 3300050496 | nmdc:mga07m45_3505_c3 | nmdc:mga07m45_3505_c3_677_991 | 104 |
| 973 | 3300050496 | nmdc:mga07m45_375506_c1 | nmdc:mga07m45_375506_c1_193_507 | 104 |
| 974 | 3300050516 | nmdc:mga0sz30_18519_c1 | nmdc:mga0sz30_18519_c1_202_516 | 104 |
| 975 | 3300050516 | nmdc:mga0sz30_279812_c1 | nmdc:mga0sz30_279812_c1_144_458 | 104 |
| 976 | 3300050516 | nmdc:mga0sz30_329384_c1 | nmdc:mga0sz30_329384_c1_44_358 | 104 |
| 977 | 3300050516 | nmdc:mga0sz30_414583_c1 | nmdc:mga0sz30_414583_c1_21_335 | 104 |
| 978 | 3300050516 | nmdc:mga0sz30_457670_c1 | nmdc:mga0sz30_457670_c1_181_495 | 104 |
| 979 | 3300053079 | Ga0500610_0000140 | Ga0500610_0000140_13268_13582 | 104 |
| 980 | 3300053080 | Ga0500635_0252205 | Ga0500635_0252205_287_601 | 104 |
| 981 | 3300053083 | Ga0495655_0034011 | Ga0495655_0034011_845_1159 | 104 |
| 982 | 3300053085 | Ga0495619_0305738 | Ga0495619_0305738_477_791 | 104 |
| 983 | 3300053086 | Ga0500578_0125959 | Ga0500578_0125959_914_1228 | 104 |
| 984 | 3300053086 | Ga0500578_0164851 | Ga0500578_0164851_201_515 | 104 |
| 985 | 3300053087 | Ga0500643_043167 | Ga0500643_043167_184_498 | 104 |
| 986 | 3300053093 | Ga0500651_0117980 | Ga0500651_0117980_510_824 | 104 |
| 987 | 3300053098 | Ga0500650_0262282 | Ga0500650_0262282_120_434 | 104 |
| 988 | 3300053099 | Ga0500654_192564 | Ga0500654_192564_156_470 | 104 |
| 989 | 3300053109 | Ga0500569_129751 | Ga0500569_129751_399_713 | 104 |
| 990 | 3300053109 | Ga0500569_318291 | Ga0500569_318291_27_341 | 104 |
| 991 | 3300053118 | Ga0500594_0007898 | Ga0500594_0007898_859_1173 | 104 |
| 992 | 3300053118 | Ga0500594_0186761 | Ga0500594_0186761_133_447 | 104 |
| 993 | 3300053119 | Ga0500595_004282 | Ga0500595_004282_5983_6297 | 104 |
| 994 | 3300053119 | Ga0500595_010172 | Ga0500595_010172_2919_3233 | 104 |
| 995 | 3300053121 | Ga0500607_053714 | Ga0500607_053714_923_1237 | 104 |
| 996 | 3300053121 | Ga0500607_141440 | Ga0500607_141440_156_470 | 104 |
| 997 | 3300053125 | Ga0500618_005797 | Ga0500618_005797_2648_2962 | 104 |
| 998 | 3300053130 | Ga0500642_0000153 | Ga0500642_0000153_2075_2389 | 104 |
| 999 | 3300053134 | Ga0500658_0003673 | Ga0500658_0003673_2379_2693 | 104 |
| 1000 | 3300053139 | Ga0500568_0000137 | Ga0500568_0000137_11748_12062 | 104 |
| 1001 | 3300053139 | Ga0500568_0000825 | Ga0500568_0000825_17680_17994 | 104 |
| 1002 | 3300053142 | Ga0500577_0111971 | Ga0500577_0111971_332_646 | 104 |
| 1003 | 3300053142 | Ga0500577_0120812 | Ga0500577_0120812_682_996 | 104 |
| 1004 | 3300053146 | Ga0500588_0115528 | Ga0500588_0115528_327_641 | 104 |
| 1005 | 3300053148 | Ga0500590_010218 | Ga0500590_010218_1338_1652 | 104 |
| 1006 | 3300053151 | Ga0500604_0000014 | Ga0500604_0000014_85738_86052 | 104 |
| 1007 | 3300053153 | Ga0500616_0003922 | Ga0500616_0003922_6364_6678 | 104 |
| 1008 | 3300053153 | Ga0500616_0005323 | Ga0500616_0005323_3908_4222 | 104 |
| 1009 | 3300053153 | Ga0500616_0051437 | Ga0500616_0051437_1208_1522 | 104 |
| 1010 | 3300053153 | Ga0500616_0107076 | Ga0500616_0107076_1032_1346 | 104 |
| 1011 | 3300053156 | Ga0500622_0008480 | Ga0500622_0008480_4625_4939 | 104 |
| 1012 | 3300053157 | Ga0500624_129640 | Ga0500624_129640_168_482 | 104 |
| 1013 | 3300053158 | Ga0500627_0128507 | Ga0500627_0128507_384_698 | 104 |
| 1014 | 3300053158 | Ga0500627_0150025 | Ga0500627_0150025_140_454 | 104 |
| 1015 | 3300053160 | Ga0500633_0202629 | Ga0500633_0202629_161_475 | 104 |
| 1016 | 3300053161 | Ga0500634_0039678 | Ga0500634_0039678_1236_1550 | 104 |
| 1017 | 3300053177 | Ga0500636_0028586 | Ga0500636_0028586_779_1093 | 104 |
| 1018 | 3300053177 | Ga0500636_0209036 | Ga0500636_0209036_404_718 | 104 |
| 1019 | 3300053730 | Ga0500645_000080 | Ga0500645_000080_27546_27860 | 104 |
| 1020 | 3300053730 | Ga0500645_060522 | Ga0500645_060522_680_994 | 104 |
| 1021 | 3300053730 | Ga0500645_125620 | Ga0500645_125620_379_693 | 104 |
| 1022 | 3300053735 | Ga0500596_002571 | Ga0500596_002571_1133_1447 | 104 |
| 1023 | 3300053737 | Ga0500601_004212 | Ga0500601_004212_568_882 | 104 |
| 1024 | 3300054114 | Ga0501084_1795822 | Ga0501084_1795822_113_427 | 104 |
| 1025 | 3300055283 | Ga0500661_059991 | Ga0500661_059991_257_571 | 104 |
| 1026 | 3300060353 | Ga0501082_1371466 | Ga0501082_1371466_44_358 | 104 |
| 1027 | iso_pu_bacteria | 3000135777 | 3000138478 | 104 |
| 1028 | 3300001904 | JGI24736J21556_1019435 | JGI24736J21556_10194352 | 110 |
| 1029 | 3300005331 | Ga0070670_100478173 | Ga0070670_1004781732 | 110 |
| 1030 | 3300005539 | Ga0068853_100755317 | Ga0068853_1007553171 | 110 |
| 1031 | 3300012513 | Ga0157326_1005515 | Ga0157326_10055152 | 110 |
| 1032 | 3300013102 | Ga0157371_11060191 | Ga0157371_110601912 | 110 |
| 1033 | 3300025250 | Ga0209026_1020525 | Ga0209026_10205251 | 110 |
| 1034 | 3300025919 | Ga0207657_11378601 | Ga0207657_113786012 | 110 |
| 1035 | 3300046475 | Ga0495639_0147246 | Ga0495639_0147246_625_957 | 110 |
| 1036 | 3300046524 | Ga0495648_0000303 | Ga0495648_0000303_50168_50500 | 110 |
| 1037 | 3300046557 | Ga0495622_0119506 | Ga0495622_0119506_348_680 | 110 |
| 1038 | 3300046674 | Ga0495588_0416707 | Ga0495588_0416707_218_550 | 110 |
| 1039 | 3300047443 | Ga0495687_013793 | Ga0495687_013793_1960_2292 | 110 |
| 1040 | 3300048905 | Ga0496102_0011729 | Ga0496102_0011729_2528_2860 | 110 |
| 1041 | 3300048906 | Ga0496103_0000836 | Ga0496103_0000836_4410_4742 | 110 |
| 1042 | 3300048907 | Ga0496104_0052957 | Ga0496104_0052957_1144_1476 | 110 |
| 1043 | 3300048908 | Ga0496105_0114733 | Ga0496105_0114733_807_1139 | 110 |
| 1044 | 3300048913 | Ga0496110_0070499 | Ga0496110_0070499_714_1046 | 110 |
| 1045 | 3300048914 | Ga0496111_0007641 | Ga0496111_0007641_2598_2930 | 110 |
| 1046 | 3300048918 | Ga0496115_0002445 | Ga0496115_0002445_8497_8829 | 110 |
| 1047 | 3300048919 | Ga0496116_0017799 | Ga0496116_0017799_4659_4991 | 110 |
| 1048 | 3300048920 | Ga0496117_0000182 | Ga0496117_0000182_60001_60333 | 110 |
| 1049 | 3300048921 | Ga0496118_0000125 | Ga0496118_0000125_67704_68036 | 110 |
| 1050 | 3300048922 | Ga0496119_0010214 | Ga0496119_0010214_3742_4074 | 110 |
| 1051 | 3300048924 | Ga0496121_0007290 | Ga0496121_0007290_4644_4976 | 110 |
| 1052 | 3300048926 | Ga0496123_0024694 | Ga0496123_0024694_2033_2365 | 110 |
| 1053 | 3300048927 | Ga0496124_0000082 | Ga0496124_0000082_68372_68704 | 110 |
| 1054 | 3300048928 | Ga0496125_0002269 | Ga0496125_0002269_3687_4019 | 110 |
| 1055 | 3300048929 | Ga0496126_0000221 | Ga0496126_0000221_56162_56494 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j05-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9273 | 6 | 86 |
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.9192 | 18 | 75 |
| 8iuh-assembly1.cif.gz_P | rna polymerase iii pre-initiation complex open complex 1 | 0.9164 | 20 | 77 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9138 | 6 | 85 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9016 | 5 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9498 | 18 | 74 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9419 | 16 | 80 | 1.10.10.10 |
| af_P91529_82_146_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9363 | 18 | 75 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9351 | 14 | 77 | 1.10.10.10 |
| af_P71941_17_120_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9338 | 6 | 85 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S2J3F8-F1-model_v4 | deleted | 0.9701 | 6 | 91 |
|
| AF-A0A1G7HSF5-F1-model_v4 | Transcriptional regulator, ArsR family | 0.9696 | 7 | 89 |
GO:0003700
|
| AF-A0A3D5I9A4-F1-model_v4 | Transcriptional regulator | 0.9648 | 3 | 91 |
GO:0003700
|
| AF-A0A0R2IM56-F1-model_v4 | deleted | 0.9625 | 7 | 90 |
|
| AF-K2AR67-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9607 | 7 | 93 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar