F489159
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 502 | 2111 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_4042678|Ga0451853_4042678_74_1342 |
| Length | 422 |
| Sequence | MNASTSSRASSSLPDLPVFPGTASASGQPATLGVMGGGQLGRMFVHAAQRLGYFTAVLDPDPQSPAGLVSHHHIQTGYSDEKGLAELAALCAAVTTEFENVPAGALQALAASRPVAPGAAAVAIAQNRIEEKSHFTASAAESGVLAGVSCAPYAVIETEAQLRAVPADLLPGILKTARMGYDGKGQVRVKNAAELAGAWAGLKQAFCVLEKMLPLKAECSVVVARGWDGRVVSFAPQRNVHVDGILAVTQAYEGNMPAALAQRALAATHTIAHHVGYVGVLCVEFFLVDDGSADGALVVNEMAPRPHNSGHYTMDACDVSQFDLQVHAMAGLPLPQPRQHSPAIMLNLLGDVWVDAQGNSRTPDWQAVLALPGTHLHLYGKTEARAGRKMGHLNITGADVATVKATARQAAAILGLPGLEDI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 223 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 224 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 225 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 226 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 227 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 228 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 231 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 262 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 265 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 266 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 267 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 268 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 269 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 270 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 272 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 273 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 274 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 277 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 278 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 279 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 280 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 281 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 282 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 283 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 284 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 285 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 286 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 287 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 288 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 289 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 290 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 291 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 292 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 293 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 294 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 295 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 296 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 297 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 298 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 299 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 300 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 301 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 302 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 303 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 304 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 305 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 306 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 307 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 308 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 309 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 310 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 311 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 312 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 313 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 316 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 354 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 370 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 373 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 386 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 387 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 388 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 406 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 408 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 410 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 412 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 413 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 414 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 415 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 416 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 417 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 418 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 420 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 421 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 423 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 426 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 427 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 428 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 429 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 430 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 431 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 432 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 433 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 434 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 435 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 436 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 437 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 438 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 439 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 440 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 441 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 442 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 443 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 444 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 445 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 446 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 447 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 448 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 449 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 450 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 451 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 452 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 453 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 454 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 455 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 456 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 457 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 458 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 459 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 460 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 461 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 462 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 463 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 464 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 465 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 466 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 467 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 468 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 469 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 470 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 471 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 472 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 473 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 474 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 475 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 476 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 477 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 478 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 479 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 480 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 481 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 482 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 483 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 484 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 485 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 486 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 487 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 488 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 489 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 490 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 491 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 492 | 2939615513 | Lactococcus lactis 1925 | Isolate | Rhizosphere |
| 493 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 494 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 495 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 496 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 497 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 498 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 499 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 500 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 501 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 502 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.42 |
| Metatranscriptomes | 0.47 |
| Isolates | 7.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 28.63 |
| Nodule | 0.76 |
| Rhizoplane | 2.37 |
| Rhizosphere | 54.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451853_4042678 | 3300041512 | Bacteria | 1563 |
| 2 | JGI24740J21852_10007049 | 3300001979 | Bacteria | 4606 |
| 3 | JGI24740J21852_10016505 | 3300001979 | Bacteria | 2668 |
| 4 | JGI24739J22299_10006314 | 3300001989 | Bacteria | 4475 |
| 5 | JGI25155J39150_1000037 | 3300002704 | Bacteria | 97260 |
| 6 | JGI25156J39149_1000024 | 3300002705 | Bacteria | 141748 |
| 7 | JGI25156J39149_1000273 | 3300002705 | Bacteria | 35022 |
| 8 | JGI25154J39366_1000043 | 3300002738 | Bacteria | 142417 |
| 9 | JGI25154J39366_1001641 | 3300002738 | Bacteria | 7499 |
| 10 | JGI25158J39367_1005090 | 3300002739 | Bacteria | 1942 |
| 11 | JGI25157J39369_1000031 | 3300002741 | Bacteria | 141953 |
| 12 | JGI25157J39369_1000141 | 3300002741 | Bacteria | 61029 |
| 13 | JGI25152J39213_1007178 | 3300002773 | Bacteria | 2918 |
| 14 | JGI25150J39212_1002395 | 3300002774 | Bacteria | 4697 |
| 15 | JGI25150J39212_1004345 | 3300002774 | Bacteria | 3166 |
| 16 | JGI25159J45721_1004996 | 3300002987 | Bacteria | 4246 |
| 17 | JGI25159J45721_1007712 | 3300002987 | Bacteria | 3047 |
| 18 | JGI25151J46595_10001536 | 3300003187 | Bacteria | 15422 |
| 19 | JGI25151J46595_10002156 | 3300003187 | Bacteria | 12214 |
| 20 | JGI25151J46595_10002752 | 3300003187 | Bacteria | 10217 |
| 21 | JGI25151J46595_10011019 | 3300003187 | Bacteria | 4174 |
| 22 | JGI25151J46595_10019115 | 3300003187 | Bacteria | 2920 |
| 23 | JGI25153J46596_10001676 | 3300003215 | Bacteria | 13140 |
| 24 | JGI25153J46596_10003840 | 3300003215 | Bacteria | 8278 |
| 25 | JGI25153J46596_10016969 | 3300003215 | Bacteria | 2888 |
| 26 | rootH1_10000170 | 3300003316 | Bacteria | 11868 |
| 27 | rootH1_10000170 | 3300003323 | Bacteria | 3661 |
| 28 | rootH1_10002432 | 3300003316 | Bacteria | 8940 |
| 29 | rootH1_10043915 | 3300003316 | Bacteria | 4849 |
| 30 | rootL2_10001066 | 3300003322 | Bacteria | 89444 |
| 31 | rootL2_10090276 | 3300003322 | Bacteria | 6717 |
| 32 | rootH1_10002491 | 3300003323 | Bacteria | 40530 |
| 33 | JGI25160J50197_1000172 | 3300003354 | Bacteria | 55781 |
| 34 | JGI25160J50197_1011812 | 3300003354 | Bacteria | 3068 |
| 35 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 36 | JGI25161J50226_1003544 | 3300003374 | Bacteria | 3532 |
| 37 | JGI25161J50226_1005059 | 3300003374 | Bacteria | 2639 |
| 38 | Ga0006562J51391_1039805 | 3300003578 | Bacteria | 9925 |
| 39 | Ga0006562J51391_1039806 | 3300003578 | Bacteria | 9600 |
| 40 | Ga0006562J51391_1066746 | 3300003578 | Bacteria | 3980 |
| 41 | Ga0006562J51391_1066748 | 3300003578 | Bacteria | 2040 |
| 42 | Ga0055539_1000219 | 3300003752 | Bacteria | 40919 |
| 43 | Ga0055533_1000008 | 3300003756 | Bacteria | 575861 |
| 44 | Ga0055525_1000054 | 3300003759 | Bacteria | 216523 |
| 45 | Ga0055525_1001100 | 3300003759 | Bacteria | 6698 |
| 46 | Ga0055535_1000271 | 3300003761 | Bacteria | 54319 |
| 47 | Ga0055535_1000995 | 3300003761 | Bacteria | 18294 |
| 48 | Ga0055535_1007207 | 3300003761 | Bacteria | 2149 |
| 49 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 50 | Ga0055529_1000321 | 3300003763 | Bacteria | 54307 |
| 51 | Ga0055526_1001240 | 3300003771 | Bacteria | 18300 |
| 52 | Ga0055526_1014459 | 3300003771 | Bacteria | 3245 |
| 53 | Ga0055526_1015438 | 3300003771 | Bacteria | 3065 |
| 54 | Ga0055526_1015538 | 3300003771 | Bacteria | 3051 |
| 55 | Ga0055526_1017593 | 3300003771 | Bacteria | 2723 |
| 56 | Ga0055537_1000356 | 3300003773 | Bacteria | 31055 |
| 57 | Ga0055537_1001103 | 3300003773 | Bacteria | 11701 |
| 58 | Ga0055537_1007183 | 3300003773 | Bacteria | 2723 |
| 59 | Ga0055524_1000140 | 3300003775 | Bacteria | 85990 |
| 60 | Ga0055524_1000213 | 3300003775 | Bacteria | 61225 |
| 61 | Ga0055524_1000550 | 3300003775 | Bacteria | 28332 |
| 62 | Ga0055524_1014230 | 3300003775 | Bacteria | 2959 |
| 63 | Ga0055524_1015505 | 3300003775 | Bacteria | 2774 |
| 64 | Ga0055536_1002468 | 3300003781 | Bacteria | 10386 |
| 65 | Ga0055536_1006719 | 3300003781 | Bacteria | 5284 |
| 66 | Ga0055536_1009794 | 3300003781 | Bacteria | 3906 |
| 67 | Ga0055536_1015963 | 3300003781 | Bacteria | 2539 |
| 68 | Ga0055536_1021287 | 3300003781 | Bacteria | 1972 |
| 69 | Ga0055534_1000346 | 3300003784 | Bacteria | 29725 |
| 70 | Ga0055534_1001067 | 3300003784 | Bacteria | 11831 |
| 71 | Ga0055534_1001587 | 3300003784 | Bacteria | 8817 |
| 72 | Ga0055534_1009018 | 3300003784 | Bacteria | 2204 |
| 73 | Ga0055528_1000846 | 3300003790 | Bacteria | 20747 |
| 74 | Ga0055528_1001593 | 3300003790 | Bacteria | 13457 |
| 75 | Ga0055528_1015691 | 3300003790 | Bacteria | 2723 |
| 76 | Ga0055530_10000763 | 3300003791 | Bacteria | 26793 |
| 77 | Ga0055530_10003145 | 3300003791 | Bacteria | 9734 |
| 78 | Ga0055530_10003770 | 3300003791 | Bacteria | 8359 |
| 79 | Ga0055530_10015503 | 3300003791 | Bacteria | 2483 |
| 80 | Ga0055540_1000133 | 3300003792 | Bacteria | 75104 |
| 81 | Ga0055540_1000504 | 3300003792 | Bacteria | 29761 |
| 82 | Ga0055540_1000765 | 3300003792 | Bacteria | 21856 |
| 83 | Ga0055540_1003891 | 3300003792 | Bacteria | 7009 |
| 84 | Ga0055540_1007562 | 3300003792 | Bacteria | 4069 |
| 85 | Ga0055540_1007906 | 3300003792 | Bacteria | 3918 |
| 86 | Ga0055540_1011179 | 3300003792 | Bacteria | 2918 |
| 87 | Ga0055531_10000469 | 3300003794 | Bacteria | 37355 |
| 88 | Ga0055531_10000973 | 3300003794 | Bacteria | 22864 |
| 89 | Ga0055531_10002263 | 3300003794 | Bacteria | 13024 |
| 90 | Ga0055531_10003310 | 3300003794 | Bacteria | 10312 |
| 91 | Ga0055531_10004604 | 3300003794 | Bacteria | 8305 |
| 92 | Ga0055531_10012397 | 3300003794 | Bacteria | 4014 |
| 93 | Ga0055531_10018174 | 3300003794 | Bacteria | 2918 |
| 94 | Ga0055531_10018180 | 3300003794 | Bacteria | 2918 |
| 95 | Ga0055543_1000061 | 3300004625 | Bacteria | 98138 |
| 96 | Ga0055543_1001261 | 3300004625 | Bacteria | 10444 |
| 97 | Ga0055543_1005771 | 3300004625 | Bacteria | 3106 |
| 98 | Ga0055543_1005778 | 3300004625 | Bacteria | 3103 |
| 99 | Ga0065165_1000474 | 3300005262 | Bacteria | 62687 |
| 100 | Ga0065165_1000621 | 3300005262 | Bacteria | 51523 |
| 101 | Ga0065165_1005479 | 3300005262 | Bacteria | 7103 |
| 102 | Ga0065165_1006179 | 3300005262 | Bacteria | 6391 |
| 103 | Ga0065165_1008900 | 3300005262 | Bacteria | 4605 |
| 104 | Ga0065165_1014201 | 3300005262 | Bacteria | 3106 |
| 105 | Ga0070658_10008606 | 3300005327 | Bacteria | 8205 |
| 106 | Ga0070658_10022214 | 3300005327 | Bacteria | 5091 |
| 107 | Ga0070658_10040585 | 3300005327 | Bacteria | 3755 |
| 108 | Ga0070658_10104791 | 3300005327 | Bacteria | 2340 |
| 109 | Ga0070676_10019300 | 3300005328 | Bacteria | 3792 |
| 110 | Ga0070676_10147765 | 3300005328 | Bacteria | 1502 |
| 111 | Ga0070690_100012795 | 3300005330 | Bacteria | 4943 |
| 112 | Ga0070670_100040263 | 3300005331 | Bacteria | 4019 |
| 113 | Ga0070670_100061187 | 3300005331 | Bacteria | 3232 |
| 114 | Ga0070670_100080010 | 3300005331 | Unclassified | 2808 |
| 115 | Ga0070670_100098308 | 3300005331 | Bacteria | 2518 |
| 116 | Ga0070670_100155303 | 3300005331 | Bacteria | 1981 |
| 117 | Ga0070670_100199120 | 3300005331 | Bacteria | 1740 |
| 118 | Ga0068869_100049108 | 3300005334 | Bacteria | 3053 |
| 119 | Ga0068869_100226830 | 3300005334 | Bacteria | 1483 |
| 120 | Ga0070666_10048516 | 3300005335 | Bacteria | 2853 |
| 121 | Ga0070666_10095199 | 3300005335 | Bacteria | 2049 |
| 122 | Ga0070680_100096268 | 3300005336 | Bacteria | 2454 |
| 123 | Ga0068868_100017925 | 3300005338 | Bacteria | 5283 |
| 124 | Ga0068868_100024364 | 3300005338 | Bacteria | 4592 |
| 125 | Ga0068868_100055588 | 3300005338 | Bacteria | 3123 |
| 126 | Ga0070660_100166540 | 3300005339 | Bacteria | 1778 |
| 127 | Ga0070689_100045943 | 3300005340 | Bacteria | 3364 |
| 128 | Ga0070689_100124259 | 3300005340 | Bacteria | 2064 |
| 129 | Ga0070661_100018267 | 3300005344 | Bacteria | 4984 |
| 130 | Ga0070661_100110471 | 3300005344 | Bacteria | 2052 |
| 131 | Ga0070668_100020579 | 3300005347 | Bacteria | 4981 |
| 132 | Ga0070675_100004369 | 3300005354 | Bacteria | 10783 |
| 133 | Ga0070675_100089027 | 3300005354 | Bacteria | 2584 |
| 134 | Ga0070675_100111069 | 3300005354 | Bacteria | 2319 |
| 135 | Ga0070675_100238362 | 3300005354 | Bacteria | 1589 |
| 136 | Ga0070671_100007073 | 3300005355 | Bacteria | 8988 |
| 137 | Ga0070671_100017702 | 3300005355 | Bacteria | 5775 |
| 138 | Ga0070671_100020190 | 3300005355 | Bacteria | 5430 |
| 139 | Ga0070671_100023028 | 3300005355 | Bacteria | 5091 |
| 140 | Ga0070674_100054573 | 3300005356 | Unclassified | 2764 |
| 141 | Ga0070674_100085143 | 3300005356 | Bacteria | 2268 |
| 142 | Ga0070673_100001467 | 3300005364 | Bacteria | 13796 |
| 143 | Ga0070673_100007248 | 3300005364 | Bacteria | 7298 |
| 144 | Ga0070673_100014291 | 3300005364 | Bacteria | 5522 |
| 145 | Ga0070673_100020089 | 3300005364 | Bacteria | 4810 |
| 146 | Ga0070659_100021184 | 3300005366 | Bacteria | 4946 |
| 147 | Ga0070659_100168799 | 3300005366 | Bacteria | 1791 |
| 148 | Ga0070667_100006934 | 3300005367 | Bacteria | 9413 |
| 149 | Ga0070667_100180339 | 3300005367 | Bacteria | 1867 |
| 150 | Ga0070667_100272942 | 3300005367 | Bacteria | 1517 |
| 151 | Ga0070714_100318394 | 3300005435 | Bacteria | 1454 |
| 152 | Ga0070663_100020950 | 3300005455 | Bacteria | 4338 |
| 153 | Ga0070663_100188131 | 3300005455 | Bacteria | 1605 |
| 154 | Ga0070678_100034556 | 3300005456 | Bacteria | 3522 |
| 155 | Ga0070662_100012766 | 3300005457 | Bacteria | 5576 |
| 156 | Ga0070662_100021970 | 3300005457 | Bacteria | 4362 |
| 157 | Ga0070662_100051373 | 3300005457 | Bacteria | 2976 |
| 158 | Ga0068867_100000245 | 3300005459 | Bacteria | 35758 |
| 159 | Ga0068867_100000605 | 3300005459 | Bacteria | 23775 |
| 160 | Ga0068867_100011924 | 3300005459 | Bacteria | 6141 |
| 161 | Ga0068867_100021133 | 3300005459 | Bacteria | 4643 |
| 162 | Ga0070706_100002995 | 3300005467 | Bacteria | 16740 |
| 163 | Ga0070707_100067782 | 3300005468 | Bacteria | 3434 |
| 164 | Ga0070679_100039040 | 3300005530 | Bacteria | 4720 |
| 165 | Ga0070684_100199409 | 3300005535 | Bacteria | 1823 |
| 166 | Ga0068853_100036201 | 3300005539 | Bacteria | 4195 |
| 167 | Ga0068853_100071427 | 3300005539 | Bacteria | 3023 |
| 168 | Ga0068853_100077168 | 3300005539 | Bacteria | 2910 |
| 169 | Ga0070672_100002136 | 3300005543 | Bacteria | 12474 |
| 170 | Ga0070672_100010450 | 3300005543 | Bacteria | 6441 |
| 171 | Ga0070672_100029290 | 3300005543 | Bacteria | 4128 |
| 172 | Ga0070672_100068866 | 3300005543 | Bacteria | 2808 |
| 173 | Ga0070672_100117681 | 3300005543 | Bacteria | 2172 |
| 174 | Ga0070665_100005540 | 3300005548 | Bacteria | 12985 |
| 175 | Ga0070665_100008298 | 3300005548 | Bacteria | 10503 |
| 176 | Ga0070665_100057790 | 3300005548 | Unclassified | 3889 |
| 177 | Ga0070665_100291979 | 3300005548 | Bacteria | 1633 |
| 178 | Ga0068855_100011340 | 3300005563 | Bacteria | 10760 |
| 179 | Ga0068855_100046322 | 3300005563 | Bacteria | 5141 |
| 180 | Ga0068855_100237784 | 3300005563 | Bacteria | 2036 |
| 181 | Ga0068855_100412193 | 3300005563 | Bacteria | 1479 |
| 182 | Ga0070664_100002435 | 3300005564 | Bacteria | 14972 |
| 183 | Ga0070664_100048553 | 3300005564 | Bacteria | 3587 |
| 184 | Ga0068857_100028700 | 3300005577 | Bacteria | 4909 |
| 185 | Ga0068857_100031742 | 3300005577 | Bacteria | 4669 |
| 186 | Ga0068857_100039422 | 3300005577 | Bacteria | 4184 |
| 187 | Ga0068857_100055364 | 3300005577 | Bacteria | 3520 |
| 188 | Ga0068854_100047028 | 3300005578 | Bacteria | 3074 |
| 189 | Ga0068854_100101013 | 3300005578 | Bacteria | 2163 |
| 190 | Ga0068854_100171813 | 3300005578 | Bacteria | 1687 |
| 191 | Ga0068856_100000135 | 3300005614 | Bacteria | 74419 |
| 192 | Ga0068856_100027773 | 3300005614 | Bacteria | 5521 |
| 193 | Ga0068856_100399115 | 3300005614 | Bacteria | 1395 |
| 194 | Ga0068852_100008014 | 3300005616 | Bacteria | 7748 |
| 195 | Ga0068852_100023462 | 3300005616 | Bacteria | 4966 |
| 196 | Ga0068852_100113592 | 3300005616 | Bacteria | 2467 |
| 197 | Ga0068852_100286729 | 3300005616 | Bacteria | 1589 |
| 198 | Ga0068864_100039478 | 3300005618 | Bacteria | 4035 |
| 199 | Ga0068861_100022363 | 3300005719 | Bacteria | 4554 |
| 200 | Ga0068851_10018422 | 3300005834 | Bacteria | 3362 |
| 201 | Ga0068851_10065776 | 3300005834 | Bacteria | 1867 |
| 202 | Ga0068863_100017699 | 3300005841 | Bacteria | 6821 |
| 203 | Ga0068858_100347127 | 3300005842 | Bacteria | 1421 |
| 204 | Ga0068860_100000384 | 3300005843 | Bacteria | 57893 |
| 205 | Ga0068860_100097440 | 3300005843 | Bacteria | 2804 |
| 206 | Ga0068860_100272194 | 3300005843 | Bacteria | 1653 |
| 207 | Ga0068862_100037567 | 3300005844 | Bacteria | 4104 |
| 208 | Ga0075365_10027748 | 3300006038 | Bacteria | 3605 |
| 209 | Ga0075365_10100168 | 3300006038 | Bacteria | 1983 |
| 210 | Ga0075368_10048762 | 3300006042 | Bacteria | 1679 |
| 211 | Ga0075363_100029235 | 3300006048 | Bacteria | 2843 |
| 212 | Ga0075363_100090501 | 3300006048 | Bacteria | 1683 |
| 213 | Ga0075363_100139801 | 3300006048 | Bacteria | 1363 |
| 214 | Ga0075364_10012964 | 3300006051 | Bacteria | 5117 |
| 215 | Ga0075364_10053774 | 3300006051 | Bacteria | 2632 |
| 216 | Ga0075364_10207369 | 3300006051 | Bacteria | 1329 |
| 217 | Ga0075362_10001785 | 3300006177 | Bacteria | 7012 |
| 218 | Ga0075362_10005324 | 3300006177 | Bacteria | 4700 |
| 219 | Ga0075362_10009607 | 3300006177 | Bacteria | 3747 |
| 220 | Ga0075362_10053518 | 3300006177 | Bacteria | 1812 |
| 221 | Ga0075367_10159630 | 3300006178 | Bacteria | 1402 |
| 222 | Ga0075369_10010982 | 3300006186 | Bacteria | 3552 |
| 223 | Ga0075369_10046293 | 3300006186 | Bacteria | 1873 |
| 224 | Ga0075366_10002666 | 3300006195 | Bacteria | 9199 |
| 225 | Ga0075366_10011244 | 3300006195 | Bacteria | 5051 |
| 226 | Ga0075366_10017453 | 3300006195 | Bacteria | 4130 |
| 227 | Ga0075366_10029529 | 3300006195 | Bacteria | 3221 |
| 228 | Ga0075366_10032812 | 3300006195 | Bacteria | 3057 |
| 229 | Ga0075366_10042553 | 3300006195 | Bacteria | 2689 |
| 230 | Ga0075366_10077926 | 3300006195 | Bacteria | 1978 |
| 231 | Ga0075366_10092230 | 3300006195 | Bacteria | 1815 |
| 232 | Ga0075366_10093239 | 3300006195 | Bacteria | 1805 |
| 233 | Ga0097621_100140511 | 3300006237 | Bacteria | 2063 |
| 234 | Ga0075370_10003469 | 3300006353 | Bacteria | 7514 |
| 235 | Ga0075370_10004178 | 3300006353 | Bacteria | 6967 |
| 236 | Ga0075370_10006062 | 3300006353 | Bacteria | 6058 |
| 237 | Ga0075370_10011470 | 3300006353 | Bacteria | 4658 |
| 238 | Ga0075370_10012670 | 3300006353 | Bacteria | 4463 |
| 239 | Ga0075370_10032077 | 3300006353 | Bacteria | 2935 |
| 240 | Ga0075370_10042272 | 3300006353 | Bacteria | 2575 |
| 241 | Ga0075429_100000224 | 3300006880 | Bacteria | 38311 |
| 242 | Ga0068865_100002745 | 3300006881 | Bacteria | 10461 |
| 243 | Ga0068865_100017355 | 3300006881 | Bacteria | 4629 |
| 244 | Ga0099823_1000005 | 3300006944 | Bacteria | 139631 |
| 245 | Ga0079104_1000053 | 3300006946 | Bacteria | 168604 |
| 246 | Ga0099826_10000959 | 3300006948 | Bacteria | 16025 |
| 247 | Ga0105244_10002315 | 3300009036 | Bacteria | 14476 |
| 248 | Ga0105240_10002477 | 3300009093 | Bacteria | 29680 |
| 249 | Ga0105240_10009882 | 3300009093 | Bacteria | 13462 |
| 250 | Ga0105240_10146487 | 3300009093 | Bacteria | 2817 |
| 251 | Ga0105240_10332956 | 3300009093 | Bacteria | 1727 |
| 252 | Ga0105240_10433567 | 3300009093 | Bacteria | 1474 |
| 253 | Ga0105245_10026119 | 3300009098 | Bacteria | 5139 |
| 254 | Ga0105245_10042445 | 3300009098 | Bacteria | 4059 |
| 255 | Ga0105245_10048303 | 3300009098 | Bacteria | 3807 |
| 256 | Ga0105243_10004228 | 3300009148 | Bacteria | 11379 |
| 257 | Ga0105243_10006082 | 3300009148 | Bacteria | 9332 |
| 258 | Ga0105243_10061212 | 3300009148 | Bacteria | 3010 |
| 259 | Ga0105243_10067374 | 3300009148 | Bacteria | 2882 |
| 260 | Ga0105243_10095301 | 3300009148 | Bacteria | 2459 |
| 261 | Ga0105243_10138475 | 3300009148 | Bacteria | 2073 |
| 262 | Ga0105243_10148545 | 3300009148 | Bacteria | 2008 |
| 263 | Ga0105241_10243781 | 3300009174 | Bacteria | 1520 |
| 264 | Ga0105241_10257780 | 3300009174 | Bacteria | 1481 |
| 265 | Ga0105242_10016941 | 3300009176 | Bacteria | 5671 |
| 266 | Ga0105248_10001355 | 3300009177 | Bacteria | 27299 |
| 267 | Ga0105237_10000668 | 3300009545 | Bacteria | 47303 |
| 268 | Ga0105237_10011246 | 3300009545 | Bacteria | 9474 |
| 269 | Ga0105237_10028106 | 3300009545 | Bacteria | 5731 |
| 270 | Ga0105237_10046071 | 3300009545 | Bacteria | 4387 |
| 271 | Ga0105238_10007313 | 3300009551 | Bacteria | 11057 |
| 272 | Ga0105238_10061434 | 3300009551 | Bacteria | 3760 |
| 273 | Ga0105238_10106330 | 3300009551 | Bacteria | 2788 |
| 274 | Ga0105238_10180384 | 3300009551 | Bacteria | 2088 |
| 275 | Ga0105249_10017117 | 3300009553 | Bacteria | 6433 |
| 276 | Ga0105239_10020399 | 3300010375 | Bacteria | 7311 |
| 277 | Ga0105239_10021874 | 3300010375 | Bacteria | 7050 |
| 278 | Ga0105239_10025029 | 3300010375 | Bacteria | 6576 |
| 279 | Ga0105239_10032539 | 3300010375 | Bacteria | 5730 |
| 280 | Ga0105246_10038570 | 3300011119 | Bacteria | 3214 |
| 281 | Ga0105246_10119579 | 3300011119 | Bacteria | 1950 |
| 282 | Ga0157317_1001054 | 3300012475 | Bacteria | 1405 |
| 283 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 284 | Ga0157373_10023614 | 3300013100 | Bacteria | 4456 |
| 285 | Ga0157371_10118626 | 3300013102 | Bacteria | 1881 |
| 286 | Ga0157370_10231461 | 3300013104 | Bacteria | 1710 |
| 287 | Ga0157369_10143197 | 3300013105 | Bacteria | 2528 |
| 288 | Ga0157369_10211029 | 3300013105 | Bacteria | 2035 |
| 289 | Ga0157374_10183833 | 3300013296 | Bacteria | 2043 |
| 290 | Ga0157378_10096431 | 3300013297 | Bacteria | 2695 |
| 291 | Ga0157378_10357565 | 3300013297 | Bacteria | 1428 |
| 292 | Ga0163162_10000794 | 3300013306 | Bacteria | 29387 |
| 293 | Ga0163162_10001355 | 3300013306 | Bacteria | 22806 |
| 294 | Ga0157372_10556056 | 3300013307 | Bacteria | 1338 |
| 295 | Ga0157375_10040833 | 3300013308 | Bacteria | 4475 |
| 296 | Ga0157375_10197055 | 3300013308 | Bacteria | 2169 |
| 297 | Ga0163163_10096492 | 3300014325 | Bacteria | 2976 |
| 298 | Ga0157380_10012894 | 3300014326 | Bacteria | 6076 |
| 299 | Ga0157380_10183432 | 3300014326 | Bacteria | 1841 |
| 300 | Ga0157380_10335850 | 3300014326 | Bacteria | 1407 |
| 301 | Ga0182008_10004921 | 3300014497 | Bacteria | 7702 |
| 302 | Ga0182008_10010747 | 3300014497 | Bacteria | 4891 |
| 303 | Ga0157377_10000034 | 3300014745 | Bacteria | 117744 |
| 304 | Ga0157379_10009090 | 3300014968 | Bacteria | 8659 |
| 305 | Ga0157379_10073730 | 3300014968 | Bacteria | 3055 |
| 306 | Ga0157379_10083761 | 3300014968 | Bacteria | 2858 |
| 307 | Ga0157376_10083963 | 3300014969 | Bacteria | 2741 |
| 308 | Ga0157376_10269892 | 3300014969 | Bacteria | 1598 |
| 309 | Ga0182006_1001345 | 3300015261 | Bacteria | 15063 |
| 310 | Ga0182006_1063506 | 3300015261 | Bacteria | 1387 |
| 311 | Ga0182007_10000317 | 3300015262 | Bacteria | 30601 |
| 312 | Ga0182007_10001372 | 3300015262 | Bacteria | 13100 |
| 313 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 314 | Ga0163161_10000361 | 3300017792 | Bacteria | 38156 |
| 315 | Ga0163161_10011636 | 3300017792 | Bacteria | 6108 |
| 316 | Ga0163161_10096335 | 3300017792 | Bacteria | 2196 |
| 317 | Ga0213872_10001003 | 3300021361 | Bacteria | 19713 |
| 318 | Ga0213872_10004509 | 3300021361 | Bacteria | 7376 |
| 319 | Ga0213872_10012188 | 3300021361 | Bacteria | 4053 |
| 320 | Ga0213872_10017132 | 3300021361 | Bacteria | 3353 |
| 321 | Ga0213876_10095098 | 3300021384 | Bacteria | 1578 |
| 322 | Ga0213875_10060163 | 3300021388 | Bacteria | 1777 |
| 323 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 324 | Ga0209674_100015 | 3300025226 | Bacteria | 697299 |
| 325 | Ga0209672_101139 | 3300025228 | Bacteria | 11037 |
| 326 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 327 | Ga0209563_100075 | 3300025230 | Bacteria | 216575 |
| 328 | Ga0207427_100444 | 3300025231 | Bacteria | 22994 |
| 329 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 330 | Ga0209258_100025 | 3300025242 | Bacteria | 534777 |
| 331 | Ga0209258_100726 | 3300025242 | Bacteria | 21958 |
| 332 | Ga0207425_1000570 | 3300025245 | Bacteria | 21658 |
| 333 | Ga0207425_1002945 | 3300025245 | Bacteria | 5699 |
| 334 | Ga0207425_1006495 | 3300025245 | Bacteria | 3192 |
| 335 | Ga0207425_1007181 | 3300025245 | Bacteria | 2969 |
| 336 | Ga0209646_1000079 | 3300025246 | Bacteria | 207677 |
| 337 | Ga0209646_1000438 | 3300025246 | Bacteria | 22604 |
| 338 | Ga0209026_1000028 | 3300025250 | Bacteria | 341399 |
| 339 | Ga0209026_1000067 | 3300025250 | Bacteria | 207677 |
| 340 | Ga0209677_100037 | 3300025253 | Bacteria | 286702 |
| 341 | Ga0209677_100113 | 3300025253 | Bacteria | 84174 |
| 342 | Ga0209677_101296 | 3300025253 | Bacteria | 11131 |
| 343 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 344 | Ga0209759_1000021 | 3300025256 | Bacteria | 341399 |
| 345 | Ga0209759_1000056 | 3300025256 | Bacteria | 207677 |
| 346 | Ga0209759_1001016 | 3300025256 | Bacteria | 18856 |
| 347 | Ga0209759_1001538 | 3300025256 | Bacteria | 12653 |
| 348 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 349 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 350 | Ga0209129_1002921 | 3300025258 | Bacteria | 7835 |
| 351 | Ga0209129_1011570 | 3300025258 | Bacteria | 2096 |
| 352 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 353 | Ga0209565_1000259 | 3300025263 | Bacteria | 56285 |
| 354 | Ga0209565_1000333 | 3300025263 | Bacteria | 42094 |
| 355 | Ga0209565_1002282 | 3300025263 | Bacteria | 7077 |
| 356 | Ga0209565_1004128 | 3300025263 | Bacteria | 4517 |
| 357 | Ga0209565_1007247 | 3300025263 | Bacteria | 3011 |
| 358 | Ga0209455_1000166 | 3300025272 | Bacteria | 113101 |
| 359 | Ga0209673_1000193 | 3300025273 | Bacteria | 123134 |
| 360 | Ga0209673_1000364 | 3300025273 | Bacteria | 81319 |
| 361 | Ga0209673_1004816 | 3300025273 | Bacteria | 7077 |
| 362 | Ga0209673_1005119 | 3300025273 | Bacteria | 6717 |
| 363 | Ga0209673_1014689 | 3300025273 | Bacteria | 3020 |
| 364 | Ga0209673_1021019 | 3300025273 | Bacteria | 2294 |
| 365 | Ga0209673_1033619 | 3300025273 | Bacteria | 1560 |
| 366 | Ga0209130_1000245 | 3300025284 | Bacteria | 68668 |
| 367 | Ga0209130_1000708 | 3300025284 | Bacteria | 29740 |
| 368 | Ga0209130_1001785 | 3300025284 | Bacteria | 12655 |
| 369 | Ga0209130_1002505 | 3300025284 | Bacteria | 9064 |
| 370 | Ga0209130_1002770 | 3300025284 | Bacteria | 8248 |
| 371 | Ga0209675_1000220 | 3300025291 | Bacteria | 59335 |
| 372 | Ga0209675_1000316 | 3300025291 | Bacteria | 43181 |
| 373 | Ga0209675_1003708 | 3300025291 | Bacteria | 7104 |
| 374 | Ga0209675_1015740 | 3300025291 | Bacteria | 2231 |
| 375 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 376 | Ga0209676_1000074 | 3300025292 | Bacteria | 305770 |
| 377 | Ga0209676_1000209 | 3300025292 | Bacteria | 130388 |
| 378 | Ga0209676_1000689 | 3300025292 | Bacteria | 47629 |
| 379 | Ga0209676_1002936 | 3300025292 | Bacteria | 11131 |
| 380 | Ga0209676_1006483 | 3300025292 | Bacteria | 5765 |
| 381 | Ga0209676_1014369 | 3300025292 | Bacteria | 2981 |
| 382 | Ga0209676_1027482 | 3300025292 | Bacteria | 1790 |
| 383 | Ga0209025_1000283 | 3300025294 | Bacteria | 114855 |
| 384 | Ga0209025_1001092 | 3300025294 | Bacteria | 39204 |
| 385 | Ga0209025_1001101 | 3300025294 | Bacteria | 38908 |
| 386 | Ga0209025_1003444 | 3300025294 | Bacteria | 14976 |
| 387 | Ga0209025_1003852 | 3300025294 | Bacteria | 13624 |
| 388 | Ga0209025_1022772 | 3300025294 | Bacteria | 3306 |
| 389 | Ga0209025_1025542 | 3300025294 | Bacteria | 3002 |
| 390 | Ga0209025_1029710 | 3300025294 | Bacteria | 2636 |
| 391 | Ga0209025_1054573 | 3300025294 | Bacteria | 1555 |
| 392 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 393 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 394 | Ga0209564_1000363 | 3300025295 | Bacteria | 84210 |
| 395 | Ga0209564_1001279 | 3300025295 | Bacteria | 27663 |
| 396 | Ga0209564_1001670 | 3300025295 | Bacteria | 21241 |
| 397 | Ga0209564_1003353 | 3300025295 | Bacteria | 11082 |
| 398 | Ga0209564_1013238 | 3300025295 | Bacteria | 3523 |
| 399 | Ga0209758_1000496 | 3300025297 | Bacteria | 64085 |
| 400 | Ga0209758_1000815 | 3300025297 | Bacteria | 43876 |
| 401 | Ga0209758_1000910 | 3300025297 | Bacteria | 40059 |
| 402 | Ga0209758_1009742 | 3300025297 | Bacteria | 5899 |
| 403 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 404 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 405 | Ga0209050_1000996 | 3300025298 | Bacteria | 35727 |
| 406 | Ga0209050_1001406 | 3300025298 | Bacteria | 26103 |
| 407 | Ga0209050_1002179 | 3300025298 | Bacteria | 17697 |
| 408 | Ga0209050_1002987 | 3300025298 | Bacteria | 13163 |
| 409 | Ga0209050_1006789 | 3300025298 | Bacteria | 6669 |
| 410 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 411 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 412 | Ga0209256_1000264 | 3300025299 | Bacteria | 92750 |
| 413 | Ga0209256_1000304 | 3300025299 | Bacteria | 85971 |
| 414 | Ga0209256_1000309 | 3300025299 | Bacteria | 85294 |
| 415 | Ga0209256_1001207 | 3300025299 | Bacteria | 28954 |
| 416 | Ga0209256_1027278 | 3300025299 | Bacteria | 1630 |
| 417 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 418 | Ga0207426_1000108 | 3300025302 | Bacteria | 242257 |
| 419 | Ga0207426_1000130 | 3300025302 | Bacteria | 210271 |
| 420 | Ga0207426_1002234 | 3300025302 | Bacteria | 12910 |
| 421 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 422 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 423 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 424 | Ga0209051_1000156 | 3300025303 | Bacteria | 128246 |
| 425 | Ga0209051_1000306 | 3300025303 | Bacteria | 77135 |
| 426 | Ga0209051_1000621 | 3300025303 | Bacteria | 40763 |
| 427 | Ga0209051_1000680 | 3300025303 | Bacteria | 37836 |
| 428 | Ga0209051_1001349 | 3300025303 | Bacteria | 21311 |
| 429 | Ga0209051_1006701 | 3300025303 | Bacteria | 6438 |
| 430 | Ga0209051_1019395 | 3300025303 | Bacteria | 2968 |
| 431 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 432 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 433 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 434 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 435 | Ga0209257_1000172 | 3300025304 | Bacteria | 167434 |
| 436 | Ga0209257_1000315 | 3300025304 | Bacteria | 102293 |
| 437 | Ga0209257_1000981 | 3300025304 | Bacteria | 38736 |
| 438 | Ga0209257_1003138 | 3300025304 | Bacteria | 14743 |
| 439 | Ga0209257_1014093 | 3300025304 | Bacteria | 3473 |
| 440 | Ga0209257_1016709 | 3300025304 | Bacteria | 2947 |
| 441 | Ga0207697_10000321 | 3300025315 | Bacteria | 26793 |
| 442 | Ga0207655_1001367 | 3300025728 | Bacteria | 22840 |
| 443 | Ga0207682_10029747 | 3300025893 | Bacteria | 2185 |
| 444 | Ga0207688_10001947 | 3300025901 | Bacteria | 11055 |
| 445 | Ga0207645_10005998 | 3300025907 | Bacteria | 8744 |
| 446 | Ga0207645_10045667 | 3300025907 | Bacteria | 2799 |
| 447 | Ga0207643_10030070 | 3300025908 | Bacteria | 3022 |
| 448 | Ga0207705_10019722 | 3300025909 | Bacteria | 4822 |
| 449 | Ga0207705_10166511 | 3300025909 | Bacteria | 1658 |
| 450 | Ga0207684_10045694 | 3300025910 | Bacteria | 3713 |
| 451 | Ga0207684_10049002 | 3300025910 | Bacteria | 3584 |
| 452 | Ga0207695_10004981 | 3300025913 | Bacteria | 17877 |
| 453 | Ga0207695_10007014 | 3300025913 | Bacteria | 14454 |
| 454 | Ga0207695_10047957 | 3300025913 | Bacteria | 4514 |
| 455 | Ga0207695_10057931 | 3300025913 | Bacteria | 4023 |
| 456 | Ga0207695_10124467 | 3300025913 | Bacteria | 2542 |
| 457 | Ga0207671_10021969 | 3300025914 | Bacteria | 4833 |
| 458 | Ga0207671_10145514 | 3300025914 | Bacteria | 1828 |
| 459 | Ga0207660_10061622 | 3300025917 | Bacteria | 2700 |
| 460 | Ga0207657_10017128 | 3300025919 | Bacteria | 6961 |
| 461 | Ga0207657_10105000 | 3300025919 | Bacteria | 2340 |
| 462 | Ga0207649_10000614 | 3300025920 | Bacteria | 24092 |
| 463 | Ga0207652_10069419 | 3300025921 | Bacteria | 3059 |
| 464 | Ga0207652_10076312 | 3300025921 | Bacteria | 2922 |
| 465 | Ga0207681_10079142 | 3300025923 | Bacteria | 2315 |
| 466 | Ga0207681_10191266 | 3300025923 | Bacteria | 1566 |
| 467 | Ga0207694_10028649 | 3300025924 | Bacteria | 4246 |
| 468 | Ga0207650_10054134 | 3300025925 | Bacteria | 2975 |
| 469 | Ga0207650_10071989 | 3300025925 | Bacteria | 2601 |
| 470 | Ga0207659_10228316 | 3300025926 | Bacteria | 1500 |
| 471 | Ga0207659_10252640 | 3300025926 | Bacteria | 1431 |
| 472 | Ga0207687_10009833 | 3300025927 | Bacteria | 6260 |
| 473 | Ga0207687_10038401 | 3300025927 | Bacteria | 3272 |
| 474 | Ga0207687_10115900 | 3300025927 | Bacteria | 1996 |
| 475 | Ga0207687_10250675 | 3300025927 | Bacteria | 1407 |
| 476 | Ga0207664_10029018 | 3300025929 | Bacteria | 4212 |
| 477 | Ga0207644_10017792 | 3300025931 | Bacteria | 4806 |
| 478 | Ga0207644_10026836 | 3300025931 | Bacteria | 3975 |
| 479 | Ga0207644_10158156 | 3300025931 | Bacteria | 1759 |
| 480 | Ga0207690_10009309 | 3300025932 | Bacteria | 5835 |
| 481 | Ga0207690_10013071 | 3300025932 | Bacteria | 4980 |
| 482 | Ga0207706_10002180 | 3300025933 | Bacteria | 19100 |
| 483 | Ga0207706_10032088 | 3300025933 | Bacteria | 4677 |
| 484 | Ga0207706_10173593 | 3300025933 | Bacteria | 1894 |
| 485 | Ga0207686_10000960 | 3300025934 | Bacteria | 17164 |
| 486 | Ga0207709_10000433 | 3300025935 | Bacteria | 39614 |
| 487 | Ga0207709_10000838 | 3300025935 | Bacteria | 23593 |
| 488 | Ga0207709_10001092 | 3300025935 | Bacteria | 19873 |
| 489 | Ga0207709_10012723 | 3300025935 | Bacteria | 4639 |
| 490 | Ga0207709_10061034 | 3300025935 | Bacteria | 2354 |
| 491 | Ga0207669_10049782 | 3300025937 | Bacteria | 2500 |
| 492 | Ga0207704_10023252 | 3300025938 | Bacteria | 3337 |
| 493 | Ga0207665_10145960 | 3300025939 | Bacteria | 1691 |
| 494 | Ga0207691_10004655 | 3300025940 | Bacteria | 13284 |
| 495 | Ga0207691_10005007 | 3300025940 | Bacteria | 12778 |
| 496 | Ga0207711_10146343 | 3300025941 | Bacteria | 2129 |
| 497 | Ga0207689_10018687 | 3300025942 | Bacteria | 5847 |
| 498 | Ga0207689_10169441 | 3300025942 | Bacteria | 1799 |
| 499 | Ga0207661_10133563 | 3300025944 | Bacteria | 2129 |
| 500 | Ga0207679_10000077 | 3300025945 | Bacteria | 86432 |
| 501 | Ga0207679_10095392 | 3300025945 | Bacteria | 2312 |
| 502 | Ga0207679_10125626 | 3300025945 | Bacteria | 2049 |
| 503 | Ga0207667_10003517 | 3300025949 | Bacteria | 19368 |
| 504 | Ga0207667_10040596 | 3300025949 | Bacteria | 4955 |
| 505 | Ga0207667_10189447 | 3300025949 | Bacteria | 2111 |
| 506 | Ga0207667_10297476 | 3300025949 | Bacteria | 1649 |
| 507 | Ga0207651_10004806 | 3300025960 | Bacteria | 6875 |
| 508 | Ga0207651_10078807 | 3300025960 | Bacteria | 2364 |
| 509 | Ga0207651_10232572 | 3300025960 | Bacteria | 1497 |
| 510 | Ga0207712_10009930 | 3300025961 | Bacteria | 6033 |
| 511 | Ga0207640_10032295 | 3300025981 | Bacteria | 3245 |
| 512 | Ga0207640_10133252 | 3300025981 | Bacteria | 1799 |
| 513 | Ga0207658_10029648 | 3300025986 | Bacteria | 3867 |
| 514 | Ga0207658_10036634 | 3300025986 | Bacteria | 3518 |
| 515 | Ga0207677_10021042 | 3300026023 | Bacteria | 3977 |
| 516 | Ga0207677_10028704 | 3300026023 | Bacteria | 3524 |
| 517 | Ga0207703_10041044 | 3300026035 | Bacteria | 3706 |
| 518 | Ga0207639_10040814 | 3300026041 | Bacteria | 3466 |
| 519 | Ga0207678_10037832 | 3300026067 | Bacteria | 4196 |
| 520 | Ga0207678_10052599 | 3300026067 | Bacteria | 3512 |
| 521 | Ga0207678_10061958 | 3300026067 | Bacteria | 3217 |
| 522 | Ga0207708_10060111 | 3300026075 | Bacteria | 2901 |
| 523 | Ga0207702_10001523 | 3300026078 | Bacteria | 22929 |
| 524 | Ga0207702_10024832 | 3300026078 | Bacteria | 4972 |
| 525 | Ga0207702_10136882 | 3300026078 | Bacteria | 2211 |
| 526 | Ga0207702_10196605 | 3300026078 | Bacteria | 1867 |
| 527 | Ga0207648_10000054 | 3300026089 | Bacteria | 106684 |
| 528 | Ga0207648_10002852 | 3300026089 | Bacteria | 18291 |
| 529 | Ga0207648_10004823 | 3300026089 | Bacteria | 13753 |
| 530 | Ga0207648_10016725 | 3300026089 | Bacteria | 6693 |
| 531 | Ga0207648_10030389 | 3300026089 | Bacteria | 4785 |
| 532 | Ga0207648_10149976 | 3300026089 | Bacteria | 2057 |
| 533 | Ga0207676_10027619 | 3300026095 | Bacteria | 4229 |
| 534 | Ga0207676_10054808 | 3300026095 | Bacteria | 3126 |
| 535 | Ga0207676_10280172 | 3300026095 | Bacteria | 1513 |
| 536 | Ga0207674_10005841 | 3300026116 | Bacteria | 14594 |
| 537 | Ga0207674_10008175 | 3300026116 | Bacteria | 12132 |
| 538 | Ga0207674_10016268 | 3300026116 | Bacteria | 8147 |
| 539 | Ga0207674_10054882 | 3300026116 | Bacteria | 4054 |
| 540 | Ga0207675_100025649 | 3300026118 | Bacteria | 5486 |
| 541 | Ga0207675_100036742 | 3300026118 | Bacteria | 4569 |
| 542 | Ga0207683_10023817 | 3300026121 | Bacteria | 5267 |
| 543 | Ga0207683_10136967 | 3300026121 | Bacteria | 2204 |
| 544 | Ga0207683_10296511 | 3300026121 | Bacteria | 1479 |
| 545 | Ga0207698_10019411 | 3300026142 | Bacteria | 4654 |
| 546 | Ga0207698_10035266 | 3300026142 | Bacteria | 3657 |
| 547 | Ga0207698_10036734 | 3300026142 | Bacteria | 3600 |
| 548 | Ga0207698_10050766 | 3300026142 | Bacteria | 3167 |
| 549 | Ga0207698_10175478 | 3300026142 | Bacteria | 1892 |
| 550 | Ga0207698_10191700 | 3300026142 | Bacteria | 1821 |
| 551 | Ga0207698_10339731 | 3300026142 | Bacteria | 1414 |
| 552 | Ga0209281_1000147 | 3300027111 | Bacteria | 168586 |
| 553 | Ga0209389_1000295 | 3300027296 | Bacteria | 31035 |
| 554 | Ga0209968_1000628 | 3300027526 | Bacteria | 5458 |
| 555 | Ga0209970_1001072 | 3300027614 | Bacteria | 4837 |
| 556 | Ga0209282_1000107 | 3300027666 | Bacteria | 54230 |
| 557 | Ga0209966_1000117 | 3300027695 | Bacteria | 35145 |
| 558 | Ga0209974_10032873 | 3300027876 | Bacteria | 1720 |
| 559 | Ga0268266_10005478 | 3300028379 | Bacteria | 11822 |
| 560 | Ga0268266_10030341 | 3300028379 | Bacteria | 4593 |
| 561 | Ga0268266_10042256 | 3300028379 | Unclassified | 3893 |
| 562 | Ga0268265_10003306 | 3300028380 | Bacteria | 11674 |
| 563 | Ga0268265_10135271 | 3300028380 | Bacteria | 2055 |
| 564 | Ga0268265_10181367 | 3300028380 | Bacteria | 1809 |
| 565 | Ga0268264_10001034 | 3300028381 | Bacteria | 27952 |
| 566 | Ga0268264_10062691 | 3300028381 | Bacteria | 3123 |
| 567 | Ga0268264_10095775 | 3300028381 | Bacteria | 2569 |
| 568 | Ga0265336_10000274 | 3300028666 | Bacteria | 36140 |
| 569 | Ga0307517_10072069 | 3300028786 | Bacteria | 3085 |
| 570 | Ga0307517_10121377 | 3300028786 | Bacteria | 1930 |
| 571 | Ga0307515_10000139 | 3300028794 | Bacteria | 173074 |
| 572 | Ga0307515_10004822 | 3300028794 | Bacteria | 27609 |
| 573 | Ga0307515_10005936 | 3300028794 | Bacteria | 24621 |
| 574 | Ga0307515_10011641 | 3300028794 | Bacteria | 16669 |
| 575 | Ga0307515_10060941 | 3300028794 | Bacteria | 5367 |
| 576 | Ga0307515_10081261 | 3300028794 | Bacteria | 4212 |
| 577 | Ga0307515_10157352 | 3300028794 | Bacteria | 2337 |
| 578 | Ga0265324_10022676 | 3300029957 | Bacteria | 2242 |
| 579 | Ga0307512_10010416 | 3300030522 | Bacteria | 8867 |
| 580 | Ga0307512_10044434 | 3300030522 | Bacteria | 3652 |
| 581 | Ga0316177_1147685 | 3300030731 | Bacteria | 2456 |
| 582 | Ga0316176_1019717 | 3300030732 | Bacteria | 5051 |
| 583 | Ga0316179_1045655 | 3300030734 | Bacteria | 1476 |
| 584 | Ga0316183_1086347 | 3300030742 | Bacteria | 2728 |
| 585 | Ga0316182_1395773 | 3300030745 | Bacteria | 1404 |
| 586 | Ga0265330_10000174 | 3300031235 | Bacteria | 49860 |
| 587 | Ga0265330_10009612 | 3300031235 | Bacteria | 4589 |
| 588 | Ga0265332_10000048 | 3300031238 | Bacteria | 113285 |
| 589 | Ga0265328_10006713 | 3300031239 | Bacteria | 4846 |
| 590 | Ga0265328_10019614 | 3300031239 | Bacteria | 2595 |
| 591 | Ga0265325_10006440 | 3300031241 | Bacteria | 7119 |
| 592 | Ga0265331_10022083 | 3300031250 | Bacteria | 3250 |
| 593 | Ga0265327_10000080 | 3300031251 | Bacteria | 206086 |
| 594 | Ga0265327_10000925 | 3300031251 | Bacteria | 42948 |
| 595 | Ga0265327_10002797 | 3300031251 | Bacteria | 17626 |
| 596 | Ga0265327_10011216 | 3300031251 | Bacteria | 6206 |
| 597 | Ga0265316_10000176 | 3300031344 | Bacteria | 72297 |
| 598 | Ga0307513_10004491 | 3300031456 | Bacteria | 18612 |
| 599 | Ga0307513_10004870 | 3300031456 | Bacteria | 17818 |
| 600 | Ga0307513_10005821 | 3300031456 | Bacteria | 16188 |
| 601 | Ga0307513_10008739 | 3300031456 | Bacteria | 12903 |
| 602 | Ga0307513_10046962 | 3300031456 | Bacteria | 4702 |
| 603 | Ga0307513_10086947 | 3300031456 | Bacteria | 3202 |
| 604 | Ga0307509_10000698 | 3300031507 | Bacteria | 57430 |
| 605 | Ga0307509_10039083 | 3300031507 | Bacteria | 5172 |
| 606 | Ga0307509_10250815 | 3300031507 | Bacteria | 1554 |
| 607 | Ga0307408_100000012 | 3300031548 | Bacteria | 408153 |
| 608 | Ga0307408_100031021 | 3300031548 | Bacteria | 3717 |
| 609 | Ga0307408_100060389 | 3300031548 | Bacteria | 2763 |
| 610 | Ga0307408_100159554 | 3300031548 | Bacteria | 1790 |
| 611 | Ga0307408_100178395 | 3300031548 | Bacteria | 1701 |
| 612 | Ga0307408_100229417 | 3300031548 | Bacteria | 1519 |
| 613 | Ga0307508_10000504 | 3300031616 | Bacteria | 46711 |
| 614 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 615 | Ga0307514_10002566 | 3300031649 | Bacteria | 18663 |
| 616 | Ga0307514_10003227 | 3300031649 | Bacteria | 15920 |
| 617 | Ga0307514_10007369 | 3300031649 | Bacteria | 9478 |
| 618 | Ga0265314_10000132 | 3300031711 | Bacteria | 113285 |
| 619 | Ga0265314_10000882 | 3300031711 | Bacteria | 35754 |
| 620 | Ga0307516_10001199 | 3300031730 | Bacteria | 36246 |
| 621 | Ga0307516_10007072 | 3300031730 | Bacteria | 12977 |
| 622 | Ga0307516_10034081 | 3300031730 | Bacteria | 5120 |
| 623 | Ga0307516_10041822 | 3300031730 | Bacteria | 4551 |
| 624 | Ga0307516_10133884 | 3300031730 | Bacteria | 2255 |
| 625 | Ga0307516_10256683 | 3300031730 | Bacteria | 1440 |
| 626 | Ga0307405_10071205 | 3300031731 | Bacteria | 2236 |
| 627 | Ga0307410_10016446 | 3300031852 | Bacteria | 4413 |
| 628 | Ga0307406_10020825 | 3300031901 | Bacteria | 3869 |
| 629 | Ga0307406_10101144 | 3300031901 | Bacteria | 1964 |
| 630 | Ga0307412_10086029 | 3300031911 | Bacteria | 2186 |
| 631 | Ga0307412_10093686 | 3300031911 | Bacteria | 2107 |
| 632 | Ga0307416_100018698 | 3300032002 | Bacteria | 4891 |
| 633 | Ga0307416_100070883 | 3300032002 | Bacteria | 2892 |
| 634 | Ga0307416_100092169 | 3300032002 | Bacteria | 2605 |
| 635 | Ga0307416_100219979 | 3300032002 | Bacteria | 1820 |
| 636 | Ga0307414_10035032 | 3300032004 | Bacteria | 3336 |
| 637 | Ga0307414_10066493 | 3300032004 | Bacteria | 2577 |
| 638 | Ga0307411_10005248 | 3300032005 | Bacteria | 6340 |
| 639 | Ga0307411_10092065 | 3300032005 | Bacteria | 2119 |
| 640 | Ga0316593_10018061 | 3300032168 | Bacteria | 2161 |
| 641 | Ga0307507_10080161 | 3300033179 | Bacteria | 2880 |
| 642 | Ga0307510_10000426 | 3300033180 | Bacteria | 40466 |
| 643 | Ga0307510_10027810 | 3300033180 | Bacteria | 6469 |
| 644 | Ga0307510_10033683 | 3300033180 | Bacteria | 5750 |
| 645 | Ga0373939_0000047 | 3300035114 | Bacteria | 43790 |
| 646 | Ga0373960_0001152 | 3300035121 | Bacteria | 5741 |
| 647 | Ga0373961_0020937 | 3300035241 | Bacteria | 1734 |
| 648 | Ga0373931_0000579 | 3300035691 | Bacteria | 15108 |
| 649 | Ga0373931_0022811 | 3300035691 | Bacteria | 3153 |
| 650 | Ga0373931_0054113 | 3300035691 | Bacteria | 2144 |
| 651 | Ga0316582_0140047 | 3300036647 | Bacteria | 1630 |
| 652 | Ga0395899_0008314 | 3300037312 | Bacteria | 7987 |
| 653 | Ga0395899_0014983 | 3300037312 | Bacteria | 5913 |
| 654 | Ga0395900_0001308 | 3300037418 | Bacteria | 30266 |
| 655 | Ga0395900_0019620 | 3300037418 | Bacteria | 6893 |
| 656 | Ga0395900_0036461 | 3300037418 | Bacteria | 5070 |
| 657 | Ga0395900_0092989 | 3300037418 | Bacteria | 3098 |
| 658 | Ga0395898_0002912 | 3300037466 | Bacteria | 19475 |
| 659 | Ga0395898_0008455 | 3300037466 | Bacteria | 10879 |
| 660 | Ga0395898_0013070 | 3300037466 | Bacteria | 8557 |
| 661 | Ga0395898_0025264 | 3300037466 | Bacteria | 5987 |
| 662 | Ga0395898_0028823 | 3300037466 | Bacteria | 5565 |
| 663 | Ga0395905_0000432 | 3300037471 | Bacteria | 58505 |
| 664 | Ga0395905_0000504 | 3300037471 | Bacteria | 53598 |
| 665 | Ga0395905_0002540 | 3300037471 | Bacteria | 20135 |
| 666 | Ga0395905_0004034 | 3300037471 | Bacteria | 15413 |
| 667 | Ga0395905_0005387 | 3300037471 | Bacteria | 13076 |
| 668 | Ga0395905_0011861 | 3300037471 | Bacteria | 8413 |
| 669 | Ga0395905_0028947 | 3300037471 | Bacteria | 5221 |
| 670 | Ga0395905_0029755 | 3300037471 | Bacteria | 5147 |
| 671 | Ga0395905_0034159 | 3300037471 | Bacteria | 4774 |
| 672 | Ga0395905_0038030 | 3300037471 | Bacteria | 4514 |
| 673 | Ga0395905_0040851 | 3300037471 | Bacteria | 4351 |
| 674 | Ga0395905_0061234 | 3300037471 | Bacteria | 3520 |
| 675 | Ga0395905_0083148 | 3300037471 | Bacteria | 2999 |
| 676 | Ga0395905_0128803 | 3300037471 | Bacteria | 2380 |
| 677 | Ga0316581_0007161 | 3300037588 | Bacteria | 2983 |
| 678 | Ga0436364_0241783 | 3300037853 | Bacteria | 3108 |
| 679 | Ga0436364_1356834 | 3300037853 | Bacteria | 1508 |
| 680 | Ga0395901_0006507 | 3300038443 | Bacteria | 11821 |
| 681 | Ga0395901_0024911 | 3300038443 | Bacteria | 6142 |
| 682 | Ga0395901_0053630 | 3300038443 | Bacteria | 4189 |
| 683 | Ga0395901_0084582 | 3300038443 | Bacteria | 3315 |
| 684 | Ga0395901_0359346 | 3300038443 | Bacteria | 1502 |
| 685 | Ga0400483_062160 | 3300039062 | Bacteria | 34333 |
| 686 | Ga0400483_158300 | 3300039062 | Bacteria | 14388 |
| 687 | Ga0400483_160107 | 3300039062 | Bacteria | 13880 |
| 688 | Ga0436365_0112515 | 3300039437 | Bacteria | 3551 |
| 689 | Ga0436365_0287923 | 3300039437 | Bacteria | 2883 |
| 690 | Ga0436365_0974771 | 3300039437 | Bacteria | 5898 |
| 691 | Ga0436361_0156562 | 3300039447 | Bacteria | 6162 |
| 692 | Ga0436361_0264437 | 3300039447 | Bacteria | 60444 |
| 693 | Ga0436361_0272384 | 3300039447 | Bacteria | 13210 |
| 694 | Ga0436361_0827051 | 3300039447 | Bacteria | 2739 |
| 695 | Ga0439436_0011478 | 3300041404 | Bacteria | 2691 |
| 696 | Ga0439436_0020293 | 3300041404 | Bacteria | 1980 |
| 697 | Ga0439466_0018087 | 3300041411 | Bacteria | 2531 |
| 698 | Ga0439465_0007667 | 3300041413 | Bacteria | 3425 |
| 699 | Ga0451793_1547269 | 3300041452 | Bacteria | 2343 |
| 700 | Ga0451839_1626730 | 3300041496 | Bacteria | 1658 |
| 701 | Ga0451851_0584746 | 3300041507 | Bacteria | 1480 |
| 702 | Ga0439442_001212 | 3300042002 | Bacteria | 5132 |
| 703 | Ga0439442_002138 | 3300042002 | Bacteria | 3887 |
| 704 | Ga0439445_0023936 | 3300042004 | Bacteria | 1549 |
| 705 | Ga0439445_0025144 | 3300042004 | Bacteria | 1518 |
| 706 | Ga0439432_009856 | 3300042006 | Bacteria | 3323 |
| 707 | Ga0439449_0003996 | 3300042007 | Bacteria | 5704 |
| 708 | Ga0439452_006839 | 3300042010 | Bacteria | 3540 |
| 709 | Ga0439462_0001911 | 3300042015 | Bacteria | 4744 |
| 710 | Ga0450911_001157 | 3300042115 | Bacteria | 6505 |
| 711 | Ga0450917_000309 | 3300042120 | Bacteria | 3601 |
| 712 | Ga0450919_000132 | 3300042121 | Bacteria | 7624 |
| 713 | Ga0450920_005304 | 3300042122 | Bacteria | 2286 |
| 714 | Ga0450920_010904 | 3300042122 | Bacteria | 1688 |
| 715 | Ga0450923_000606 | 3300042125 | Bacteria | 4119 |
| 716 | Ga0450923_001222 | 3300042125 | Bacteria | 3316 |
| 717 | Ga0450888_000258 | 3300042126 | Bacteria | 4916 |
| 718 | Ga0450890_000482 | 3300042127 | Bacteria | 5846 |
| 719 | Ga0450890_001454 | 3300042127 | Bacteria | 3406 |
| 720 | Ga0450890_001951 | 3300042127 | Bacteria | 2915 |
| 721 | Ga0450891_001653 | 3300042129 | Bacteria | 2295 |
| 722 | Ga0450892_000718 | 3300042130 | Bacteria | 3697 |
| 723 | Ga0450894_002761 | 3300042131 | Bacteria | 2328 |
| 724 | Ga0450896_002019 | 3300042133 | Bacteria | 2584 |
| 725 | Ga0450898_001291 | 3300042134 | Bacteria | 3265 |
| 726 | Ga0450898_011820 | 3300042134 | Bacteria | 1435 |
| 727 | Ga0450889_000025 | 3300042144 | Bacteria | 12924 |
| 728 | Ga0450906_000686 | 3300042145 | Bacteria | 7259 |
| 729 | Ga0450906_001537 | 3300042145 | Bacteria | 5042 |
| 730 | Ga0450910_000244 | 3300042147 | Bacteria | 6237 |
| 731 | Ga0450908_000233 | 3300042184 | Bacteria | 11214 |
| 732 | Ga0450908_008161 | 3300042184 | Bacteria | 1964 |
| 733 | Ga0450909_010803 | 3300042185 | Bacteria | 1336 |
| 734 | Ga0439459_0000990 | 3300042438 | Bacteria | 4030 |
| 735 | Ga0450916_005246 | 3300042530 | Bacteria | 1493 |
| 736 | Ga0450918_000057 | 3300042531 | Bacteria | 22722 |
| 737 | Ga0450918_004991 | 3300042531 | Bacteria | 2391 |
| 738 | Ga0450893_0002098 | 3300042532 | Bacteria | 3104 |
| 739 | Ga0451577_0000126 | 3300042876 | Bacteria | 168037 |
| 740 | Ga0451577_0006685 | 3300042876 | Bacteria | 11445 |
| 741 | Ga0451577_0018745 | 3300042876 | Bacteria | 6367 |
| 742 | Ga0451577_0086850 | 3300042876 | Bacteria | 2791 |
| 743 | Ga0466969_0000018 | 3300044656 | Bacteria | 102911 |
| 744 | Ga0466969_0007499 | 3300044656 | Bacteria | 5800 |
| 745 | Ga0466969_0024919 | 3300044656 | Bacteria | 3076 |
| 746 | Ga0466972_0005104 | 3300044658 | Bacteria | 6575 |
| 747 | Ga0453683_0007182 | 3300044673 | Bacteria | 7590 |
| 748 | Ga0466965_0054848 | 3300044683 | Bacteria | 1982 |
| 749 | Ga0466966_0014306 | 3300044684 | Bacteria | 5253 |
| 750 | Ga0466966_0035444 | 3300044684 | Bacteria | 3222 |
| 751 | Ga0466966_0123612 | 3300044684 | Bacteria | 1588 |
| 752 | Ga0466961_0006521 | 3300044693 | Bacteria | 7416 |
| 753 | Ga0466961_0046171 | 3300044693 | Bacteria | 2786 |
| 754 | Ga0466961_0078138 | 3300044693 | Bacteria | 2096 |
| 755 | Ga0466963_0017494 | 3300044694 | Bacteria | 4469 |
| 756 | Ga0466963_0066522 | 3300044694 | Bacteria | 2417 |
| 757 | Ga0466963_0089148 | 3300044694 | Bacteria | 2098 |
| 758 | Ga0466964_0016300 | 3300044706 | Bacteria | 2836 |
| 759 | Ga0453684_0000365 | 3300044712 | Bacteria | 186233 |
| 760 | Ga0453684_0008286 | 3300044712 | Bacteria | 18722 |
| 761 | Ga0453684_0026097 | 3300044712 | Bacteria | 8456 |
| 762 | Ga0453684_0035441 | 3300044712 | Bacteria | 6896 |
| 763 | Ga0466971_0034133 | 3300044719 | Bacteria | 2280 |
| 764 | Ga0466968_0016365 | 3300044735 | Bacteria | 2952 |
| 765 | Ga0466968_0043870 | 3300044735 | Bacteria | 1894 |
| 766 | Ga0466970_0048635 | 3300044765 | Bacteria | 2261 |
| 767 | Ga0466970_0049986 | 3300044765 | Bacteria | 2230 |
| 768 | Ga0466957_0004358 | 3300044842 | Bacteria | 7868 |
| 769 | Ga0466959_0009769 | 3300045049 | Bacteria | 6835 |
| 770 | Ga0466959_0024616 | 3300045049 | Bacteria | 4460 |
| 771 | Ga0466959_0031472 | 3300045049 | Bacteria | 3924 |
| 772 | Ga0466959_0167643 | 3300045049 | Bacteria | 1541 |
| 773 | Ga0451576_0000627 | 3300045051 | Bacteria | 73597 |
| 774 | Ga0451576_0010718 | 3300045051 | Bacteria | 10495 |
| 775 | Ga0451576_0048235 | 3300045051 | Bacteria | 4475 |
| 776 | Ga0451576_0065287 | 3300045051 | Bacteria | 3790 |
| 777 | Ga0451576_0073572 | 3300045051 | Bacteria | 3556 |
| 778 | Ga0451576_0085485 | 3300045051 | Bacteria | 3281 |
| 779 | Ga0451576_0126862 | 3300045051 | Bacteria | 2659 |
| 780 | Ga0466958_0009242 | 3300045836 | Bacteria | 5487 |
| 781 | Ga0495592_0000499 | 3300046454 | Bacteria | 28648 |
| 782 | Ga0495590_0003163 | 3300046457 | Bacteria | 6732 |
| 783 | Ga0495638_0030970 | 3300046460 | Bacteria | 3440 |
| 784 | Ga0495638_0077223 | 3300046460 | Bacteria | 2028 |
| 785 | Ga0495650_0009623 | 3300046471 | Bacteria | 5479 |
| 786 | Ga0495650_0065547 | 3300046471 | Bacteria | 1441 |
| 787 | Ga0495583_0000428 | 3300046506 | Bacteria | 63526 |
| 788 | Ga0495606_0000821 | 3300046507 | Bacteria | 47099 |
| 789 | Ga0495608_0066591 | 3300046511 | Bacteria | 2358 |
| 790 | Ga0495610_0019230 | 3300046512 | Bacteria | 3830 |
| 791 | Ga0495616_0001020 | 3300046513 | Bacteria | 20032 |
| 792 | Ga0495620_0016702 | 3300046515 | Bacteria | 3677 |
| 793 | Ga0495631_0000803 | 3300046518 | Bacteria | 20026 |
| 794 | Ga0495632_0002352 | 3300046519 | Bacteria | 14499 |
| 795 | Ga0495632_0020371 | 3300046519 | Bacteria | 3591 |
| 796 | Ga0495632_0106906 | 3300046519 | Bacteria | 1316 |
| 797 | Ga0495637_0002174 | 3300046520 | Bacteria | 10964 |
| 798 | Ga0495643_0033985 | 3300046522 | Bacteria | 2816 |
| 799 | Ga0495654_0001492 | 3300046530 | Bacteria | 16011 |
| 800 | Ga0495654_0018028 | 3300046530 | Bacteria | 3703 |
| 801 | Ga0495621_0009162 | 3300046539 | Bacteria | 2996 |
| 802 | Ga0495621_0027194 | 3300046539 | Bacteria | 1935 |
| 803 | Ga0495597_0007542 | 3300046542 | Bacteria | 5516 |
| 804 | Ga0495645_0037182 | 3300046543 | Bacteria | 3548 |
| 805 | Ga0495656_0001009 | 3300046615 | Bacteria | 9102 |
| 806 | Ga0495668_0017953 | 3300046616 | Bacteria | 4097 |
| 807 | Ga0495668_0021362 | 3300046616 | Bacteria | 3713 |
| 808 | Ga0495625_0000098 | 3300046660 | Bacteria | 140987 |
| 809 | Ga0495625_0000827 | 3300046660 | Bacteria | 42621 |
| 810 | Ga0495625_0013529 | 3300046660 | Bacteria | 6549 |
| 811 | Ga0495625_0091088 | 3300046660 | Bacteria | 2108 |
| 812 | Ga0495659_0048833 | 3300046664 | Bacteria | 1535 |
| 813 | Ga0495588_0053425 | 3300046674 | Bacteria | 2083 |
| 814 | Ga0495647_0005177 | 3300046681 | Bacteria | 4272 |
| 815 | Ga0495658_0032461 | 3300046683 | Bacteria | 2851 |
| 816 | Ga0495669_0041763 | 3300046684 | Bacteria | 2038 |
| 817 | Ga0495671_0006329 | 3300046692 | Bacteria | 6847 |
| 818 | Ga0495649_0000380 | 3300046694 | Bacteria | 38612 |
| 819 | Ga0495649_0003008 | 3300046694 | Bacteria | 11564 |
| 820 | Ga0495589_0062792 | 3300046794 | Bacteria | 1822 |
| 821 | Ga0495660_0026773 | 3300046810 | Bacteria | 3266 |
| 822 | Ga0495674_0053355 | 3300047319 | Bacteria | 3554 |
| 823 | Ga0495687_000850 | 3300047443 | Bacteria | 32575 |
| 824 | Ga0495687_008280 | 3300047443 | Bacteria | 5978 |
| 825 | Ga0495685_012460 | 3300047447 | Bacteria | 2881 |
| 826 | Ga0495686_0023279 | 3300047472 | Bacteria | 4087 |
| 827 | Ga0496100_0053208 | 3300048903 | Bacteria | 2635 |
| 828 | Ga0496101_0003712 | 3300048904 | Bacteria | 9524 |
| 829 | Ga0496102_0003201 | 3300048905 | Bacteria | 13884 |
| 830 | Ga0496102_0040796 | 3300048905 | Bacteria | 4200 |
| 831 | Ga0496103_0049276 | 3300048906 | Bacteria | 2604 |
| 832 | Ga0496104_0098843 | 3300048907 | Bacteria | 2794 |
| 833 | Ga0496104_0126968 | 3300048907 | Bacteria | 2449 |
| 834 | Ga0496106_0025782 | 3300048909 | Bacteria | 4375 |
| 835 | Ga0496108_0052454 | 3300048911 | Bacteria | 3418 |
| 836 | Ga0496109_0000810 | 3300048912 | Bacteria | 26068 |
| 837 | Ga0496109_0005617 | 3300048912 | Bacteria | 10495 |
| 838 | Ga0496109_0045569 | 3300048912 | Bacteria | 3980 |
| 839 | Ga0496109_0097926 | 3300048912 | Bacteria | 2719 |
| 840 | Ga0496109_0214464 | 3300048912 | Bacteria | 1810 |
| 841 | Ga0496111_0024896 | 3300048914 | Bacteria | 4221 |
| 842 | Ga0496112_0009640 | 3300048915 | Bacteria | 8713 |
| 843 | Ga0496113_0137469 | 3300048916 | Bacteria | 1921 |
| 844 | Ga0496114_0056418 | 3300048917 | Bacteria | 3278 |
| 845 | Ga0496114_0085310 | 3300048917 | Bacteria | 2675 |
| 846 | Ga0496114_0301106 | 3300048917 | Bacteria | 1416 |
| 847 | Ga0496115_0008890 | 3300048918 | Bacteria | 7445 |
| 848 | Ga0496116_0008159 | 3300048919 | Bacteria | 9141 |
| 849 | Ga0496116_0020369 | 3300048919 | Bacteria | 5039 |
| 850 | Ga0496117_0000029 | 3300048920 | Bacteria | 392339 |
| 851 | Ga0496117_0029813 | 3300048920 | Bacteria | 4199 |
| 852 | Ga0496117_0039574 | 3300048920 | Bacteria | 3477 |
| 853 | Ga0496118_0022033 | 3300048921 | Bacteria | 5586 |
| 854 | Ga0496118_0026467 | 3300048921 | Bacteria | 4939 |
| 855 | Ga0496121_0003335 | 3300048924 | Bacteria | 23043 |
| 856 | Ga0496121_0015328 | 3300048924 | Bacteria | 8044 |
| 857 | Ga0496121_0080422 | 3300048924 | Bacteria | 2583 |
| 858 | Ga0496122_0069768 | 3300048925 | Bacteria | 2515 |
| 859 | Ga0496122_0114005 | 3300048925 | Bacteria | 1764 |
| 860 | Ga0496123_0030703 | 3300048926 | Bacteria | 3928 |
| 861 | Ga0496123_0057303 | 3300048926 | Bacteria | 2537 |
| 862 | Ga0496123_0155100 | 3300048926 | Bacteria | 1229 |
| 863 | Ga0496123_0180729 | 3300048926 | Bacteria | 1102 |
| 864 | Ga0496124_0000733 | 3300048927 | Bacteria | 53604 |
| 865 | Ga0496124_0046785 | 3300048927 | Bacteria | 3703 |
| 866 | Ga0496124_0056407 | 3300048927 | Bacteria | 3313 |
| 867 | Ga0496124_0076165 | 3300048927 | Bacteria | 2770 |
| 868 | Ga0496125_0017746 | 3300048928 | Bacteria | 6774 |
| 869 | Ga0496125_0017837 | 3300048928 | Bacteria | 6754 |
| 870 | Ga0496125_0046766 | 3300048928 | Bacteria | 3627 |
| 871 | Ga0496125_0051955 | 3300048928 | Bacteria | 3375 |
| 872 | Ga0496125_0054939 | 3300048928 | Bacteria | 3250 |
| 873 | Ga0501291_003279 | 3300049514 | Bacteria | 2004 |
| 874 | Ga0501292_009696 | 3300049515 | Bacteria | 1432 |
| 875 | Ga0501031_0001713 | 3300049568 | Bacteria | 13770 |
| 876 | Ga0501031_0029305 | 3300049568 | Bacteria | 3591 |
| 877 | Ga0501034_0345305 | 3300049571 | Bacteria | 1418 |
| 878 | Ga0501036_0117354 | 3300049572 | Bacteria | 2248 |
| 879 | Ga0501039_0293249 | 3300049575 | Bacteria | 1279 |
| 880 | Ga0501041_0084458 | 3300049577 | Bacteria | 1957 |
| 881 | Ga0501043_0000058 | 3300049579 | Bacteria | 102030 |
| 882 | Ga0501046_0000051 | 3300049580 | Bacteria | 133545 |
| 883 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 884 | Ga0501047_0016202 | 3300049581 | Bacteria | 7112 |
| 885 | Ga0501047_0287546 | 3300049581 | Bacteria | 1488 |
| 886 | Ga0501070_0147670 | 3300049586 | Bacteria | 1940 |
| 887 | Ga0501075_0032839 | 3300049591 | Bacteria | 3859 |
| 888 | Ga0501076_0079761 | 3300049592 | Bacteria | 2627 |
| 889 | Ga0501076_0296899 | 3300049592 | Bacteria | 1324 |
| 890 | Ga0501198_000007 | 3300049649 | Bacteria | 129700 |
| 891 | Ga0501222_000005 | 3300049662 | Bacteria | 129724 |
| 892 | Ga0501249_004367 | 3300049679 | Bacteria | 2872 |
| 893 | Ga0501225_0024202 | 3300049705 | Bacteria | 1672 |
| 894 | Ga0501229_000685 | 3300049706 | Bacteria | 3816 |
| 895 | Ga0501080_0202514 | 3300049742 | Bacteria | 1822 |
| 896 | Ga0501081_0099489 | 3300049743 | Bacteria | 2055 |
| 897 | Ga0501083_0025871 | 3300049744 | Bacteria | 4062 |
| 898 | Ga0501267_002227 | 3300049764 | Bacteria | 1725 |
| 899 | Ga0501044_0004830 | 3300049823 | Bacteria | 15074 |
| 900 | Ga0501045_0015123 | 3300049824 | Bacteria | 5477 |
| 901 | Ga0501045_0210284 | 3300049824 | Unclassified | 1449 |
| 902 | nmdc:mga03683_29128_c1 | 3300050489 | Bacteria | 2200 |
| 903 | nmdc:mga03683_59943_c1 | 3300050489 | Bacteria | 1606 |
| 904 | nmdc:mga03683_916_c1 | 3300050489 | Bacteria | 8502 |
| 905 | nmdc:mga03n38_117193_c1 | 3300050490 | Bacteria | 1304 |
| 906 | nmdc:mga03n38_21764_c1 | 3300050490 | Bacteria | 2585 |
| 907 | nmdc:mga03n38_45913_c1 | 3300050490 | Bacteria | 1926 |
| 908 | nmdc:mga03n38_56000_c1 | 3300050490 | Bacteria | 1778 |
| 909 | nmdc:mga03n38_58155_c1 | 3300050490 | Bacteria | 1751 |
| 910 | nmdc:mga03n38_70573_c1 | 3300050490 | Bacteria | 1616 |
| 911 | nmdc:mga00v17_31205_c1 | 3300050491 | Bacteria | 3141 |
| 912 | nmdc:mga0yw44_88132_c1 | 3300050492 | Bacteria | 1957 |
| 913 | nmdc:mga0k408_103336_c1 | 3300050493 | Bacteria | 1681 |
| 914 | nmdc:mga0k408_103779_c1 | 3300050493 | Bacteria | 1677 |
| 915 | nmdc:mga0k408_10449_c1 | 3300050493 | Bacteria | 5018 |
| 916 | nmdc:mga0k408_10776_c1 | 3300050493 | Bacteria | 4956 |
| 917 | nmdc:mga0k408_134114_c1 | 3300050493 | Bacteria | 1471 |
| 918 | nmdc:mga0k408_1536_c1 | 3300050493 | Bacteria | 12468 |
| 919 | nmdc:mga0k408_196283_c1 | 3300050493 | Bacteria | 1205 |
| 920 | nmdc:mga0k408_21153_c1 | 3300050493 | Bacteria | 3652 |
| 921 | nmdc:mga0k408_35374_c1 | 3300050493 | Bacteria | 2865 |
| 922 | nmdc:mga0k408_366_c1 | 3300050493 | Bacteria | 24717 |
| 923 | nmdc:mga0k408_49562_c1 | 3300050493 | Bacteria | 2431 |
| 924 | nmdc:mga0k408_8221_c1 | 3300050493 | Bacteria | 5592 |
| 925 | nmdc:mga0k408_83171_c1 | 3300050493 | Bacteria | 1876 |
| 926 | nmdc:mga0k408_87039_c1 | 3300050493 | Bacteria | 1835 |
| 927 | nmdc:mga0k408_98163_c1 | 3300050493 | Bacteria | 1726 |
| 928 | nmdc:mga06z11_21913_c2 | 3300050494 | Bacteria | 2652 |
| 929 | nmdc:mga07m45_10234_c1 | 3300050496 | Bacteria | 4892 |
| 930 | nmdc:mga07m45_29854_c1 | 3300050496 | Bacteria | 3018 |
| 931 | nmdc:mga07m45_2992_c2 | 3300050496 | Bacteria | 7393 |
| 932 | nmdc:mga07m45_2998_c1 | 3300050496 | Bacteria | 1502 |
| 933 | nmdc:mga07m45_3088_c1 | 3300050496 | Bacteria | 7964 |
| 934 | nmdc:mga07m45_3233_c1 | 3300050496 | Bacteria | 7824 |
| 935 | nmdc:mga07m45_4705_c1 | 3300050496 | Bacteria | 6701 |
| 936 | nmdc:mga07m45_6187_c1 | 3300050496 | Bacteria | 6038 |
| 937 | nmdc:mga07m45_64416_c1 | 3300050496 | Bacteria | 2080 |
| 938 | nmdc:mga07m45_6836_c1 | 3300050496 | Bacteria | 5800 |
| 939 | nmdc:mga07m45_9468_c1 | 3300050496 | Bacteria | 5056 |
| 940 | nmdc:mga09592_174_c1 | 3300050508 | Bacteria | 45665 |
| 941 | nmdc:mga0sz30_35023_c1 | 3300050516 | Bacteria | 2093 |
| 942 | nmdc:mga0sz30_42066_c1 | 3300050516 | Bacteria | 1922 |
| 943 | Ga0500635_0000070 | 3300053080 | Bacteria | 67480 |
| 944 | Ga0500578_0000417 | 3300053086 | Bacteria | 52045 |
| 945 | Ga0500651_0000093 | 3300053093 | Bacteria | 55843 |
| 946 | Ga0500651_0001098 | 3300053093 | Bacteria | 13378 |
| 947 | Ga0500651_0065399 | 3300053093 | Bacteria | 2266 |
| 948 | Ga0500566_0106332 | 3300053094 | Bacteria | 1531 |
| 949 | Ga0500562_002046 | 3300053108 | Bacteria | 5042 |
| 950 | Ga0500571_000137 | 3300053110 | Bacteria | 24800 |
| 951 | Ga0500593_000471 | 3300053117 | Bacteria | 16019 |
| 952 | Ga0500593_000805 | 3300053117 | Bacteria | 11731 |
| 953 | Ga0500593_001574 | 3300053117 | Bacteria | 8215 |
| 954 | Ga0500594_0005325 | 3300053118 | Bacteria | 2851 |
| 955 | Ga0500607_004111 | 3300053121 | Bacteria | 10178 |
| 956 | Ga0500608_006080 | 3300053122 | Bacteria | 4875 |
| 957 | Ga0500608_010693 | 3300053122 | Bacteria | 3949 |
| 958 | Ga0500642_0008356 | 3300053130 | Bacteria | 3538 |
| 959 | Ga0500642_0020754 | 3300053130 | Bacteria | 2588 |
| 960 | Ga0500652_001084 | 3300053131 | Bacteria | 8794 |
| 961 | Ga0500652_064140 | 3300053131 | Bacteria | 1516 |
| 962 | Ga0500655_000776 | 3300053133 | Bacteria | 6285 |
| 963 | Ga0500658_0000827 | 3300053134 | Bacteria | 12740 |
| 964 | Ga0500658_0011664 | 3300053134 | Bacteria | 3238 |
| 965 | Ga0500658_0029034 | 3300053134 | Bacteria | 2149 |
| 966 | Ga0500559_0000097 | 3300053136 | Bacteria | 70124 |
| 967 | Ga0500559_0004744 | 3300053136 | Bacteria | 6381 |
| 968 | Ga0500559_0023297 | 3300053136 | Bacteria | 2628 |
| 969 | Ga0500568_0004144 | 3300053139 | Bacteria | 7832 |
| 970 | Ga0500568_0004342 | 3300053139 | Bacteria | 7602 |
| 971 | Ga0500568_0007402 | 3300053139 | Bacteria | 5388 |
| 972 | Ga0500568_0015839 | 3300053139 | Bacteria | 3364 |
| 973 | Ga0500590_064552 | 3300053148 | Bacteria | 1833 |
| 974 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 975 | Ga0500622_0005315 | 3300053156 | Bacteria | 7764 |
| 976 | Ga0500627_0002058 | 3300053158 | Bacteria | 5820 |
| 977 | Ga0500645_000259 | 3300053730 | Bacteria | 38655 |
| 978 | Ga0500645_002355 | 3300053730 | Bacteria | 8513 |
| 979 | Ga0500587_000676 | 3300053739 | Bacteria | 4338 |
| 980 | Ga0500661_008021 | 3300055283 | Bacteria | 1946 |
| 981 | Ga0466962_0003983 | 3300061719 | Bacteria | 7072 |
| 982 | 2511245341 | 2511231002 | Bacteria | 5042903 |
| 983 | 2548500276 | 2547132374 | Bacteria | 5530232 |
| 984 | 2587725949 | 2585428057 | Bacteria | 6737412 |
| 985 | 2587735600 | 2585428058 | Bacteria | 6853932 |
| 986 | 2588292838 | 2588253510 | Bacteria | 6901809 |
| 987 | 2599621793 | 2599185214 | Bacteria | 8209958 |
| 988 | 2599670523 | 2599185226 | Bacteria | 8233575 |
| 989 | 2599679013 | 2599185227 | Bacteria | 8246414 |
| 990 | 2599691304 | 2599185229 | Bacteria | 8216126 |
| 991 | 2643744049 | 2643221544 | Bacteria | 5886209 |
| 992 | 2643864692 | 2643221570 | Bacteria | 5103772 |
| 993 | 2643932478 | 2643221585 | Bacteria | 5812563 |
| 994 | 2643992696 | 2643221596 | Bacteria | 5006805 |
| 995 | 2644058399 | 2643221609 | Bacteria | 6756331 |
| 996 | 2644073450 | 2643221611 | Bacteria | 6820941 |
| 997 | 2644163726 | 2643221628 | Bacteria | 5745828 |
| 998 | 2644219892 | 2643221639 | Bacteria | 6649903 |
| 999 | 2644247189 | 2643221644 | Bacteria | 6865017 |
| 1000 | 2644260990 | 2643221646 | Bacteria | 6433402 |
| 1001 | 2644296484 | 2643221652 | Bacteria | 5140275 |
| 1002 | 2644301004 | 2643221654 | Bacteria | 5273570 |
| 1003 | 2644313729 | 2643221656 | Bacteria | 5809961 |
| 1004 | 2644327043 | 2643221658 | Bacteria | 6064537 |
| 1005 | 2644339818 | 2643221660 | Bacteria | 4208257 |
| 1006 | 2644398846 | 2643221672 | Bacteria | 6322190 |
| 1007 | 2644466527 | 2643221683 | Bacteria | 5749203 |
| 1008 | 2644647171 | 2643221717 | Bacteria | 5676132 |
| 1009 | 2735818178 | 2734482258 | Unclassified | 2930739 |
| 1010 | 2738721855 | 2738541277 | Bacteria | 7458140 |
| 1011 | 2738882029 | 2738541307 | Bacteria | 8606193 |
| 1012 | 2739054795 | 2738541337 | Bacteria | 6183410 |
| 1013 | 2739247033 | 2738543012 | Bacteria | 7115078 |
| 1014 | 2739247829 | 2738543013 | Bacteria | 5618633 |
| 1015 | 2739282219 | 2738543019 | Bacteria | 7459457 |
| 1016 | 2740032516 | 2739367866 | Bacteria | 4215900 |
| 1017 | 2787508467 | 2786546548 | Bacteria | 4745694 |
| 1018 | 2816469687 | 2816332133 | Bacteria | 7249298 |
| 1019 | 2819597962 | 2818991446 | Bacteria | 7757362 |
| 1020 | 2831268951 | 2831265667 | Bacteria | 7184833 |
| 1021 | 2831867635 | 2831864461 | Bacteria | 6502356 |
| 1022 | 2838058379 | 2838054893 | Bacteria | 7451788 |
| 1023 | 2842678299 | 2842677519 | Bacteria | 5615038 |
| 1024 | 2842720649 | 2842718218 | Bacteria | 4560148 |
| 1025 | 2842738632 | 2842733646 | Bacteria | 5716726 |
| 1026 | 2881104357 | 2881101125 | Bacteria | 4590519 |
| 1027 | 2881645022 | 2881644220 | Bacteria | 5302661 |
| 1028 | 2885203881 | 2885198086 | Bacteria | 7212419 |
| 1029 | 2885217784 | 2885211737 | Bacteria | 7212420 |
| 1030 | 2886854914 | 2886848708 | Bacteria | 5632523 |
| 1031 | 2899929381 | 2899924645 | Bacteria | 7487985 |
| 1032 | 2904451123 | 2904449895 | Bacteria | 6927402 |
| 1033 | 2904457977 | 2904456579 | Bacteria | 6819253 |
| 1034 | 2904546720 | 2904541872 | Bacteria | 8915136 |
| 1035 | 2919465672 | 2919462493 | Bacteria | 5817112 |
| 1036 | 2928040175 | 2928037797 | Bacteria | 7273642 |
| 1037 | 2928047076 | 2928044640 | Bacteria | 7271509 |
| 1038 | 2928057720 | 2928051484 | Bacteria | 7773759 |
| 1039 | 2928067897 | 2928064002 | Bacteria | 7419480 |
| 1040 | 2928072461 | 2928070936 | Bacteria | 8062541 |
| 1041 | 2928085660 | 2928084124 | Bacteria | 7159212 |
| 1042 | 2928118830 | 2928115317 | Bacteria | 6477646 |
| 1043 | 2928520417 | 2928519762 | Bacteria | 1953908 |
| 1044 | 2929166169 | 2929160207 | Bacteria | 9075316 |
| 1045 | 2929526408 | 2929520902 | Bacteria | 6765052 |
| 1046 | 2939615677 | 2939615513 | Bacteria | 2384962 |
| 1047 | 2939634697 | 2939631187 | Bacteria | 6118131 |
| 1048 | 2945915015 | 2945909444 | Bacteria | 7065066 |
| 1049 | 2945950962 | 2945945610 | Bacteria | 5951079 |
| 1050 | 2945974401 | 2945972063 | Bacteria | 6086495 |
| 1051 | 2945989587 | 2945984333 | Bacteria | 7358892 |
| 1052 | 2990715271 | 2990710928 | Bacteria | 5002431 |
| 1053 | 3001271207 | 3001267043 | Bacteria | 4823521 |
| 1054 | 3001272105 | 3001272096 | Bacteria | 4729684 |
| 1055 | 3006978298 | 3006973921 | Bacteria | 4423788 |
| 1056 | 3006992730 | 3006988479 | Bacteria | 4767936 |
| 1057 | Ga0451853_4042678 | |||
| 1058 | JGI24740J21852_10007049 | |||
| 1059 | JGI24740J21852_10016505 | |||
| 1060 | JGI24739J22299_10006314 | |||
| 1061 | JGI25155J39150_1000037 | |||
| 1062 | JGI25156J39149_1000024 | |||
| 1063 | JGI25156J39149_1000273 | |||
| 1064 | JGI25154J39366_1000043 | |||
| 1065 | JGI25154J39366_1001641 | |||
| 1066 | JGI25158J39367_1005090 | |||
| 1067 | JGI25157J39369_1000031 | |||
| 1068 | JGI25157J39369_1000141 | |||
| 1069 | JGI25152J39213_1007178 | |||
| 1070 | JGI25150J39212_1002395 | |||
| 1071 | JGI25150J39212_1004345 | |||
| 1072 | JGI25159J45721_1004996 | |||
| 1073 | JGI25159J45721_1007712 | |||
| 1074 | JGI25151J46595_10001536 | |||
| 1075 | JGI25151J46595_10002156 | |||
| 1076 | JGI25151J46595_10002752 | |||
| 1077 | JGI25151J46595_10011019 | |||
| 1078 | JGI25151J46595_10019115 | |||
| 1079 | JGI25153J46596_10001676 | |||
| 1080 | JGI25153J46596_10003840 | |||
| 1081 | JGI25153J46596_10016969 | |||
| 1082 | rootH1_10000170 | |||
| 1083 | rootH1_10002432 | |||
| 1084 | rootH1_10043915 | |||
| 1085 | rootL2_10001066 | |||
| 1086 | rootL2_10090276 | |||
| 1087 | rootH1_10002491 | |||
| 1088 | JGI25160J50197_1000172 | |||
| 1089 | JGI25160J50197_1011812 | |||
| 1090 | JGI25161J50226_1000007 | |||
| 1091 | JGI25161J50226_1003544 | |||
| 1092 | JGI25161J50226_1005059 | |||
| 1093 | Ga0006562J51391_1039805 | |||
| 1094 | Ga0006562J51391_1039806 | |||
| 1095 | Ga0006562J51391_1066746 | |||
| 1096 | Ga0006562J51391_1066748 | |||
| 1097 | Ga0055539_1000219 | |||
| 1098 | Ga0055533_1000008 | |||
| 1099 | Ga0055525_1000054 | |||
| 1100 | Ga0055525_1001100 | |||
| 1101 | Ga0055535_1000271 | |||
| 1102 | Ga0055535_1000995 | |||
| 1103 | Ga0055535_1007207 | |||
| 1104 | Ga0055542_1000003 | |||
| 1105 | Ga0055529_1000321 | |||
| 1106 | Ga0055526_1001240 | |||
| 1107 | Ga0055526_1014459 | |||
| 1108 | Ga0055526_1015438 | |||
| 1109 | Ga0055526_1015538 | |||
| 1110 | Ga0055526_1017593 | |||
| 1111 | Ga0055537_1000356 | |||
| 1112 | Ga0055537_1001103 | |||
| 1113 | Ga0055537_1007183 | |||
| 1114 | Ga0055524_1000140 | |||
| 1115 | Ga0055524_1000213 | |||
| 1116 | Ga0055524_1000550 | |||
| 1117 | Ga0055524_1014230 | |||
| 1118 | Ga0055524_1015505 | |||
| 1119 | Ga0055536_1002468 | |||
| 1120 | Ga0055536_1006719 | |||
| 1121 | Ga0055536_1009794 | |||
| 1122 | Ga0055536_1015963 | |||
| 1123 | Ga0055536_1021287 | |||
| 1124 | Ga0055534_1000346 | |||
| 1125 | Ga0055534_1001067 | |||
| 1126 | Ga0055534_1001587 | |||
| 1127 | Ga0055534_1009018 | |||
| 1128 | Ga0055528_1000846 | |||
| 1129 | Ga0055528_1001593 | |||
| 1130 | Ga0055528_1015691 | |||
| 1131 | Ga0055530_10000763 | |||
| 1132 | Ga0055530_10003145 | |||
| 1133 | Ga0055530_10003770 | |||
| 1134 | Ga0055530_10015503 | |||
| 1135 | Ga0055540_1000133 | |||
| 1136 | Ga0055540_1000504 | |||
| 1137 | Ga0055540_1000765 | |||
| 1138 | Ga0055540_1003891 | |||
| 1139 | Ga0055540_1007562 | |||
| 1140 | Ga0055540_1007906 | |||
| 1141 | Ga0055540_1011179 | |||
| 1142 | Ga0055531_10000469 | |||
| 1143 | Ga0055531_10000973 | |||
| 1144 | Ga0055531_10002263 | |||
| 1145 | Ga0055531_10003310 | |||
| 1146 | Ga0055531_10004604 | |||
| 1147 | Ga0055531_10012397 | |||
| 1148 | Ga0055531_10018174 | |||
| 1149 | Ga0055531_10018180 | |||
| 1150 | Ga0055543_1000061 | |||
| 1151 | Ga0055543_1001261 | |||
| 1152 | Ga0055543_1005771 | |||
| 1153 | Ga0055543_1005778 | |||
| 1154 | Ga0065165_1000474 | |||
| 1155 | Ga0065165_1000621 | |||
| 1156 | Ga0065165_1005479 | |||
| 1157 | Ga0065165_1006179 | |||
| 1158 | Ga0065165_1008900 | |||
| 1159 | Ga0065165_1014201 | |||
| 1160 | Ga0070658_10008606 | |||
| 1161 | Ga0070658_10022214 | |||
| 1162 | Ga0070658_10040585 | |||
| 1163 | Ga0070658_10104791 | |||
| 1164 | Ga0070676_10019300 | |||
| 1165 | Ga0070676_10147765 | |||
| 1166 | Ga0070690_100012795 | |||
| 1167 | Ga0070670_100040263 | |||
| 1168 | Ga0070670_100061187 | |||
| 1169 | Ga0070670_100080010 | |||
| 1170 | Ga0070670_100098308 | |||
| 1171 | Ga0070670_100155303 | |||
| 1172 | Ga0070670_100199120 | |||
| 1173 | Ga0068869_100049108 | |||
| 1174 | Ga0068869_100226830 | |||
| 1175 | Ga0070666_10048516 | |||
| 1176 | Ga0070666_10095199 | |||
| 1177 | Ga0070680_100096268 | |||
| 1178 | Ga0068868_100017925 | |||
| 1179 | Ga0068868_100024364 | |||
| 1180 | Ga0068868_100055588 | |||
| 1181 | Ga0070660_100166540 | |||
| 1182 | Ga0070689_100045943 | |||
| 1183 | Ga0070689_100124259 | |||
| 1184 | Ga0070661_100018267 | |||
| 1185 | Ga0070661_100110471 | |||
| 1186 | Ga0070668_100020579 | |||
| 1187 | Ga0070675_100004369 | |||
| 1188 | Ga0070675_100089027 | |||
| 1189 | Ga0070675_100111069 | |||
| 1190 | Ga0070675_100238362 | |||
| 1191 | Ga0070671_100007073 | |||
| 1192 | Ga0070671_100017702 | |||
| 1193 | Ga0070671_100020190 | |||
| 1194 | Ga0070671_100023028 | |||
| 1195 | Ga0070674_100054573 | |||
| 1196 | Ga0070674_100085143 | |||
| 1197 | Ga0070673_100001467 | |||
| 1198 | Ga0070673_100007248 | |||
| 1199 | Ga0070673_100014291 | |||
| 1200 | Ga0070673_100020089 | |||
| 1201 | Ga0070659_100021184 | |||
| 1202 | Ga0070659_100168799 | |||
| 1203 | Ga0070667_100006934 | |||
| 1204 | Ga0070667_100180339 | |||
| 1205 | Ga0070667_100272942 | |||
| 1206 | Ga0070714_100318394 | |||
| 1207 | Ga0070663_100020950 | |||
| 1208 | Ga0070663_100188131 | |||
| 1209 | Ga0070678_100034556 | |||
| 1210 | Ga0070662_100012766 | |||
| 1211 | Ga0070662_100021970 | |||
| 1212 | Ga0070662_100051373 | |||
| 1213 | Ga0068867_100000245 | |||
| 1214 | Ga0068867_100000605 | |||
| 1215 | Ga0068867_100011924 | |||
| 1216 | Ga0068867_100021133 | |||
| 1217 | Ga0070706_100002995 | |||
| 1218 | Ga0070707_100067782 | |||
| 1219 | Ga0070679_100039040 | |||
| 1220 | Ga0070684_100199409 | |||
| 1221 | Ga0068853_100036201 | |||
| 1222 | Ga0068853_100071427 | |||
| 1223 | Ga0068853_100077168 | |||
| 1224 | Ga0070672_100002136 | |||
| 1225 | Ga0070672_100010450 | |||
| 1226 | Ga0070672_100029290 | |||
| 1227 | Ga0070672_100068866 | |||
| 1228 | Ga0070672_100117681 | |||
| 1229 | Ga0070665_100005540 | |||
| 1230 | Ga0070665_100008298 | |||
| 1231 | Ga0070665_100057790 | |||
| 1232 | Ga0070665_100291979 | |||
| 1233 | Ga0068855_100011340 | |||
| 1234 | Ga0068855_100046322 | |||
| 1235 | Ga0068855_100237784 | |||
| 1236 | Ga0068855_100412193 | |||
| 1237 | Ga0070664_100002435 | |||
| 1238 | Ga0070664_100048553 | |||
| 1239 | Ga0068857_100028700 | |||
| 1240 | Ga0068857_100031742 | |||
| 1241 | Ga0068857_100039422 | |||
| 1242 | Ga0068857_100055364 | |||
| 1243 | Ga0068854_100047028 | |||
| 1244 | Ga0068854_100101013 | |||
| 1245 | Ga0068854_100171813 | |||
| 1246 | Ga0068856_100000135 | |||
| 1247 | Ga0068856_100027773 | |||
| 1248 | Ga0068856_100399115 | |||
| 1249 | Ga0068852_100008014 | |||
| 1250 | Ga0068852_100023462 | |||
| 1251 | Ga0068852_100113592 | |||
| 1252 | Ga0068852_100286729 | |||
| 1253 | Ga0068864_100039478 | |||
| 1254 | Ga0068861_100022363 | |||
| 1255 | Ga0068851_10018422 | |||
| 1256 | Ga0068851_10065776 | |||
| 1257 | Ga0068863_100017699 | |||
| 1258 | Ga0068858_100347127 | |||
| 1259 | Ga0068860_100000384 | |||
| 1260 | Ga0068860_100097440 | |||
| 1261 | Ga0068860_100272194 | |||
| 1262 | Ga0068862_100037567 | |||
| 1263 | Ga0075365_10027748 | |||
| 1264 | Ga0075365_10100168 | |||
| 1265 | Ga0075368_10048762 | |||
| 1266 | Ga0075363_100029235 | |||
| 1267 | Ga0075363_100090501 | |||
| 1268 | Ga0075363_100139801 | |||
| 1269 | Ga0075364_10012964 | |||
| 1270 | Ga0075364_10053774 | |||
| 1271 | Ga0075364_10207369 | |||
| 1272 | Ga0075362_10001785 | |||
| 1273 | Ga0075362_10005324 | |||
| 1274 | Ga0075362_10009607 | |||
| 1275 | Ga0075362_10053518 | |||
| 1276 | Ga0075367_10159630 | |||
| 1277 | Ga0075369_10010982 | |||
| 1278 | Ga0075369_10046293 | |||
| 1279 | Ga0075366_10002666 | |||
| 1280 | Ga0075366_10011244 | |||
| 1281 | Ga0075366_10017453 | |||
| 1282 | Ga0075366_10029529 | |||
| 1283 | Ga0075366_10032812 | |||
| 1284 | Ga0075366_10042553 | |||
| 1285 | Ga0075366_10077926 | |||
| 1286 | Ga0075366_10092230 | |||
| 1287 | Ga0075366_10093239 | |||
| 1288 | Ga0097621_100140511 | |||
| 1289 | Ga0075370_10003469 | |||
| 1290 | Ga0075370_10004178 | |||
| 1291 | Ga0075370_10006062 | |||
| 1292 | Ga0075370_10011470 | |||
| 1293 | Ga0075370_10012670 | |||
| 1294 | Ga0075370_10032077 | |||
| 1295 | Ga0075370_10042272 | |||
| 1296 | Ga0075429_100000224 | |||
| 1297 | Ga0068865_100002745 | |||
| 1298 | Ga0068865_100017355 | |||
| 1299 | Ga0099823_1000005 | |||
| 1300 | Ga0079104_1000053 | |||
| 1301 | Ga0099826_10000959 | |||
| 1302 | Ga0105244_10002315 | |||
| 1303 | Ga0105240_10002477 | |||
| 1304 | Ga0105240_10009882 | |||
| 1305 | Ga0105240_10146487 | |||
| 1306 | Ga0105240_10332956 | |||
| 1307 | Ga0105240_10433567 | |||
| 1308 | Ga0105245_10026119 | |||
| 1309 | Ga0105245_10042445 | |||
| 1310 | Ga0105245_10048303 | |||
| 1311 | Ga0105243_10004228 | |||
| 1312 | Ga0105243_10006082 | |||
| 1313 | Ga0105243_10061212 | |||
| 1314 | Ga0105243_10067374 | |||
| 1315 | Ga0105243_10095301 | |||
| 1316 | Ga0105243_10138475 | |||
| 1317 | Ga0105243_10148545 | |||
| 1318 | Ga0105241_10243781 | |||
| 1319 | Ga0105241_10257780 | |||
| 1320 | Ga0105242_10016941 | |||
| 1321 | Ga0105248_10001355 | |||
| 1322 | Ga0105237_10000668 | |||
| 1323 | Ga0105237_10011246 | |||
| 1324 | Ga0105237_10028106 | |||
| 1325 | Ga0105237_10046071 | |||
| 1326 | Ga0105238_10007313 | |||
| 1327 | Ga0105238_10061434 | |||
| 1328 | Ga0105238_10106330 | |||
| 1329 | Ga0105238_10180384 | |||
| 1330 | Ga0105249_10017117 | |||
| 1331 | Ga0105239_10020399 | |||
| 1332 | Ga0105239_10021874 | |||
| 1333 | Ga0105239_10025029 | |||
| 1334 | Ga0105239_10032539 | |||
| 1335 | Ga0105246_10038570 | |||
| 1336 | Ga0105246_10119579 | |||
| 1337 | Ga0157317_1001054 | |||
| 1338 | Ga0157319_1000005 | |||
| 1339 | Ga0157373_10023614 | |||
| 1340 | Ga0157371_10118626 | |||
| 1341 | Ga0157370_10231461 | |||
| 1342 | Ga0157369_10143197 | |||
| 1343 | Ga0157369_10211029 | |||
| 1344 | Ga0157374_10183833 | |||
| 1345 | Ga0157378_10096431 | |||
| 1346 | Ga0157378_10357565 | |||
| 1347 | Ga0163162_10000794 | |||
| 1348 | Ga0163162_10001355 | |||
| 1349 | Ga0157372_10556056 | |||
| 1350 | Ga0157375_10040833 | |||
| 1351 | Ga0157375_10197055 | |||
| 1352 | Ga0163163_10096492 | |||
| 1353 | Ga0157380_10012894 | |||
| 1354 | Ga0157380_10183432 | |||
| 1355 | Ga0157380_10335850 | |||
| 1356 | Ga0182008_10004921 | |||
| 1357 | Ga0182008_10010747 | |||
| 1358 | Ga0157377_10000034 | |||
| 1359 | Ga0157379_10009090 | |||
| 1360 | Ga0157379_10073730 | |||
| 1361 | Ga0157379_10083761 | |||
| 1362 | Ga0157376_10083963 | |||
| 1363 | Ga0157376_10269892 | |||
| 1364 | Ga0182006_1001345 | |||
| 1365 | Ga0182006_1063506 | |||
| 1366 | Ga0182007_10000317 | |||
| 1367 | Ga0182007_10001372 | |||
| 1368 | Ga0183362_10004 | |||
| 1369 | Ga0163161_10000361 | |||
| 1370 | Ga0163161_10011636 | |||
| 1371 | Ga0163161_10096335 | |||
| 1372 | Ga0213872_10001003 | |||
| 1373 | Ga0213872_10004509 | |||
| 1374 | Ga0213872_10012188 | |||
| 1375 | Ga0213872_10017132 | |||
| 1376 | Ga0213876_10095098 | |||
| 1377 | Ga0213875_10060163 | |||
| 1378 | Ga0209435_100008 | |||
| 1379 | Ga0209674_100015 | |||
| 1380 | Ga0209672_101139 | |||
| 1381 | Ga0209563_100017 | |||
| 1382 | Ga0209563_100075 | |||
| 1383 | Ga0207427_100444 | |||
| 1384 | Ga0209258_100015 | |||
| 1385 | Ga0209258_100025 | |||
| 1386 | Ga0209258_100726 | |||
| 1387 | Ga0207425_1000570 | |||
| 1388 | Ga0207425_1002945 | |||
| 1389 | Ga0207425_1006495 | |||
| 1390 | Ga0207425_1007181 | |||
| 1391 | Ga0209646_1000079 | |||
| 1392 | Ga0209646_1000438 | |||
| 1393 | Ga0209026_1000028 | |||
| 1394 | Ga0209026_1000067 | |||
| 1395 | Ga0209677_100037 | |||
| 1396 | Ga0209677_100113 | |||
| 1397 | Ga0209677_101296 | |||
| 1398 | Ga0209148_1000028 | |||
| 1399 | Ga0209759_1000021 | |||
| 1400 | Ga0209759_1000056 | |||
| 1401 | Ga0209759_1001016 | |||
| 1402 | Ga0209759_1001538 | |||
| 1403 | Ga0209129_1000049 | |||
| 1404 | Ga0209129_1000158 | |||
| 1405 | Ga0209129_1002921 | |||
| 1406 | Ga0209129_1011570 | |||
| 1407 | Ga0209565_1000041 | |||
| 1408 | Ga0209565_1000259 | |||
| 1409 | Ga0209565_1000333 | |||
| 1410 | Ga0209565_1002282 | |||
| 1411 | Ga0209565_1004128 | |||
| 1412 | Ga0209565_1007247 | |||
| 1413 | Ga0209455_1000166 | |||
| 1414 | Ga0209673_1000193 | |||
| 1415 | Ga0209673_1000364 | |||
| 1416 | Ga0209673_1004816 | |||
| 1417 | Ga0209673_1005119 | |||
| 1418 | Ga0209673_1014689 | |||
| 1419 | Ga0209673_1021019 | |||
| 1420 | Ga0209673_1033619 | |||
| 1421 | Ga0209130_1000245 | |||
| 1422 | Ga0209130_1000708 | |||
| 1423 | Ga0209130_1001785 | |||
| 1424 | Ga0209130_1002505 | |||
| 1425 | Ga0209130_1002770 | |||
| 1426 | Ga0209675_1000220 | |||
| 1427 | Ga0209675_1000316 | |||
| 1428 | Ga0209675_1003708 | |||
| 1429 | Ga0209675_1015740 | |||
| 1430 | Ga0209676_1000013 | |||
| 1431 | Ga0209676_1000074 | |||
| 1432 | Ga0209676_1000209 | |||
| 1433 | Ga0209676_1000689 | |||
| 1434 | Ga0209676_1002936 | |||
| 1435 | Ga0209676_1006483 | |||
| 1436 | Ga0209676_1014369 | |||
| 1437 | Ga0209676_1027482 | |||
| 1438 | Ga0209025_1000283 | |||
| 1439 | Ga0209025_1001092 | |||
| 1440 | Ga0209025_1001101 | |||
| 1441 | Ga0209025_1003444 | |||
| 1442 | Ga0209025_1003852 | |||
| 1443 | Ga0209025_1022772 | |||
| 1444 | Ga0209025_1025542 | |||
| 1445 | Ga0209025_1029710 | |||
| 1446 | Ga0209025_1054573 | |||
| 1447 | Ga0209564_1000021 | |||
| 1448 | Ga0209564_1000282 | |||
| 1449 | Ga0209564_1000363 | |||
| 1450 | Ga0209564_1001279 | |||
| 1451 | Ga0209564_1001670 | |||
| 1452 | Ga0209564_1003353 | |||
| 1453 | Ga0209564_1013238 | |||
| 1454 | Ga0209758_1000496 | |||
| 1455 | Ga0209758_1000815 | |||
| 1456 | Ga0209758_1000910 | |||
| 1457 | Ga0209758_1009742 | |||
| 1458 | Ga0209050_1000008 | |||
| 1459 | Ga0209050_1000015 | |||
| 1460 | Ga0209050_1000996 | |||
| 1461 | Ga0209050_1001406 | |||
| 1462 | Ga0209050_1002179 | |||
| 1463 | Ga0209050_1002987 | |||
| 1464 | Ga0209050_1006789 | |||
| 1465 | Ga0209256_1000003 | |||
| 1466 | Ga0209256_1000045 | |||
| 1467 | Ga0209256_1000264 | |||
| 1468 | Ga0209256_1000304 | |||
| 1469 | Ga0209256_1000309 | |||
| 1470 | Ga0209256_1001207 | |||
| 1471 | Ga0209256_1027278 | |||
| 1472 | Ga0207426_1000091 | |||
| 1473 | Ga0207426_1000108 | |||
| 1474 | Ga0207426_1000130 | |||
| 1475 | Ga0207426_1002234 | |||
| 1476 | Ga0209051_1000004 | |||
| 1477 | Ga0209051_1000005 | |||
| 1478 | Ga0209051_1000010 | |||
| 1479 | Ga0209051_1000156 | |||
| 1480 | Ga0209051_1000306 | |||
| 1481 | Ga0209051_1000621 | |||
| 1482 | Ga0209051_1000680 | |||
| 1483 | Ga0209051_1001349 | |||
| 1484 | Ga0209051_1006701 | |||
| 1485 | Ga0209051_1019395 | |||
| 1486 | Ga0209257_1000015 | |||
| 1487 | Ga0209257_1000016 | |||
| 1488 | Ga0209257_1000026 | |||
| 1489 | Ga0209257_1000048 | |||
| 1490 | Ga0209257_1000172 | |||
| 1491 | Ga0209257_1000315 | |||
| 1492 | Ga0209257_1000981 | |||
| 1493 | Ga0209257_1003138 | |||
| 1494 | Ga0209257_1014093 | |||
| 1495 | Ga0209257_1016709 | |||
| 1496 | Ga0207697_10000321 | |||
| 1497 | Ga0207655_1001367 | |||
| 1498 | Ga0207682_10029747 | |||
| 1499 | Ga0207688_10001947 | |||
| 1500 | Ga0207645_10005998 | |||
| 1501 | Ga0207645_10045667 | |||
| 1502 | Ga0207643_10030070 | |||
| 1503 | Ga0207705_10019722 | |||
| 1504 | Ga0207705_10166511 | |||
| 1505 | Ga0207684_10045694 | |||
| 1506 | Ga0207684_10049002 | |||
| 1507 | Ga0207695_10004981 | |||
| 1508 | Ga0207695_10007014 | |||
| 1509 | Ga0207695_10047957 | |||
| 1510 | Ga0207695_10057931 | |||
| 1511 | Ga0207695_10124467 | |||
| 1512 | Ga0207671_10021969 | |||
| 1513 | Ga0207671_10145514 | |||
| 1514 | Ga0207660_10061622 | |||
| 1515 | Ga0207657_10017128 | |||
| 1516 | Ga0207657_10105000 | |||
| 1517 | Ga0207649_10000614 | |||
| 1518 | Ga0207652_10069419 | |||
| 1519 | Ga0207652_10076312 | |||
| 1520 | Ga0207681_10079142 | |||
| 1521 | Ga0207681_10191266 | |||
| 1522 | Ga0207694_10028649 | |||
| 1523 | Ga0207650_10054134 | |||
| 1524 | Ga0207650_10071989 | |||
| 1525 | Ga0207659_10228316 | |||
| 1526 | Ga0207659_10252640 | |||
| 1527 | Ga0207687_10009833 | |||
| 1528 | Ga0207687_10038401 | |||
| 1529 | Ga0207687_10115900 | |||
| 1530 | Ga0207687_10250675 | |||
| 1531 | Ga0207664_10029018 | |||
| 1532 | Ga0207644_10017792 | |||
| 1533 | Ga0207644_10026836 | |||
| 1534 | Ga0207644_10158156 | |||
| 1535 | Ga0207690_10009309 | |||
| 1536 | Ga0207690_10013071 | |||
| 1537 | Ga0207706_10002180 | |||
| 1538 | Ga0207706_10032088 | |||
| 1539 | Ga0207706_10173593 | |||
| 1540 | Ga0207686_10000960 | |||
| 1541 | Ga0207709_10000433 | |||
| 1542 | Ga0207709_10000838 | |||
| 1543 | Ga0207709_10001092 | |||
| 1544 | Ga0207709_10012723 | |||
| 1545 | Ga0207709_10061034 | |||
| 1546 | Ga0207669_10049782 | |||
| 1547 | Ga0207704_10023252 | |||
| 1548 | Ga0207665_10145960 | |||
| 1549 | Ga0207691_10004655 | |||
| 1550 | Ga0207691_10005007 | |||
| 1551 | Ga0207711_10146343 | |||
| 1552 | Ga0207689_10018687 | |||
| 1553 | Ga0207689_10169441 | |||
| 1554 | Ga0207661_10133563 | |||
| 1555 | Ga0207679_10000077 | |||
| 1556 | Ga0207679_10095392 | |||
| 1557 | Ga0207679_10125626 | |||
| 1558 | Ga0207667_10003517 | |||
| 1559 | Ga0207667_10040596 | |||
| 1560 | Ga0207667_10189447 | |||
| 1561 | Ga0207667_10297476 | |||
| 1562 | Ga0207651_10004806 | |||
| 1563 | Ga0207651_10078807 | |||
| 1564 | Ga0207651_10232572 | |||
| 1565 | Ga0207712_10009930 | |||
| 1566 | Ga0207640_10032295 | |||
| 1567 | Ga0207640_10133252 | |||
| 1568 | Ga0207658_10029648 | |||
| 1569 | Ga0207658_10036634 | |||
| 1570 | Ga0207677_10021042 | |||
| 1571 | Ga0207677_10028704 | |||
| 1572 | Ga0207703_10041044 | |||
| 1573 | Ga0207639_10040814 | |||
| 1574 | Ga0207678_10037832 | |||
| 1575 | Ga0207678_10052599 | |||
| 1576 | Ga0207678_10061958 | |||
| 1577 | Ga0207708_10060111 | |||
| 1578 | Ga0207702_10001523 | |||
| 1579 | Ga0207702_10024832 | |||
| 1580 | Ga0207702_10136882 | |||
| 1581 | Ga0207702_10196605 | |||
| 1582 | Ga0207648_10000054 | |||
| 1583 | Ga0207648_10002852 | |||
| 1584 | Ga0207648_10004823 | |||
| 1585 | Ga0207648_10016725 | |||
| 1586 | Ga0207648_10030389 | |||
| 1587 | Ga0207648_10149976 | |||
| 1588 | Ga0207676_10027619 | |||
| 1589 | Ga0207676_10054808 | |||
| 1590 | Ga0207676_10280172 | |||
| 1591 | Ga0207674_10005841 | |||
| 1592 | Ga0207674_10008175 | |||
| 1593 | Ga0207674_10016268 | |||
| 1594 | Ga0207674_10054882 | |||
| 1595 | Ga0207675_100025649 | |||
| 1596 | Ga0207675_100036742 | |||
| 1597 | Ga0207683_10023817 | |||
| 1598 | Ga0207683_10136967 | |||
| 1599 | Ga0207683_10296511 | |||
| 1600 | Ga0207698_10019411 | |||
| 1601 | Ga0207698_10035266 | |||
| 1602 | Ga0207698_10036734 | |||
| 1603 | Ga0207698_10050766 | |||
| 1604 | Ga0207698_10175478 | |||
| 1605 | Ga0207698_10191700 | |||
| 1606 | Ga0207698_10339731 | |||
| 1607 | Ga0209281_1000147 | |||
| 1608 | Ga0209389_1000295 | |||
| 1609 | Ga0209968_1000628 | |||
| 1610 | Ga0209970_1001072 | |||
| 1611 | Ga0209282_1000107 | |||
| 1612 | Ga0209966_1000117 | |||
| 1613 | Ga0209974_10032873 | |||
| 1614 | Ga0268266_10005478 | |||
| 1615 | Ga0268266_10030341 | |||
| 1616 | Ga0268266_10042256 | |||
| 1617 | Ga0268265_10003306 | |||
| 1618 | Ga0268265_10135271 | |||
| 1619 | Ga0268265_10181367 | |||
| 1620 | Ga0268264_10001034 | |||
| 1621 | Ga0268264_10062691 | |||
| 1622 | Ga0268264_10095775 | |||
| 1623 | Ga0265336_10000274 | |||
| 1624 | Ga0307517_10072069 | |||
| 1625 | Ga0307517_10121377 | |||
| 1626 | Ga0307515_10000139 | |||
| 1627 | Ga0307515_10004822 | |||
| 1628 | Ga0307515_10005936 | |||
| 1629 | Ga0307515_10011641 | |||
| 1630 | Ga0307515_10060941 | |||
| 1631 | Ga0307515_10081261 | |||
| 1632 | Ga0307515_10157352 | |||
| 1633 | Ga0265324_10022676 | |||
| 1634 | Ga0307512_10010416 | |||
| 1635 | Ga0307512_10044434 | |||
| 1636 | Ga0316177_1147685 | |||
| 1637 | Ga0316176_1019717 | |||
| 1638 | Ga0316179_1045655 | |||
| 1639 | Ga0316183_1086347 | |||
| 1640 | Ga0316182_1395773 | |||
| 1641 | Ga0265330_10000174 | |||
| 1642 | Ga0265330_10009612 | |||
| 1643 | Ga0265332_10000048 | |||
| 1644 | Ga0265328_10006713 | |||
| 1645 | Ga0265328_10019614 | |||
| 1646 | Ga0265325_10006440 | |||
| 1647 | Ga0265331_10022083 | |||
| 1648 | Ga0265327_10000080 | |||
| 1649 | Ga0265327_10000925 | |||
| 1650 | Ga0265327_10002797 | |||
| 1651 | Ga0265327_10011216 | |||
| 1652 | Ga0265316_10000176 | |||
| 1653 | Ga0307513_10004491 | |||
| 1654 | Ga0307513_10004870 | |||
| 1655 | Ga0307513_10005821 | |||
| 1656 | Ga0307513_10008739 | |||
| 1657 | Ga0307513_10046962 | |||
| 1658 | Ga0307513_10086947 | |||
| 1659 | Ga0307509_10000698 | |||
| 1660 | Ga0307509_10039083 | |||
| 1661 | Ga0307509_10250815 | |||
| 1662 | Ga0307408_100000012 | |||
| 1663 | Ga0307408_100031021 | |||
| 1664 | Ga0307408_100060389 | |||
| 1665 | Ga0307408_100159554 | |||
| 1666 | Ga0307408_100178395 | |||
| 1667 | Ga0307408_100229417 | |||
| 1668 | Ga0307508_10000504 | |||
| 1669 | Ga0307514_10000339 | |||
| 1670 | Ga0307514_10002566 | |||
| 1671 | Ga0307514_10003227 | |||
| 1672 | Ga0307514_10007369 | |||
| 1673 | Ga0265314_10000132 | |||
| 1674 | Ga0265314_10000882 | |||
| 1675 | Ga0307516_10001199 | |||
| 1676 | Ga0307516_10007072 | |||
| 1677 | Ga0307516_10034081 | |||
| 1678 | Ga0307516_10041822 | |||
| 1679 | Ga0307516_10133884 | |||
| 1680 | Ga0307516_10256683 | |||
| 1681 | Ga0307405_10071205 | |||
| 1682 | Ga0307410_10016446 | |||
| 1683 | Ga0307406_10020825 | |||
| 1684 | Ga0307406_10101144 | |||
| 1685 | Ga0307412_10086029 | |||
| 1686 | Ga0307412_10093686 | |||
| 1687 | Ga0307416_100018698 | |||
| 1688 | Ga0307416_100070883 | |||
| 1689 | Ga0307416_100092169 | |||
| 1690 | Ga0307416_100219979 | |||
| 1691 | Ga0307414_10035032 | |||
| 1692 | Ga0307414_10066493 | |||
| 1693 | Ga0307411_10005248 | |||
| 1694 | Ga0307411_10092065 | |||
| 1695 | Ga0316593_10018061 | |||
| 1696 | Ga0307507_10080161 | |||
| 1697 | Ga0307510_10000426 | |||
| 1698 | Ga0307510_10027810 | |||
| 1699 | Ga0307510_10033683 | |||
| 1700 | Ga0373939_0000047 | |||
| 1701 | Ga0373960_0001152 | |||
| 1702 | Ga0373961_0020937 | |||
| 1703 | Ga0373931_0000579 | |||
| 1704 | Ga0373931_0022811 | |||
| 1705 | Ga0373931_0054113 | |||
| 1706 | Ga0316582_0140047 | |||
| 1707 | Ga0395899_0008314 | |||
| 1708 | Ga0395899_0014983 | |||
| 1709 | Ga0395900_0001308 | |||
| 1710 | Ga0395900_0019620 | |||
| 1711 | Ga0395900_0036461 | |||
| 1712 | Ga0395900_0092989 | |||
| 1713 | Ga0395898_0002912 | |||
| 1714 | Ga0395898_0008455 | |||
| 1715 | Ga0395898_0013070 | |||
| 1716 | Ga0395898_0025264 | |||
| 1717 | Ga0395898_0028823 | |||
| 1718 | Ga0395905_0000432 | |||
| 1719 | Ga0395905_0000504 | |||
| 1720 | Ga0395905_0002540 | |||
| 1721 | Ga0395905_0004034 | |||
| 1722 | Ga0395905_0005387 | |||
| 1723 | Ga0395905_0011861 | |||
| 1724 | Ga0395905_0028947 | |||
| 1725 | Ga0395905_0029755 | |||
| 1726 | Ga0395905_0034159 | |||
| 1727 | Ga0395905_0038030 | |||
| 1728 | Ga0395905_0040851 | |||
| 1729 | Ga0395905_0061234 | |||
| 1730 | Ga0395905_0083148 | |||
| 1731 | Ga0395905_0128803 | |||
| 1732 | Ga0316581_0007161 | |||
| 1733 | Ga0436364_0241783 | |||
| 1734 | Ga0436364_1356834 | |||
| 1735 | Ga0395901_0006507 | |||
| 1736 | Ga0395901_0024911 | |||
| 1737 | Ga0395901_0053630 | |||
| 1738 | Ga0395901_0084582 | |||
| 1739 | Ga0395901_0359346 | |||
| 1740 | Ga0400483_062160 | |||
| 1741 | Ga0400483_158300 | |||
| 1742 | Ga0400483_160107 | |||
| 1743 | Ga0436365_0112515 | |||
| 1744 | Ga0436365_0287923 | |||
| 1745 | Ga0436365_0974771 | |||
| 1746 | Ga0436361_0156562 | |||
| 1747 | Ga0436361_0264437 | |||
| 1748 | Ga0436361_0272384 | |||
| 1749 | Ga0436361_0827051 | |||
| 1750 | Ga0439436_0011478 | |||
| 1751 | Ga0439436_0020293 | |||
| 1752 | Ga0439466_0018087 | |||
| 1753 | Ga0439465_0007667 | |||
| 1754 | Ga0451793_1547269 | |||
| 1755 | Ga0451839_1626730 | |||
| 1756 | Ga0451851_0584746 | |||
| 1757 | Ga0439442_001212 | |||
| 1758 | Ga0439442_002138 | |||
| 1759 | Ga0439445_0023936 | |||
| 1760 | Ga0439445_0025144 | |||
| 1761 | Ga0439432_009856 | |||
| 1762 | Ga0439449_0003996 | |||
| 1763 | Ga0439452_006839 | |||
| 1764 | Ga0439462_0001911 | |||
| 1765 | Ga0450911_001157 | |||
| 1766 | Ga0450917_000309 | |||
| 1767 | Ga0450919_000132 | |||
| 1768 | Ga0450920_005304 | |||
| 1769 | Ga0450920_010904 | |||
| 1770 | Ga0450923_000606 | |||
| 1771 | Ga0450923_001222 | |||
| 1772 | Ga0450888_000258 | |||
| 1773 | Ga0450890_000482 | |||
| 1774 | Ga0450890_001454 | |||
| 1775 | Ga0450890_001951 | |||
| 1776 | Ga0450891_001653 | |||
| 1777 | Ga0450892_000718 | |||
| 1778 | Ga0450894_002761 | |||
| 1779 | Ga0450896_002019 | |||
| 1780 | Ga0450898_001291 | |||
| 1781 | Ga0450898_011820 | |||
| 1782 | Ga0450889_000025 | |||
| 1783 | Ga0450906_000686 | |||
| 1784 | Ga0450906_001537 | |||
| 1785 | Ga0450910_000244 | |||
| 1786 | Ga0450908_000233 | |||
| 1787 | Ga0450908_008161 | |||
| 1788 | Ga0450909_010803 | |||
| 1789 | Ga0439459_0000990 | |||
| 1790 | Ga0450916_005246 | |||
| 1791 | Ga0450918_000057 | |||
| 1792 | Ga0450918_004991 | |||
| 1793 | Ga0450893_0002098 | |||
| 1794 | Ga0451577_0000126 | |||
| 1795 | Ga0451577_0006685 | |||
| 1796 | Ga0451577_0018745 | |||
| 1797 | Ga0451577_0086850 | |||
| 1798 | Ga0466969_0000018 | |||
| 1799 | Ga0466969_0007499 | |||
| 1800 | Ga0466969_0024919 | |||
| 1801 | Ga0466972_0005104 | |||
| 1802 | Ga0453683_0007182 | |||
| 1803 | Ga0466965_0054848 | |||
| 1804 | Ga0466966_0014306 | |||
| 1805 | Ga0466966_0035444 | |||
| 1806 | Ga0466966_0123612 | |||
| 1807 | Ga0466961_0006521 | |||
| 1808 | Ga0466961_0046171 | |||
| 1809 | Ga0466961_0078138 | |||
| 1810 | Ga0466963_0017494 | |||
| 1811 | Ga0466963_0066522 | |||
| 1812 | Ga0466963_0089148 | |||
| 1813 | Ga0466964_0016300 | |||
| 1814 | Ga0453684_0000365 | |||
| 1815 | Ga0453684_0008286 | |||
| 1816 | Ga0453684_0026097 | |||
| 1817 | Ga0453684_0035441 | |||
| 1818 | Ga0466971_0034133 | |||
| 1819 | Ga0466968_0016365 | |||
| 1820 | Ga0466968_0043870 | |||
| 1821 | Ga0466970_0048635 | |||
| 1822 | Ga0466970_0049986 | |||
| 1823 | Ga0466957_0004358 | |||
| 1824 | Ga0466959_0009769 | |||
| 1825 | Ga0466959_0024616 | |||
| 1826 | Ga0466959_0031472 | |||
| 1827 | Ga0466959_0167643 | |||
| 1828 | Ga0451576_0000627 | |||
| 1829 | Ga0451576_0010718 | |||
| 1830 | Ga0451576_0048235 | |||
| 1831 | Ga0451576_0065287 | |||
| 1832 | Ga0451576_0073572 | |||
| 1833 | Ga0451576_0085485 | |||
| 1834 | Ga0451576_0126862 | |||
| 1835 | Ga0466958_0009242 | |||
| 1836 | Ga0495592_0000499 | |||
| 1837 | Ga0495590_0003163 | |||
| 1838 | Ga0495638_0030970 | |||
| 1839 | Ga0495638_0077223 | |||
| 1840 | Ga0495650_0009623 | |||
| 1841 | Ga0495650_0065547 | |||
| 1842 | Ga0495583_0000428 | |||
| 1843 | Ga0495606_0000821 | |||
| 1844 | Ga0495608_0066591 | |||
| 1845 | Ga0495610_0019230 | |||
| 1846 | Ga0495616_0001020 | |||
| 1847 | Ga0495620_0016702 | |||
| 1848 | Ga0495631_0000803 | |||
| 1849 | Ga0495632_0002352 | |||
| 1850 | Ga0495632_0020371 | |||
| 1851 | Ga0495632_0106906 | |||
| 1852 | Ga0495637_0002174 | |||
| 1853 | Ga0495643_0033985 | |||
| 1854 | Ga0495654_0001492 | |||
| 1855 | Ga0495654_0018028 | |||
| 1856 | Ga0495621_0009162 | |||
| 1857 | Ga0495621_0027194 | |||
| 1858 | Ga0495597_0007542 | |||
| 1859 | Ga0495645_0037182 | |||
| 1860 | Ga0495656_0001009 | |||
| 1861 | Ga0495668_0017953 | |||
| 1862 | Ga0495668_0021362 | |||
| 1863 | Ga0495625_0000098 | |||
| 1864 | Ga0495625_0000827 | |||
| 1865 | Ga0495625_0013529 | |||
| 1866 | Ga0495625_0091088 | |||
| 1867 | Ga0495659_0048833 | |||
| 1868 | Ga0495588_0053425 | |||
| 1869 | Ga0495647_0005177 | |||
| 1870 | Ga0495658_0032461 | |||
| 1871 | Ga0495669_0041763 | |||
| 1872 | Ga0495671_0006329 | |||
| 1873 | Ga0495649_0000380 | |||
| 1874 | Ga0495649_0003008 | |||
| 1875 | Ga0495589_0062792 | |||
| 1876 | Ga0495660_0026773 | |||
| 1877 | Ga0495674_0053355 | |||
| 1878 | Ga0495687_000850 | |||
| 1879 | Ga0495687_008280 | |||
| 1880 | Ga0495685_012460 | |||
| 1881 | Ga0495686_0023279 | |||
| 1882 | Ga0496100_0053208 | |||
| 1883 | Ga0496101_0003712 | |||
| 1884 | Ga0496102_0003201 | |||
| 1885 | Ga0496102_0040796 | |||
| 1886 | Ga0496103_0049276 | |||
| 1887 | Ga0496104_0098843 | |||
| 1888 | Ga0496104_0126968 | |||
| 1889 | Ga0496106_0025782 | |||
| 1890 | Ga0496108_0052454 | |||
| 1891 | Ga0496109_0000810 | |||
| 1892 | Ga0496109_0005617 | |||
| 1893 | Ga0496109_0045569 | |||
| 1894 | Ga0496109_0097926 | |||
| 1895 | Ga0496109_0214464 | |||
| 1896 | Ga0496111_0024896 | |||
| 1897 | Ga0496112_0009640 | |||
| 1898 | Ga0496113_0137469 | |||
| 1899 | Ga0496114_0056418 | |||
| 1900 | Ga0496114_0085310 | |||
| 1901 | Ga0496114_0301106 | |||
| 1902 | Ga0496115_0008890 | |||
| 1903 | Ga0496116_0008159 | |||
| 1904 | Ga0496116_0020369 | |||
| 1905 | Ga0496117_0000029 | |||
| 1906 | Ga0496117_0029813 | |||
| 1907 | Ga0496117_0039574 | |||
| 1908 | Ga0496118_0022033 | |||
| 1909 | Ga0496118_0026467 | |||
| 1910 | Ga0496121_0003335 | |||
| 1911 | Ga0496121_0015328 | |||
| 1912 | Ga0496121_0080422 | |||
| 1913 | Ga0496122_0069768 | |||
| 1914 | Ga0496122_0114005 | |||
| 1915 | Ga0496123_0030703 | |||
| 1916 | Ga0496123_0057303 | |||
| 1917 | Ga0496123_0155100 | |||
| 1918 | Ga0496123_0180729 | |||
| 1919 | Ga0496124_0000733 | |||
| 1920 | Ga0496124_0046785 | |||
| 1921 | Ga0496124_0056407 | |||
| 1922 | Ga0496124_0076165 | |||
| 1923 | Ga0496125_0017746 | |||
| 1924 | Ga0496125_0017837 | |||
| 1925 | Ga0496125_0046766 | |||
| 1926 | Ga0496125_0051955 | |||
| 1927 | Ga0496125_0054939 | |||
| 1928 | Ga0501291_003279 | |||
| 1929 | Ga0501292_009696 | |||
| 1930 | Ga0501031_0001713 | |||
| 1931 | Ga0501031_0029305 | |||
| 1932 | Ga0501034_0345305 | |||
| 1933 | Ga0501036_0117354 | |||
| 1934 | Ga0501039_0293249 | |||
| 1935 | Ga0501041_0084458 | |||
| 1936 | Ga0501043_0000058 | |||
| 1937 | Ga0501046_0000051 | |||
| 1938 | Ga0501047_0000003 | |||
| 1939 | Ga0501047_0016202 | |||
| 1940 | Ga0501047_0287546 | |||
| 1941 | Ga0501070_0147670 | |||
| 1942 | Ga0501075_0032839 | |||
| 1943 | Ga0501076_0079761 | |||
| 1944 | Ga0501076_0296899 | |||
| 1945 | Ga0501198_000007 | |||
| 1946 | Ga0501222_000005 | |||
| 1947 | Ga0501249_004367 | |||
| 1948 | Ga0501225_0024202 | |||
| 1949 | Ga0501229_000685 | |||
| 1950 | Ga0501080_0202514 | |||
| 1951 | Ga0501081_0099489 | |||
| 1952 | Ga0501083_0025871 | |||
| 1953 | Ga0501267_002227 | |||
| 1954 | Ga0501044_0004830 | |||
| 1955 | Ga0501045_0015123 | |||
| 1956 | Ga0501045_0210284 | |||
| 1957 | nmdc:mga03683_29128_c1 | |||
| 1958 | nmdc:mga03683_59943_c1 | |||
| 1959 | nmdc:mga03683_916_c1 | |||
| 1960 | nmdc:mga03n38_117193_c1 | |||
| 1961 | nmdc:mga03n38_21764_c1 | |||
| 1962 | nmdc:mga03n38_45913_c1 | |||
| 1963 | nmdc:mga03n38_56000_c1 | |||
| 1964 | nmdc:mga03n38_58155_c1 | |||
| 1965 | nmdc:mga03n38_70573_c1 | |||
| 1966 | nmdc:mga00v17_31205_c1 | |||
| 1967 | nmdc:mga0yw44_88132_c1 | |||
| 1968 | nmdc:mga0k408_103336_c1 | |||
| 1969 | nmdc:mga0k408_103779_c1 | |||
| 1970 | nmdc:mga0k408_10449_c1 | |||
| 1971 | nmdc:mga0k408_10776_c1 | |||
| 1972 | nmdc:mga0k408_134114_c1 | |||
| 1973 | nmdc:mga0k408_1536_c1 | |||
| 1974 | nmdc:mga0k408_196283_c1 | |||
| 1975 | nmdc:mga0k408_21153_c1 | |||
| 1976 | nmdc:mga0k408_35374_c1 | |||
| 1977 | nmdc:mga0k408_366_c1 | |||
| 1978 | nmdc:mga0k408_49562_c1 | |||
| 1979 | nmdc:mga0k408_8221_c1 | |||
| 1980 | nmdc:mga0k408_83171_c1 | |||
| 1981 | nmdc:mga0k408_87039_c1 | |||
| 1982 | nmdc:mga0k408_98163_c1 | |||
| 1983 | nmdc:mga06z11_21913_c2 | |||
| 1984 | nmdc:mga07m45_10234_c1 | |||
| 1985 | nmdc:mga07m45_29854_c1 | |||
| 1986 | nmdc:mga07m45_2992_c2 | |||
| 1987 | nmdc:mga07m45_2998_c1 | |||
| 1988 | nmdc:mga07m45_3088_c1 | |||
| 1989 | nmdc:mga07m45_3233_c1 | |||
| 1990 | nmdc:mga07m45_4705_c1 | |||
| 1991 | nmdc:mga07m45_6187_c1 | |||
| 1992 | nmdc:mga07m45_64416_c1 | |||
| 1993 | nmdc:mga07m45_6836_c1 | |||
| 1994 | nmdc:mga07m45_9468_c1 | |||
| 1995 | nmdc:mga09592_174_c1 | |||
| 1996 | nmdc:mga0sz30_35023_c1 | |||
| 1997 | nmdc:mga0sz30_42066_c1 | |||
| 1998 | Ga0500635_0000070 | |||
| 1999 | Ga0500578_0000417 | |||
| 2000 | Ga0500651_0000093 | |||
| 2001 | Ga0500651_0001098 | |||
| 2002 | Ga0500651_0065399 | |||
| 2003 | Ga0500566_0106332 | |||
| 2004 | Ga0500562_002046 | |||
| 2005 | Ga0500571_000137 | |||
| 2006 | Ga0500593_000471 | |||
| 2007 | Ga0500593_000805 | |||
| 2008 | Ga0500593_001574 | |||
| 2009 | Ga0500594_0005325 | |||
| 2010 | Ga0500607_004111 | |||
| 2011 | Ga0500608_006080 | |||
| 2012 | Ga0500608_010693 | |||
| 2013 | Ga0500642_0008356 | |||
| 2014 | Ga0500642_0020754 | |||
| 2015 | Ga0500652_001084 | |||
| 2016 | Ga0500652_064140 | |||
| 2017 | Ga0500655_000776 | |||
| 2018 | Ga0500658_0000827 | |||
| 2019 | Ga0500658_0011664 | |||
| 2020 | Ga0500658_0029034 | |||
| 2021 | Ga0500559_0000097 | |||
| 2022 | Ga0500559_0004744 | |||
| 2023 | Ga0500559_0023297 | |||
| 2024 | Ga0500568_0004144 | |||
| 2025 | Ga0500568_0004342 | |||
| 2026 | Ga0500568_0007402 | |||
| 2027 | Ga0500568_0015839 | |||
| 2028 | Ga0500590_064552 | |||
| 2029 | Ga0500622_0000198 | |||
| 2030 | Ga0500622_0005315 | |||
| 2031 | Ga0500627_0002058 | |||
| 2032 | Ga0500645_000259 | |||
| 2033 | Ga0500645_002355 | |||
| 2034 | Ga0500587_000676 | |||
| 2035 | Ga0500661_008021 | |||
| 2036 | Ga0466962_0003983 | |||
| 2037 | 2511245341 | |||
| 2038 | 2548500276 | |||
| 2039 | 2587725949 | |||
| 2040 | 2587735600 | |||
| 2041 | 2588292838 | |||
| 2042 | 2599621793 | |||
| 2043 | 2599670523 | |||
| 2044 | 2599679013 | |||
| 2045 | 2599691304 | |||
| 2046 | 2643744049 | |||
| 2047 | 2643864692 | |||
| 2048 | 2643932478 | |||
| 2049 | 2643992696 | |||
| 2050 | 2644058399 | |||
| 2051 | 2644073450 | |||
| 2052 | 2644163726 | |||
| 2053 | 2644219892 | |||
| 2054 | 2644247189 | |||
| 2055 | 2644260990 | |||
| 2056 | 2644296484 | |||
| 2057 | 2644301004 | |||
| 2058 | 2644313729 | |||
| 2059 | 2644327043 | |||
| 2060 | 2644339818 | |||
| 2061 | 2644398846 | |||
| 2062 | 2644466527 | |||
| 2063 | 2644647171 | |||
| 2064 | 2735818178 | |||
| 2065 | 2738721855 | |||
| 2066 | 2738882029 | |||
| 2067 | 2739054795 | |||
| 2068 | 2739247033 | |||
| 2069 | 2739247829 | |||
| 2070 | 2739282219 | |||
| 2071 | 2740032516 | |||
| 2072 | 2787508467 | |||
| 2073 | 2816469687 | |||
| 2074 | 2819597962 | |||
| 2075 | 2831268951 | |||
| 2076 | 2831867635 | |||
| 2077 | 2838058379 | |||
| 2078 | 2842678299 | |||
| 2079 | 2842720649 | |||
| 2080 | 2842738632 | |||
| 2081 | 2881104357 | |||
| 2082 | 2881645022 | |||
| 2083 | 2885203881 | |||
| 2084 | 2885217784 | |||
| 2085 | 2886854914 | |||
| 2086 | 2899929381 | |||
| 2087 | 2904451123 | |||
| 2088 | 2904457977 | |||
| 2089 | 2904546720 | |||
| 2090 | 2919465672 | |||
| 2091 | 2928040175 | |||
| 2092 | 2928047076 | |||
| 2093 | 2928057720 | |||
| 2094 | 2928067897 | |||
| 2095 | 2928072461 | |||
| 2096 | 2928085660 | |||
| 2097 | 2928118830 | |||
| 2098 | 2928520417 | |||
| 2099 | 2929166169 | |||
| 2100 | 2929526408 | |||
| 2101 | 2939615677 | |||
| 2102 | 2939634697 | |||
| 2103 | 2945915015 | |||
| 2104 | 2945950962 | |||
| 2105 | 2945974401 | |||
| 2106 | 2945989587 | |||
| 2107 | 2990715271 | |||
| 2108 | 3001271207 | |||
| 2109 | 3001272105 | |||
| 2110 | 3006978298 | |||
| 2111 | 3006992730 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4izo-assembly1.cif.gz_A | crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis | 0.9659 | 8 | 398 |
| 4izo-assembly1.cif.gz_A | crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis | 0.9609 | 8 | 398 |
| 4e4t-assembly1.cif.gz_B | crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria | 0.959 | 8 | 399 |
| 4e4t-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria | 0.9579 | 8 | 399 |
| 4e4t-assembly1.cif.gz_B | crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria | 0.9541 | 8 | 399 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4izoA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9892 | 8 | 117 | 3.40.50.20 |
| 4izoA03 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9754 | 189 | 397 | 3.30.470.20 |
| 3v4sB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9722 | 10 | 117 | 3.40.50.20 |
| 4izoA03 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9706 | 189 | 397 | 3.30.470.20 |
| 3aw8B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9605 | 16 | 110 | 3.40.50.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5WH15-F1-model_v4 | deleted | 0.998 | 8 | 314 |
|
| AF-A0A3C1MWY2-F1-model_v4 | 5-(Carboxyamino)imidazole ribonucleotide synthase | 0.9952 | 10 | 117 |
GO:0005829
|
| AF-A0A4Q5WH15-F1-model_v4 | deleted | 0.9884 | 8 | 314 |
|
| AF-A0A1I7Y3B8-F1-model_v4 | Multifunctional fusion protein | 0.9778 | 22 | 398 |
GO:0004638
GO:0004639 GO:0005524 GO:0005829 GO:0005975 GO:0006189 GO:0008270 GO:0016832 |
| AF-A0A7C5KY93-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) | 0.9774 | 1 | 395 |
GO:0004638
GO:0005524 GO:0005829 GO:0006189 GO:0034028 GO:0046872 |