F489152
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 427 | 2110 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300014745|Ga0157377_10050193|Ga0157377_100501932 |
| Length | 263 |
| Sequence | LDRRGFFPGDSRFGDEKVPHQSESPDRGLLRRHGDNKNGAKRAFFGRRKGHSLKPRQAALFDTLLPRLALDLSNAAPADPRALFAVPVDALRLEIGFGGAEHLIAQAQANPRIGFIATDAFVNAVAKALVAIDERTLTNIRLHFGDASELLDWLPNASISQLDLLYPDPWPKRRHWKRRFIQDDNLRRLARILKTEGELRFATDIADYAAYALARVFRSADFVWTAECADDWRKPWTDFGGTRYEAKAKREGRRPAYFVFRRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 136 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 254 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 264 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 281 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 286 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 287 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 288 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 289 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 292 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 293 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 294 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 295 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 296 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 297 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 379 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 409 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 424 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 426 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 8.25 |
| Rhizosphere | 90.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157377_10050193 | 3300014745 | Bacteria | 2348 |
| 2 | 2214745198 | 2209111006 | Bacteria | 16611 |
| 3 | ARcpr5oldR_c000001 | 3300000041 | Bacteria | 84000 |
| 4 | ARSoilYngRDRAFT_c00002 | 3300000042 | Bacteria | 45421 |
| 5 | ARcpr5yngRDRAFT_c000052 | 3300000043 | Bacteria | 18395 |
| 6 | ARSoilOldRDRAFT_c000001 | 3300000044 | Bacteria | 104759 |
| 7 | ARCol0oldRDRAFT_c00118 | 3300000045 | Bacteria | 6952 |
| 8 | ARCol0yngRDRAFT_1000001 | 3300000652 | Bacteria | 73871 |
| 9 | JGI24032J14994_100737 | 3300001430 | Bacteria | 1673 |
| 10 | JGI24741J21665_1003866 | 3300001915 | Bacteria | 3458 |
| 11 | JGI24752J21851_1006376 | 3300001976 | Bacteria | 1542 |
| 12 | JGI24746J21847_1000659 | 3300001977 | Bacteria | 5287 |
| 13 | JGI24739J22299_10000177 | 3300001989 | Bacteria | 21227 |
| 14 | JGI24737J22298_10005064 | 3300001990 | Bacteria | 4565 |
| 15 | JGI24737J22298_10005147 | 3300001990 | Bacteria | 4528 |
| 16 | JGI24750J21931_1000821 | 3300002070 | Bacteria | 4287 |
| 17 | JGI24750J21931_1000850 | 3300002070 | Bacteria | 4210 |
| 18 | JGI24745J21846_1000205 | 3300002073 | Bacteria | 4792 |
| 19 | JGI24748J21848_1000211 | 3300002074 | Bacteria | 7274 |
| 20 | JGI24738J21930_10000256 | 3300002075 | Bacteria | 14438 |
| 21 | JGI24749J21850_1006010 | 3300002076 | Bacteria | 1693 |
| 22 | JGI24744J21845_10000112 | 3300002077 | Bacteria | 11058 |
| 23 | JGI24033J26618_1000425 | 3300002155 | Bacteria | 4204 |
| 24 | JGI24742J22300_10002461 | 3300002244 | Bacteria | 2962 |
| 25 | JGI25404J52841_10002600 | 3300003659 | Bacteria | 3440 |
| 26 | JGI25405J52794_10023352 | 3300003911 | Bacteria | 1258 |
| 27 | Ga0065712_10001068 | 3300005290 | Bacteria | 8962 |
| 28 | Ga0065712_10188505 | 3300005290 | Bacteria | 1159 |
| 29 | Ga0065715_10003590 | 3300005293 | Bacteria | 4262 |
| 30 | Ga0065715_10093721 | 3300005293 | Bacteria | 4582 |
| 31 | Ga0070658_10008439 | 3300005327 | Bacteria | 8286 |
| 32 | Ga0070676_10012964 | 3300005328 | Bacteria | 4566 |
| 33 | Ga0070676_10044006 | 3300005328 | Bacteria | 2597 |
| 34 | Ga0070683_100000098 | 3300005329 | Bacteria | 57301 |
| 35 | Ga0070683_101029154 | 3300005329 | Bacteria | 791 |
| 36 | Ga0070690_100015149 | 3300005330 | Bacteria | 4592 |
| 37 | Ga0070690_100026107 | 3300005330 | Bacteria | 3600 |
| 38 | Ga0070690_100104042 | 3300005330 | Bacteria | 1886 |
| 39 | Ga0070670_100001544 | 3300005331 | Bacteria | 18563 |
| 40 | Ga0070677_10000092 | 3300005333 | Bacteria | 29109 |
| 41 | Ga0068869_100000054 | 3300005334 | Bacteria | 49952 |
| 42 | Ga0070680_100027363 | 3300005336 | Bacteria | 4566 |
| 43 | Ga0070680_100058485 | 3300005336 | Bacteria | 3152 |
| 44 | Ga0070680_100396210 | 3300005336 | Bacteria | 1176 |
| 45 | Ga0070682_100000181 | 3300005337 | Bacteria | 47168 |
| 46 | Ga0068868_100003816 | 3300005338 | Bacteria | 10523 |
| 47 | Ga0068868_100186885 | 3300005338 | Bacteria | 1722 |
| 48 | Ga0070660_100027651 | 3300005339 | Bacteria | 4235 |
| 49 | Ga0070660_100089794 | 3300005339 | Bacteria | 2421 |
| 50 | Ga0070660_100297881 | 3300005339 | Bacteria | 1322 |
| 51 | Ga0070660_100708931 | 3300005339 | Bacteria | 844 |
| 52 | Ga0070689_100024070 | 3300005340 | Bacteria | 4566 |
| 53 | Ga0070689_100039552 | 3300005340 | Bacteria | 3611 |
| 54 | Ga0070689_100377502 | 3300005340 | Bacteria | 1194 |
| 55 | Ga0070691_10009004 | 3300005341 | Bacteria | 4566 |
| 56 | Ga0070691_10014475 | 3300005341 | Bacteria | 3620 |
| 57 | Ga0070687_100007432 | 3300005343 | Bacteria | 4566 |
| 58 | Ga0070687_100013713 | 3300005343 | Bacteria | 3620 |
| 59 | Ga0070687_100393211 | 3300005343 | Bacteria | 907 |
| 60 | Ga0070661_100000153 | 3300005344 | Bacteria | 56652 |
| 61 | Ga0070661_100059218 | 3300005344 | Bacteria | 2807 |
| 62 | Ga0070692_10000320 | 3300005345 | Bacteria | 13809 |
| 63 | Ga0070668_100024606 | 3300005347 | Bacteria | 4562 |
| 64 | Ga0070669_100027199 | 3300005353 | Bacteria | 4117 |
| 65 | Ga0070669_100070208 | 3300005353 | Bacteria | 2589 |
| 66 | Ga0070669_100367658 | 3300005353 | Bacteria | 1171 |
| 67 | Ga0070675_100027317 | 3300005354 | Bacteria | 4584 |
| 68 | Ga0070675_100378773 | 3300005354 | Bacteria | 1259 |
| 69 | Ga0070675_100383468 | 3300005354 | Bacteria | 1251 |
| 70 | Ga0070671_100011992 | 3300005355 | Bacteria | 6971 |
| 71 | Ga0070671_100114916 | 3300005355 | Bacteria | 2262 |
| 72 | Ga0070671_100512358 | 3300005355 | Bacteria | 1032 |
| 73 | Ga0070674_100017007 | 3300005356 | Bacteria | 4566 |
| 74 | Ga0070674_100083413 | 3300005356 | Bacteria | 2289 |
| 75 | Ga0070674_100212083 | 3300005356 | Bacteria | 1501 |
| 76 | Ga0070674_100385786 | 3300005356 | Bacteria | 1141 |
| 77 | Ga0070673_100005417 | 3300005364 | Bacteria | 8166 |
| 78 | Ga0070688_100023577 | 3300005365 | Bacteria | 3620 |
| 79 | Ga0070659_100025193 | 3300005366 | Bacteria | 4566 |
| 80 | Ga0070659_100054309 | 3300005366 | Bacteria | 3155 |
| 81 | Ga0070659_100349765 | 3300005366 | Bacteria | 1240 |
| 82 | Ga0070667_100029223 | 3300005367 | Bacteria | 4592 |
| 83 | Ga0070667_100107011 | 3300005367 | Bacteria | 2421 |
| 84 | Ga0070703_10004107 | 3300005406 | Bacteria | 4111 |
| 85 | Ga0070703_10007172 | 3300005406 | Bacteria | 3129 |
| 86 | Ga0070709_10246392 | 3300005434 | Bacteria | 1285 |
| 87 | Ga0070709_10544292 | 3300005434 | Unclassified | 887 |
| 88 | Ga0070714_100370257 | 3300005435 | Bacteria | 1349 |
| 89 | Ga0070714_100603998 | 3300005435 | Bacteria | 1054 |
| 90 | Ga0070713_100005576 | 3300005436 | Bacteria | 8624 |
| 91 | Ga0070713_100016744 | 3300005436 | Bacteria | 5519 |
| 92 | Ga0070713_100116115 | 3300005436 | Bacteria | 2340 |
| 93 | Ga0070710_10004049 | 3300005437 | Bacteria | 6957 |
| 94 | Ga0070710_10094569 | 3300005437 | Bacteria | 1769 |
| 95 | Ga0070701_10014309 | 3300005438 | Bacteria | 3634 |
| 96 | Ga0070711_100062903 | 3300005439 | Bacteria | 2588 |
| 97 | Ga0070711_100355580 | 3300005439 | Bacteria | 1178 |
| 98 | Ga0070711_100471932 | 3300005439 | Unclassified | 1030 |
| 99 | Ga0070705_100000311 | 3300005440 | Bacteria | 28719 |
| 100 | Ga0070705_100032626 | 3300005440 | Bacteria | 2895 |
| 101 | Ga0070705_100109693 | 3300005440 | Bacteria | 1760 |
| 102 | Ga0070700_100013652 | 3300005441 | Bacteria | 4566 |
| 103 | Ga0070694_100122542 | 3300005444 | Bacteria | 1867 |
| 104 | Ga0070708_100015291 | 3300005445 | Bacteria | 6333 |
| 105 | Ga0070663_100002418 | 3300005455 | Bacteria | 10500 |
| 106 | Ga0070663_100156092 | 3300005455 | Bacteria | 1753 |
| 107 | Ga0070678_100000382 | 3300005456 | Bacteria | 20769 |
| 108 | Ga0070678_100147029 | 3300005456 | Bacteria | 1893 |
| 109 | Ga0070662_100019898 | 3300005457 | Bacteria | 4566 |
| 110 | Ga0070662_100033993 | 3300005457 | Bacteria | 3593 |
| 111 | Ga0070662_100072994 | 3300005457 | Bacteria | 2535 |
| 112 | Ga0070681_10042293 | 3300005458 | Bacteria | 4566 |
| 113 | Ga0070681_10173797 | 3300005458 | Bacteria | 2076 |
| 114 | Ga0070681_10221004 | 3300005458 | Bacteria | 1809 |
| 115 | Ga0070681_10523804 | 3300005458 | Bacteria | 1099 |
| 116 | Ga0068867_100021877 | 3300005459 | Bacteria | 4566 |
| 117 | Ga0070685_10004779 | 3300005466 | Bacteria | 6861 |
| 118 | Ga0070685_10080613 | 3300005466 | Bacteria | 1950 |
| 119 | Ga0070685_10169087 | 3300005466 | Bacteria | 1400 |
| 120 | Ga0070707_100164538 | 3300005468 | Bacteria | 2162 |
| 121 | Ga0070679_100022398 | 3300005530 | Bacteria | 6176 |
| 122 | Ga0070679_100041737 | 3300005530 | Bacteria | 4566 |
| 123 | Ga0070679_100051061 | 3300005530 | Bacteria | 4118 |
| 124 | Ga0070679_100051422 | 3300005530 | Bacteria | 4104 |
| 125 | Ga0070679_100077850 | 3300005530 | Bacteria | 3305 |
| 126 | Ga0070679_100144573 | 3300005530 | Bacteria | 2356 |
| 127 | Ga0070679_100241026 | 3300005530 | Bacteria | 1765 |
| 128 | Ga0070684_100030755 | 3300005535 | Bacteria | 4566 |
| 129 | Ga0070684_100050287 | 3300005535 | Bacteria | 3620 |
| 130 | Ga0070684_100394562 | 3300005535 | Bacteria | 1275 |
| 131 | Ga0070697_100074309 | 3300005536 | Bacteria | 2792 |
| 132 | Ga0068853_100001615 | 3300005539 | Bacteria | 16456 |
| 133 | Ga0068853_100054660 | 3300005539 | Bacteria | 3441 |
| 134 | Ga0070672_100010353 | 3300005543 | Bacteria | 6467 |
| 135 | Ga0070672_100173707 | 3300005543 | Bacteria | 1793 |
| 136 | Ga0070672_100333385 | 3300005543 | Bacteria | 1291 |
| 137 | Ga0070686_100014350 | 3300005544 | Bacteria | 4566 |
| 138 | Ga0070695_100015681 | 3300005545 | Bacteria | 4578 |
| 139 | Ga0070696_100004854 | 3300005546 | Bacteria | 8984 |
| 140 | Ga0070696_100060128 | 3300005546 | Bacteria | 2657 |
| 141 | Ga0070696_100309990 | 3300005546 | Bacteria | 1211 |
| 142 | Ga0070696_100350674 | 3300005546 | Bacteria | 1143 |
| 143 | Ga0070696_100456101 | 3300005546 | Bacteria | 1010 |
| 144 | Ga0070693_100004759 | 3300005547 | Bacteria | 6462 |
| 145 | Ga0070665_100047110 | 3300005548 | Bacteria | 4327 |
| 146 | Ga0070665_100141229 | 3300005548 | Bacteria | 2411 |
| 147 | Ga0070665_100692157 | 3300005548 | Bacteria | 1032 |
| 148 | Ga0070704_100093974 | 3300005549 | Bacteria | 2242 |
| 149 | Ga0070704_100096510 | 3300005549 | Bacteria | 2216 |
| 150 | Ga0068855_100057337 | 3300005563 | Bacteria | 4566 |
| 151 | Ga0068855_100143145 | 3300005563 | Bacteria | 2723 |
| 152 | Ga0068855_100194016 | 3300005563 | Bacteria | 2289 |
| 153 | Ga0070664_100014418 | 3300005564 | Bacteria | 6444 |
| 154 | Ga0070664_100047954 | 3300005564 | Bacteria | 3610 |
| 155 | Ga0070664_100082047 | 3300005564 | Bacteria | 2780 |
| 156 | Ga0070664_100106768 | 3300005564 | Bacteria | 2440 |
| 157 | Ga0070664_100322413 | 3300005564 | Unclassified | 1400 |
| 158 | Ga0068857_100032777 | 3300005577 | Bacteria | 4592 |
| 159 | Ga0068857_100093574 | 3300005577 | Bacteria | 2691 |
| 160 | Ga0068857_100151308 | 3300005577 | Bacteria | 2102 |
| 161 | Ga0068854_100000145 | 3300005578 | Bacteria | 49590 |
| 162 | Ga0068854_100051437 | 3300005578 | Bacteria | 2952 |
| 163 | Ga0068854_100298229 | 3300005578 | Bacteria | 1303 |
| 164 | Ga0068856_100084816 | 3300005614 | Bacteria | 3147 |
| 165 | Ga0068856_100086099 | 3300005614 | Bacteria | 3122 |
| 166 | Ga0070702_100001703 | 3300005615 | Bacteria | 9128 |
| 167 | Ga0070702_100555793 | 3300005615 | Bacteria | 853 |
| 168 | Ga0068852_100028596 | 3300005616 | Bacteria | 4566 |
| 169 | Ga0068852_100133271 | 3300005616 | Bacteria | 2290 |
| 170 | Ga0068852_100926228 | 3300005616 | Bacteria | 889 |
| 171 | Ga0068859_100062972 | 3300005617 | Bacteria | 3739 |
| 172 | Ga0068859_100066075 | 3300005617 | Bacteria | 3651 |
| 173 | Ga0068859_100075527 | 3300005617 | Bacteria | 3410 |
| 174 | Ga0068864_100014958 | 3300005618 | Bacteria | 6449 |
| 175 | Ga0068864_100135595 | 3300005618 | Bacteria | 2216 |
| 176 | Ga0068866_10000209 | 3300005718 | Bacteria | 27638 |
| 177 | Ga0068861_100021773 | 3300005719 | Bacteria | 4610 |
| 178 | Ga0068861_100037215 | 3300005719 | Bacteria | 3617 |
| 179 | Ga0068861_100265060 | 3300005719 | Bacteria | 1473 |
| 180 | Ga0068851_10021107 | 3300005834 | Bacteria | 3160 |
| 181 | Ga0068870_10000029 | 3300005840 | Bacteria | 45103 |
| 182 | Ga0068863_100019798 | 3300005841 | Bacteria | 6436 |
| 183 | Ga0068863_100113155 | 3300005841 | Unclassified | 2585 |
| 184 | Ga0068858_100035970 | 3300005842 | Bacteria | 4592 |
| 185 | Ga0068858_100117267 | 3300005842 | Bacteria | 2488 |
| 186 | Ga0068858_100170651 | 3300005842 | Bacteria | 2051 |
| 187 | Ga0068860_100044535 | 3300005843 | Bacteria | 4229 |
| 188 | Ga0068860_100059856 | 3300005843 | Bacteria | 3620 |
| 189 | Ga0068860_100395141 | 3300005843 | Bacteria | 1367 |
| 190 | Ga0068862_100011280 | 3300005844 | Bacteria | 7379 |
| 191 | Ga0068862_100036879 | 3300005844 | Bacteria | 4143 |
| 192 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 193 | Ga0081455_10007598 | 3300005937 | Bacteria | 11395 |
| 194 | Ga0081540_1000150 | 3300005983 | Bacteria | 71934 |
| 195 | Ga0081540_1014154 | 3300005983 | Bacteria | 5133 |
| 196 | Ga0070717_10003573 | 3300006028 | Bacteria | 11149 |
| 197 | Ga0070717_10134176 | 3300006028 | Bacteria | 2131 |
| 198 | Ga0075365_10064057 | 3300006038 | Bacteria | 2462 |
| 199 | Ga0075432_10000858 | 3300006058 | Bacteria | 9575 |
| 200 | Ga0070715_10004174 | 3300006163 | Bacteria | 4701 |
| 201 | Ga0070715_10009672 | 3300006163 | Bacteria | 3407 |
| 202 | Ga0075367_10116176 | 3300006178 | Bacteria | 1646 |
| 203 | Ga0075427_10006621 | 3300006194 | Bacteria | 1684 |
| 204 | Ga0097621_100000328 | 3300006237 | Bacteria | 32181 |
| 205 | Ga0097621_100009094 | 3300006237 | Bacteria | 7199 |
| 206 | Ga0075370_10205919 | 3300006353 | Bacteria | 1161 |
| 207 | Ga0068871_100007030 | 3300006358 | Bacteria | 8017 |
| 208 | Ga0068871_100023940 | 3300006358 | Bacteria | 4731 |
| 209 | Ga0068871_100085303 | 3300006358 | Bacteria | 2622 |
| 210 | Ga0075428_100002065 | 3300006844 | Bacteria | 21658 |
| 211 | Ga0075430_100000129 | 3300006846 | Bacteria | 47714 |
| 212 | Ga0075431_100000234 | 3300006847 | Bacteria | 41571 |
| 213 | Ga0075431_100449841 | 3300006847 | Bacteria | 1284 |
| 214 | Ga0075433_10000060 | 3300006852 | Bacteria | 47870 |
| 215 | Ga0075433_10005178 | 3300006852 | Bacteria | 10214 |
| 216 | Ga0075433_10091829 | 3300006852 | Bacteria | 2684 |
| 217 | Ga0075434_100000412 | 3300006871 | Bacteria | 31664 |
| 218 | Ga0075434_100003277 | 3300006871 | Bacteria | 14477 |
| 219 | Ga0075434_100049205 | 3300006871 | Bacteria | 4185 |
| 220 | Ga0075434_100109607 | 3300006871 | Bacteria | 2771 |
| 221 | Ga0075429_100000532 | 3300006880 | Bacteria | 28949 |
| 222 | Ga0075429_100303077 | 3300006880 | Bacteria | 1399 |
| 223 | Ga0068865_100011649 | 3300006881 | Bacteria | 5510 |
| 224 | Ga0068865_100061544 | 3300006881 | Bacteria | 2632 |
| 225 | Ga0068865_100395594 | 3300006881 | Bacteria | 1131 |
| 226 | Ga0075436_100070902 | 3300006914 | Bacteria | 2409 |
| 227 | Ga0075436_100203536 | 3300006914 | Bacteria | 1402 |
| 228 | Ga0075436_100470404 | 3300006914 | Bacteria | 917 |
| 229 | Ga0097620_100062974 | 3300006931 | Bacteria | 3739 |
| 230 | Ga0097620_100066081 | 3300006931 | Bacteria | 3651 |
| 231 | Ga0097620_100075530 | 3300006931 | Bacteria | 3410 |
| 232 | Ga0075435_100008631 | 3300007076 | Bacteria | 7325 |
| 233 | Ga0075435_100074494 | 3300007076 | Bacteria | 2777 |
| 234 | Ga0075435_100128723 | 3300007076 | Bacteria | 2117 |
| 235 | Ga0075435_100247441 | 3300007076 | Bacteria | 1517 |
| 236 | Ga0105244_10020723 | 3300009036 | Bacteria | 3647 |
| 237 | Ga0105250_10004829 | 3300009092 | Bacteria | 6133 |
| 238 | Ga0105250_10126411 | 3300009092 | Bacteria | 1053 |
| 239 | Ga0105240_10029089 | 3300009093 | Bacteria | 7205 |
| 240 | Ga0105240_10071744 | 3300009093 | Bacteria | 4282 |
| 241 | Ga0105240_10228923 | 3300009093 | Bacteria | 2162 |
| 242 | Ga0111539_10004252 | 3300009094 | Bacteria | 18756 |
| 243 | Ga0111539_10058244 | 3300009094 | Bacteria | 4584 |
| 244 | Ga0111539_10058514 | 3300009094 | Bacteria | 4572 |
| 245 | Ga0111539_10087470 | 3300009094 | Bacteria | 3660 |
| 246 | Ga0105245_10000882 | 3300009098 | Bacteria | 27254 |
| 247 | Ga0105245_10180158 | 3300009098 | Bacteria | 2018 |
| 248 | Ga0105245_11045134 | 3300009098 | Bacteria | 862 |
| 249 | Ga0105247_10001969 | 3300009101 | Bacteria | 14264 |
| 250 | Ga0105247_10015650 | 3300009101 | Bacteria | 4540 |
| 251 | Ga0105247_10088788 | 3300009101 | Bacteria | 1959 |
| 252 | Ga0105247_10113517 | 3300009101 | Bacteria | 1746 |
| 253 | Ga0105247_10145007 | 3300009101 | Bacteria | 1560 |
| 254 | Ga0114129_10011272 | 3300009147 | Bacteria | 12741 |
| 255 | Ga0114129_10011377 | 3300009147 | Bacteria | 12675 |
| 256 | Ga0105243_10024684 | 3300009148 | Bacteria | 4587 |
| 257 | Ga0105243_10039281 | 3300009148 | Bacteria | 3688 |
| 258 | Ga0105243_10112355 | 3300009148 | Bacteria | 2282 |
| 259 | Ga0105243_10137153 | 3300009148 | Bacteria | 2083 |
| 260 | Ga0105243_10330732 | 3300009148 | Bacteria | 1392 |
| 261 | Ga0105241_10004094 | 3300009174 | Bacteria | 10774 |
| 262 | Ga0105241_10097873 | 3300009174 | Bacteria | 2327 |
| 263 | Ga0105242_10021910 | 3300009176 | Bacteria | 5022 |
| 264 | Ga0105242_10230762 | 3300009176 | Bacteria | 1659 |
| 265 | Ga0105242_10422351 | 3300009176 | Bacteria | 1250 |
| 266 | Ga0105248_10034980 | 3300009177 | Bacteria | 5621 |
| 267 | Ga0105248_10049550 | 3300009177 | Bacteria | 4711 |
| 268 | Ga0105248_10381652 | 3300009177 | Bacteria | 1587 |
| 269 | Ga0105248_10658159 | 3300009177 | Bacteria | 1182 |
| 270 | Ga0105237_10016131 | 3300009545 | Bacteria | 7769 |
| 271 | Ga0105237_10110080 | 3300009545 | Bacteria | 2746 |
| 272 | Ga0105237_10380585 | 3300009545 | Bacteria | 1416 |
| 273 | Ga0105238_10288062 | 3300009551 | Bacteria | 1624 |
| 274 | Ga0105238_10292464 | 3300009551 | Bacteria | 1611 |
| 275 | Ga0105249_10008019 | 3300009553 | Bacteria | 9205 |
| 276 | Ga0105249_10037532 | 3300009553 | Bacteria | 4397 |
| 277 | Ga0105249_10194309 | 3300009553 | Bacteria | 1982 |
| 278 | Ga0105249_10413790 | 3300009553 | Bacteria | 1381 |
| 279 | Ga0105239_10049789 | 3300010375 | Bacteria | 4595 |
| 280 | Ga0105239_10052026 | 3300010375 | Bacteria | 4490 |
| 281 | Ga0105239_10349846 | 3300010375 | Bacteria | 1668 |
| 282 | Ga0105246_10007744 | 3300011119 | Bacteria | 6591 |
| 283 | Ga0157347_1004501 | 3300012502 | Bacteria | 1298 |
| 284 | Ga0157338_1006414 | 3300012515 | Bacteria | 1087 |
| 285 | Ga0157373_10006834 | 3300013100 | Bacteria | 8493 |
| 286 | Ga0157371_10012862 | 3300013102 | Bacteria | 6372 |
| 287 | Ga0157371_10052032 | 3300013102 | Bacteria | 2909 |
| 288 | Ga0157371_10123108 | 3300013102 | Bacteria | 1844 |
| 289 | Ga0157370_10038422 | 3300013104 | Bacteria | 4630 |
| 290 | Ga0157369_10299185 | 3300013105 | Bacteria | 1674 |
| 291 | Ga0157374_10000614 | 3300013296 | Bacteria | 31520 |
| 292 | Ga0157374_10432005 | 3300013296 | Bacteria | 1317 |
| 293 | Ga0157374_10790265 | 3300013296 | Bacteria | 965 |
| 294 | Ga0157378_10000701 | 3300013297 | Bacteria | 31354 |
| 295 | Ga0157378_10141244 | 3300013297 | Bacteria | 2236 |
| 296 | Ga0157378_10154525 | 3300013297 | Bacteria | 2140 |
| 297 | Ga0157378_10622402 | 3300013297 | Bacteria | 1093 |
| 298 | Ga0163162_10042063 | 3300013306 | Bacteria | 4572 |
| 299 | Ga0163162_10060042 | 3300013306 | Bacteria | 3836 |
| 300 | Ga0163162_10467102 | 3300013306 | Bacteria | 1393 |
| 301 | Ga0163162_10545355 | 3300013306 | Bacteria | 1288 |
| 302 | Ga0157372_10028350 | 3300013307 | Bacteria | 6110 |
| 303 | Ga0157372_10338765 | 3300013307 | Bacteria | 1752 |
| 304 | Ga0157372_10699436 | 3300013307 | Bacteria | 1180 |
| 305 | Ga0157375_10009978 | 3300013308 | Bacteria | 8349 |
| 306 | Ga0157375_10038574 | 3300013308 | Bacteria | 4587 |
| 307 | Ga0157375_10159258 | 3300013308 | Bacteria | 2399 |
| 308 | Ga0157375_10414997 | 3300013308 | Bacteria | 1512 |
| 309 | Ga0157375_11126533 | 3300013308 | Bacteria | 919 |
| 310 | Ga0163163_10007899 | 3300014325 | Bacteria | 9406 |
| 311 | Ga0163163_10033764 | 3300014325 | Bacteria | 4952 |
| 312 | Ga0157380_10001646 | 3300014326 | Bacteria | 14707 |
| 313 | Ga0157380_10107099 | 3300014326 | Bacteria | 2340 |
| 314 | Ga0157380_10304208 | 3300014326 | Bacteria | 1470 |
| 315 | Ga0157380_10616293 | 3300014326 | Bacteria | 1076 |
| 316 | Ga0157377_10000514 | 3300014745 | Bacteria | 16439 |
| 317 | Ga0157379_10003823 | 3300014968 | Bacteria | 12837 |
| 318 | Ga0157379_10125244 | 3300014968 | Bacteria | 2312 |
| 319 | Ga0157379_10129603 | 3300014968 | Bacteria | 2270 |
| 320 | Ga0157379_10137747 | 3300014968 | Bacteria | 2200 |
| 321 | Ga0157379_10270049 | 3300014968 | Bacteria | 1546 |
| 322 | Ga0157379_10305929 | 3300014968 | Bacteria | 1449 |
| 323 | Ga0157376_10000860 | 3300014969 | Bacteria | 19922 |
| 324 | Ga0157376_10048487 | 3300014969 | Bacteria | 3512 |
| 325 | Ga0157376_10341078 | 3300014969 | Bacteria | 1431 |
| 326 | Ga0157376_10748979 | 3300014969 | Bacteria | 986 |
| 327 | Ga0163161_10000956 | 3300017792 | Bacteria | 22176 |
| 328 | Ga0163161_10178929 | 3300017792 | Bacteria | 1625 |
| 329 | Ga0163161_10222039 | 3300017792 | Bacteria | 1463 |
| 330 | Ga0197907_11114363 | 3300020069 | Bacteria | 1585 |
| 331 | Ga0206354_11430131 | 3300020081 | Bacteria | 1411 |
| 332 | Ga0206353_11674680 | 3300020082 | Bacteria | 2049 |
| 333 | Ga0213876_10062749 | 3300021384 | Bacteria | 1962 |
| 334 | Ga0207666_1000043 | 3300025271 | Bacteria | 24939 |
| 335 | Ga0207666_1000617 | 3300025271 | Bacteria | 4255 |
| 336 | Ga0207673_1000017 | 3300025290 | Bacteria | 12689 |
| 337 | Ga0207697_10001136 | 3300025315 | Bacteria | 14657 |
| 338 | Ga0207697_10008878 | 3300025315 | Bacteria | 4371 |
| 339 | Ga0207653_10007260 | 3300025885 | Bacteria | 3456 |
| 340 | Ga0207653_10015009 | 3300025885 | Bacteria | 2431 |
| 341 | Ga0207682_10000021 | 3300025893 | Bacteria | 63904 |
| 342 | Ga0207692_10011004 | 3300025898 | Bacteria | 3830 |
| 343 | Ga0207642_10000063 | 3300025899 | Bacteria | 29814 |
| 344 | Ga0207710_10028544 | 3300025900 | Bacteria | 2422 |
| 345 | Ga0207710_10116105 | 3300025900 | Bacteria | 1274 |
| 346 | Ga0207688_10000949 | 3300025901 | Bacteria | 14704 |
| 347 | Ga0207688_10094425 | 3300025901 | Bacteria | 1721 |
| 348 | Ga0207680_10009142 | 3300025903 | Bacteria | 4899 |
| 349 | Ga0207680_10285752 | 3300025903 | Bacteria | 1147 |
| 350 | Ga0207647_10013700 | 3300025904 | Bacteria | 5614 |
| 351 | Ga0207647_10021210 | 3300025904 | Bacteria | 4339 |
| 352 | Ga0207685_10019435 | 3300025905 | Bacteria | 2239 |
| 353 | Ga0207699_10001682 | 3300025906 | Bacteria | 10460 |
| 354 | Ga0207699_10061636 | 3300025906 | Bacteria | 2257 |
| 355 | Ga0207645_10011742 | 3300025907 | Bacteria | 5968 |
| 356 | Ga0207645_10018617 | 3300025907 | Bacteria | 4563 |
| 357 | Ga0207645_10123720 | 3300025907 | Bacteria | 1680 |
| 358 | Ga0207645_10268287 | 3300025907 | Bacteria | 1131 |
| 359 | Ga0207643_10000108 | 3300025908 | Bacteria | 56497 |
| 360 | Ga0207705_10077997 | 3300025909 | Bacteria | 2410 |
| 361 | Ga0207705_10632208 | 3300025909 | Bacteria | 832 |
| 362 | Ga0207654_10001731 | 3300025911 | Bacteria | 11357 |
| 363 | Ga0207654_10263515 | 3300025911 | Bacteria | 1160 |
| 364 | Ga0207707_10013364 | 3300025912 | Bacteria | 7156 |
| 365 | Ga0207707_10032373 | 3300025912 | Bacteria | 4576 |
| 366 | Ga0207707_10052219 | 3300025912 | Bacteria | 3560 |
| 367 | Ga0207707_10145745 | 3300025912 | Bacteria | 2070 |
| 368 | Ga0207707_10377881 | 3300025912 | Bacteria | 1218 |
| 369 | Ga0207707_10662366 | 3300025912 | Bacteria | 879 |
| 370 | Ga0207695_10212559 | 3300025913 | Bacteria | 1844 |
| 371 | Ga0207671_10012822 | 3300025914 | Bacteria | 6715 |
| 372 | Ga0207671_10055174 | 3300025914 | Bacteria | 2944 |
| 373 | Ga0207693_10006099 | 3300025915 | Bacteria | 9985 |
| 374 | Ga0207693_10018314 | 3300025915 | Bacteria | 5580 |
| 375 | Ga0207693_10059968 | 3300025915 | Bacteria | 2981 |
| 376 | Ga0207663_10008774 | 3300025916 | Bacteria | 5310 |
| 377 | Ga0207663_10200440 | 3300025916 | Bacteria | 1439 |
| 378 | Ga0207663_10265191 | 3300025916 | Bacteria | 1270 |
| 379 | Ga0207663_10453618 | 3300025916 | Bacteria | 989 |
| 380 | Ga0207660_10000014 | 3300025917 | Bacteria | 79328 |
| 381 | Ga0207660_10164360 | 3300025917 | Bacteria | 1715 |
| 382 | Ga0207662_10005530 | 3300025918 | Bacteria | 6749 |
| 383 | Ga0207662_10020149 | 3300025918 | Bacteria | 3804 |
| 384 | Ga0207657_10007397 | 3300025919 | Bacteria | 11262 |
| 385 | Ga0207657_10034796 | 3300025919 | Bacteria | 4524 |
| 386 | Ga0207657_10054202 | 3300025919 | Bacteria | 3469 |
| 387 | Ga0207657_10286673 | 3300025919 | Bacteria | 1306 |
| 388 | Ga0207649_10000086 | 3300025920 | Bacteria | 79546 |
| 389 | Ga0207649_10089487 | 3300025920 | Bacteria | 2012 |
| 390 | Ga0207652_10000255 | 3300025921 | Bacteria | 55415 |
| 391 | Ga0207652_10120280 | 3300025921 | Bacteria | 2336 |
| 392 | Ga0207652_10322151 | 3300025921 | Bacteria | 1395 |
| 393 | Ga0207681_10000024 | 3300025923 | Bacteria | 206607 |
| 394 | Ga0207681_10405362 | 3300025923 | Bacteria | 1102 |
| 395 | Ga0207694_10619387 | 3300025924 | Bacteria | 911 |
| 396 | Ga0207650_10005453 | 3300025925 | Bacteria | 8683 |
| 397 | Ga0207650_10481834 | 3300025925 | Bacteria | 1035 |
| 398 | Ga0207659_10000034 | 3300025926 | Bacteria | 108227 |
| 399 | Ga0207659_10089772 | 3300025926 | Bacteria | 2292 |
| 400 | Ga0207659_10315215 | 3300025926 | Bacteria | 1289 |
| 401 | Ga0207659_10408687 | 3300025926 | Bacteria | 1137 |
| 402 | Ga0207687_10000110 | 3300025927 | Bacteria | 58672 |
| 403 | Ga0207687_10076773 | 3300025927 | Bacteria | 2401 |
| 404 | Ga0207687_10124760 | 3300025927 | Bacteria | 1931 |
| 405 | Ga0207687_10744148 | 3300025927 | Bacteria | 834 |
| 406 | Ga0207700_10001909 | 3300025928 | Bacteria | 11858 |
| 407 | Ga0207700_10206762 | 3300025928 | Bacteria | 1657 |
| 408 | Ga0207664_10066335 | 3300025929 | Bacteria | 2893 |
| 409 | Ga0207644_10000868 | 3300025931 | Bacteria | 19086 |
| 410 | Ga0207644_10025290 | 3300025931 | Bacteria | 4082 |
| 411 | Ga0207644_10782751 | 3300025931 | Bacteria | 797 |
| 412 | Ga0207690_10000270 | 3300025932 | Bacteria | 36976 |
| 413 | Ga0207690_10087572 | 3300025932 | Bacteria | 2191 |
| 414 | Ga0207690_10114094 | 3300025932 | Bacteria | 1951 |
| 415 | Ga0207706_10033611 | 3300025933 | Bacteria | 4563 |
| 416 | Ga0207706_10040100 | 3300025933 | Bacteria | 4150 |
| 417 | Ga0207706_10189817 | 3300025933 | Bacteria | 1804 |
| 418 | Ga0207706_10229486 | 3300025933 | Bacteria | 1625 |
| 419 | Ga0207706_10313411 | 3300025933 | Bacteria | 1366 |
| 420 | Ga0207706_10341766 | 3300025933 | Bacteria | 1302 |
| 421 | Ga0207686_10000214 | 3300025934 | Bacteria | 44245 |
| 422 | Ga0207686_10072351 | 3300025934 | Bacteria | 2221 |
| 423 | Ga0207709_10000344 | 3300025935 | Bacteria | 48058 |
| 424 | Ga0207709_10010118 | 3300025935 | Bacteria | 5195 |
| 425 | Ga0207709_10244590 | 3300025935 | Bacteria | 1307 |
| 426 | Ga0207709_10321624 | 3300025935 | Bacteria | 1158 |
| 427 | Ga0207670_10010144 | 3300025936 | Bacteria | 5410 |
| 428 | Ga0207670_10015325 | 3300025936 | Bacteria | 4578 |
| 429 | Ga0207670_10122715 | 3300025936 | Bacteria | 1891 |
| 430 | Ga0207669_10000295 | 3300025937 | Bacteria | 22936 |
| 431 | Ga0207669_10025469 | 3300025937 | Bacteria | 3199 |
| 432 | Ga0207669_10026480 | 3300025937 | Bacteria | 3155 |
| 433 | Ga0207704_10000343 | 3300025938 | Bacteria | 21644 |
| 434 | Ga0207704_10165665 | 3300025938 | Bacteria | 1578 |
| 435 | Ga0207704_10404826 | 3300025938 | Bacteria | 1078 |
| 436 | Ga0207665_10001068 | 3300025939 | Bacteria | 18420 |
| 437 | Ga0207665_10782940 | 3300025939 | Bacteria | 753 |
| 438 | Ga0207691_10003768 | 3300025940 | Bacteria | 14723 |
| 439 | Ga0207691_10286420 | 3300025940 | Bacteria | 1417 |
| 440 | Ga0207691_10315884 | 3300025940 | Bacteria | 1340 |
| 441 | Ga0207711_10001706 | 3300025941 | Bacteria | 20209 |
| 442 | Ga0207711_10007798 | 3300025941 | Bacteria | 8948 |
| 443 | Ga0207711_10342736 | 3300025941 | Bacteria | 1383 |
| 444 | Ga0207689_10002655 | 3300025942 | Bacteria | 16537 |
| 445 | Ga0207689_10209544 | 3300025942 | Bacteria | 1610 |
| 446 | Ga0207661_10000094 | 3300025944 | Bacteria | 56621 |
| 447 | Ga0207661_10691251 | 3300025944 | Bacteria | 938 |
| 448 | Ga0207679_10000025 | 3300025945 | Bacteria | 203699 |
| 449 | Ga0207679_10020011 | 3300025945 | Bacteria | 4509 |
| 450 | Ga0207679_10132305 | 3300025945 | Bacteria | 2003 |
| 451 | Ga0207679_10238500 | 3300025945 | Bacteria | 1539 |
| 452 | Ga0207679_10248196 | 3300025945 | Bacteria | 1512 |
| 453 | Ga0207667_10006649 | 3300025949 | Bacteria | 13973 |
| 454 | Ga0207667_10046648 | 3300025949 | Bacteria | 4588 |
| 455 | Ga0207667_10054806 | 3300025949 | Bacteria | 4193 |
| 456 | Ga0207651_10000028 | 3300025960 | Bacteria | 68962 |
| 457 | Ga0207712_10000558 | 3300025961 | Bacteria | 30161 |
| 458 | Ga0207668_10000098 | 3300025972 | Bacteria | 62195 |
| 459 | Ga0207668_10045417 | 3300025972 | Bacteria | 2996 |
| 460 | Ga0207668_10092117 | 3300025972 | Bacteria | 2230 |
| 461 | Ga0207640_10000104 | 3300025981 | Bacteria | 65093 |
| 462 | Ga0207640_10015182 | 3300025981 | Bacteria | 4453 |
| 463 | Ga0207658_10276159 | 3300025986 | Bacteria | 1438 |
| 464 | Ga0207658_10291315 | 3300025986 | Bacteria | 1403 |
| 465 | Ga0207677_10005087 | 3300026023 | Bacteria | 7109 |
| 466 | Ga0207677_10012453 | 3300026023 | Bacteria | 4890 |
| 467 | Ga0207703_10000594 | 3300026035 | Bacteria | 36837 |
| 468 | Ga0207703_10006566 | 3300026035 | Bacteria | 9280 |
| 469 | Ga0207703_10764680 | 3300026035 | Bacteria | 921 |
| 470 | Ga0207639_10000265 | 3300026041 | Bacteria | 37412 |
| 471 | Ga0207678_10003256 | 3300026067 | Bacteria | 14657 |
| 472 | Ga0207678_10035004 | 3300026067 | Bacteria | 4372 |
| 473 | Ga0207678_10085762 | 3300026067 | Bacteria | 2691 |
| 474 | Ga0207708_10024812 | 3300026075 | Bacteria | 4536 |
| 475 | Ga0207708_10024934 | 3300026075 | Bacteria | 4524 |
| 476 | Ga0207708_10625825 | 3300026075 | Bacteria | 914 |
| 477 | Ga0207702_10001351 | 3300026078 | Bacteria | 24451 |
| 478 | Ga0207702_10085087 | 3300026078 | Bacteria | 2755 |
| 479 | Ga0207702_10132731 | 3300026078 | Bacteria | 2242 |
| 480 | Ga0207702_10897314 | 3300026078 | Bacteria | 878 |
| 481 | Ga0207641_10005095 | 3300026088 | Bacteria | 11256 |
| 482 | Ga0207648_10004307 | 3300026089 | Bacteria | 14659 |
| 483 | Ga0207648_10160756 | 3300026089 | Bacteria | 1984 |
| 484 | Ga0207676_10000640 | 3300026095 | Bacteria | 28116 |
| 485 | Ga0207674_10005795 | 3300026116 | Bacteria | 14657 |
| 486 | Ga0207674_10094456 | 3300026116 | Bacteria | 2977 |
| 487 | Ga0207675_100003849 | 3300026118 | Bacteria | 14589 |
| 488 | Ga0207675_100041595 | 3300026118 | Bacteria | 4292 |
| 489 | Ga0207675_100041946 | 3300026118 | Bacteria | 4272 |
| 490 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 491 | Ga0207683_10007134 | 3300026121 | Bacteria | 9578 |
| 492 | Ga0207683_10067720 | 3300026121 | Bacteria | 3150 |
| 493 | Ga0207698_10001784 | 3300026142 | Bacteria | 12572 |
| 494 | Ga0207698_10559774 | 3300026142 | Bacteria | 1122 |
| 495 | Ga0209973_1000485 | 3300027252 | Bacteria | 3029 |
| 496 | Ga0209995_1006935 | 3300027471 | Bacteria | 1827 |
| 497 | Ga0210002_1001067 | 3300027617 | Bacteria | 3795 |
| 498 | Ga0209983_1016594 | 3300027665 | Bacteria | 1521 |
| 499 | Ga0209971_1011706 | 3300027682 | Bacteria | 2079 |
| 500 | Ga0209966_1001536 | 3300027695 | Bacteria | 4012 |
| 501 | Ga0209998_10002199 | 3300027717 | Bacteria | 4524 |
| 502 | Ga0209998_10003000 | 3300027717 | Bacteria | 3755 |
| 503 | Ga0209998_10012661 | 3300027717 | Bacteria | 1752 |
| 504 | Ga0209974_10004169 | 3300027876 | Bacteria | 5171 |
| 505 | Ga0209974_10014697 | 3300027876 | Bacteria | 2602 |
| 506 | Ga0207428_10000146 | 3300027907 | Bacteria | 95417 |
| 507 | Ga0207428_10000221 | 3300027907 | Bacteria | 79234 |
| 508 | Ga0207428_10000590 | 3300027907 | Bacteria | 42889 |
| 509 | Ga0268266_10012422 | 3300028379 | Bacteria | 7362 |
| 510 | Ga0268266_10022724 | 3300028379 | Bacteria | 5339 |
| 511 | Ga0268266_10108502 | 3300028379 | Bacteria | 2456 |
| 512 | Ga0268266_10602734 | 3300028379 | Bacteria | 1055 |
| 513 | Ga0268265_10005507 | 3300028380 | Bacteria | 8641 |
| 514 | Ga0268265_10228447 | 3300028380 | Bacteria | 1634 |
| 515 | Ga0268264_10000456 | 3300028381 | Bacteria | 55761 |
| 516 | Ga0268264_10178976 | 3300028381 | Bacteria | 1924 |
| 517 | Ga0268264_10390491 | 3300028381 | Bacteria | 1335 |
| 518 | Ga0268264_10575414 | 3300028381 | Bacteria | 1107 |
| 519 | Ga0265338_10131874 | 3300028800 | Bacteria | 1971 |
| 520 | Ga0265330_10017783 | 3300031235 | Bacteria | 3271 |
| 521 | Ga0265325_10000056 | 3300031241 | Bacteria | 77353 |
| 522 | Ga0265325_10009447 | 3300031241 | Bacteria | 5691 |
| 523 | Ga0265325_10011003 | 3300031241 | Bacteria | 5210 |
| 524 | Ga0265325_10134796 | 3300031241 | Bacteria | 1179 |
| 525 | Ga0265340_10021356 | 3300031247 | Bacteria | 3321 |
| 526 | Ga0265339_10001467 | 3300031249 | Bacteria | 17421 |
| 527 | Ga0265339_10069942 | 3300031249 | Bacteria | 1873 |
| 528 | Ga0265339_10191220 | 3300031249 | Bacteria | 1014 |
| 529 | Ga0265316_10022096 | 3300031344 | Bacteria | 5374 |
| 530 | Ga0265316_10046316 | 3300031344 | Bacteria | 3447 |
| 531 | Ga0265316_10108046 | 3300031344 | Bacteria | 2109 |
| 532 | Ga0265313_10002478 | 3300031595 | Bacteria | 15910 |
| 533 | Ga0265313_10019854 | 3300031595 | Bacteria | 3725 |
| 534 | Ga0265313_10034043 | 3300031595 | Bacteria | 2581 |
| 535 | Ga0265313_10047272 | 3300031595 | Bacteria | 2084 |
| 536 | Ga0265313_10136068 | 3300031595 | Bacteria | 1060 |
| 537 | Ga0316575_10082457 | 3300031665 | Bacteria | 1298 |
| 538 | Ga0265314_10000391 | 3300031711 | Bacteria | 59630 |
| 539 | Ga0265314_10015471 | 3300031711 | Bacteria | 6053 |
| 540 | Ga0265314_10111305 | 3300031711 | Bacteria | 1740 |
| 541 | Ga0265342_10000983 | 3300031712 | Bacteria | 28114 |
| 542 | Ga0307409_100689398 | 3300031995 | Bacteria | 1020 |
| 543 | Ga0373930_0000005 | 3300034816 | Bacteria | 25122 |
| 544 | Ga0373948_0000203 | 3300034817 | Bacteria | 6831 |
| 545 | Ga0373948_0006852 | 3300034817 | Bacteria | 1898 |
| 546 | Ga0373948_0021977 | 3300034817 | Bacteria | 1226 |
| 547 | Ga0373950_0000614 | 3300034818 | Bacteria | 4412 |
| 548 | Ga0373958_0000033 | 3300034819 | Bacteria | 13945 |
| 549 | Ga0373958_0000839 | 3300034819 | Bacteria | 3934 |
| 550 | Ga0373959_0000714 | 3300034820 | Bacteria | 5679 |
| 551 | Ga0373938_0000517 | 3300034957 | Bacteria | 6246 |
| 552 | Ga0373938_0002463 | 3300034957 | Bacteria | 2988 |
| 553 | Ga0373926_0028249 | 3300035083 | Bacteria | 1968 |
| 554 | Ga0373928_0000058 | 3300035084 | Bacteria | 19168 |
| 555 | Ga0373928_0002188 | 3300035084 | Bacteria | 3810 |
| 556 | Ga0373928_0003549 | 3300035084 | Bacteria | 2975 |
| 557 | Ga0373929_0000552 | 3300035085 | Bacteria | 7202 |
| 558 | Ga0373929_0008568 | 3300035085 | Bacteria | 1887 |
| 559 | Ga0373934_0057166 | 3300035086 | Bacteria | 1552 |
| 560 | Ga0373934_0072943 | 3300035086 | Bacteria | 1374 |
| 561 | Ga0373940_0001756 | 3300035088 | Bacteria | 4028 |
| 562 | Ga0373940_0007632 | 3300035088 | Bacteria | 2447 |
| 563 | Ga0373940_0013713 | 3300035088 | Bacteria | 1967 |
| 564 | Ga0373944_0006589 | 3300035089 | Bacteria | 3084 |
| 565 | Ga0373944_0053039 | 3300035089 | Bacteria | 1282 |
| 566 | Ga0373949_0002457 | 3300035090 | Bacteria | 4755 |
| 567 | Ga0373949_0015490 | 3300035090 | Bacteria | 1704 |
| 568 | Ga0373949_0027929 | 3300035090 | Bacteria | 1329 |
| 569 | Ga0373949_0032644 | 3300035090 | Bacteria | 1247 |
| 570 | Ga0373951_0002590 | 3300035091 | Bacteria | 4541 |
| 571 | Ga0373951_0049579 | 3300035091 | Bacteria | 1030 |
| 572 | Ga0373952_0002862 | 3300035092 | Bacteria | 3119 |
| 573 | Ga0373952_0003011 | 3300035092 | Bacteria | 3042 |
| 574 | Ga0373952_0004967 | 3300035092 | Bacteria | 2420 |
| 575 | Ga0373923_0019083 | 3300035111 | Bacteria | 2649 |
| 576 | Ga0373932_0000987 | 3300035112 | Bacteria | 8250 |
| 577 | Ga0373932_0003158 | 3300035112 | Bacteria | 4011 |
| 578 | Ga0373932_0003436 | 3300035112 | Bacteria | 3810 |
| 579 | Ga0373936_0010987 | 3300035113 | Bacteria | 3421 |
| 580 | Ga0373939_0000783 | 3300035114 | Bacteria | 7833 |
| 581 | Ga0373939_0001082 | 3300035114 | Bacteria | 6698 |
| 582 | Ga0373939_0002024 | 3300035114 | Bacteria | 4839 |
| 583 | Ga0373939_0008014 | 3300035114 | Bacteria | 2580 |
| 584 | Ga0373939_0010179 | 3300035114 | Bacteria | 2346 |
| 585 | Ga0373941_0000140 | 3300035115 | Bacteria | 12827 |
| 586 | Ga0373941_0003396 | 3300035115 | Bacteria | 3605 |
| 587 | Ga0373945_0077083 | 3300035116 | Bacteria | 1271 |
| 588 | Ga0373953_0022523 | 3300035117 | Bacteria | 2376 |
| 589 | Ga0373953_0139634 | 3300035117 | Bacteria | 1036 |
| 590 | Ga0373953_0195319 | 3300035117 | Bacteria | 875 |
| 591 | Ga0373954_0004912 | 3300035118 | Bacteria | 5772 |
| 592 | Ga0373954_0007317 | 3300035118 | Bacteria | 4828 |
| 593 | Ga0373956_0014602 | 3300035119 | Bacteria | 3283 |
| 594 | Ga0373956_0023059 | 3300035119 | Bacteria | 2668 |
| 595 | Ga0373956_0148111 | 3300035119 | Bacteria | 1104 |
| 596 | Ga0373957_0014554 | 3300035120 | Bacteria | 2691 |
| 597 | Ga0373957_0083530 | 3300035120 | Bacteria | 1263 |
| 598 | Ga0373957_0102114 | 3300035120 | Bacteria | 1149 |
| 599 | Ga0373960_0002027 | 3300035121 | Bacteria | 4553 |
| 600 | Ga0373960_0003110 | 3300035121 | Bacteria | 3747 |
| 601 | Ga0373960_0038885 | 3300035121 | Bacteria | 1366 |
| 602 | Ga0373943_0016382 | 3300035170 | Bacteria | 3379 |
| 603 | Ga0373943_0017942 | 3300035170 | Bacteria | 3245 |
| 604 | Ga0373946_0012607 | 3300035171 | Bacteria | 3167 |
| 605 | Ga0373946_0014256 | 3300035171 | Bacteria | 2996 |
| 606 | Ga0373955_0024171 | 3300035172 | Bacteria | 3104 |
| 607 | Ga0373955_0024957 | 3300035172 | Bacteria | 3063 |
| 608 | Ga0373955_0047108 | 3300035172 | Bacteria | 2333 |
| 609 | Ga0373955_0225138 | 3300035172 | Bacteria | 1121 |
| 610 | Ga0373942_0004650 | 3300035207 | Bacteria | 3180 |
| 611 | Ga0373942_0005098 | 3300035207 | Bacteria | 3046 |
| 612 | Ga0373942_0027485 | 3300035207 | Bacteria | 1480 |
| 613 | Ga0373961_0000385 | 3300035241 | Bacteria | 18617 |
| 614 | Ga0373961_0018927 | 3300035241 | Bacteria | 1803 |
| 615 | Ga0373961_0023941 | 3300035241 | Bacteria | 1647 |
| 616 | Ga0373962_0009009 | 3300035242 | Bacteria | 2464 |
| 617 | Ga0373962_0011063 | 3300035242 | Bacteria | 2256 |
| 618 | Ga0373962_0013150 | 3300035242 | Bacteria | 2092 |
| 619 | Ga0373924_0003869 | 3300035410 | Bacteria | 5186 |
| 620 | Ga0373924_0014049 | 3300035410 | Bacteria | 3020 |
| 621 | Ga0373931_0000130 | 3300035691 | Bacteria | 34420 |
| 622 | Ga0373931_0003847 | 3300035691 | Bacteria | 6785 |
| 623 | Ga0373931_0011865 | 3300035691 | Bacteria | 4213 |
| 624 | Ga0373931_0242563 | 3300035691 | Bacteria | 1093 |
| 625 | Ga0373935_0003155 | 3300035692 | Bacteria | 9507 |
| 626 | Ga0373935_0030530 | 3300035692 | Bacteria | 3341 |
| 627 | Ga0373935_0284115 | 3300035692 | Bacteria | 1165 |
| 628 | Ga0373935_0311701 | 3300035692 | Bacteria | 1114 |
| 629 | Ga0373935_0556600 | 3300035692 | Bacteria | 836 |
| 630 | Ga0373927_0004274 | 3300035695 | Bacteria | 10029 |
| 631 | Ga0373933_0005885 | 3300035724 | Bacteria | 6669 |
| 632 | Ga0373933_0013244 | 3300035724 | Bacteria | 4568 |
| 633 | Ga0373933_0087116 | 3300035724 | Bacteria | 1923 |
| 634 | Ga0373933_0127897 | 3300035724 | Bacteria | 1595 |
| 635 | Ga0373947_0004749 | 3300035725 | Bacteria | 7968 |
| 636 | Ga0373947_0111730 | 3300035725 | Bacteria | 1727 |
| 637 | Ga0373937_0010450 | 3300036401 | Bacteria | 8105 |
| 638 | Ga0373937_0016552 | 3300036401 | Bacteria | 6548 |
| 639 | Ga0373937_0029083 | 3300036401 | Bacteria | 5003 |
| 640 | Ga0373937_0125919 | 3300036401 | Bacteria | 2390 |
| 641 | Ga0373937_0205189 | 3300036401 | Bacteria | 1853 |
| 642 | Ga0373937_0264040 | 3300036401 | Bacteria | 1624 |
| 643 | Ga0373937_0288143 | 3300036401 | Bacteria | 1551 |
| 644 | Ga0373925_0001412 | 3300037068 | Bacteria | 20860 |
| 645 | Ga0373925_0400974 | 3300037068 | Bacteria | 1119 |
| 646 | Ga0242420_008710 | 3300038996 | Bacteria | 1652 |
| 647 | Ga0436365_1153613 | 3300039437 | Bacteria | 1226 |
| 648 | Ga0436365_1291451 | 3300039437 | Bacteria | 2194 |
| 649 | Ga0439453_0000724 | 3300041408 | Bacteria | 3817 |
| 650 | Ga0439441_028274 | 3300042001 | Bacteria | 1074 |
| 651 | Ga0439463_007316 | 3300042016 | Bacteria | 2728 |
| 652 | Ga0439446_0070335 | 3300042156 | Bacteria | 1070 |
| 653 | Ga0439434_0049585 | 3300042435 | Bacteria | 1300 |
| 654 | Ga0439435_0020743 | 3300042436 | Bacteria | 1698 |
| 655 | Ga0439459_0009621 | 3300042438 | Bacteria | 1673 |
| 656 | Ga0439464_0025431 | 3300042439 | Bacteria | 1639 |
| 657 | Ga0439460_0021792 | 3300042461 | Bacteria | 1754 |
| 658 | Ga0439460_0032851 | 3300042461 | Bacteria | 1489 |
| 659 | Ga0451577_0076456 | 3300042876 | Bacteria | 2985 |
| 660 | Ga0453684_0045660 | 3300044712 | Bacteria | 5839 |
| 661 | Ga0451576_0005933 | 3300045051 | Bacteria | 15133 |
| 662 | Ga0495617_009209 | 3300046452 | Bacteria | 3393 |
| 663 | Ga0495592_0007579 | 3300046454 | Bacteria | 8126 |
| 664 | Ga0495592_0016926 | 3300046454 | Bacteria | 5535 |
| 665 | Ga0495592_0079259 | 3300046454 | Bacteria | 2377 |
| 666 | Ga0495603_0010367 | 3300046455 | Bacteria | 5641 |
| 667 | Ga0495603_0021414 | 3300046455 | Bacteria | 3915 |
| 668 | Ga0495603_0116140 | 3300046455 | Bacteria | 1560 |
| 669 | Ga0495629_0000909 | 3300046459 | Bacteria | 23761 |
| 670 | Ga0495629_0056541 | 3300046459 | Bacteria | 2743 |
| 671 | Ga0495629_0095300 | 3300046459 | Bacteria | 2076 |
| 672 | Ga0495641_0015089 | 3300046461 | Bacteria | 4148 |
| 673 | Ga0495641_0036557 | 3300046461 | Bacteria | 2307 |
| 674 | Ga0495651_0002035 | 3300046462 | Bacteria | 15618 |
| 675 | Ga0495651_0008748 | 3300046462 | Bacteria | 7766 |
| 676 | Ga0495651_0011644 | 3300046462 | Bacteria | 6762 |
| 677 | Ga0495651_0065926 | 3300046462 | Bacteria | 2765 |
| 678 | Ga0495651_0076302 | 3300046462 | Bacteria | 2539 |
| 679 | Ga0495651_0495623 | 3300046462 | Bacteria | 783 |
| 680 | Ga0495653_0027062 | 3300046463 | Bacteria | 4592 |
| 681 | Ga0495653_0029649 | 3300046463 | Bacteria | 4365 |
| 682 | Ga0495653_0054179 | 3300046463 | Bacteria | 3066 |
| 683 | Ga0495653_0057670 | 3300046463 | Bacteria | 2954 |
| 684 | Ga0495653_0207867 | 3300046463 | Bacteria | 1324 |
| 685 | Ga0495580_0088609 | 3300046472 | Bacteria | 2155 |
| 686 | Ga0495580_0145924 | 3300046472 | Bacteria | 1640 |
| 687 | Ga0495582_0002021 | 3300046473 | Bacteria | 11367 |
| 688 | Ga0495582_0002597 | 3300046473 | Bacteria | 10047 |
| 689 | Ga0495605_0032808 | 3300046474 | Bacteria | 2641 |
| 690 | Ga0495639_0006208 | 3300046475 | Bacteria | 5131 |
| 691 | Ga0495662_0043060 | 3300046476 | Bacteria | 2179 |
| 692 | Ga0495662_0154713 | 3300046476 | Bacteria | 1129 |
| 693 | Ga0495664_0007311 | 3300046477 | Bacteria | 6128 |
| 694 | Ga0495664_0023714 | 3300046477 | Bacteria | 3561 |
| 695 | Ga0495664_0032029 | 3300046477 | Bacteria | 3083 |
| 696 | Ga0495664_0057905 | 3300046477 | Bacteria | 2305 |
| 697 | Ga0495584_0004152 | 3300046491 | Bacteria | 7819 |
| 698 | Ga0495585_0000856 | 3300046492 | Bacteria | 26041 |
| 699 | Ga0495594_0161848 | 3300046499 | Bacteria | 1272 |
| 700 | Ga0495594_0253507 | 3300046499 | Bacteria | 1002 |
| 701 | Ga0495607_0001563 | 3300046501 | Bacteria | 20034 |
| 702 | Ga0495608_0000915 | 3300046511 | Bacteria | 20676 |
| 703 | Ga0495608_0025614 | 3300046511 | Bacteria | 4027 |
| 704 | Ga0495608_0029844 | 3300046511 | Bacteria | 3696 |
| 705 | Ga0495618_0024462 | 3300046514 | Bacteria | 3740 |
| 706 | Ga0495618_0056529 | 3300046514 | Bacteria | 2484 |
| 707 | Ga0495618_0178095 | 3300046514 | Bacteria | 1351 |
| 708 | Ga0495618_0223002 | 3300046514 | Bacteria | 1189 |
| 709 | Ga0495628_0010424 | 3300046516 | Bacteria | 7895 |
| 710 | Ga0495628_0020944 | 3300046516 | Bacteria | 5385 |
| 711 | Ga0495628_0049175 | 3300046516 | Bacteria | 3339 |
| 712 | Ga0495628_0076288 | 3300046516 | Bacteria | 2609 |
| 713 | Ga0495630_0083103 | 3300046517 | Bacteria | 2417 |
| 714 | Ga0495630_0193891 | 3300046517 | Bacteria | 1550 |
| 715 | Ga0495630_0286970 | 3300046517 | Bacteria | 1257 |
| 716 | Ga0495637_0008444 | 3300046520 | Bacteria | 5058 |
| 717 | Ga0495637_0022486 | 3300046520 | Bacteria | 2875 |
| 718 | Ga0495644_0000392 | 3300046523 | Bacteria | 19644 |
| 719 | Ga0495663_0016049 | 3300046525 | Bacteria | 2115 |
| 720 | Ga0495666_0105934 | 3300046526 | Bacteria | 1323 |
| 721 | Ga0495652_0009116 | 3300046529 | Bacteria | 9030 |
| 722 | Ga0495652_0020953 | 3300046529 | Bacteria | 5810 |
| 723 | Ga0495652_0197711 | 3300046529 | Bacteria | 1528 |
| 724 | Ga0495665_0003663 | 3300046531 | Bacteria | 8332 |
| 725 | Ga0495665_0027096 | 3300046531 | Bacteria | 3076 |
| 726 | Ga0495640_0029737 | 3300046533 | Bacteria | 3918 |
| 727 | Ga0495640_0037750 | 3300046533 | Bacteria | 3403 |
| 728 | Ga0495640_0172767 | 3300046533 | Bacteria | 1380 |
| 729 | Ga0495586_0032773 | 3300046535 | Bacteria | 2787 |
| 730 | Ga0495587_0001734 | 3300046536 | Bacteria | 14559 |
| 731 | Ga0495587_0011728 | 3300046536 | Bacteria | 5546 |
| 732 | Ga0495587_0029163 | 3300046536 | Bacteria | 3351 |
| 733 | Ga0495598_0001967 | 3300046537 | Bacteria | 4173 |
| 734 | Ga0495645_0004078 | 3300046543 | Bacteria | 9978 |
| 735 | Ga0495645_0004983 | 3300046543 | Bacteria | 9095 |
| 736 | Ga0495633_0000645 | 3300046558 | Bacteria | 32436 |
| 737 | Ga0495667_0000259 | 3300046559 | Bacteria | 34280 |
| 738 | Ga0495667_0015414 | 3300046559 | Bacteria | 5163 |
| 739 | Ga0495656_0000157 | 3300046615 | Bacteria | 24846 |
| 740 | Ga0495634_0068575 | 3300046642 | Bacteria | 2342 |
| 741 | Ga0495634_0083127 | 3300046642 | Bacteria | 2090 |
| 742 | Ga0495634_0201345 | 3300046642 | Bacteria | 1237 |
| 743 | Ga0495611_0001997 | 3300046648 | Bacteria | 9664 |
| 744 | Ga0495635_0004119 | 3300046663 | Bacteria | 10079 |
| 745 | Ga0495635_0026839 | 3300046663 | Bacteria | 4006 |
| 746 | Ga0495635_0113751 | 3300046663 | Bacteria | 1847 |
| 747 | Ga0495635_0161557 | 3300046663 | Bacteria | 1525 |
| 748 | Ga0495659_0000900 | 3300046664 | Bacteria | 10589 |
| 749 | Ga0495588_0010993 | 3300046674 | Bacteria | 4235 |
| 750 | Ga0495657_0003179 | 3300046675 | Bacteria | 13534 |
| 751 | Ga0495657_0071813 | 3300046675 | Bacteria | 2259 |
| 752 | Ga0495599_0008671 | 3300046678 | Bacteria | 6189 |
| 753 | Ga0495599_0153235 | 3300046678 | Bacteria | 1426 |
| 754 | Ga0495599_0192724 | 3300046678 | Bacteria | 1253 |
| 755 | Ga0495599_0409653 | 3300046678 | Bacteria | 806 |
| 756 | Ga0495623_0000981 | 3300046679 | Bacteria | 19240 |
| 757 | Ga0495623_0089382 | 3300046679 | Bacteria | 1893 |
| 758 | Ga0495623_0191642 | 3300046679 | Bacteria | 1181 |
| 759 | Ga0495646_0001919 | 3300046680 | Bacteria | 12501 |
| 760 | Ga0495646_0035551 | 3300046680 | Bacteria | 3090 |
| 761 | Ga0495646_0050547 | 3300046680 | Bacteria | 2519 |
| 762 | Ga0495647_0005796 | 3300046681 | Bacteria | 4064 |
| 763 | Ga0495647_0039154 | 3300046681 | Bacteria | 1795 |
| 764 | Ga0495647_0078828 | 3300046681 | Bacteria | 1332 |
| 765 | Ga0495658_0000360 | 3300046683 | Bacteria | 25675 |
| 766 | Ga0495658_0024624 | 3300046683 | Bacteria | 3207 |
| 767 | Ga0495669_0076118 | 3300046684 | Bacteria | 1536 |
| 768 | Ga0495613_0018760 | 3300046689 | Bacteria | 5156 |
| 769 | Ga0495613_0052318 | 3300046689 | Bacteria | 3008 |
| 770 | Ga0495613_0167337 | 3300046689 | Bacteria | 1561 |
| 771 | Ga0495624_0007588 | 3300046690 | Bacteria | 7613 |
| 772 | Ga0495624_0058845 | 3300046690 | Bacteria | 2412 |
| 773 | Ga0495624_0064121 | 3300046690 | Bacteria | 2296 |
| 774 | Ga0495670_0000213 | 3300046691 | Bacteria | 26531 |
| 775 | Ga0495600_0014240 | 3300046809 | Bacteria | 5011 |
| 776 | Ga0495600_0022131 | 3300046809 | Bacteria | 4079 |
| 777 | Ga0495600_0023157 | 3300046809 | Bacteria | 3994 |
| 778 | Ga0495581_0012254 | 3300047315 | Bacteria | 4966 |
| 779 | Ga0495581_0086801 | 3300047315 | Bacteria | 1814 |
| 780 | Ga0495581_0087282 | 3300047315 | Bacteria | 1808 |
| 781 | Ga0495604_0001954 | 3300047317 | Bacteria | 16634 |
| 782 | Ga0495604_0008955 | 3300047317 | Bacteria | 7912 |
| 783 | Ga0495604_0034057 | 3300047317 | Bacteria | 4030 |
| 784 | Ga0495674_0010262 | 3300047319 | Bacteria | 8870 |
| 785 | Ga0495674_0022491 | 3300047319 | Bacteria | 5815 |
| 786 | Ga0495674_0099970 | 3300047319 | Bacteria | 2469 |
| 787 | Ga0495676_0035234 | 3300047321 | Bacteria | 4188 |
| 788 | Ga0495676_0197971 | 3300047321 | Bacteria | 1397 |
| 789 | Ga0495680_0002446 | 3300047322 | Bacteria | 19009 |
| 790 | Ga0495680_0009264 | 3300047322 | Bacteria | 8869 |
| 791 | Ga0495680_0043847 | 3300047322 | Bacteria | 3539 |
| 792 | Ga0495680_0051002 | 3300047322 | Bacteria | 3233 |
| 793 | Ga0495680_0064647 | 3300047322 | Bacteria | 2805 |
| 794 | Ga0495680_0136516 | 3300047322 | Bacteria | 1798 |
| 795 | Ga0495675_0000147 | 3300047444 | Bacteria | 49274 |
| 796 | Ga0495675_0006699 | 3300047444 | Bacteria | 7061 |
| 797 | Ga0495679_040117 | 3300047446 | Bacteria | 1457 |
| 798 | Ga0495684_0005638 | 3300047471 | Bacteria | 9754 |
| 799 | Ga0495684_0063016 | 3300047471 | Bacteria | 2819 |
| 800 | Ga0495593_0004620 | 3300047673 | Bacteria | 8183 |
| 801 | Ga0495593_0020466 | 3300047673 | Bacteria | 3705 |
| 802 | Ga0495593_0071695 | 3300047673 | Bacteria | 1799 |
| 803 | Ga0495593_0080949 | 3300047673 | Bacteria | 1679 |
| 804 | Ga0495602_0002613 | 3300048088 | Bacteria | 18403 |
| 805 | Ga0495602_0005981 | 3300048088 | Bacteria | 12776 |
| 806 | Ga0495602_0071405 | 3300048088 | Bacteria | 2965 |
| 807 | Ga0495614_0006737 | 3300048089 | Bacteria | 5142 |
| 808 | Ga0495614_0201846 | 3300048089 | Bacteria | 900 |
| 809 | Ga0495615_0037975 | 3300048090 | Bacteria | 1189 |
| 810 | Ga0496100_0001667 | 3300048903 | Bacteria | 11014 |
| 811 | Ga0496100_0012737 | 3300048903 | Bacteria | 4833 |
| 812 | Ga0496100_0062922 | 3300048903 | Bacteria | 2450 |
| 813 | Ga0496100_0153159 | 3300048903 | Bacteria | 1646 |
| 814 | Ga0496100_0200409 | 3300048903 | Bacteria | 1454 |
| 815 | Ga0496100_0295865 | 3300048903 | Bacteria | 1210 |
| 816 | Ga0496100_0297824 | 3300048903 | Bacteria | 1206 |
| 817 | Ga0496101_0000079 | 3300048904 | Bacteria | 107673 |
| 818 | Ga0496101_0016662 | 3300048904 | Bacteria | 4971 |
| 819 | Ga0496101_0070024 | 3300048904 | Bacteria | 2567 |
| 820 | Ga0496101_0135932 | 3300048904 | Bacteria | 1870 |
| 821 | Ga0496101_0161750 | 3300048904 | Bacteria | 1717 |
| 822 | Ga0496101_0207427 | 3300048904 | Bacteria | 1517 |
| 823 | Ga0496101_0351400 | 3300048904 | Bacteria | 1158 |
| 824 | Ga0496102_0004410 | 3300048905 | Bacteria | 11888 |
| 825 | Ga0496102_0104825 | 3300048905 | Bacteria | 2630 |
| 826 | Ga0496102_0108844 | 3300048905 | Bacteria | 2581 |
| 827 | Ga0496102_0203216 | 3300048905 | Bacteria | 1867 |
| 828 | Ga0496102_0279436 | 3300048905 | Bacteria | 1574 |
| 829 | Ga0496102_0453830 | 3300048905 | Bacteria | 1202 |
| 830 | Ga0496103_0003888 | 3300048906 | Bacteria | 9088 |
| 831 | Ga0496103_0082312 | 3300048906 | Bacteria | 2025 |
| 832 | Ga0496103_0083312 | 3300048906 | Bacteria | 2013 |
| 833 | Ga0496103_0112186 | 3300048906 | Bacteria | 1732 |
| 834 | Ga0496104_0000203 | 3300048907 | Bacteria | 53173 |
| 835 | Ga0496104_0050199 | 3300048907 | Bacteria | 3936 |
| 836 | Ga0496104_0135318 | 3300048907 | Bacteria | 2367 |
| 837 | Ga0496104_0150281 | 3300048907 | Bacteria | 2236 |
| 838 | Ga0496104_0197580 | 3300048907 | Bacteria | 1923 |
| 839 | Ga0496104_0256749 | 3300048907 | Bacteria | 1660 |
| 840 | Ga0496104_0262828 | 3300048907 | Bacteria | 1638 |
| 841 | Ga0496104_0368696 | 3300048907 | Bacteria | 1348 |
| 842 | Ga0496105_0000378 | 3300048908 | Bacteria | 29328 |
| 843 | Ga0496105_0014937 | 3300048908 | Bacteria | 6181 |
| 844 | Ga0496105_0060404 | 3300048908 | Bacteria | 3128 |
| 845 | Ga0496105_0079013 | 3300048908 | Bacteria | 2716 |
| 846 | Ga0496105_0111416 | 3300048908 | Bacteria | 2258 |
| 847 | Ga0496105_0239347 | 3300048908 | Bacteria | 1473 |
| 848 | Ga0496106_0030064 | 3300048909 | Bacteria | 4050 |
| 849 | Ga0496106_0041579 | 3300048909 | Bacteria | 3444 |
| 850 | Ga0496106_0120142 | 3300048909 | Bacteria | 2053 |
| 851 | Ga0496106_0197745 | 3300048909 | Bacteria | 1599 |
| 852 | Ga0496106_0335187 | 3300048909 | Bacteria | 1214 |
| 853 | Ga0496107_0020541 | 3300048910 | Bacteria | 4666 |
| 854 | Ga0496107_0023690 | 3300048910 | Bacteria | 4339 |
| 855 | Ga0496107_0025593 | 3300048910 | Bacteria | 4178 |
| 856 | Ga0496107_0056439 | 3300048910 | Bacteria | 2837 |
| 857 | Ga0496107_0071064 | 3300048910 | Bacteria | 2528 |
| 858 | Ga0496107_0443439 | 3300048910 | Bacteria | 964 |
| 859 | Ga0496107_0464350 | 3300048910 | Bacteria | 940 |
| 860 | Ga0496107_0512662 | 3300048910 | Bacteria | 889 |
| 861 | Ga0496108_0005809 | 3300048911 | Bacteria | 10002 |
| 862 | Ga0496108_0081425 | 3300048911 | Bacteria | 2743 |
| 863 | Ga0496108_0087944 | 3300048911 | Bacteria | 2639 |
| 864 | Ga0496108_0118736 | 3300048911 | Unclassified | 2267 |
| 865 | Ga0496108_0138143 | 3300048911 | Bacteria | 2098 |
| 866 | Ga0496108_0312417 | 3300048911 | Bacteria | 1369 |
| 867 | Ga0496109_0000223 | 3300048912 | Bacteria | 56008 |
| 868 | Ga0496109_0050643 | 3300048912 | Bacteria | 3782 |
| 869 | Ga0496109_0062821 | 3300048912 | Bacteria | 3396 |
| 870 | Ga0496110_0005653 | 3300048913 | Bacteria | 9810 |
| 871 | Ga0496110_0133133 | 3300048913 | Bacteria | 2245 |
| 872 | Ga0496110_0136904 | 3300048913 | Bacteria | 2213 |
| 873 | Ga0496110_0210296 | 3300048913 | Bacteria | 1768 |
| 874 | Ga0496111_0007705 | 3300048914 | Bacteria | 7081 |
| 875 | Ga0496111_0042491 | 3300048914 | Bacteria | 3264 |
| 876 | Ga0496111_0074829 | 3300048914 | Bacteria | 2467 |
| 877 | Ga0496111_0120204 | 3300048914 | Bacteria | 1940 |
| 878 | Ga0496112_0055975 | 3300048915 | Bacteria | 3881 |
| 879 | Ga0496112_0088107 | 3300048915 | Bacteria | 3071 |
| 880 | Ga0496112_0091895 | 3300048915 | Bacteria | 3004 |
| 881 | Ga0496112_0167574 | 3300048915 | Bacteria | 2162 |
| 882 | Ga0496112_0756676 | 3300048915 | Bacteria | 897 |
| 883 | Ga0496113_0000624 | 3300048916 | Bacteria | 17779 |
| 884 | Ga0496113_0066235 | 3300048916 | Bacteria | 2735 |
| 885 | Ga0496113_0067511 | 3300048916 | Bacteria | 2711 |
| 886 | Ga0496113_0233293 | 3300048916 | Bacteria | 1467 |
| 887 | Ga0496113_0311774 | 3300048916 | Bacteria | 1260 |
| 888 | Ga0496114_0010254 | 3300048917 | Bacteria | 7456 |
| 889 | Ga0496114_0158527 | 3300048917 | Bacteria | 1966 |
| 890 | Ga0496114_0198527 | 3300048917 | Bacteria | 1756 |
| 891 | Ga0496115_0001792 | 3300048918 | Bacteria | 15386 |
| 892 | Ga0496115_0048404 | 3300048918 | Bacteria | 3400 |
| 893 | Ga0496115_0103501 | 3300048918 | Bacteria | 2335 |
| 894 | Ga0496115_0105890 | 3300048918 | Bacteria | 2308 |
| 895 | Ga0496115_0159920 | 3300048918 | Bacteria | 1861 |
| 896 | Ga0496115_0216170 | 3300048918 | Bacteria | 1582 |
| 897 | Ga0496126_0287700 | 3300048929 | Bacteria | 1360 |
| 898 | Ga0501031_0007895 | 3300049568 | Bacteria | 6926 |
| 899 | Ga0501031_0378836 | 3300049568 | Bacteria | 915 |
| 900 | Ga0501032_0066398 | 3300049569 | Bacteria | 2410 |
| 901 | Ga0501032_0099488 | 3300049569 | Bacteria | 1926 |
| 902 | Ga0501032_0117291 | 3300049569 | Bacteria | 1760 |
| 903 | Ga0501033_0016242 | 3300049570 | Bacteria | 5638 |
| 904 | Ga0501033_0276620 | 3300049570 | Bacteria | 1186 |
| 905 | Ga0501033_0322022 | 3300049570 | Bacteria | 1086 |
| 906 | Ga0501034_0000089 | 3300049571 | Bacteria | 165644 |
| 907 | Ga0501034_0006479 | 3300049571 | Bacteria | 12605 |
| 908 | Ga0501034_0089671 | 3300049571 | Bacteria | 3073 |
| 909 | Ga0501034_0118791 | 3300049571 | Bacteria | 2630 |
| 910 | Ga0501034_0171836 | 3300049571 | Bacteria | 2134 |
| 911 | Ga0501036_0004689 | 3300049572 | Bacteria | 11039 |
| 912 | Ga0501036_0013953 | 3300049572 | Bacteria | 6680 |
| 913 | Ga0501036_0030377 | 3300049572 | Bacteria | 4564 |
| 914 | Ga0501036_0198071 | 3300049572 | Bacteria | 1689 |
| 915 | Ga0501037_0013965 | 3300049573 | Bacteria | 5918 |
| 916 | Ga0501037_0018777 | 3300049573 | Bacteria | 5094 |
| 917 | Ga0501037_0049478 | 3300049573 | Bacteria | 3077 |
| 918 | Ga0501037_0157760 | 3300049573 | Bacteria | 1618 |
| 919 | Ga0501037_0227615 | 3300049573 | Bacteria | 1310 |
| 920 | Ga0501038_0008360 | 3300049574 | Bacteria | 9518 |
| 921 | Ga0501038_0222223 | 3300049574 | Bacteria | 1506 |
| 922 | Ga0501039_0005535 | 3300049575 | Bacteria | 9560 |
| 923 | Ga0501039_0148448 | 3300049575 | Bacteria | 1842 |
| 924 | Ga0501042_0065144 | 3300049578 | Bacteria | 2604 |
| 925 | Ga0501043_0001206 | 3300049579 | Bacteria | 22752 |
| 926 | Ga0501043_0024663 | 3300049579 | Bacteria | 4716 |
| 927 | Ga0501043_0030112 | 3300049579 | Bacteria | 4263 |
| 928 | Ga0501043_0049829 | 3300049579 | Bacteria | 3292 |
| 929 | Ga0501043_0065943 | 3300049579 | Bacteria | 2843 |
| 930 | Ga0501046_0019306 | 3300049580 | Bacteria | 5655 |
| 931 | Ga0501046_0076895 | 3300049580 | Bacteria | 2585 |
| 932 | Ga0501046_0179586 | 3300049580 | Bacteria | 1583 |
| 933 | Ga0501046_0223038 | 3300049580 | Bacteria | 1395 |
| 934 | Ga0501046_0296148 | 3300049580 | Bacteria | 1182 |
| 935 | Ga0501047_0000108 | 3300049581 | Bacteria | 101252 |
| 936 | Ga0501047_0030345 | 3300049581 | Bacteria | 5212 |
| 937 | Ga0501047_0059519 | 3300049581 | Bacteria | 3687 |
| 938 | Ga0501047_0563196 | 3300049581 | Bacteria | 963 |
| 939 | Ga0501048_0000493 | 3300049582 | Bacteria | 27551 |
| 940 | Ga0501048_0112368 | 3300049582 | Bacteria | 1924 |
| 941 | Ga0501048_0300827 | 3300049582 | Bacteria | 1141 |
| 942 | Ga0501067_0002851 | 3300049583 | Bacteria | 9519 |
| 943 | Ga0501067_0045338 | 3300049583 | Bacteria | 2442 |
| 944 | Ga0501068_0007207 | 3300049584 | Bacteria | 6157 |
| 945 | Ga0501068_0062789 | 3300049584 | Bacteria | 2259 |
| 946 | Ga0501068_0232858 | 3300049584 | Bacteria | 1171 |
| 947 | Ga0501069_0004416 | 3300049585 | Bacteria | 7261 |
| 948 | Ga0501069_0051175 | 3300049585 | Bacteria | 2298 |
| 949 | Ga0501069_0083524 | 3300049585 | Bacteria | 1800 |
| 950 | Ga0501070_0030292 | 3300049586 | Bacteria | 4533 |
| 951 | Ga0501070_0031929 | 3300049586 | Bacteria | 4410 |
| 952 | Ga0501070_0056871 | 3300049586 | Bacteria | 3242 |
| 953 | Ga0501070_0072072 | 3300049586 | Bacteria | 2860 |
| 954 | Ga0501070_0155493 | 3300049586 | Bacteria | 1885 |
| 955 | Ga0501070_0429390 | 3300049586 | Bacteria | 1066 |
| 956 | Ga0501071_0080378 | 3300049587 | Bacteria | 2383 |
| 957 | Ga0501072_0281738 | 3300049588 | Bacteria | 1322 |
| 958 | Ga0501073_0010473 | 3300049589 | Bacteria | 6797 |
| 959 | Ga0501073_0028323 | 3300049589 | Bacteria | 4003 |
| 960 | Ga0501073_0035595 | 3300049589 | Bacteria | 3537 |
| 961 | Ga0501073_0049083 | 3300049589 | Bacteria | 2961 |
| 962 | Ga0501073_0051395 | 3300049589 | Bacteria | 2887 |
| 963 | Ga0501073_0424498 | 3300049589 | Bacteria | 919 |
| 964 | Ga0501074_0001683 | 3300049590 | Bacteria | 15063 |
| 965 | Ga0501074_0035388 | 3300049590 | Bacteria | 3618 |
| 966 | Ga0501074_0046011 | 3300049590 | Bacteria | 3155 |
| 967 | Ga0501076_0448358 | 3300049592 | Bacteria | 1062 |
| 968 | Ga0501079_0022593 | 3300049741 | Bacteria | 4824 |
| 969 | Ga0501079_0072864 | 3300049741 | Bacteria | 2655 |
| 970 | Ga0501079_0129243 | 3300049741 | Bacteria | 1966 |
| 971 | Ga0501079_0165326 | 3300049741 | Bacteria | 1725 |
| 972 | Ga0501079_0206364 | 3300049741 | Bacteria | 1535 |
| 973 | Ga0501080_0003238 | 3300049742 | Bacteria | 14365 |
| 974 | Ga0501080_0033446 | 3300049742 | Bacteria | 4798 |
| 975 | Ga0501080_0120932 | 3300049742 | Bacteria | 2426 |
| 976 | Ga0501080_0172727 | 3300049742 | Bacteria | 1992 |
| 977 | Ga0501083_0002587 | 3300049744 | Bacteria | 12452 |
| 978 | Ga0501083_0007793 | 3300049744 | Bacteria | 7587 |
| 979 | Ga0501083_0041181 | 3300049744 | Bacteria | 3133 |
| 980 | Ga0501083_0120675 | 3300049744 | Bacteria | 1719 |
| 981 | Ga0501035_0002622 | 3300049822 | Bacteria | 17526 |
| 982 | Ga0501035_0121335 | 3300049822 | Bacteria | 2284 |
| 983 | Ga0501035_0222290 | 3300049822 | Bacteria | 1612 |
| 984 | Ga0501035_0263789 | 3300049822 | Bacteria | 1459 |
| 985 | Ga0501035_0760810 | 3300049822 | Bacteria | 777 |
| 986 | Ga0501044_0000998 | 3300049823 | Bacteria | 34042 |
| 987 | Ga0501044_0059613 | 3300049823 | Bacteria | 3910 |
| 988 | Ga0501044_0101735 | 3300049823 | Bacteria | 2890 |
| 989 | Ga0501044_0193784 | 3300049823 | Bacteria | 1993 |
| 990 | Ga0501044_0221669 | 3300049823 | Bacteria | 1842 |
| 991 | Ga0501044_0589927 | 3300049823 | Bacteria | 1005 |
| 992 | Ga0501045_0037222 | 3300049824 | Bacteria | 3536 |
| 993 | Ga0501045_0267485 | 3300049824 | Bacteria | 1273 |
| 994 | nmdc:mga0yw44_158748_c1 | 3300050492 | Bacteria | 1479 |
| 995 | nmdc:mga0k408_30249_c1 | 3300050493 | Bacteria | 1432 |
| 996 | nmdc:mga06z11_93342_c1 | 3300050494 | Bacteria | 1638 |
| 997 | nmdc:mga05p37_111_c1 | 3300050507 | Bacteria | 32778 |
| 998 | nmdc:mga05p37_64417_c1 | 3300050507 | Bacteria | 4511 |
| 999 | nmdc:mga09592_519_c1 | 3300050508 | Bacteria | 29199 |
| 1000 | nmdc:mga0qj67_5814_c1 | 3300050509 | Bacteria | 9027 |
| 1001 | nmdc:mga06r32_3010_c1 | 3300050510 | Bacteria | 15094 |
| 1002 | nmdc:mga08y16_11075_c1 | 3300050511 | Bacteria | 9469 |
| 1003 | nmdc:mga08y16_223100_c1 | 3300050511 | Bacteria | 1951 |
| 1004 | nmdc:mga08y16_59876_c1 | 3300050511 | Bacteria | 3978 |
| 1005 | nmdc:mga08y16_82929_c1 | 3300050511 | Bacteria | 3342 |
| 1006 | nmdc:mga0n895_2911_c1 | 3300050512 | Bacteria | 13576 |
| 1007 | nmdc:mga0n895_497_c1 | 3300050512 | Bacteria | 26681 |
| 1008 | nmdc:mga0n895_52554_c1 | 3300050512 | Bacteria | 4000 |
| 1009 | nmdc:mga0n895_6865_c1 | 3300050512 | Bacteria | 9722 |
| 1010 | nmdc:mga0rr50_636_c1 | 3300050513 | Bacteria | 18874 |
| 1011 | nmdc:mga0rr50_702502_c1 | 3300050513 | Bacteria | 863 |
| 1012 | nmdc:mga08x19_183599_c1 | 3300050514 | Bacteria | 1429 |
| 1013 | nmdc:mga08x19_197544_c1 | 3300050514 | Bacteria | 1378 |
| 1014 | nmdc:mga08x19_436421_c1 | 3300050514 | Unclassified | 921 |
| 1015 | nmdc:mga0a205_269192_c1 | 3300050515 | Bacteria | 1581 |
| 1016 | nmdc:mga0a205_5029_c1 | 3300050515 | Bacteria | 11910 |
| 1017 | nmdc:mga0a205_50_c1 | 3300050515 | Bacteria | 64126 |
| 1018 | Ga0495601_0000259 | 3300053077 | Bacteria | 28526 |
| 1019 | Ga0495601_0002525 | 3300053077 | Bacteria | 10410 |
| 1020 | Ga0495601_0004827 | 3300053077 | Bacteria | 7817 |
| 1021 | Ga0495601_0059824 | 3300053077 | Bacteria | 2416 |
| 1022 | Ga0495601_0196120 | 3300053077 | Bacteria | 1320 |
| 1023 | Ga0495612_0000173 | 3300053078 | Bacteria | 27147 |
| 1024 | Ga0495612_0005298 | 3300053078 | Bacteria | 5327 |
| 1025 | Ga0495612_0005917 | 3300053078 | Bacteria | 5042 |
| 1026 | Ga0495612_0010418 | 3300053078 | Bacteria | 3758 |
| 1027 | Ga0495612_0017601 | 3300053078 | Bacteria | 2860 |
| 1028 | Ga0495612_0213992 | 3300053078 | Bacteria | 852 |
| 1029 | Ga0495595_0002058 | 3300053084 | Bacteria | 7825 |
| 1030 | Ga0495595_0005278 | 3300053084 | Bacteria | 5224 |
| 1031 | Ga0495595_0009740 | 3300053084 | Bacteria | 3980 |
| 1032 | Ga0495595_0011900 | 3300053084 | Bacteria | 3646 |
| 1033 | Ga0495595_0117609 | 3300053084 | Bacteria | 1293 |
| 1034 | Ga0495595_0131756 | 3300053084 | Bacteria | 1222 |
| 1035 | Ga0495619_0000132 | 3300053085 | Bacteria | 55452 |
| 1036 | Ga0495619_0000178 | 3300053085 | Bacteria | 46773 |
| 1037 | Ga0495619_0001228 | 3300053085 | Bacteria | 16765 |
| 1038 | Ga0495619_0004954 | 3300053085 | Bacteria | 8458 |
| 1039 | Ga0495619_0023258 | 3300053085 | Bacteria | 3971 |
| 1040 | Ga0495619_0032913 | 3300053085 | Bacteria | 3365 |
| 1041 | Ga0495619_0261479 | 3300053085 | Bacteria | 1199 |
| 1042 | Ga0500641_0000709 | 3300053096 | Bacteria | 12054 |
| 1043 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1044 | Ga0500616_0093155 | 3300053153 | Bacteria | 1487 |
| 1045 | Ga0501084_0025949 | 3300054114 | Bacteria | 4887 |
| 1046 | Ga0501084_0047646 | 3300054114 | Bacteria | 3589 |
| 1047 | Ga0501084_0199671 | 3300054114 | Bacteria | 1687 |
| 1048 | Ga0501084_0239714 | 3300054114 | Bacteria | 1531 |
| 1049 | Ga0501084_0689869 | 3300054114 | Bacteria | 861 |
| 1050 | Ga0501082_0027930 | 3300060353 | Bacteria | 4859 |
| 1051 | Ga0501082_0035092 | 3300060353 | Bacteria | 4323 |
| 1052 | Ga0501082_0050587 | 3300060353 | Bacteria | 3583 |
| 1053 | Ga0501082_0130231 | 3300060353 | Bacteria | 2183 |
| 1054 | Ga0501082_0171884 | 3300060353 | Bacteria | 1884 |
| 1055 | Ga0501082_0200682 | 3300060353 | Bacteria | 1735 |
| 1056 | Ga0157377_10050193 | |||
| 1057 | 2214745198 | |||
| 1058 | ARcpr5oldR_c000001 | |||
| 1059 | ARSoilYngRDRAFT_c00002 | |||
| 1060 | ARcpr5yngRDRAFT_c000052 | |||
| 1061 | ARSoilOldRDRAFT_c000001 | |||
| 1062 | ARCol0oldRDRAFT_c00118 | |||
| 1063 | ARCol0yngRDRAFT_1000001 | |||
| 1064 | JGI24032J14994_100737 | |||
| 1065 | JGI24741J21665_1003866 | |||
| 1066 | JGI24752J21851_1006376 | |||
| 1067 | JGI24746J21847_1000659 | |||
| 1068 | JGI24739J22299_10000177 | |||
| 1069 | JGI24737J22298_10005064 | |||
| 1070 | JGI24737J22298_10005147 | |||
| 1071 | JGI24750J21931_1000821 | |||
| 1072 | JGI24750J21931_1000850 | |||
| 1073 | JGI24745J21846_1000205 | |||
| 1074 | JGI24748J21848_1000211 | |||
| 1075 | JGI24738J21930_10000256 | |||
| 1076 | JGI24749J21850_1006010 | |||
| 1077 | JGI24744J21845_10000112 | |||
| 1078 | JGI24033J26618_1000425 | |||
| 1079 | JGI24742J22300_10002461 | |||
| 1080 | JGI25404J52841_10002600 | |||
| 1081 | JGI25405J52794_10023352 | |||
| 1082 | Ga0065712_10001068 | |||
| 1083 | Ga0065712_10188505 | |||
| 1084 | Ga0065715_10003590 | |||
| 1085 | Ga0065715_10093721 | |||
| 1086 | Ga0070658_10008439 | |||
| 1087 | Ga0070676_10012964 | |||
| 1088 | Ga0070676_10044006 | |||
| 1089 | Ga0070683_100000098 | |||
| 1090 | Ga0070683_101029154 | |||
| 1091 | Ga0070690_100015149 | |||
| 1092 | Ga0070690_100026107 | |||
| 1093 | Ga0070690_100104042 | |||
| 1094 | Ga0070670_100001544 | |||
| 1095 | Ga0070677_10000092 | |||
| 1096 | Ga0068869_100000054 | |||
| 1097 | Ga0070680_100027363 | |||
| 1098 | Ga0070680_100058485 | |||
| 1099 | Ga0070680_100396210 | |||
| 1100 | Ga0070682_100000181 | |||
| 1101 | Ga0068868_100003816 | |||
| 1102 | Ga0068868_100186885 | |||
| 1103 | Ga0070660_100027651 | |||
| 1104 | Ga0070660_100089794 | |||
| 1105 | Ga0070660_100297881 | |||
| 1106 | Ga0070660_100708931 | |||
| 1107 | Ga0070689_100024070 | |||
| 1108 | Ga0070689_100039552 | |||
| 1109 | Ga0070689_100377502 | |||
| 1110 | Ga0070691_10009004 | |||
| 1111 | Ga0070691_10014475 | |||
| 1112 | Ga0070687_100007432 | |||
| 1113 | Ga0070687_100013713 | |||
| 1114 | Ga0070687_100393211 | |||
| 1115 | Ga0070661_100000153 | |||
| 1116 | Ga0070661_100059218 | |||
| 1117 | Ga0070692_10000320 | |||
| 1118 | Ga0070668_100024606 | |||
| 1119 | Ga0070669_100027199 | |||
| 1120 | Ga0070669_100070208 | |||
| 1121 | Ga0070669_100367658 | |||
| 1122 | Ga0070675_100027317 | |||
| 1123 | Ga0070675_100378773 | |||
| 1124 | Ga0070675_100383468 | |||
| 1125 | Ga0070671_100011992 | |||
| 1126 | Ga0070671_100114916 | |||
| 1127 | Ga0070671_100512358 | |||
| 1128 | Ga0070674_100017007 | |||
| 1129 | Ga0070674_100083413 | |||
| 1130 | Ga0070674_100212083 | |||
| 1131 | Ga0070674_100385786 | |||
| 1132 | Ga0070673_100005417 | |||
| 1133 | Ga0070688_100023577 | |||
| 1134 | Ga0070659_100025193 | |||
| 1135 | Ga0070659_100054309 | |||
| 1136 | Ga0070659_100349765 | |||
| 1137 | Ga0070667_100029223 | |||
| 1138 | Ga0070667_100107011 | |||
| 1139 | Ga0070703_10004107 | |||
| 1140 | Ga0070703_10007172 | |||
| 1141 | Ga0070709_10246392 | |||
| 1142 | Ga0070709_10544292 | |||
| 1143 | Ga0070714_100370257 | |||
| 1144 | Ga0070714_100603998 | |||
| 1145 | Ga0070713_100005576 | |||
| 1146 | Ga0070713_100016744 | |||
| 1147 | Ga0070713_100116115 | |||
| 1148 | Ga0070710_10004049 | |||
| 1149 | Ga0070710_10094569 | |||
| 1150 | Ga0070701_10014309 | |||
| 1151 | Ga0070711_100062903 | |||
| 1152 | Ga0070711_100355580 | |||
| 1153 | Ga0070711_100471932 | |||
| 1154 | Ga0070705_100000311 | |||
| 1155 | Ga0070705_100032626 | |||
| 1156 | Ga0070705_100109693 | |||
| 1157 | Ga0070700_100013652 | |||
| 1158 | Ga0070694_100122542 | |||
| 1159 | Ga0070708_100015291 | |||
| 1160 | Ga0070663_100002418 | |||
| 1161 | Ga0070663_100156092 | |||
| 1162 | Ga0070678_100000382 | |||
| 1163 | Ga0070678_100147029 | |||
| 1164 | Ga0070662_100019898 | |||
| 1165 | Ga0070662_100033993 | |||
| 1166 | Ga0070662_100072994 | |||
| 1167 | Ga0070681_10042293 | |||
| 1168 | Ga0070681_10173797 | |||
| 1169 | Ga0070681_10221004 | |||
| 1170 | Ga0070681_10523804 | |||
| 1171 | Ga0068867_100021877 | |||
| 1172 | Ga0070685_10004779 | |||
| 1173 | Ga0070685_10080613 | |||
| 1174 | Ga0070685_10169087 | |||
| 1175 | Ga0070707_100164538 | |||
| 1176 | Ga0070679_100022398 | |||
| 1177 | Ga0070679_100041737 | |||
| 1178 | Ga0070679_100051061 | |||
| 1179 | Ga0070679_100051422 | |||
| 1180 | Ga0070679_100077850 | |||
| 1181 | Ga0070679_100144573 | |||
| 1182 | Ga0070679_100241026 | |||
| 1183 | Ga0070684_100030755 | |||
| 1184 | Ga0070684_100050287 | |||
| 1185 | Ga0070684_100394562 | |||
| 1186 | Ga0070697_100074309 | |||
| 1187 | Ga0068853_100001615 | |||
| 1188 | Ga0068853_100054660 | |||
| 1189 | Ga0070672_100010353 | |||
| 1190 | Ga0070672_100173707 | |||
| 1191 | Ga0070672_100333385 | |||
| 1192 | Ga0070686_100014350 | |||
| 1193 | Ga0070695_100015681 | |||
| 1194 | Ga0070696_100004854 | |||
| 1195 | Ga0070696_100060128 | |||
| 1196 | Ga0070696_100309990 | |||
| 1197 | Ga0070696_100350674 | |||
| 1198 | Ga0070696_100456101 | |||
| 1199 | Ga0070693_100004759 | |||
| 1200 | Ga0070665_100047110 | |||
| 1201 | Ga0070665_100141229 | |||
| 1202 | Ga0070665_100692157 | |||
| 1203 | Ga0070704_100093974 | |||
| 1204 | Ga0070704_100096510 | |||
| 1205 | Ga0068855_100057337 | |||
| 1206 | Ga0068855_100143145 | |||
| 1207 | Ga0068855_100194016 | |||
| 1208 | Ga0070664_100014418 | |||
| 1209 | Ga0070664_100047954 | |||
| 1210 | Ga0070664_100082047 | |||
| 1211 | Ga0070664_100106768 | |||
| 1212 | Ga0070664_100322413 | |||
| 1213 | Ga0068857_100032777 | |||
| 1214 | Ga0068857_100093574 | |||
| 1215 | Ga0068857_100151308 | |||
| 1216 | Ga0068854_100000145 | |||
| 1217 | Ga0068854_100051437 | |||
| 1218 | Ga0068854_100298229 | |||
| 1219 | Ga0068856_100084816 | |||
| 1220 | Ga0068856_100086099 | |||
| 1221 | Ga0070702_100001703 | |||
| 1222 | Ga0070702_100555793 | |||
| 1223 | Ga0068852_100028596 | |||
| 1224 | Ga0068852_100133271 | |||
| 1225 | Ga0068852_100926228 | |||
| 1226 | Ga0068859_100062972 | |||
| 1227 | Ga0068859_100066075 | |||
| 1228 | Ga0068859_100075527 | |||
| 1229 | Ga0068864_100014958 | |||
| 1230 | Ga0068864_100135595 | |||
| 1231 | Ga0068866_10000209 | |||
| 1232 | Ga0068861_100021773 | |||
| 1233 | Ga0068861_100037215 | |||
| 1234 | Ga0068861_100265060 | |||
| 1235 | Ga0068851_10021107 | |||
| 1236 | Ga0068870_10000029 | |||
| 1237 | Ga0068863_100019798 | |||
| 1238 | Ga0068863_100113155 | |||
| 1239 | Ga0068858_100035970 | |||
| 1240 | Ga0068858_100117267 | |||
| 1241 | Ga0068858_100170651 | |||
| 1242 | Ga0068860_100044535 | |||
| 1243 | Ga0068860_100059856 | |||
| 1244 | Ga0068860_100395141 | |||
| 1245 | Ga0068862_100011280 | |||
| 1246 | Ga0068862_100036879 | |||
| 1247 | Ga0081455_10000002 | |||
| 1248 | Ga0081455_10007598 | |||
| 1249 | Ga0081540_1000150 | |||
| 1250 | Ga0081540_1014154 | |||
| 1251 | Ga0070717_10003573 | |||
| 1252 | Ga0070717_10134176 | |||
| 1253 | Ga0075365_10064057 | |||
| 1254 | Ga0075432_10000858 | |||
| 1255 | Ga0070715_10004174 | |||
| 1256 | Ga0070715_10009672 | |||
| 1257 | Ga0075367_10116176 | |||
| 1258 | Ga0075427_10006621 | |||
| 1259 | Ga0097621_100000328 | |||
| 1260 | Ga0097621_100009094 | |||
| 1261 | Ga0075370_10205919 | |||
| 1262 | Ga0068871_100007030 | |||
| 1263 | Ga0068871_100023940 | |||
| 1264 | Ga0068871_100085303 | |||
| 1265 | Ga0075428_100002065 | |||
| 1266 | Ga0075430_100000129 | |||
| 1267 | Ga0075431_100000234 | |||
| 1268 | Ga0075431_100449841 | |||
| 1269 | Ga0075433_10000060 | |||
| 1270 | Ga0075433_10005178 | |||
| 1271 | Ga0075433_10091829 | |||
| 1272 | Ga0075434_100000412 | |||
| 1273 | Ga0075434_100003277 | |||
| 1274 | Ga0075434_100049205 | |||
| 1275 | Ga0075434_100109607 | |||
| 1276 | Ga0075429_100000532 | |||
| 1277 | Ga0075429_100303077 | |||
| 1278 | Ga0068865_100011649 | |||
| 1279 | Ga0068865_100061544 | |||
| 1280 | Ga0068865_100395594 | |||
| 1281 | Ga0075436_100070902 | |||
| 1282 | Ga0075436_100203536 | |||
| 1283 | Ga0075436_100470404 | |||
| 1284 | Ga0097620_100062974 | |||
| 1285 | Ga0097620_100066081 | |||
| 1286 | Ga0097620_100075530 | |||
| 1287 | Ga0075435_100008631 | |||
| 1288 | Ga0075435_100074494 | |||
| 1289 | Ga0075435_100128723 | |||
| 1290 | Ga0075435_100247441 | |||
| 1291 | Ga0105244_10020723 | |||
| 1292 | Ga0105250_10004829 | |||
| 1293 | Ga0105250_10126411 | |||
| 1294 | Ga0105240_10029089 | |||
| 1295 | Ga0105240_10071744 | |||
| 1296 | Ga0105240_10228923 | |||
| 1297 | Ga0111539_10004252 | |||
| 1298 | Ga0111539_10058244 | |||
| 1299 | Ga0111539_10058514 | |||
| 1300 | Ga0111539_10087470 | |||
| 1301 | Ga0105245_10000882 | |||
| 1302 | Ga0105245_10180158 | |||
| 1303 | Ga0105245_11045134 | |||
| 1304 | Ga0105247_10001969 | |||
| 1305 | Ga0105247_10015650 | |||
| 1306 | Ga0105247_10088788 | |||
| 1307 | Ga0105247_10113517 | |||
| 1308 | Ga0105247_10145007 | |||
| 1309 | Ga0114129_10011272 | |||
| 1310 | Ga0114129_10011377 | |||
| 1311 | Ga0105243_10024684 | |||
| 1312 | Ga0105243_10039281 | |||
| 1313 | Ga0105243_10112355 | |||
| 1314 | Ga0105243_10137153 | |||
| 1315 | Ga0105243_10330732 | |||
| 1316 | Ga0105241_10004094 | |||
| 1317 | Ga0105241_10097873 | |||
| 1318 | Ga0105242_10021910 | |||
| 1319 | Ga0105242_10230762 | |||
| 1320 | Ga0105242_10422351 | |||
| 1321 | Ga0105248_10034980 | |||
| 1322 | Ga0105248_10049550 | |||
| 1323 | Ga0105248_10381652 | |||
| 1324 | Ga0105248_10658159 | |||
| 1325 | Ga0105237_10016131 | |||
| 1326 | Ga0105237_10110080 | |||
| 1327 | Ga0105237_10380585 | |||
| 1328 | Ga0105238_10288062 | |||
| 1329 | Ga0105238_10292464 | |||
| 1330 | Ga0105249_10008019 | |||
| 1331 | Ga0105249_10037532 | |||
| 1332 | Ga0105249_10194309 | |||
| 1333 | Ga0105249_10413790 | |||
| 1334 | Ga0105239_10049789 | |||
| 1335 | Ga0105239_10052026 | |||
| 1336 | Ga0105239_10349846 | |||
| 1337 | Ga0105246_10007744 | |||
| 1338 | Ga0157347_1004501 | |||
| 1339 | Ga0157338_1006414 | |||
| 1340 | Ga0157373_10006834 | |||
| 1341 | Ga0157371_10012862 | |||
| 1342 | Ga0157371_10052032 | |||
| 1343 | Ga0157371_10123108 | |||
| 1344 | Ga0157370_10038422 | |||
| 1345 | Ga0157369_10299185 | |||
| 1346 | Ga0157374_10000614 | |||
| 1347 | Ga0157374_10432005 | |||
| 1348 | Ga0157374_10790265 | |||
| 1349 | Ga0157378_10000701 | |||
| 1350 | Ga0157378_10141244 | |||
| 1351 | Ga0157378_10154525 | |||
| 1352 | Ga0157378_10622402 | |||
| 1353 | Ga0163162_10042063 | |||
| 1354 | Ga0163162_10060042 | |||
| 1355 | Ga0163162_10467102 | |||
| 1356 | Ga0163162_10545355 | |||
| 1357 | Ga0157372_10028350 | |||
| 1358 | Ga0157372_10338765 | |||
| 1359 | Ga0157372_10699436 | |||
| 1360 | Ga0157375_10009978 | |||
| 1361 | Ga0157375_10038574 | |||
| 1362 | Ga0157375_10159258 | |||
| 1363 | Ga0157375_10414997 | |||
| 1364 | Ga0157375_11126533 | |||
| 1365 | Ga0163163_10007899 | |||
| 1366 | Ga0163163_10033764 | |||
| 1367 | Ga0157380_10001646 | |||
| 1368 | Ga0157380_10107099 | |||
| 1369 | Ga0157380_10304208 | |||
| 1370 | Ga0157380_10616293 | |||
| 1371 | Ga0157377_10000514 | |||
| 1372 | Ga0157379_10003823 | |||
| 1373 | Ga0157379_10125244 | |||
| 1374 | Ga0157379_10129603 | |||
| 1375 | Ga0157379_10137747 | |||
| 1376 | Ga0157379_10270049 | |||
| 1377 | Ga0157379_10305929 | |||
| 1378 | Ga0157376_10000860 | |||
| 1379 | Ga0157376_10048487 | |||
| 1380 | Ga0157376_10341078 | |||
| 1381 | Ga0157376_10748979 | |||
| 1382 | Ga0163161_10000956 | |||
| 1383 | Ga0163161_10178929 | |||
| 1384 | Ga0163161_10222039 | |||
| 1385 | Ga0197907_11114363 | |||
| 1386 | Ga0206354_11430131 | |||
| 1387 | Ga0206353_11674680 | |||
| 1388 | Ga0213876_10062749 | |||
| 1389 | Ga0207666_1000043 | |||
| 1390 | Ga0207666_1000617 | |||
| 1391 | Ga0207673_1000017 | |||
| 1392 | Ga0207697_10001136 | |||
| 1393 | Ga0207697_10008878 | |||
| 1394 | Ga0207653_10007260 | |||
| 1395 | Ga0207653_10015009 | |||
| 1396 | Ga0207682_10000021 | |||
| 1397 | Ga0207692_10011004 | |||
| 1398 | Ga0207642_10000063 | |||
| 1399 | Ga0207710_10028544 | |||
| 1400 | Ga0207710_10116105 | |||
| 1401 | Ga0207688_10000949 | |||
| 1402 | Ga0207688_10094425 | |||
| 1403 | Ga0207680_10009142 | |||
| 1404 | Ga0207680_10285752 | |||
| 1405 | Ga0207647_10013700 | |||
| 1406 | Ga0207647_10021210 | |||
| 1407 | Ga0207685_10019435 | |||
| 1408 | Ga0207699_10001682 | |||
| 1409 | Ga0207699_10061636 | |||
| 1410 | Ga0207645_10011742 | |||
| 1411 | Ga0207645_10018617 | |||
| 1412 | Ga0207645_10123720 | |||
| 1413 | Ga0207645_10268287 | |||
| 1414 | Ga0207643_10000108 | |||
| 1415 | Ga0207705_10077997 | |||
| 1416 | Ga0207705_10632208 | |||
| 1417 | Ga0207654_10001731 | |||
| 1418 | Ga0207654_10263515 | |||
| 1419 | Ga0207707_10013364 | |||
| 1420 | Ga0207707_10032373 | |||
| 1421 | Ga0207707_10052219 | |||
| 1422 | Ga0207707_10145745 | |||
| 1423 | Ga0207707_10377881 | |||
| 1424 | Ga0207707_10662366 | |||
| 1425 | Ga0207695_10212559 | |||
| 1426 | Ga0207671_10012822 | |||
| 1427 | Ga0207671_10055174 | |||
| 1428 | Ga0207693_10006099 | |||
| 1429 | Ga0207693_10018314 | |||
| 1430 | Ga0207693_10059968 | |||
| 1431 | Ga0207663_10008774 | |||
| 1432 | Ga0207663_10200440 | |||
| 1433 | Ga0207663_10265191 | |||
| 1434 | Ga0207663_10453618 | |||
| 1435 | Ga0207660_10000014 | |||
| 1436 | Ga0207660_10164360 | |||
| 1437 | Ga0207662_10005530 | |||
| 1438 | Ga0207662_10020149 | |||
| 1439 | Ga0207657_10007397 | |||
| 1440 | Ga0207657_10034796 | |||
| 1441 | Ga0207657_10054202 | |||
| 1442 | Ga0207657_10286673 | |||
| 1443 | Ga0207649_10000086 | |||
| 1444 | Ga0207649_10089487 | |||
| 1445 | Ga0207652_10000255 | |||
| 1446 | Ga0207652_10120280 | |||
| 1447 | Ga0207652_10322151 | |||
| 1448 | Ga0207681_10000024 | |||
| 1449 | Ga0207681_10405362 | |||
| 1450 | Ga0207694_10619387 | |||
| 1451 | Ga0207650_10005453 | |||
| 1452 | Ga0207650_10481834 | |||
| 1453 | Ga0207659_10000034 | |||
| 1454 | Ga0207659_10089772 | |||
| 1455 | Ga0207659_10315215 | |||
| 1456 | Ga0207659_10408687 | |||
| 1457 | Ga0207687_10000110 | |||
| 1458 | Ga0207687_10076773 | |||
| 1459 | Ga0207687_10124760 | |||
| 1460 | Ga0207687_10744148 | |||
| 1461 | Ga0207700_10001909 | |||
| 1462 | Ga0207700_10206762 | |||
| 1463 | Ga0207664_10066335 | |||
| 1464 | Ga0207644_10000868 | |||
| 1465 | Ga0207644_10025290 | |||
| 1466 | Ga0207644_10782751 | |||
| 1467 | Ga0207690_10000270 | |||
| 1468 | Ga0207690_10087572 | |||
| 1469 | Ga0207690_10114094 | |||
| 1470 | Ga0207706_10033611 | |||
| 1471 | Ga0207706_10040100 | |||
| 1472 | Ga0207706_10189817 | |||
| 1473 | Ga0207706_10229486 | |||
| 1474 | Ga0207706_10313411 | |||
| 1475 | Ga0207706_10341766 | |||
| 1476 | Ga0207686_10000214 | |||
| 1477 | Ga0207686_10072351 | |||
| 1478 | Ga0207709_10000344 | |||
| 1479 | Ga0207709_10010118 | |||
| 1480 | Ga0207709_10244590 | |||
| 1481 | Ga0207709_10321624 | |||
| 1482 | Ga0207670_10010144 | |||
| 1483 | Ga0207670_10015325 | |||
| 1484 | Ga0207670_10122715 | |||
| 1485 | Ga0207669_10000295 | |||
| 1486 | Ga0207669_10025469 | |||
| 1487 | Ga0207669_10026480 | |||
| 1488 | Ga0207704_10000343 | |||
| 1489 | Ga0207704_10165665 | |||
| 1490 | Ga0207704_10404826 | |||
| 1491 | Ga0207665_10001068 | |||
| 1492 | Ga0207665_10782940 | |||
| 1493 | Ga0207691_10003768 | |||
| 1494 | Ga0207691_10286420 | |||
| 1495 | Ga0207691_10315884 | |||
| 1496 | Ga0207711_10001706 | |||
| 1497 | Ga0207711_10007798 | |||
| 1498 | Ga0207711_10342736 | |||
| 1499 | Ga0207689_10002655 | |||
| 1500 | Ga0207689_10209544 | |||
| 1501 | Ga0207661_10000094 | |||
| 1502 | Ga0207661_10691251 | |||
| 1503 | Ga0207679_10000025 | |||
| 1504 | Ga0207679_10020011 | |||
| 1505 | Ga0207679_10132305 | |||
| 1506 | Ga0207679_10238500 | |||
| 1507 | Ga0207679_10248196 | |||
| 1508 | Ga0207667_10006649 | |||
| 1509 | Ga0207667_10046648 | |||
| 1510 | Ga0207667_10054806 | |||
| 1511 | Ga0207651_10000028 | |||
| 1512 | Ga0207712_10000558 | |||
| 1513 | Ga0207668_10000098 | |||
| 1514 | Ga0207668_10045417 | |||
| 1515 | Ga0207668_10092117 | |||
| 1516 | Ga0207640_10000104 | |||
| 1517 | Ga0207640_10015182 | |||
| 1518 | Ga0207658_10276159 | |||
| 1519 | Ga0207658_10291315 | |||
| 1520 | Ga0207677_10005087 | |||
| 1521 | Ga0207677_10012453 | |||
| 1522 | Ga0207703_10000594 | |||
| 1523 | Ga0207703_10006566 | |||
| 1524 | Ga0207703_10764680 | |||
| 1525 | Ga0207639_10000265 | |||
| 1526 | Ga0207678_10003256 | |||
| 1527 | Ga0207678_10035004 | |||
| 1528 | Ga0207678_10085762 | |||
| 1529 | Ga0207708_10024812 | |||
| 1530 | Ga0207708_10024934 | |||
| 1531 | Ga0207708_10625825 | |||
| 1532 | Ga0207702_10001351 | |||
| 1533 | Ga0207702_10085087 | |||
| 1534 | Ga0207702_10132731 | |||
| 1535 | Ga0207702_10897314 | |||
| 1536 | Ga0207641_10005095 | |||
| 1537 | Ga0207648_10004307 | |||
| 1538 | Ga0207648_10160756 | |||
| 1539 | Ga0207676_10000640 | |||
| 1540 | Ga0207674_10005795 | |||
| 1541 | Ga0207674_10094456 | |||
| 1542 | Ga0207675_100003849 | |||
| 1543 | Ga0207675_100041595 | |||
| 1544 | Ga0207675_100041946 | |||
| 1545 | Ga0207683_10000001 | |||
| 1546 | Ga0207683_10007134 | |||
| 1547 | Ga0207683_10067720 | |||
| 1548 | Ga0207698_10001784 | |||
| 1549 | Ga0207698_10559774 | |||
| 1550 | Ga0209973_1000485 | |||
| 1551 | Ga0209995_1006935 | |||
| 1552 | Ga0210002_1001067 | |||
| 1553 | Ga0209983_1016594 | |||
| 1554 | Ga0209971_1011706 | |||
| 1555 | Ga0209966_1001536 | |||
| 1556 | Ga0209998_10002199 | |||
| 1557 | Ga0209998_10003000 | |||
| 1558 | Ga0209998_10012661 | |||
| 1559 | Ga0209974_10004169 | |||
| 1560 | Ga0209974_10014697 | |||
| 1561 | Ga0207428_10000146 | |||
| 1562 | Ga0207428_10000221 | |||
| 1563 | Ga0207428_10000590 | |||
| 1564 | Ga0268266_10012422 | |||
| 1565 | Ga0268266_10022724 | |||
| 1566 | Ga0268266_10108502 | |||
| 1567 | Ga0268266_10602734 | |||
| 1568 | Ga0268265_10005507 | |||
| 1569 | Ga0268265_10228447 | |||
| 1570 | Ga0268264_10000456 | |||
| 1571 | Ga0268264_10178976 | |||
| 1572 | Ga0268264_10390491 | |||
| 1573 | Ga0268264_10575414 | |||
| 1574 | Ga0265338_10131874 | |||
| 1575 | Ga0265330_10017783 | |||
| 1576 | Ga0265325_10000056 | |||
| 1577 | Ga0265325_10009447 | |||
| 1578 | Ga0265325_10011003 | |||
| 1579 | Ga0265325_10134796 | |||
| 1580 | Ga0265340_10021356 | |||
| 1581 | Ga0265339_10001467 | |||
| 1582 | Ga0265339_10069942 | |||
| 1583 | Ga0265339_10191220 | |||
| 1584 | Ga0265316_10022096 | |||
| 1585 | Ga0265316_10046316 | |||
| 1586 | Ga0265316_10108046 | |||
| 1587 | Ga0265313_10002478 | |||
| 1588 | Ga0265313_10019854 | |||
| 1589 | Ga0265313_10034043 | |||
| 1590 | Ga0265313_10047272 | |||
| 1591 | Ga0265313_10136068 | |||
| 1592 | Ga0316575_10082457 | |||
| 1593 | Ga0265314_10000391 | |||
| 1594 | Ga0265314_10015471 | |||
| 1595 | Ga0265314_10111305 | |||
| 1596 | Ga0265342_10000983 | |||
| 1597 | Ga0307409_100689398 | |||
| 1598 | Ga0373930_0000005 | |||
| 1599 | Ga0373948_0000203 | |||
| 1600 | Ga0373948_0006852 | |||
| 1601 | Ga0373948_0021977 | |||
| 1602 | Ga0373950_0000614 | |||
| 1603 | Ga0373958_0000033 | |||
| 1604 | Ga0373958_0000839 | |||
| 1605 | Ga0373959_0000714 | |||
| 1606 | Ga0373938_0000517 | |||
| 1607 | Ga0373938_0002463 | |||
| 1608 | Ga0373926_0028249 | |||
| 1609 | Ga0373928_0000058 | |||
| 1610 | Ga0373928_0002188 | |||
| 1611 | Ga0373928_0003549 | |||
| 1612 | Ga0373929_0000552 | |||
| 1613 | Ga0373929_0008568 | |||
| 1614 | Ga0373934_0057166 | |||
| 1615 | Ga0373934_0072943 | |||
| 1616 | Ga0373940_0001756 | |||
| 1617 | Ga0373940_0007632 | |||
| 1618 | Ga0373940_0013713 | |||
| 1619 | Ga0373944_0006589 | |||
| 1620 | Ga0373944_0053039 | |||
| 1621 | Ga0373949_0002457 | |||
| 1622 | Ga0373949_0015490 | |||
| 1623 | Ga0373949_0027929 | |||
| 1624 | Ga0373949_0032644 | |||
| 1625 | Ga0373951_0002590 | |||
| 1626 | Ga0373951_0049579 | |||
| 1627 | Ga0373952_0002862 | |||
| 1628 | Ga0373952_0003011 | |||
| 1629 | Ga0373952_0004967 | |||
| 1630 | Ga0373923_0019083 | |||
| 1631 | Ga0373932_0000987 | |||
| 1632 | Ga0373932_0003158 | |||
| 1633 | Ga0373932_0003436 | |||
| 1634 | Ga0373936_0010987 | |||
| 1635 | Ga0373939_0000783 | |||
| 1636 | Ga0373939_0001082 | |||
| 1637 | Ga0373939_0002024 | |||
| 1638 | Ga0373939_0008014 | |||
| 1639 | Ga0373939_0010179 | |||
| 1640 | Ga0373941_0000140 | |||
| 1641 | Ga0373941_0003396 | |||
| 1642 | Ga0373945_0077083 | |||
| 1643 | Ga0373953_0022523 | |||
| 1644 | Ga0373953_0139634 | |||
| 1645 | Ga0373953_0195319 | |||
| 1646 | Ga0373954_0004912 | |||
| 1647 | Ga0373954_0007317 | |||
| 1648 | Ga0373956_0014602 | |||
| 1649 | Ga0373956_0023059 | |||
| 1650 | Ga0373956_0148111 | |||
| 1651 | Ga0373957_0014554 | |||
| 1652 | Ga0373957_0083530 | |||
| 1653 | Ga0373957_0102114 | |||
| 1654 | Ga0373960_0002027 | |||
| 1655 | Ga0373960_0003110 | |||
| 1656 | Ga0373960_0038885 | |||
| 1657 | Ga0373943_0016382 | |||
| 1658 | Ga0373943_0017942 | |||
| 1659 | Ga0373946_0012607 | |||
| 1660 | Ga0373946_0014256 | |||
| 1661 | Ga0373955_0024171 | |||
| 1662 | Ga0373955_0024957 | |||
| 1663 | Ga0373955_0047108 | |||
| 1664 | Ga0373955_0225138 | |||
| 1665 | Ga0373942_0004650 | |||
| 1666 | Ga0373942_0005098 | |||
| 1667 | Ga0373942_0027485 | |||
| 1668 | Ga0373961_0000385 | |||
| 1669 | Ga0373961_0018927 | |||
| 1670 | Ga0373961_0023941 | |||
| 1671 | Ga0373962_0009009 | |||
| 1672 | Ga0373962_0011063 | |||
| 1673 | Ga0373962_0013150 | |||
| 1674 | Ga0373924_0003869 | |||
| 1675 | Ga0373924_0014049 | |||
| 1676 | Ga0373931_0000130 | |||
| 1677 | Ga0373931_0003847 | |||
| 1678 | Ga0373931_0011865 | |||
| 1679 | Ga0373931_0242563 | |||
| 1680 | Ga0373935_0003155 | |||
| 1681 | Ga0373935_0030530 | |||
| 1682 | Ga0373935_0284115 | |||
| 1683 | Ga0373935_0311701 | |||
| 1684 | Ga0373935_0556600 | |||
| 1685 | Ga0373927_0004274 | |||
| 1686 | Ga0373933_0005885 | |||
| 1687 | Ga0373933_0013244 | |||
| 1688 | Ga0373933_0087116 | |||
| 1689 | Ga0373933_0127897 | |||
| 1690 | Ga0373947_0004749 | |||
| 1691 | Ga0373947_0111730 | |||
| 1692 | Ga0373937_0010450 | |||
| 1693 | Ga0373937_0016552 | |||
| 1694 | Ga0373937_0029083 | |||
| 1695 | Ga0373937_0125919 | |||
| 1696 | Ga0373937_0205189 | |||
| 1697 | Ga0373937_0264040 | |||
| 1698 | Ga0373937_0288143 | |||
| 1699 | Ga0373925_0001412 | |||
| 1700 | Ga0373925_0400974 | |||
| 1701 | Ga0242420_008710 | |||
| 1702 | Ga0436365_1153613 | |||
| 1703 | Ga0436365_1291451 | |||
| 1704 | Ga0439453_0000724 | |||
| 1705 | Ga0439441_028274 | |||
| 1706 | Ga0439463_007316 | |||
| 1707 | Ga0439446_0070335 | |||
| 1708 | Ga0439434_0049585 | |||
| 1709 | Ga0439435_0020743 | |||
| 1710 | Ga0439459_0009621 | |||
| 1711 | Ga0439464_0025431 | |||
| 1712 | Ga0439460_0021792 | |||
| 1713 | Ga0439460_0032851 | |||
| 1714 | Ga0451577_0076456 | |||
| 1715 | Ga0453684_0045660 | |||
| 1716 | Ga0451576_0005933 | |||
| 1717 | Ga0495617_009209 | |||
| 1718 | Ga0495592_0007579 | |||
| 1719 | Ga0495592_0016926 | |||
| 1720 | Ga0495592_0079259 | |||
| 1721 | Ga0495603_0010367 | |||
| 1722 | Ga0495603_0021414 | |||
| 1723 | Ga0495603_0116140 | |||
| 1724 | Ga0495629_0000909 | |||
| 1725 | Ga0495629_0056541 | |||
| 1726 | Ga0495629_0095300 | |||
| 1727 | Ga0495641_0015089 | |||
| 1728 | Ga0495641_0036557 | |||
| 1729 | Ga0495651_0002035 | |||
| 1730 | Ga0495651_0008748 | |||
| 1731 | Ga0495651_0011644 | |||
| 1732 | Ga0495651_0065926 | |||
| 1733 | Ga0495651_0076302 | |||
| 1734 | Ga0495651_0495623 | |||
| 1735 | Ga0495653_0027062 | |||
| 1736 | Ga0495653_0029649 | |||
| 1737 | Ga0495653_0054179 | |||
| 1738 | Ga0495653_0057670 | |||
| 1739 | Ga0495653_0207867 | |||
| 1740 | Ga0495580_0088609 | |||
| 1741 | Ga0495580_0145924 | |||
| 1742 | Ga0495582_0002021 | |||
| 1743 | Ga0495582_0002597 | |||
| 1744 | Ga0495605_0032808 | |||
| 1745 | Ga0495639_0006208 | |||
| 1746 | Ga0495662_0043060 | |||
| 1747 | Ga0495662_0154713 | |||
| 1748 | Ga0495664_0007311 | |||
| 1749 | Ga0495664_0023714 | |||
| 1750 | Ga0495664_0032029 | |||
| 1751 | Ga0495664_0057905 | |||
| 1752 | Ga0495584_0004152 | |||
| 1753 | Ga0495585_0000856 | |||
| 1754 | Ga0495594_0161848 | |||
| 1755 | Ga0495594_0253507 | |||
| 1756 | Ga0495607_0001563 | |||
| 1757 | Ga0495608_0000915 | |||
| 1758 | Ga0495608_0025614 | |||
| 1759 | Ga0495608_0029844 | |||
| 1760 | Ga0495618_0024462 | |||
| 1761 | Ga0495618_0056529 | |||
| 1762 | Ga0495618_0178095 | |||
| 1763 | Ga0495618_0223002 | |||
| 1764 | Ga0495628_0010424 | |||
| 1765 | Ga0495628_0020944 | |||
| 1766 | Ga0495628_0049175 | |||
| 1767 | Ga0495628_0076288 | |||
| 1768 | Ga0495630_0083103 | |||
| 1769 | Ga0495630_0193891 | |||
| 1770 | Ga0495630_0286970 | |||
| 1771 | Ga0495637_0008444 | |||
| 1772 | Ga0495637_0022486 | |||
| 1773 | Ga0495644_0000392 | |||
| 1774 | Ga0495663_0016049 | |||
| 1775 | Ga0495666_0105934 | |||
| 1776 | Ga0495652_0009116 | |||
| 1777 | Ga0495652_0020953 | |||
| 1778 | Ga0495652_0197711 | |||
| 1779 | Ga0495665_0003663 | |||
| 1780 | Ga0495665_0027096 | |||
| 1781 | Ga0495640_0029737 | |||
| 1782 | Ga0495640_0037750 | |||
| 1783 | Ga0495640_0172767 | |||
| 1784 | Ga0495586_0032773 | |||
| 1785 | Ga0495587_0001734 | |||
| 1786 | Ga0495587_0011728 | |||
| 1787 | Ga0495587_0029163 | |||
| 1788 | Ga0495598_0001967 | |||
| 1789 | Ga0495645_0004078 | |||
| 1790 | Ga0495645_0004983 | |||
| 1791 | Ga0495633_0000645 | |||
| 1792 | Ga0495667_0000259 | |||
| 1793 | Ga0495667_0015414 | |||
| 1794 | Ga0495656_0000157 | |||
| 1795 | Ga0495634_0068575 | |||
| 1796 | Ga0495634_0083127 | |||
| 1797 | Ga0495634_0201345 | |||
| 1798 | Ga0495611_0001997 | |||
| 1799 | Ga0495635_0004119 | |||
| 1800 | Ga0495635_0026839 | |||
| 1801 | Ga0495635_0113751 | |||
| 1802 | Ga0495635_0161557 | |||
| 1803 | Ga0495659_0000900 | |||
| 1804 | Ga0495588_0010993 | |||
| 1805 | Ga0495657_0003179 | |||
| 1806 | Ga0495657_0071813 | |||
| 1807 | Ga0495599_0008671 | |||
| 1808 | Ga0495599_0153235 | |||
| 1809 | Ga0495599_0192724 | |||
| 1810 | Ga0495599_0409653 | |||
| 1811 | Ga0495623_0000981 | |||
| 1812 | Ga0495623_0089382 | |||
| 1813 | Ga0495623_0191642 | |||
| 1814 | Ga0495646_0001919 | |||
| 1815 | Ga0495646_0035551 | |||
| 1816 | Ga0495646_0050547 | |||
| 1817 | Ga0495647_0005796 | |||
| 1818 | Ga0495647_0039154 | |||
| 1819 | Ga0495647_0078828 | |||
| 1820 | Ga0495658_0000360 | |||
| 1821 | Ga0495658_0024624 | |||
| 1822 | Ga0495669_0076118 | |||
| 1823 | Ga0495613_0018760 | |||
| 1824 | Ga0495613_0052318 | |||
| 1825 | Ga0495613_0167337 | |||
| 1826 | Ga0495624_0007588 | |||
| 1827 | Ga0495624_0058845 | |||
| 1828 | Ga0495624_0064121 | |||
| 1829 | Ga0495670_0000213 | |||
| 1830 | Ga0495600_0014240 | |||
| 1831 | Ga0495600_0022131 | |||
| 1832 | Ga0495600_0023157 | |||
| 1833 | Ga0495581_0012254 | |||
| 1834 | Ga0495581_0086801 | |||
| 1835 | Ga0495581_0087282 | |||
| 1836 | Ga0495604_0001954 | |||
| 1837 | Ga0495604_0008955 | |||
| 1838 | Ga0495604_0034057 | |||
| 1839 | Ga0495674_0010262 | |||
| 1840 | Ga0495674_0022491 | |||
| 1841 | Ga0495674_0099970 | |||
| 1842 | Ga0495676_0035234 | |||
| 1843 | Ga0495676_0197971 | |||
| 1844 | Ga0495680_0002446 | |||
| 1845 | Ga0495680_0009264 | |||
| 1846 | Ga0495680_0043847 | |||
| 1847 | Ga0495680_0051002 | |||
| 1848 | Ga0495680_0064647 | |||
| 1849 | Ga0495680_0136516 | |||
| 1850 | Ga0495675_0000147 | |||
| 1851 | Ga0495675_0006699 | |||
| 1852 | Ga0495679_040117 | |||
| 1853 | Ga0495684_0005638 | |||
| 1854 | Ga0495684_0063016 | |||
| 1855 | Ga0495593_0004620 | |||
| 1856 | Ga0495593_0020466 | |||
| 1857 | Ga0495593_0071695 | |||
| 1858 | Ga0495593_0080949 | |||
| 1859 | Ga0495602_0002613 | |||
| 1860 | Ga0495602_0005981 | |||
| 1861 | Ga0495602_0071405 | |||
| 1862 | Ga0495614_0006737 | |||
| 1863 | Ga0495614_0201846 | |||
| 1864 | Ga0495615_0037975 | |||
| 1865 | Ga0496100_0001667 | |||
| 1866 | Ga0496100_0012737 | |||
| 1867 | Ga0496100_0062922 | |||
| 1868 | Ga0496100_0153159 | |||
| 1869 | Ga0496100_0200409 | |||
| 1870 | Ga0496100_0295865 | |||
| 1871 | Ga0496100_0297824 | |||
| 1872 | Ga0496101_0000079 | |||
| 1873 | Ga0496101_0016662 | |||
| 1874 | Ga0496101_0070024 | |||
| 1875 | Ga0496101_0135932 | |||
| 1876 | Ga0496101_0161750 | |||
| 1877 | Ga0496101_0207427 | |||
| 1878 | Ga0496101_0351400 | |||
| 1879 | Ga0496102_0004410 | |||
| 1880 | Ga0496102_0104825 | |||
| 1881 | Ga0496102_0108844 | |||
| 1882 | Ga0496102_0203216 | |||
| 1883 | Ga0496102_0279436 | |||
| 1884 | Ga0496102_0453830 | |||
| 1885 | Ga0496103_0003888 | |||
| 1886 | Ga0496103_0082312 | |||
| 1887 | Ga0496103_0083312 | |||
| 1888 | Ga0496103_0112186 | |||
| 1889 | Ga0496104_0000203 | |||
| 1890 | Ga0496104_0050199 | |||
| 1891 | Ga0496104_0135318 | |||
| 1892 | Ga0496104_0150281 | |||
| 1893 | Ga0496104_0197580 | |||
| 1894 | Ga0496104_0256749 | |||
| 1895 | Ga0496104_0262828 | |||
| 1896 | Ga0496104_0368696 | |||
| 1897 | Ga0496105_0000378 | |||
| 1898 | Ga0496105_0014937 | |||
| 1899 | Ga0496105_0060404 | |||
| 1900 | Ga0496105_0079013 | |||
| 1901 | Ga0496105_0111416 | |||
| 1902 | Ga0496105_0239347 | |||
| 1903 | Ga0496106_0030064 | |||
| 1904 | Ga0496106_0041579 | |||
| 1905 | Ga0496106_0120142 | |||
| 1906 | Ga0496106_0197745 | |||
| 1907 | Ga0496106_0335187 | |||
| 1908 | Ga0496107_0020541 | |||
| 1909 | Ga0496107_0023690 | |||
| 1910 | Ga0496107_0025593 | |||
| 1911 | Ga0496107_0056439 | |||
| 1912 | Ga0496107_0071064 | |||
| 1913 | Ga0496107_0443439 | |||
| 1914 | Ga0496107_0464350 | |||
| 1915 | Ga0496107_0512662 | |||
| 1916 | Ga0496108_0005809 | |||
| 1917 | Ga0496108_0081425 | |||
| 1918 | Ga0496108_0087944 | |||
| 1919 | Ga0496108_0118736 | |||
| 1920 | Ga0496108_0138143 | |||
| 1921 | Ga0496108_0312417 | |||
| 1922 | Ga0496109_0000223 | |||
| 1923 | Ga0496109_0050643 | |||
| 1924 | Ga0496109_0062821 | |||
| 1925 | Ga0496110_0005653 | |||
| 1926 | Ga0496110_0133133 | |||
| 1927 | Ga0496110_0136904 | |||
| 1928 | Ga0496110_0210296 | |||
| 1929 | Ga0496111_0007705 | |||
| 1930 | Ga0496111_0042491 | |||
| 1931 | Ga0496111_0074829 | |||
| 1932 | Ga0496111_0120204 | |||
| 1933 | Ga0496112_0055975 | |||
| 1934 | Ga0496112_0088107 | |||
| 1935 | Ga0496112_0091895 | |||
| 1936 | Ga0496112_0167574 | |||
| 1937 | Ga0496112_0756676 | |||
| 1938 | Ga0496113_0000624 | |||
| 1939 | Ga0496113_0066235 | |||
| 1940 | Ga0496113_0067511 | |||
| 1941 | Ga0496113_0233293 | |||
| 1942 | Ga0496113_0311774 | |||
| 1943 | Ga0496114_0010254 | |||
| 1944 | Ga0496114_0158527 | |||
| 1945 | Ga0496114_0198527 | |||
| 1946 | Ga0496115_0001792 | |||
| 1947 | Ga0496115_0048404 | |||
| 1948 | Ga0496115_0103501 | |||
| 1949 | Ga0496115_0105890 | |||
| 1950 | Ga0496115_0159920 | |||
| 1951 | Ga0496115_0216170 | |||
| 1952 | Ga0496126_0287700 | |||
| 1953 | Ga0501031_0007895 | |||
| 1954 | Ga0501031_0378836 | |||
| 1955 | Ga0501032_0066398 | |||
| 1956 | Ga0501032_0099488 | |||
| 1957 | Ga0501032_0117291 | |||
| 1958 | Ga0501033_0016242 | |||
| 1959 | Ga0501033_0276620 | |||
| 1960 | Ga0501033_0322022 | |||
| 1961 | Ga0501034_0000089 | |||
| 1962 | Ga0501034_0006479 | |||
| 1963 | Ga0501034_0089671 | |||
| 1964 | Ga0501034_0118791 | |||
| 1965 | Ga0501034_0171836 | |||
| 1966 | Ga0501036_0004689 | |||
| 1967 | Ga0501036_0013953 | |||
| 1968 | Ga0501036_0030377 | |||
| 1969 | Ga0501036_0198071 | |||
| 1970 | Ga0501037_0013965 | |||
| 1971 | Ga0501037_0018777 | |||
| 1972 | Ga0501037_0049478 | |||
| 1973 | Ga0501037_0157760 | |||
| 1974 | Ga0501037_0227615 | |||
| 1975 | Ga0501038_0008360 | |||
| 1976 | Ga0501038_0222223 | |||
| 1977 | Ga0501039_0005535 | |||
| 1978 | Ga0501039_0148448 | |||
| 1979 | Ga0501042_0065144 | |||
| 1980 | Ga0501043_0001206 | |||
| 1981 | Ga0501043_0024663 | |||
| 1982 | Ga0501043_0030112 | |||
| 1983 | Ga0501043_0049829 | |||
| 1984 | Ga0501043_0065943 | |||
| 1985 | Ga0501046_0019306 | |||
| 1986 | Ga0501046_0076895 | |||
| 1987 | Ga0501046_0179586 | |||
| 1988 | Ga0501046_0223038 | |||
| 1989 | Ga0501046_0296148 | |||
| 1990 | Ga0501047_0000108 | |||
| 1991 | Ga0501047_0030345 | |||
| 1992 | Ga0501047_0059519 | |||
| 1993 | Ga0501047_0563196 | |||
| 1994 | Ga0501048_0000493 | |||
| 1995 | Ga0501048_0112368 | |||
| 1996 | Ga0501048_0300827 | |||
| 1997 | Ga0501067_0002851 | |||
| 1998 | Ga0501067_0045338 | |||
| 1999 | Ga0501068_0007207 | |||
| 2000 | Ga0501068_0062789 | |||
| 2001 | Ga0501068_0232858 | |||
| 2002 | Ga0501069_0004416 | |||
| 2003 | Ga0501069_0051175 | |||
| 2004 | Ga0501069_0083524 | |||
| 2005 | Ga0501070_0030292 | |||
| 2006 | Ga0501070_0031929 | |||
| 2007 | Ga0501070_0056871 | |||
| 2008 | Ga0501070_0072072 | |||
| 2009 | Ga0501070_0155493 | |||
| 2010 | Ga0501070_0429390 | |||
| 2011 | Ga0501071_0080378 | |||
| 2012 | Ga0501072_0281738 | |||
| 2013 | Ga0501073_0010473 | |||
| 2014 | Ga0501073_0028323 | |||
| 2015 | Ga0501073_0035595 | |||
| 2016 | Ga0501073_0049083 | |||
| 2017 | Ga0501073_0051395 | |||
| 2018 | Ga0501073_0424498 | |||
| 2019 | Ga0501074_0001683 | |||
| 2020 | Ga0501074_0035388 | |||
| 2021 | Ga0501074_0046011 | |||
| 2022 | Ga0501076_0448358 | |||
| 2023 | Ga0501079_0022593 | |||
| 2024 | Ga0501079_0072864 | |||
| 2025 | Ga0501079_0129243 | |||
| 2026 | Ga0501079_0165326 | |||
| 2027 | Ga0501079_0206364 | |||
| 2028 | Ga0501080_0003238 | |||
| 2029 | Ga0501080_0033446 | |||
| 2030 | Ga0501080_0120932 | |||
| 2031 | Ga0501080_0172727 | |||
| 2032 | Ga0501083_0002587 | |||
| 2033 | Ga0501083_0007793 | |||
| 2034 | Ga0501083_0041181 | |||
| 2035 | Ga0501083_0120675 | |||
| 2036 | Ga0501035_0002622 | |||
| 2037 | Ga0501035_0121335 | |||
| 2038 | Ga0501035_0222290 | |||
| 2039 | Ga0501035_0263789 | |||
| 2040 | Ga0501035_0760810 | |||
| 2041 | Ga0501044_0000998 | |||
| 2042 | Ga0501044_0059613 | |||
| 2043 | Ga0501044_0101735 | |||
| 2044 | Ga0501044_0193784 | |||
| 2045 | Ga0501044_0221669 | |||
| 2046 | Ga0501044_0589927 | |||
| 2047 | Ga0501045_0037222 | |||
| 2048 | Ga0501045_0267485 | |||
| 2049 | nmdc:mga0yw44_158748_c1 | |||
| 2050 | nmdc:mga0k408_30249_c1 | |||
| 2051 | nmdc:mga06z11_93342_c1 | |||
| 2052 | nmdc:mga05p37_111_c1 | |||
| 2053 | nmdc:mga05p37_64417_c1 | |||
| 2054 | nmdc:mga09592_519_c1 | |||
| 2055 | nmdc:mga0qj67_5814_c1 | |||
| 2056 | nmdc:mga06r32_3010_c1 | |||
| 2057 | nmdc:mga08y16_11075_c1 | |||
| 2058 | nmdc:mga08y16_223100_c1 | |||
| 2059 | nmdc:mga08y16_59876_c1 | |||
| 2060 | nmdc:mga08y16_82929_c1 | |||
| 2061 | nmdc:mga0n895_2911_c1 | |||
| 2062 | nmdc:mga0n895_497_c1 | |||
| 2063 | nmdc:mga0n895_52554_c1 | |||
| 2064 | nmdc:mga0n895_6865_c1 | |||
| 2065 | nmdc:mga0rr50_636_c1 | |||
| 2066 | nmdc:mga0rr50_702502_c1 | |||
| 2067 | nmdc:mga08x19_183599_c1 | |||
| 2068 | nmdc:mga08x19_197544_c1 | |||
| 2069 | nmdc:mga08x19_436421_c1 | |||
| 2070 | nmdc:mga0a205_269192_c1 | |||
| 2071 | nmdc:mga0a205_5029_c1 | |||
| 2072 | nmdc:mga0a205_50_c1 | |||
| 2073 | Ga0495601_0000259 | |||
| 2074 | Ga0495601_0002525 | |||
| 2075 | Ga0495601_0004827 | |||
| 2076 | Ga0495601_0059824 | |||
| 2077 | Ga0495601_0196120 | |||
| 2078 | Ga0495612_0000173 | |||
| 2079 | Ga0495612_0005298 | |||
| 2080 | Ga0495612_0005917 | |||
| 2081 | Ga0495612_0010418 | |||
| 2082 | Ga0495612_0017601 | |||
| 2083 | Ga0495612_0213992 | |||
| 2084 | Ga0495595_0002058 | |||
| 2085 | Ga0495595_0005278 | |||
| 2086 | Ga0495595_0009740 | |||
| 2087 | Ga0495595_0011900 | |||
| 2088 | Ga0495595_0117609 | |||
| 2089 | Ga0495595_0131756 | |||
| 2090 | Ga0495619_0000132 | |||
| 2091 | Ga0495619_0000178 | |||
| 2092 | Ga0495619_0001228 | |||
| 2093 | Ga0495619_0004954 | |||
| 2094 | Ga0495619_0023258 | |||
| 2095 | Ga0495619_0032913 | |||
| 2096 | Ga0495619_0261479 | |||
| 2097 | Ga0500641_0000709 | |||
| 2098 | Ga0500595_000001 | |||
| 2099 | Ga0500616_0093155 | |||
| 2100 | Ga0501084_0025949 | |||
| 2101 | Ga0501084_0047646 | |||
| 2102 | Ga0501084_0199671 | |||
| 2103 | Ga0501084_0239714 | |||
| 2104 | Ga0501084_0689869 | |||
| 2105 | Ga0501082_0027930 | |||
| 2106 | Ga0501082_0035092 | |||
| 2107 | Ga0501082_0050587 | |||
| 2108 | Ga0501082_0130231 | |||
| 2109 | Ga0501082_0171884 | |||
| 2110 | Ga0501082_0200682 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxz-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sah | 0.8998 | 30 | 234 |
| 3dxy-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sam | 0.8858 | 30 | 233 |
| 3dxz-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sah | 0.8785 | 30 | 234 |
| 3dxy-assembly1.cif.gz_A | crystal structure of ectrmb in complex with sam | 0.8575 | 30 | 233 |
| 8hkr-assembly1.cif.gz_B | crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis | 0.856 | 60 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HSE1_104_298_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9045 | 58 | 185 | 3.40.50.150 |
| 3dxzA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8998 | 30 | 234 | 3.40.50.150 |
| 3dxzA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8785 | 30 | 234 | 3.40.50.150 |
| af_P9WFY9_38_258_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8752 | 24 | 233 | 3.40.50.150 |
| af_Q8I3G1_737_866_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8732 | 58 | 137 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A166EXN6-F1-model_v4 | tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) | 0.9799 | 37 | 233 |
GO:0008176
GO:0043527 |
| AF-A0A1G6E0H6-F1-model_v4 | tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) | 0.9773 | 36 | 234 |
GO:0008176
GO:0043527 |
| AF-A0A1M3BV46-F1-model_v4 | tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) | 0.9754 | 36 | 234 |
GO:0008176
GO:0043527 |
| AF-A0A1E3W341-F1-model_v4 | tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) | 0.9744 | 24 | 234 |
GO:0008176
GO:0043527 |
| AF-A0A656Z2U6-F1-model_v4 | tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) | 0.9743 | 16 | 234 |
GO:0008176
GO:0043527 |