F489159

General Info

Members Datasets Scaffolds Average Seq Length
1055 502 2111 390

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_4042678|Ga0451853_4042678_74_1342
Length 422
Sequence MNASTSSRASSSLPDLPVFPGTASASGQPATLGVMGGGQLGRMFVHAAQRLGYFTAVLDPDPQSPAGLVSHHHIQTGYSDEKGLAELAALCAAVTTEFENVPAGALQALAASRPVAPGAAAVAIAQNRIEEKSHFTASAAESGVLAGVSCAPYAVIETEAQLRAVPADLLPGILKTARMGYDGKGQVRVKNAAELAGAWAGLKQAFCVLEKMLPLKAECSVVVARGWDGRVVSFAPQRNVHVDGILAVTQAYEGNMPAALAQRALAATHTIAHHVGYVGVLCVEFFLVDDGSADGALVVNEMAPRPHNSGHYTMDACDVSQFDLQVHAMAGLPLPQPRQHSPAIMLNLLGDVWVDAQGNSRTPDWQAVLALPGTHLHLYGKTEARAGRKMGHLNITGADVATVKATARQAAAILGLPGLEDI

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
108 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
209 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
210 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
222 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
223 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
224 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
225 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
226 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
227 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
268 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
269 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
270 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
271 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
272 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
273 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
274 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
277 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
278 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
279 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
280 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
281 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
282 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
283 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
284 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
285 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
286 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
287 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
288 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
289 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
290 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
291 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
292 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
293 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
294 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
295 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
296 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
297 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
298 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
299 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
300 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
301 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
302 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
303 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
304 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
305 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
306 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
307 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
308 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
313 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
319 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
320 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
330 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
331 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
338 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
339 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
340 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
350 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
373 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
386 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
387 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
388 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
389 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
396 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
397 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
398 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
399 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
400 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
403 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
404 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
405 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
406 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
410 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
411 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
412 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
413 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
414 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
415 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
416 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
417 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
421 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
422 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
423 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
426 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
427 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
428 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
429 2547132374 Acidovorax radicis N35 Isolate Unclassified
430 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
431 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
432 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
433 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
434 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
435 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
436 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
437 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
438 2643221570 Acidovorax sp. Root568 Isolate Unclassified
439 2643221585 Pelomonas sp. Root662 Isolate Unclassified
440 2643221596 Acidovorax sp. Root70 Isolate Unclassified
441 2643221609 Acidovorax sp. Root217 Isolate Unclassified
442 2643221611 Acidovorax sp. Root219 Isolate Unclassified
443 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
444 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
445 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
446 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
447 2643221652 Acidovorax sp. Root402 Isolate Unclassified
448 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
449 2643221656 Pelomonas sp. Root405 Isolate Unclassified
450 2643221658 Variovorax sp. Root411 Isolate Unclassified
451 2643221660 Methylibium sp. Root1272 Isolate Unclassified
452 2643221672 Variovorax sp. Root434 Isolate Unclassified
453 2643221683 Variovorax sp. Root473 Isolate Unclassified
454 2643221717 Acidovorax sp. Root267 Isolate Unclassified
455 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
456 2738541277 Variovorax sp. GV051 Isolate Unclassified
457 2738541307 Variovorax sp. GV008 Isolate Unclassified
458 2738541337 Pelomonas sp. BT06 Isolate Unclassified
459 2738543012 Acidovorax sp. CF301 Isolate Unclassified
460 2738543013 Variovorax sp. BT01 Isolate Unclassified
461 2738543019 Variovorax sp. GV040 Isolate Unclassified
462 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
463 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
464 2816332133 Acidovorax radicis 2721A Isolate Unclassified
465 2818991446 Variovorax sp. 1180 Isolate Unclassified
466 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
467 2831864461 Roseateles noduli HZ7 Isolate Nodule
468 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
469 2842677519 Variovorax sp. R-72495 Isolate Unclassified
470 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
471 2842733646 Variovorax sp. R-72446 Isolate Unclassified
472 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
473 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
474 2885198086 Variovorax sp. 679 Isolate Unclassified
475 2885211737 Variovorax sp. 553 Isolate Unclassified
476 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
477 2899924645 Variovorax sp. 369 Isolate Unclassified
478 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
479 2904456579 Variovorax sp. 2002 Isolate Unclassified
480 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
481 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
482 2928037797 Variovorax sp. 1126 Isolate Unclassified
483 2928044640 Variovorax sp. 1128 Isolate Unclassified
484 2928051484 Variovorax sp. 1133 Isolate Unclassified
485 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
486 2928070936 Variovorax gossypii 1167 Isolate Unclassified
487 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
488 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
489 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
490 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
491 2929520902 Variovorax beijingensis 502 Isolate Unclassified
492 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
493 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
494 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
495 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
496 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
497 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
498 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
499 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
500 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
501 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
502 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.42
Metatranscriptomes 0.47
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.63
Nodule 0.76
Rhizoplane 2.37
Rhizosphere 54.69
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_4042678 3300041512 Bacteria 1563
2 JGI24740J21852_10007049 3300001979 Bacteria 4606
3 JGI24740J21852_10016505 3300001979 Bacteria 2668
4 JGI24739J22299_10006314 3300001989 Bacteria 4475
5 JGI25155J39150_1000037 3300002704 Bacteria 97260
6 JGI25156J39149_1000024 3300002705 Bacteria 141748
7 JGI25156J39149_1000273 3300002705 Bacteria 35022
8 JGI25154J39366_1000043 3300002738 Bacteria 142417
9 JGI25154J39366_1001641 3300002738 Bacteria 7499
10 JGI25158J39367_1005090 3300002739 Bacteria 1942
11 JGI25157J39369_1000031 3300002741 Bacteria 141953
12 JGI25157J39369_1000141 3300002741 Bacteria 61029
13 JGI25152J39213_1007178 3300002773 Bacteria 2918
14 JGI25150J39212_1002395 3300002774 Bacteria 4697
15 JGI25150J39212_1004345 3300002774 Bacteria 3166
16 JGI25159J45721_1004996 3300002987 Bacteria 4246
17 JGI25159J45721_1007712 3300002987 Bacteria 3047
18 JGI25151J46595_10001536 3300003187 Bacteria 15422
19 JGI25151J46595_10002156 3300003187 Bacteria 12214
20 JGI25151J46595_10002752 3300003187 Bacteria 10217
21 JGI25151J46595_10011019 3300003187 Bacteria 4174
22 JGI25151J46595_10019115 3300003187 Bacteria 2920
23 JGI25153J46596_10001676 3300003215 Bacteria 13140
24 JGI25153J46596_10003840 3300003215 Bacteria 8278
25 JGI25153J46596_10016969 3300003215 Bacteria 2888
26 rootH1_10000170 3300003316 Bacteria 11868
27 rootH1_10000170 3300003323 Bacteria 3661
28 rootH1_10002432 3300003316 Bacteria 8940
29 rootH1_10043915 3300003316 Bacteria 4849
30 rootL2_10001066 3300003322 Bacteria 89444
31 rootL2_10090276 3300003322 Bacteria 6717
32 rootH1_10002491 3300003323 Bacteria 40530
33 JGI25160J50197_1000172 3300003354 Bacteria 55781
34 JGI25160J50197_1011812 3300003354 Bacteria 3068
35 JGI25161J50226_1000007 3300003374 Bacteria 256181
36 JGI25161J50226_1003544 3300003374 Bacteria 3532
37 JGI25161J50226_1005059 3300003374 Bacteria 2639
38 Ga0006562J51391_1039805 3300003578 Bacteria 9925
39 Ga0006562J51391_1039806 3300003578 Bacteria 9600
40 Ga0006562J51391_1066746 3300003578 Bacteria 3980
41 Ga0006562J51391_1066748 3300003578 Bacteria 2040
42 Ga0055539_1000219 3300003752 Bacteria 40919
43 Ga0055533_1000008 3300003756 Bacteria 575861
44 Ga0055525_1000054 3300003759 Bacteria 216523
45 Ga0055525_1001100 3300003759 Bacteria 6698
46 Ga0055535_1000271 3300003761 Bacteria 54319
47 Ga0055535_1000995 3300003761 Bacteria 18294
48 Ga0055535_1007207 3300003761 Bacteria 2149
49 Ga0055542_1000003 3300003762 Bacteria 582721
50 Ga0055529_1000321 3300003763 Bacteria 54307
51 Ga0055526_1001240 3300003771 Bacteria 18300
52 Ga0055526_1014459 3300003771 Bacteria 3245
53 Ga0055526_1015438 3300003771 Bacteria 3065
54 Ga0055526_1015538 3300003771 Bacteria 3051
55 Ga0055526_1017593 3300003771 Bacteria 2723
56 Ga0055537_1000356 3300003773 Bacteria 31055
57 Ga0055537_1001103 3300003773 Bacteria 11701
58 Ga0055537_1007183 3300003773 Bacteria 2723
59 Ga0055524_1000140 3300003775 Bacteria 85990
60 Ga0055524_1000213 3300003775 Bacteria 61225
61 Ga0055524_1000550 3300003775 Bacteria 28332
62 Ga0055524_1014230 3300003775 Bacteria 2959
63 Ga0055524_1015505 3300003775 Bacteria 2774
64 Ga0055536_1002468 3300003781 Bacteria 10386
65 Ga0055536_1006719 3300003781 Bacteria 5284
66 Ga0055536_1009794 3300003781 Bacteria 3906
67 Ga0055536_1015963 3300003781 Bacteria 2539
68 Ga0055536_1021287 3300003781 Bacteria 1972
69 Ga0055534_1000346 3300003784 Bacteria 29725
70 Ga0055534_1001067 3300003784 Bacteria 11831
71 Ga0055534_1001587 3300003784 Bacteria 8817
72 Ga0055534_1009018 3300003784 Bacteria 2204
73 Ga0055528_1000846 3300003790 Bacteria 20747
74 Ga0055528_1001593 3300003790 Bacteria 13457
75 Ga0055528_1015691 3300003790 Bacteria 2723
76 Ga0055530_10000763 3300003791 Bacteria 26793
77 Ga0055530_10003145 3300003791 Bacteria 9734
78 Ga0055530_10003770 3300003791 Bacteria 8359
79 Ga0055530_10015503 3300003791 Bacteria 2483
80 Ga0055540_1000133 3300003792 Bacteria 75104
81 Ga0055540_1000504 3300003792 Bacteria 29761
82 Ga0055540_1000765 3300003792 Bacteria 21856
83 Ga0055540_1003891 3300003792 Bacteria 7009
84 Ga0055540_1007562 3300003792 Bacteria 4069
85 Ga0055540_1007906 3300003792 Bacteria 3918
86 Ga0055540_1011179 3300003792 Bacteria 2918
87 Ga0055531_10000469 3300003794 Bacteria 37355
88 Ga0055531_10000973 3300003794 Bacteria 22864
89 Ga0055531_10002263 3300003794 Bacteria 13024
90 Ga0055531_10003310 3300003794 Bacteria 10312
91 Ga0055531_10004604 3300003794 Bacteria 8305
92 Ga0055531_10012397 3300003794 Bacteria 4014
93 Ga0055531_10018174 3300003794 Bacteria 2918
94 Ga0055531_10018180 3300003794 Bacteria 2918
95 Ga0055543_1000061 3300004625 Bacteria 98138
96 Ga0055543_1001261 3300004625 Bacteria 10444
97 Ga0055543_1005771 3300004625 Bacteria 3106
98 Ga0055543_1005778 3300004625 Bacteria 3103
99 Ga0065165_1000474 3300005262 Bacteria 62687
100 Ga0065165_1000621 3300005262 Bacteria 51523
101 Ga0065165_1005479 3300005262 Bacteria 7103
102 Ga0065165_1006179 3300005262 Bacteria 6391
103 Ga0065165_1008900 3300005262 Bacteria 4605
104 Ga0065165_1014201 3300005262 Bacteria 3106
105 Ga0070658_10008606 3300005327 Bacteria 8205
106 Ga0070658_10022214 3300005327 Bacteria 5091
107 Ga0070658_10040585 3300005327 Bacteria 3755
108 Ga0070658_10104791 3300005327 Bacteria 2340
109 Ga0070676_10019300 3300005328 Bacteria 3792
110 Ga0070676_10147765 3300005328 Bacteria 1502
111 Ga0070690_100012795 3300005330 Bacteria 4943
112 Ga0070670_100040263 3300005331 Bacteria 4019
113 Ga0070670_100061187 3300005331 Bacteria 3232
114 Ga0070670_100080010 3300005331 Unclassified 2808
115 Ga0070670_100098308 3300005331 Bacteria 2518
116 Ga0070670_100155303 3300005331 Bacteria 1981
117 Ga0070670_100199120 3300005331 Bacteria 1740
118 Ga0068869_100049108 3300005334 Bacteria 3053
119 Ga0068869_100226830 3300005334 Bacteria 1483
120 Ga0070666_10048516 3300005335 Bacteria 2853
121 Ga0070666_10095199 3300005335 Bacteria 2049
122 Ga0070680_100096268 3300005336 Bacteria 2454
123 Ga0068868_100017925 3300005338 Bacteria 5283
124 Ga0068868_100024364 3300005338 Bacteria 4592
125 Ga0068868_100055588 3300005338 Bacteria 3123
126 Ga0070660_100166540 3300005339 Bacteria 1778
127 Ga0070689_100045943 3300005340 Bacteria 3364
128 Ga0070689_100124259 3300005340 Bacteria 2064
129 Ga0070661_100018267 3300005344 Bacteria 4984
130 Ga0070661_100110471 3300005344 Bacteria 2052
131 Ga0070668_100020579 3300005347 Bacteria 4981
132 Ga0070675_100004369 3300005354 Bacteria 10783
133 Ga0070675_100089027 3300005354 Bacteria 2584
134 Ga0070675_100111069 3300005354 Bacteria 2319
135 Ga0070675_100238362 3300005354 Bacteria 1589
136 Ga0070671_100007073 3300005355 Bacteria 8988
137 Ga0070671_100017702 3300005355 Bacteria 5775
138 Ga0070671_100020190 3300005355 Bacteria 5430
139 Ga0070671_100023028 3300005355 Bacteria 5091
140 Ga0070674_100054573 3300005356 Unclassified 2764
141 Ga0070674_100085143 3300005356 Bacteria 2268
142 Ga0070673_100001467 3300005364 Bacteria 13796
143 Ga0070673_100007248 3300005364 Bacteria 7298
144 Ga0070673_100014291 3300005364 Bacteria 5522
145 Ga0070673_100020089 3300005364 Bacteria 4810
146 Ga0070659_100021184 3300005366 Bacteria 4946
147 Ga0070659_100168799 3300005366 Bacteria 1791
148 Ga0070667_100006934 3300005367 Bacteria 9413
149 Ga0070667_100180339 3300005367 Bacteria 1867
150 Ga0070667_100272942 3300005367 Bacteria 1517
151 Ga0070714_100318394 3300005435 Bacteria 1454
152 Ga0070663_100020950 3300005455 Bacteria 4338
153 Ga0070663_100188131 3300005455 Bacteria 1605
154 Ga0070678_100034556 3300005456 Bacteria 3522
155 Ga0070662_100012766 3300005457 Bacteria 5576
156 Ga0070662_100021970 3300005457 Bacteria 4362
157 Ga0070662_100051373 3300005457 Bacteria 2976
158 Ga0068867_100000245 3300005459 Bacteria 35758
159 Ga0068867_100000605 3300005459 Bacteria 23775
160 Ga0068867_100011924 3300005459 Bacteria 6141
161 Ga0068867_100021133 3300005459 Bacteria 4643
162 Ga0070706_100002995 3300005467 Bacteria 16740
163 Ga0070707_100067782 3300005468 Bacteria 3434
164 Ga0070679_100039040 3300005530 Bacteria 4720
165 Ga0070684_100199409 3300005535 Bacteria 1823
166 Ga0068853_100036201 3300005539 Bacteria 4195
167 Ga0068853_100071427 3300005539 Bacteria 3023
168 Ga0068853_100077168 3300005539 Bacteria 2910
169 Ga0070672_100002136 3300005543 Bacteria 12474
170 Ga0070672_100010450 3300005543 Bacteria 6441
171 Ga0070672_100029290 3300005543 Bacteria 4128
172 Ga0070672_100068866 3300005543 Bacteria 2808
173 Ga0070672_100117681 3300005543 Bacteria 2172
174 Ga0070665_100005540 3300005548 Bacteria 12985
175 Ga0070665_100008298 3300005548 Bacteria 10503
176 Ga0070665_100057790 3300005548 Unclassified 3889
177 Ga0070665_100291979 3300005548 Bacteria 1633
178 Ga0068855_100011340 3300005563 Bacteria 10760
179 Ga0068855_100046322 3300005563 Bacteria 5141
180 Ga0068855_100237784 3300005563 Bacteria 2036
181 Ga0068855_100412193 3300005563 Bacteria 1479
182 Ga0070664_100002435 3300005564 Bacteria 14972
183 Ga0070664_100048553 3300005564 Bacteria 3587
184 Ga0068857_100028700 3300005577 Bacteria 4909
185 Ga0068857_100031742 3300005577 Bacteria 4669
186 Ga0068857_100039422 3300005577 Bacteria 4184
187 Ga0068857_100055364 3300005577 Bacteria 3520
188 Ga0068854_100047028 3300005578 Bacteria 3074
189 Ga0068854_100101013 3300005578 Bacteria 2163
190 Ga0068854_100171813 3300005578 Bacteria 1687
191 Ga0068856_100000135 3300005614 Bacteria 74419
192 Ga0068856_100027773 3300005614 Bacteria 5521
193 Ga0068856_100399115 3300005614 Bacteria 1395
194 Ga0068852_100008014 3300005616 Bacteria 7748
195 Ga0068852_100023462 3300005616 Bacteria 4966
196 Ga0068852_100113592 3300005616 Bacteria 2467
197 Ga0068852_100286729 3300005616 Bacteria 1589
198 Ga0068864_100039478 3300005618 Bacteria 4035
199 Ga0068861_100022363 3300005719 Bacteria 4554
200 Ga0068851_10018422 3300005834 Bacteria 3362
201 Ga0068851_10065776 3300005834 Bacteria 1867
202 Ga0068863_100017699 3300005841 Bacteria 6821
203 Ga0068858_100347127 3300005842 Bacteria 1421
204 Ga0068860_100000384 3300005843 Bacteria 57893
205 Ga0068860_100097440 3300005843 Bacteria 2804
206 Ga0068860_100272194 3300005843 Bacteria 1653
207 Ga0068862_100037567 3300005844 Bacteria 4104
208 Ga0075365_10027748 3300006038 Bacteria 3605
209 Ga0075365_10100168 3300006038 Bacteria 1983
210 Ga0075368_10048762 3300006042 Bacteria 1679
211 Ga0075363_100029235 3300006048 Bacteria 2843
212 Ga0075363_100090501 3300006048 Bacteria 1683
213 Ga0075363_100139801 3300006048 Bacteria 1363
214 Ga0075364_10012964 3300006051 Bacteria 5117
215 Ga0075364_10053774 3300006051 Bacteria 2632
216 Ga0075364_10207369 3300006051 Bacteria 1329
217 Ga0075362_10001785 3300006177 Bacteria 7012
218 Ga0075362_10005324 3300006177 Bacteria 4700
219 Ga0075362_10009607 3300006177 Bacteria 3747
220 Ga0075362_10053518 3300006177 Bacteria 1812
221 Ga0075367_10159630 3300006178 Bacteria 1402
222 Ga0075369_10010982 3300006186 Bacteria 3552
223 Ga0075369_10046293 3300006186 Bacteria 1873
224 Ga0075366_10002666 3300006195 Bacteria 9199
225 Ga0075366_10011244 3300006195 Bacteria 5051
226 Ga0075366_10017453 3300006195 Bacteria 4130
227 Ga0075366_10029529 3300006195 Bacteria 3221
228 Ga0075366_10032812 3300006195 Bacteria 3057
229 Ga0075366_10042553 3300006195 Bacteria 2689
230 Ga0075366_10077926 3300006195 Bacteria 1978
231 Ga0075366_10092230 3300006195 Bacteria 1815
232 Ga0075366_10093239 3300006195 Bacteria 1805
233 Ga0097621_100140511 3300006237 Bacteria 2063
234 Ga0075370_10003469 3300006353 Bacteria 7514
235 Ga0075370_10004178 3300006353 Bacteria 6967
236 Ga0075370_10006062 3300006353 Bacteria 6058
237 Ga0075370_10011470 3300006353 Bacteria 4658
238 Ga0075370_10012670 3300006353 Bacteria 4463
239 Ga0075370_10032077 3300006353 Bacteria 2935
240 Ga0075370_10042272 3300006353 Bacteria 2575
241 Ga0075429_100000224 3300006880 Bacteria 38311
242 Ga0068865_100002745 3300006881 Bacteria 10461
243 Ga0068865_100017355 3300006881 Bacteria 4629
244 Ga0099823_1000005 3300006944 Bacteria 139631
245 Ga0079104_1000053 3300006946 Bacteria 168604
246 Ga0099826_10000959 3300006948 Bacteria 16025
247 Ga0105244_10002315 3300009036 Bacteria 14476
248 Ga0105240_10002477 3300009093 Bacteria 29680
249 Ga0105240_10009882 3300009093 Bacteria 13462
250 Ga0105240_10146487 3300009093 Bacteria 2817
251 Ga0105240_10332956 3300009093 Bacteria 1727
252 Ga0105240_10433567 3300009093 Bacteria 1474
253 Ga0105245_10026119 3300009098 Bacteria 5139
254 Ga0105245_10042445 3300009098 Bacteria 4059
255 Ga0105245_10048303 3300009098 Bacteria 3807
256 Ga0105243_10004228 3300009148 Bacteria 11379
257 Ga0105243_10006082 3300009148 Bacteria 9332
258 Ga0105243_10061212 3300009148 Bacteria 3010
259 Ga0105243_10067374 3300009148 Bacteria 2882
260 Ga0105243_10095301 3300009148 Bacteria 2459
261 Ga0105243_10138475 3300009148 Bacteria 2073
262 Ga0105243_10148545 3300009148 Bacteria 2008
263 Ga0105241_10243781 3300009174 Bacteria 1520
264 Ga0105241_10257780 3300009174 Bacteria 1481
265 Ga0105242_10016941 3300009176 Bacteria 5671
266 Ga0105248_10001355 3300009177 Bacteria 27299
267 Ga0105237_10000668 3300009545 Bacteria 47303
268 Ga0105237_10011246 3300009545 Bacteria 9474
269 Ga0105237_10028106 3300009545 Bacteria 5731
270 Ga0105237_10046071 3300009545 Bacteria 4387
271 Ga0105238_10007313 3300009551 Bacteria 11057
272 Ga0105238_10061434 3300009551 Bacteria 3760
273 Ga0105238_10106330 3300009551 Bacteria 2788
274 Ga0105238_10180384 3300009551 Bacteria 2088
275 Ga0105249_10017117 3300009553 Bacteria 6433
276 Ga0105239_10020399 3300010375 Bacteria 7311
277 Ga0105239_10021874 3300010375 Bacteria 7050
278 Ga0105239_10025029 3300010375 Bacteria 6576
279 Ga0105239_10032539 3300010375 Bacteria 5730
280 Ga0105246_10038570 3300011119 Bacteria 3214
281 Ga0105246_10119579 3300011119 Bacteria 1950
282 Ga0157317_1001054 3300012475 Bacteria 1405
283 Ga0157319_1000005 3300012497 Bacteria 372810
284 Ga0157373_10023614 3300013100 Bacteria 4456
285 Ga0157371_10118626 3300013102 Bacteria 1881
286 Ga0157370_10231461 3300013104 Bacteria 1710
287 Ga0157369_10143197 3300013105 Bacteria 2528
288 Ga0157369_10211029 3300013105 Bacteria 2035
289 Ga0157374_10183833 3300013296 Bacteria 2043
290 Ga0157378_10096431 3300013297 Bacteria 2695
291 Ga0157378_10357565 3300013297 Bacteria 1428
292 Ga0163162_10000794 3300013306 Bacteria 29387
293 Ga0163162_10001355 3300013306 Bacteria 22806
294 Ga0157372_10556056 3300013307 Bacteria 1338
295 Ga0157375_10040833 3300013308 Bacteria 4475
296 Ga0157375_10197055 3300013308 Bacteria 2169
297 Ga0163163_10096492 3300014325 Bacteria 2976
298 Ga0157380_10012894 3300014326 Bacteria 6076
299 Ga0157380_10183432 3300014326 Bacteria 1841
300 Ga0157380_10335850 3300014326 Bacteria 1407
301 Ga0182008_10004921 3300014497 Bacteria 7702
302 Ga0182008_10010747 3300014497 Bacteria 4891
303 Ga0157377_10000034 3300014745 Bacteria 117744
304 Ga0157379_10009090 3300014968 Bacteria 8659
305 Ga0157379_10073730 3300014968 Bacteria 3055
306 Ga0157379_10083761 3300014968 Bacteria 2858
307 Ga0157376_10083963 3300014969 Bacteria 2741
308 Ga0157376_10269892 3300014969 Bacteria 1598
309 Ga0182006_1001345 3300015261 Bacteria 15063
310 Ga0182006_1063506 3300015261 Bacteria 1387
311 Ga0182007_10000317 3300015262 Bacteria 30601
312 Ga0182007_10001372 3300015262 Bacteria 13100
313 Ga0183362_10004 3300015683 Bacteria 569303
314 Ga0163161_10000361 3300017792 Bacteria 38156
315 Ga0163161_10011636 3300017792 Bacteria 6108
316 Ga0163161_10096335 3300017792 Bacteria 2196
317 Ga0213872_10001003 3300021361 Bacteria 19713
318 Ga0213872_10004509 3300021361 Bacteria 7376
319 Ga0213872_10012188 3300021361 Bacteria 4053
320 Ga0213872_10017132 3300021361 Bacteria 3353
321 Ga0213876_10095098 3300021384 Bacteria 1578
322 Ga0213875_10060163 3300021388 Bacteria 1777
323 Ga0209435_100008 3300025206 Bacteria 503644
324 Ga0209674_100015 3300025226 Bacteria 697299
325 Ga0209672_101139 3300025228 Bacteria 11037
326 Ga0209563_100017 3300025230 Bacteria 796449
327 Ga0209563_100075 3300025230 Bacteria 216575
328 Ga0207427_100444 3300025231 Bacteria 22994
329 Ga0209258_100015 3300025242 Bacteria 706310
330 Ga0209258_100025 3300025242 Bacteria 534777
331 Ga0209258_100726 3300025242 Bacteria 21958
332 Ga0207425_1000570 3300025245 Bacteria 21658
333 Ga0207425_1002945 3300025245 Bacteria 5699
334 Ga0207425_1006495 3300025245 Bacteria 3192
335 Ga0207425_1007181 3300025245 Bacteria 2969
336 Ga0209646_1000079 3300025246 Bacteria 207677
337 Ga0209646_1000438 3300025246 Bacteria 22604
338 Ga0209026_1000028 3300025250 Bacteria 341399
339 Ga0209026_1000067 3300025250 Bacteria 207677
340 Ga0209677_100037 3300025253 Bacteria 286702
341 Ga0209677_100113 3300025253 Bacteria 84174
342 Ga0209677_101296 3300025253 Bacteria 11131
343 Ga0209148_1000028 3300025254 Bacteria 582773
344 Ga0209759_1000021 3300025256 Bacteria 341399
345 Ga0209759_1000056 3300025256 Bacteria 207677
346 Ga0209759_1001016 3300025256 Bacteria 18856
347 Ga0209759_1001538 3300025256 Bacteria 12653
348 Ga0209129_1000049 3300025258 Bacteria 268086
349 Ga0209129_1000158 3300025258 Bacteria 103711
350 Ga0209129_1002921 3300025258 Bacteria 7835
351 Ga0209129_1011570 3300025258 Bacteria 2096
352 Ga0209565_1000041 3300025263 Bacteria 251081
353 Ga0209565_1000259 3300025263 Bacteria 56285
354 Ga0209565_1000333 3300025263 Bacteria 42094
355 Ga0209565_1002282 3300025263 Bacteria 7077
356 Ga0209565_1004128 3300025263 Bacteria 4517
357 Ga0209565_1007247 3300025263 Bacteria 3011
358 Ga0209455_1000166 3300025272 Bacteria 113101
359 Ga0209673_1000193 3300025273 Bacteria 123134
360 Ga0209673_1000364 3300025273 Bacteria 81319
361 Ga0209673_1004816 3300025273 Bacteria 7077
362 Ga0209673_1005119 3300025273 Bacteria 6717
363 Ga0209673_1014689 3300025273 Bacteria 3020
364 Ga0209673_1021019 3300025273 Bacteria 2294
365 Ga0209673_1033619 3300025273 Bacteria 1560
366 Ga0209130_1000245 3300025284 Bacteria 68668
367 Ga0209130_1000708 3300025284 Bacteria 29740
368 Ga0209130_1001785 3300025284 Bacteria 12655
369 Ga0209130_1002505 3300025284 Bacteria 9064
370 Ga0209130_1002770 3300025284 Bacteria 8248
371 Ga0209675_1000220 3300025291 Bacteria 59335
372 Ga0209675_1000316 3300025291 Bacteria 43181
373 Ga0209675_1003708 3300025291 Bacteria 7104
374 Ga0209675_1015740 3300025291 Bacteria 2231
375 Ga0209676_1000013 3300025292 Bacteria 816080
376 Ga0209676_1000074 3300025292 Bacteria 305770
377 Ga0209676_1000209 3300025292 Bacteria 130388
378 Ga0209676_1000689 3300025292 Bacteria 47629
379 Ga0209676_1002936 3300025292 Bacteria 11131
380 Ga0209676_1006483 3300025292 Bacteria 5765
381 Ga0209676_1014369 3300025292 Bacteria 2981
382 Ga0209676_1027482 3300025292 Bacteria 1790
383 Ga0209025_1000283 3300025294 Bacteria 114855
384 Ga0209025_1001092 3300025294 Bacteria 39204
385 Ga0209025_1001101 3300025294 Bacteria 38908
386 Ga0209025_1003444 3300025294 Bacteria 14976
387 Ga0209025_1003852 3300025294 Bacteria 13624
388 Ga0209025_1022772 3300025294 Bacteria 3306
389 Ga0209025_1025542 3300025294 Bacteria 3002
390 Ga0209025_1029710 3300025294 Bacteria 2636
391 Ga0209025_1054573 3300025294 Bacteria 1555
392 Ga0209564_1000021 3300025295 Bacteria 571316
393 Ga0209564_1000282 3300025295 Bacteria 103837
394 Ga0209564_1000363 3300025295 Bacteria 84210
395 Ga0209564_1001279 3300025295 Bacteria 27663
396 Ga0209564_1001670 3300025295 Bacteria 21241
397 Ga0209564_1003353 3300025295 Bacteria 11082
398 Ga0209564_1013238 3300025295 Bacteria 3523
399 Ga0209758_1000496 3300025297 Bacteria 64085
400 Ga0209758_1000815 3300025297 Bacteria 43876
401 Ga0209758_1000910 3300025297 Bacteria 40059
402 Ga0209758_1009742 3300025297 Bacteria 5899
403 Ga0209050_1000008 3300025298 Bacteria 1144179
404 Ga0209050_1000015 3300025298 Bacteria 759102
405 Ga0209050_1000996 3300025298 Bacteria 35727
406 Ga0209050_1001406 3300025298 Bacteria 26103
407 Ga0209050_1002179 3300025298 Bacteria 17697
408 Ga0209050_1002987 3300025298 Bacteria 13163
409 Ga0209050_1006789 3300025298 Bacteria 6669
410 Ga0209256_1000003 3300025299 Bacteria 1661127
411 Ga0209256_1000045 3300025299 Bacteria 325506
412 Ga0209256_1000264 3300025299 Bacteria 92750
413 Ga0209256_1000304 3300025299 Bacteria 85971
414 Ga0209256_1000309 3300025299 Bacteria 85294
415 Ga0209256_1001207 3300025299 Bacteria 28954
416 Ga0209256_1027278 3300025299 Bacteria 1630
417 Ga0207426_1000091 3300025302 Bacteria 280561
418 Ga0207426_1000108 3300025302 Bacteria 242257
419 Ga0207426_1000130 3300025302 Bacteria 210271
420 Ga0207426_1002234 3300025302 Bacteria 12910
421 Ga0209051_1000004 3300025303 Bacteria 1155596
422 Ga0209051_1000005 3300025303 Bacteria 1142353
423 Ga0209051_1000010 3300025303 Bacteria 641298
424 Ga0209051_1000156 3300025303 Bacteria 128246
425 Ga0209051_1000306 3300025303 Bacteria 77135
426 Ga0209051_1000621 3300025303 Bacteria 40763
427 Ga0209051_1000680 3300025303 Bacteria 37836
428 Ga0209051_1001349 3300025303 Bacteria 21311
429 Ga0209051_1006701 3300025303 Bacteria 6438
430 Ga0209051_1019395 3300025303 Bacteria 2968
431 Ga0209257_1000015 3300025304 Bacteria 908141
432 Ga0209257_1000016 3300025304 Bacteria 908015
433 Ga0209257_1000026 3300025304 Bacteria 723225
434 Ga0209257_1000048 3300025304 Bacteria 455536
435 Ga0209257_1000172 3300025304 Bacteria 167434
436 Ga0209257_1000315 3300025304 Bacteria 102293
437 Ga0209257_1000981 3300025304 Bacteria 38736
438 Ga0209257_1003138 3300025304 Bacteria 14743
439 Ga0209257_1014093 3300025304 Bacteria 3473
440 Ga0209257_1016709 3300025304 Bacteria 2947
441 Ga0207697_10000321 3300025315 Bacteria 26793
442 Ga0207655_1001367 3300025728 Bacteria 22840
443 Ga0207682_10029747 3300025893 Bacteria 2185
444 Ga0207688_10001947 3300025901 Bacteria 11055
445 Ga0207645_10005998 3300025907 Bacteria 8744
446 Ga0207645_10045667 3300025907 Bacteria 2799
447 Ga0207643_10030070 3300025908 Bacteria 3022
448 Ga0207705_10019722 3300025909 Bacteria 4822
449 Ga0207705_10166511 3300025909 Bacteria 1658
450 Ga0207684_10045694 3300025910 Bacteria 3713
451 Ga0207684_10049002 3300025910 Bacteria 3584
452 Ga0207695_10004981 3300025913 Bacteria 17877
453 Ga0207695_10007014 3300025913 Bacteria 14454
454 Ga0207695_10047957 3300025913 Bacteria 4514
455 Ga0207695_10057931 3300025913 Bacteria 4023
456 Ga0207695_10124467 3300025913 Bacteria 2542
457 Ga0207671_10021969 3300025914 Bacteria 4833
458 Ga0207671_10145514 3300025914 Bacteria 1828
459 Ga0207660_10061622 3300025917 Bacteria 2700
460 Ga0207657_10017128 3300025919 Bacteria 6961
461 Ga0207657_10105000 3300025919 Bacteria 2340
462 Ga0207649_10000614 3300025920 Bacteria 24092
463 Ga0207652_10069419 3300025921 Bacteria 3059
464 Ga0207652_10076312 3300025921 Bacteria 2922
465 Ga0207681_10079142 3300025923 Bacteria 2315
466 Ga0207681_10191266 3300025923 Bacteria 1566
467 Ga0207694_10028649 3300025924 Bacteria 4246
468 Ga0207650_10054134 3300025925 Bacteria 2975
469 Ga0207650_10071989 3300025925 Bacteria 2601
470 Ga0207659_10228316 3300025926 Bacteria 1500
471 Ga0207659_10252640 3300025926 Bacteria 1431
472 Ga0207687_10009833 3300025927 Bacteria 6260
473 Ga0207687_10038401 3300025927 Bacteria 3272
474 Ga0207687_10115900 3300025927 Bacteria 1996
475 Ga0207687_10250675 3300025927 Bacteria 1407
476 Ga0207664_10029018 3300025929 Bacteria 4212
477 Ga0207644_10017792 3300025931 Bacteria 4806
478 Ga0207644_10026836 3300025931 Bacteria 3975
479 Ga0207644_10158156 3300025931 Bacteria 1759
480 Ga0207690_10009309 3300025932 Bacteria 5835
481 Ga0207690_10013071 3300025932 Bacteria 4980
482 Ga0207706_10002180 3300025933 Bacteria 19100
483 Ga0207706_10032088 3300025933 Bacteria 4677
484 Ga0207706_10173593 3300025933 Bacteria 1894
485 Ga0207686_10000960 3300025934 Bacteria 17164
486 Ga0207709_10000433 3300025935 Bacteria 39614
487 Ga0207709_10000838 3300025935 Bacteria 23593
488 Ga0207709_10001092 3300025935 Bacteria 19873
489 Ga0207709_10012723 3300025935 Bacteria 4639
490 Ga0207709_10061034 3300025935 Bacteria 2354
491 Ga0207669_10049782 3300025937 Bacteria 2500
492 Ga0207704_10023252 3300025938 Bacteria 3337
493 Ga0207665_10145960 3300025939 Bacteria 1691
494 Ga0207691_10004655 3300025940 Bacteria 13284
495 Ga0207691_10005007 3300025940 Bacteria 12778
496 Ga0207711_10146343 3300025941 Bacteria 2129
497 Ga0207689_10018687 3300025942 Bacteria 5847
498 Ga0207689_10169441 3300025942 Bacteria 1799
499 Ga0207661_10133563 3300025944 Bacteria 2129
500 Ga0207679_10000077 3300025945 Bacteria 86432
501 Ga0207679_10095392 3300025945 Bacteria 2312
502 Ga0207679_10125626 3300025945 Bacteria 2049
503 Ga0207667_10003517 3300025949 Bacteria 19368
504 Ga0207667_10040596 3300025949 Bacteria 4955
505 Ga0207667_10189447 3300025949 Bacteria 2111
506 Ga0207667_10297476 3300025949 Bacteria 1649
507 Ga0207651_10004806 3300025960 Bacteria 6875
508 Ga0207651_10078807 3300025960 Bacteria 2364
509 Ga0207651_10232572 3300025960 Bacteria 1497
510 Ga0207712_10009930 3300025961 Bacteria 6033
511 Ga0207640_10032295 3300025981 Bacteria 3245
512 Ga0207640_10133252 3300025981 Bacteria 1799
513 Ga0207658_10029648 3300025986 Bacteria 3867
514 Ga0207658_10036634 3300025986 Bacteria 3518
515 Ga0207677_10021042 3300026023 Bacteria 3977
516 Ga0207677_10028704 3300026023 Bacteria 3524
517 Ga0207703_10041044 3300026035 Bacteria 3706
518 Ga0207639_10040814 3300026041 Bacteria 3466
519 Ga0207678_10037832 3300026067 Bacteria 4196
520 Ga0207678_10052599 3300026067 Bacteria 3512
521 Ga0207678_10061958 3300026067 Bacteria 3217
522 Ga0207708_10060111 3300026075 Bacteria 2901
523 Ga0207702_10001523 3300026078 Bacteria 22929
524 Ga0207702_10024832 3300026078 Bacteria 4972
525 Ga0207702_10136882 3300026078 Bacteria 2211
526 Ga0207702_10196605 3300026078 Bacteria 1867
527 Ga0207648_10000054 3300026089 Bacteria 106684
528 Ga0207648_10002852 3300026089 Bacteria 18291
529 Ga0207648_10004823 3300026089 Bacteria 13753
530 Ga0207648_10016725 3300026089 Bacteria 6693
531 Ga0207648_10030389 3300026089 Bacteria 4785
532 Ga0207648_10149976 3300026089 Bacteria 2057
533 Ga0207676_10027619 3300026095 Bacteria 4229
534 Ga0207676_10054808 3300026095 Bacteria 3126
535 Ga0207676_10280172 3300026095 Bacteria 1513
536 Ga0207674_10005841 3300026116 Bacteria 14594
537 Ga0207674_10008175 3300026116 Bacteria 12132
538 Ga0207674_10016268 3300026116 Bacteria 8147
539 Ga0207674_10054882 3300026116 Bacteria 4054
540 Ga0207675_100025649 3300026118 Bacteria 5486
541 Ga0207675_100036742 3300026118 Bacteria 4569
542 Ga0207683_10023817 3300026121 Bacteria 5267
543 Ga0207683_10136967 3300026121 Bacteria 2204
544 Ga0207683_10296511 3300026121 Bacteria 1479
545 Ga0207698_10019411 3300026142 Bacteria 4654
546 Ga0207698_10035266 3300026142 Bacteria 3657
547 Ga0207698_10036734 3300026142 Bacteria 3600
548 Ga0207698_10050766 3300026142 Bacteria 3167
549 Ga0207698_10175478 3300026142 Bacteria 1892
550 Ga0207698_10191700 3300026142 Bacteria 1821
551 Ga0207698_10339731 3300026142 Bacteria 1414
552 Ga0209281_1000147 3300027111 Bacteria 168586
553 Ga0209389_1000295 3300027296 Bacteria 31035
554 Ga0209968_1000628 3300027526 Bacteria 5458
555 Ga0209970_1001072 3300027614 Bacteria 4837
556 Ga0209282_1000107 3300027666 Bacteria 54230
557 Ga0209966_1000117 3300027695 Bacteria 35145
558 Ga0209974_10032873 3300027876 Bacteria 1720
559 Ga0268266_10005478 3300028379 Bacteria 11822
560 Ga0268266_10030341 3300028379 Bacteria 4593
561 Ga0268266_10042256 3300028379 Unclassified 3893
562 Ga0268265_10003306 3300028380 Bacteria 11674
563 Ga0268265_10135271 3300028380 Bacteria 2055
564 Ga0268265_10181367 3300028380 Bacteria 1809
565 Ga0268264_10001034 3300028381 Bacteria 27952
566 Ga0268264_10062691 3300028381 Bacteria 3123
567 Ga0268264_10095775 3300028381 Bacteria 2569
568 Ga0265336_10000274 3300028666 Bacteria 36140
569 Ga0307517_10072069 3300028786 Bacteria 3085
570 Ga0307517_10121377 3300028786 Bacteria 1930
571 Ga0307515_10000139 3300028794 Bacteria 173074
572 Ga0307515_10004822 3300028794 Bacteria 27609
573 Ga0307515_10005936 3300028794 Bacteria 24621
574 Ga0307515_10011641 3300028794 Bacteria 16669
575 Ga0307515_10060941 3300028794 Bacteria 5367
576 Ga0307515_10081261 3300028794 Bacteria 4212
577 Ga0307515_10157352 3300028794 Bacteria 2337
578 Ga0265324_10022676 3300029957 Bacteria 2242
579 Ga0307512_10010416 3300030522 Bacteria 8867
580 Ga0307512_10044434 3300030522 Bacteria 3652
581 Ga0316177_1147685 3300030731 Bacteria 2456
582 Ga0316176_1019717 3300030732 Bacteria 5051
583 Ga0316179_1045655 3300030734 Bacteria 1476
584 Ga0316183_1086347 3300030742 Bacteria 2728
585 Ga0316182_1395773 3300030745 Bacteria 1404
586 Ga0265330_10000174 3300031235 Bacteria 49860
587 Ga0265330_10009612 3300031235 Bacteria 4589
588 Ga0265332_10000048 3300031238 Bacteria 113285
589 Ga0265328_10006713 3300031239 Bacteria 4846
590 Ga0265328_10019614 3300031239 Bacteria 2595
591 Ga0265325_10006440 3300031241 Bacteria 7119
592 Ga0265331_10022083 3300031250 Bacteria 3250
593 Ga0265327_10000080 3300031251 Bacteria 206086
594 Ga0265327_10000925 3300031251 Bacteria 42948
595 Ga0265327_10002797 3300031251 Bacteria 17626
596 Ga0265327_10011216 3300031251 Bacteria 6206
597 Ga0265316_10000176 3300031344 Bacteria 72297
598 Ga0307513_10004491 3300031456 Bacteria 18612
599 Ga0307513_10004870 3300031456 Bacteria 17818
600 Ga0307513_10005821 3300031456 Bacteria 16188
601 Ga0307513_10008739 3300031456 Bacteria 12903
602 Ga0307513_10046962 3300031456 Bacteria 4702
603 Ga0307513_10086947 3300031456 Bacteria 3202
604 Ga0307509_10000698 3300031507 Bacteria 57430
605 Ga0307509_10039083 3300031507 Bacteria 5172
606 Ga0307509_10250815 3300031507 Bacteria 1554
607 Ga0307408_100000012 3300031548 Bacteria 408153
608 Ga0307408_100031021 3300031548 Bacteria 3717
609 Ga0307408_100060389 3300031548 Bacteria 2763
610 Ga0307408_100159554 3300031548 Bacteria 1790
611 Ga0307408_100178395 3300031548 Bacteria 1701
612 Ga0307408_100229417 3300031548 Bacteria 1519
613 Ga0307508_10000504 3300031616 Bacteria 46711
614 Ga0307514_10000339 3300031649 Bacteria 111130
615 Ga0307514_10002566 3300031649 Bacteria 18663
616 Ga0307514_10003227 3300031649 Bacteria 15920
617 Ga0307514_10007369 3300031649 Bacteria 9478
618 Ga0265314_10000132 3300031711 Bacteria 113285
619 Ga0265314_10000882 3300031711 Bacteria 35754
620 Ga0307516_10001199 3300031730 Bacteria 36246
621 Ga0307516_10007072 3300031730 Bacteria 12977
622 Ga0307516_10034081 3300031730 Bacteria 5120
623 Ga0307516_10041822 3300031730 Bacteria 4551
624 Ga0307516_10133884 3300031730 Bacteria 2255
625 Ga0307516_10256683 3300031730 Bacteria 1440
626 Ga0307405_10071205 3300031731 Bacteria 2236
627 Ga0307410_10016446 3300031852 Bacteria 4413
628 Ga0307406_10020825 3300031901 Bacteria 3869
629 Ga0307406_10101144 3300031901 Bacteria 1964
630 Ga0307412_10086029 3300031911 Bacteria 2186
631 Ga0307412_10093686 3300031911 Bacteria 2107
632 Ga0307416_100018698 3300032002 Bacteria 4891
633 Ga0307416_100070883 3300032002 Bacteria 2892
634 Ga0307416_100092169 3300032002 Bacteria 2605
635 Ga0307416_100219979 3300032002 Bacteria 1820
636 Ga0307414_10035032 3300032004 Bacteria 3336
637 Ga0307414_10066493 3300032004 Bacteria 2577
638 Ga0307411_10005248 3300032005 Bacteria 6340
639 Ga0307411_10092065 3300032005 Bacteria 2119
640 Ga0316593_10018061 3300032168 Bacteria 2161
641 Ga0307507_10080161 3300033179 Bacteria 2880
642 Ga0307510_10000426 3300033180 Bacteria 40466
643 Ga0307510_10027810 3300033180 Bacteria 6469
644 Ga0307510_10033683 3300033180 Bacteria 5750
645 Ga0373939_0000047 3300035114 Bacteria 43790
646 Ga0373960_0001152 3300035121 Bacteria 5741
647 Ga0373961_0020937 3300035241 Bacteria 1734
648 Ga0373931_0000579 3300035691 Bacteria 15108
649 Ga0373931_0022811 3300035691 Bacteria 3153
650 Ga0373931_0054113 3300035691 Bacteria 2144
651 Ga0316582_0140047 3300036647 Bacteria 1630
652 Ga0395899_0008314 3300037312 Bacteria 7987
653 Ga0395899_0014983 3300037312 Bacteria 5913
654 Ga0395900_0001308 3300037418 Bacteria 30266
655 Ga0395900_0019620 3300037418 Bacteria 6893
656 Ga0395900_0036461 3300037418 Bacteria 5070
657 Ga0395900_0092989 3300037418 Bacteria 3098
658 Ga0395898_0002912 3300037466 Bacteria 19475
659 Ga0395898_0008455 3300037466 Bacteria 10879
660 Ga0395898_0013070 3300037466 Bacteria 8557
661 Ga0395898_0025264 3300037466 Bacteria 5987
662 Ga0395898_0028823 3300037466 Bacteria 5565
663 Ga0395905_0000432 3300037471 Bacteria 58505
664 Ga0395905_0000504 3300037471 Bacteria 53598
665 Ga0395905_0002540 3300037471 Bacteria 20135
666 Ga0395905_0004034 3300037471 Bacteria 15413
667 Ga0395905_0005387 3300037471 Bacteria 13076
668 Ga0395905_0011861 3300037471 Bacteria 8413
669 Ga0395905_0028947 3300037471 Bacteria 5221
670 Ga0395905_0029755 3300037471 Bacteria 5147
671 Ga0395905_0034159 3300037471 Bacteria 4774
672 Ga0395905_0038030 3300037471 Bacteria 4514
673 Ga0395905_0040851 3300037471 Bacteria 4351
674 Ga0395905_0061234 3300037471 Bacteria 3520
675 Ga0395905_0083148 3300037471 Bacteria 2999
676 Ga0395905_0128803 3300037471 Bacteria 2380
677 Ga0316581_0007161 3300037588 Bacteria 2983
678 Ga0436364_0241783 3300037853 Bacteria 3108
679 Ga0436364_1356834 3300037853 Bacteria 1508
680 Ga0395901_0006507 3300038443 Bacteria 11821
681 Ga0395901_0024911 3300038443 Bacteria 6142
682 Ga0395901_0053630 3300038443 Bacteria 4189
683 Ga0395901_0084582 3300038443 Bacteria 3315
684 Ga0395901_0359346 3300038443 Bacteria 1502
685 Ga0400483_062160 3300039062 Bacteria 34333
686 Ga0400483_158300 3300039062 Bacteria 14388
687 Ga0400483_160107 3300039062 Bacteria 13880
688 Ga0436365_0112515 3300039437 Bacteria 3551
689 Ga0436365_0287923 3300039437 Bacteria 2883
690 Ga0436365_0974771 3300039437 Bacteria 5898
691 Ga0436361_0156562 3300039447 Bacteria 6162
692 Ga0436361_0264437 3300039447 Bacteria 60444
693 Ga0436361_0272384 3300039447 Bacteria 13210
694 Ga0436361_0827051 3300039447 Bacteria 2739
695 Ga0439436_0011478 3300041404 Bacteria 2691
696 Ga0439436_0020293 3300041404 Bacteria 1980
697 Ga0439466_0018087 3300041411 Bacteria 2531
698 Ga0439465_0007667 3300041413 Bacteria 3425
699 Ga0451793_1547269 3300041452 Bacteria 2343
700 Ga0451839_1626730 3300041496 Bacteria 1658
701 Ga0451851_0584746 3300041507 Bacteria 1480
702 Ga0439442_001212 3300042002 Bacteria 5132
703 Ga0439442_002138 3300042002 Bacteria 3887
704 Ga0439445_0023936 3300042004 Bacteria 1549
705 Ga0439445_0025144 3300042004 Bacteria 1518
706 Ga0439432_009856 3300042006 Bacteria 3323
707 Ga0439449_0003996 3300042007 Bacteria 5704
708 Ga0439452_006839 3300042010 Bacteria 3540
709 Ga0439462_0001911 3300042015 Bacteria 4744
710 Ga0450911_001157 3300042115 Bacteria 6505
711 Ga0450917_000309 3300042120 Bacteria 3601
712 Ga0450919_000132 3300042121 Bacteria 7624
713 Ga0450920_005304 3300042122 Bacteria 2286
714 Ga0450920_010904 3300042122 Bacteria 1688
715 Ga0450923_000606 3300042125 Bacteria 4119
716 Ga0450923_001222 3300042125 Bacteria 3316
717 Ga0450888_000258 3300042126 Bacteria 4916
718 Ga0450890_000482 3300042127 Bacteria 5846
719 Ga0450890_001454 3300042127 Bacteria 3406
720 Ga0450890_001951 3300042127 Bacteria 2915
721 Ga0450891_001653 3300042129 Bacteria 2295
722 Ga0450892_000718 3300042130 Bacteria 3697
723 Ga0450894_002761 3300042131 Bacteria 2328
724 Ga0450896_002019 3300042133 Bacteria 2584
725 Ga0450898_001291 3300042134 Bacteria 3265
726 Ga0450898_011820 3300042134 Bacteria 1435
727 Ga0450889_000025 3300042144 Bacteria 12924
728 Ga0450906_000686 3300042145 Bacteria 7259
729 Ga0450906_001537 3300042145 Bacteria 5042
730 Ga0450910_000244 3300042147 Bacteria 6237
731 Ga0450908_000233 3300042184 Bacteria 11214
732 Ga0450908_008161 3300042184 Bacteria 1964
733 Ga0450909_010803 3300042185 Bacteria 1336
734 Ga0439459_0000990 3300042438 Bacteria 4030
735 Ga0450916_005246 3300042530 Bacteria 1493
736 Ga0450918_000057 3300042531 Bacteria 22722
737 Ga0450918_004991 3300042531 Bacteria 2391
738 Ga0450893_0002098 3300042532 Bacteria 3104
739 Ga0451577_0000126 3300042876 Bacteria 168037
740 Ga0451577_0006685 3300042876 Bacteria 11445
741 Ga0451577_0018745 3300042876 Bacteria 6367
742 Ga0451577_0086850 3300042876 Bacteria 2791
743 Ga0466969_0000018 3300044656 Bacteria 102911
744 Ga0466969_0007499 3300044656 Bacteria 5800
745 Ga0466969_0024919 3300044656 Bacteria 3076
746 Ga0466972_0005104 3300044658 Bacteria 6575
747 Ga0453683_0007182 3300044673 Bacteria 7590
748 Ga0466965_0054848 3300044683 Bacteria 1982
749 Ga0466966_0014306 3300044684 Bacteria 5253
750 Ga0466966_0035444 3300044684 Bacteria 3222
751 Ga0466966_0123612 3300044684 Bacteria 1588
752 Ga0466961_0006521 3300044693 Bacteria 7416
753 Ga0466961_0046171 3300044693 Bacteria 2786
754 Ga0466961_0078138 3300044693 Bacteria 2096
755 Ga0466963_0017494 3300044694 Bacteria 4469
756 Ga0466963_0066522 3300044694 Bacteria 2417
757 Ga0466963_0089148 3300044694 Bacteria 2098
758 Ga0466964_0016300 3300044706 Bacteria 2836
759 Ga0453684_0000365 3300044712 Bacteria 186233
760 Ga0453684_0008286 3300044712 Bacteria 18722
761 Ga0453684_0026097 3300044712 Bacteria 8456
762 Ga0453684_0035441 3300044712 Bacteria 6896
763 Ga0466971_0034133 3300044719 Bacteria 2280
764 Ga0466968_0016365 3300044735 Bacteria 2952
765 Ga0466968_0043870 3300044735 Bacteria 1894
766 Ga0466970_0048635 3300044765 Bacteria 2261
767 Ga0466970_0049986 3300044765 Bacteria 2230
768 Ga0466957_0004358 3300044842 Bacteria 7868
769 Ga0466959_0009769 3300045049 Bacteria 6835
770 Ga0466959_0024616 3300045049 Bacteria 4460
771 Ga0466959_0031472 3300045049 Bacteria 3924
772 Ga0466959_0167643 3300045049 Bacteria 1541
773 Ga0451576_0000627 3300045051 Bacteria 73597
774 Ga0451576_0010718 3300045051 Bacteria 10495
775 Ga0451576_0048235 3300045051 Bacteria 4475
776 Ga0451576_0065287 3300045051 Bacteria 3790
777 Ga0451576_0073572 3300045051 Bacteria 3556
778 Ga0451576_0085485 3300045051 Bacteria 3281
779 Ga0451576_0126862 3300045051 Bacteria 2659
780 Ga0466958_0009242 3300045836 Bacteria 5487
781 Ga0495592_0000499 3300046454 Bacteria 28648
782 Ga0495590_0003163 3300046457 Bacteria 6732
783 Ga0495638_0030970 3300046460 Bacteria 3440
784 Ga0495638_0077223 3300046460 Bacteria 2028
785 Ga0495650_0009623 3300046471 Bacteria 5479
786 Ga0495650_0065547 3300046471 Bacteria 1441
787 Ga0495583_0000428 3300046506 Bacteria 63526
788 Ga0495606_0000821 3300046507 Bacteria 47099
789 Ga0495608_0066591 3300046511 Bacteria 2358
790 Ga0495610_0019230 3300046512 Bacteria 3830
791 Ga0495616_0001020 3300046513 Bacteria 20032
792 Ga0495620_0016702 3300046515 Bacteria 3677
793 Ga0495631_0000803 3300046518 Bacteria 20026
794 Ga0495632_0002352 3300046519 Bacteria 14499
795 Ga0495632_0020371 3300046519 Bacteria 3591
796 Ga0495632_0106906 3300046519 Bacteria 1316
797 Ga0495637_0002174 3300046520 Bacteria 10964
798 Ga0495643_0033985 3300046522 Bacteria 2816
799 Ga0495654_0001492 3300046530 Bacteria 16011
800 Ga0495654_0018028 3300046530 Bacteria 3703
801 Ga0495621_0009162 3300046539 Bacteria 2996
802 Ga0495621_0027194 3300046539 Bacteria 1935
803 Ga0495597_0007542 3300046542 Bacteria 5516
804 Ga0495645_0037182 3300046543 Bacteria 3548
805 Ga0495656_0001009 3300046615 Bacteria 9102
806 Ga0495668_0017953 3300046616 Bacteria 4097
807 Ga0495668_0021362 3300046616 Bacteria 3713
808 Ga0495625_0000098 3300046660 Bacteria 140987
809 Ga0495625_0000827 3300046660 Bacteria 42621
810 Ga0495625_0013529 3300046660 Bacteria 6549
811 Ga0495625_0091088 3300046660 Bacteria 2108
812 Ga0495659_0048833 3300046664 Bacteria 1535
813 Ga0495588_0053425 3300046674 Bacteria 2083
814 Ga0495647_0005177 3300046681 Bacteria 4272
815 Ga0495658_0032461 3300046683 Bacteria 2851
816 Ga0495669_0041763 3300046684 Bacteria 2038
817 Ga0495671_0006329 3300046692 Bacteria 6847
818 Ga0495649_0000380 3300046694 Bacteria 38612
819 Ga0495649_0003008 3300046694 Bacteria 11564
820 Ga0495589_0062792 3300046794 Bacteria 1822
821 Ga0495660_0026773 3300046810 Bacteria 3266
822 Ga0495674_0053355 3300047319 Bacteria 3554
823 Ga0495687_000850 3300047443 Bacteria 32575
824 Ga0495687_008280 3300047443 Bacteria 5978
825 Ga0495685_012460 3300047447 Bacteria 2881
826 Ga0495686_0023279 3300047472 Bacteria 4087
827 Ga0496100_0053208 3300048903 Bacteria 2635
828 Ga0496101_0003712 3300048904 Bacteria 9524
829 Ga0496102_0003201 3300048905 Bacteria 13884
830 Ga0496102_0040796 3300048905 Bacteria 4200
831 Ga0496103_0049276 3300048906 Bacteria 2604
832 Ga0496104_0098843 3300048907 Bacteria 2794
833 Ga0496104_0126968 3300048907 Bacteria 2449
834 Ga0496106_0025782 3300048909 Bacteria 4375
835 Ga0496108_0052454 3300048911 Bacteria 3418
836 Ga0496109_0000810 3300048912 Bacteria 26068
837 Ga0496109_0005617 3300048912 Bacteria 10495
838 Ga0496109_0045569 3300048912 Bacteria 3980
839 Ga0496109_0097926 3300048912 Bacteria 2719
840 Ga0496109_0214464 3300048912 Bacteria 1810
841 Ga0496111_0024896 3300048914 Bacteria 4221
842 Ga0496112_0009640 3300048915 Bacteria 8713
843 Ga0496113_0137469 3300048916 Bacteria 1921
844 Ga0496114_0056418 3300048917 Bacteria 3278
845 Ga0496114_0085310 3300048917 Bacteria 2675
846 Ga0496114_0301106 3300048917 Bacteria 1416
847 Ga0496115_0008890 3300048918 Bacteria 7445
848 Ga0496116_0008159 3300048919 Bacteria 9141
849 Ga0496116_0020369 3300048919 Bacteria 5039
850 Ga0496117_0000029 3300048920 Bacteria 392339
851 Ga0496117_0029813 3300048920 Bacteria 4199
852 Ga0496117_0039574 3300048920 Bacteria 3477
853 Ga0496118_0022033 3300048921 Bacteria 5586
854 Ga0496118_0026467 3300048921 Bacteria 4939
855 Ga0496121_0003335 3300048924 Bacteria 23043
856 Ga0496121_0015328 3300048924 Bacteria 8044
857 Ga0496121_0080422 3300048924 Bacteria 2583
858 Ga0496122_0069768 3300048925 Bacteria 2515
859 Ga0496122_0114005 3300048925 Bacteria 1764
860 Ga0496123_0030703 3300048926 Bacteria 3928
861 Ga0496123_0057303 3300048926 Bacteria 2537
862 Ga0496123_0155100 3300048926 Bacteria 1229
863 Ga0496123_0180729 3300048926 Bacteria 1102
864 Ga0496124_0000733 3300048927 Bacteria 53604
865 Ga0496124_0046785 3300048927 Bacteria 3703
866 Ga0496124_0056407 3300048927 Bacteria 3313
867 Ga0496124_0076165 3300048927 Bacteria 2770
868 Ga0496125_0017746 3300048928 Bacteria 6774
869 Ga0496125_0017837 3300048928 Bacteria 6754
870 Ga0496125_0046766 3300048928 Bacteria 3627
871 Ga0496125_0051955 3300048928 Bacteria 3375
872 Ga0496125_0054939 3300048928 Bacteria 3250
873 Ga0501291_003279 3300049514 Bacteria 2004
874 Ga0501292_009696 3300049515 Bacteria 1432
875 Ga0501031_0001713 3300049568 Bacteria 13770
876 Ga0501031_0029305 3300049568 Bacteria 3591
877 Ga0501034_0345305 3300049571 Bacteria 1418
878 Ga0501036_0117354 3300049572 Bacteria 2248
879 Ga0501039_0293249 3300049575 Bacteria 1279
880 Ga0501041_0084458 3300049577 Bacteria 1957
881 Ga0501043_0000058 3300049579 Bacteria 102030
882 Ga0501046_0000051 3300049580 Bacteria 133545
883 Ga0501047_0000003 3300049581 Bacteria 508375
884 Ga0501047_0016202 3300049581 Bacteria 7112
885 Ga0501047_0287546 3300049581 Bacteria 1488
886 Ga0501070_0147670 3300049586 Bacteria 1940
887 Ga0501075_0032839 3300049591 Bacteria 3859
888 Ga0501076_0079761 3300049592 Bacteria 2627
889 Ga0501076_0296899 3300049592 Bacteria 1324
890 Ga0501198_000007 3300049649 Bacteria 129700
891 Ga0501222_000005 3300049662 Bacteria 129724
892 Ga0501249_004367 3300049679 Bacteria 2872
893 Ga0501225_0024202 3300049705 Bacteria 1672
894 Ga0501229_000685 3300049706 Bacteria 3816
895 Ga0501080_0202514 3300049742 Bacteria 1822
896 Ga0501081_0099489 3300049743 Bacteria 2055
897 Ga0501083_0025871 3300049744 Bacteria 4062
898 Ga0501267_002227 3300049764 Bacteria 1725
899 Ga0501044_0004830 3300049823 Bacteria 15074
900 Ga0501045_0015123 3300049824 Bacteria 5477
901 Ga0501045_0210284 3300049824 Unclassified 1449
902 nmdc:mga03683_29128_c1 3300050489 Bacteria 2200
903 nmdc:mga03683_59943_c1 3300050489 Bacteria 1606
904 nmdc:mga03683_916_c1 3300050489 Bacteria 8502
905 nmdc:mga03n38_117193_c1 3300050490 Bacteria 1304
906 nmdc:mga03n38_21764_c1 3300050490 Bacteria 2585
907 nmdc:mga03n38_45913_c1 3300050490 Bacteria 1926
908 nmdc:mga03n38_56000_c1 3300050490 Bacteria 1778
909 nmdc:mga03n38_58155_c1 3300050490 Bacteria 1751
910 nmdc:mga03n38_70573_c1 3300050490 Bacteria 1616
911 nmdc:mga00v17_31205_c1 3300050491 Bacteria 3141
912 nmdc:mga0yw44_88132_c1 3300050492 Bacteria 1957
913 nmdc:mga0k408_103336_c1 3300050493 Bacteria 1681
914 nmdc:mga0k408_103779_c1 3300050493 Bacteria 1677
915 nmdc:mga0k408_10449_c1 3300050493 Bacteria 5018
916 nmdc:mga0k408_10776_c1 3300050493 Bacteria 4956
917 nmdc:mga0k408_134114_c1 3300050493 Bacteria 1471
918 nmdc:mga0k408_1536_c1 3300050493 Bacteria 12468
919 nmdc:mga0k408_196283_c1 3300050493 Bacteria 1205
920 nmdc:mga0k408_21153_c1 3300050493 Bacteria 3652
921 nmdc:mga0k408_35374_c1 3300050493 Bacteria 2865
922 nmdc:mga0k408_366_c1 3300050493 Bacteria 24717
923 nmdc:mga0k408_49562_c1 3300050493 Bacteria 2431
924 nmdc:mga0k408_8221_c1 3300050493 Bacteria 5592
925 nmdc:mga0k408_83171_c1 3300050493 Bacteria 1876
926 nmdc:mga0k408_87039_c1 3300050493 Bacteria 1835
927 nmdc:mga0k408_98163_c1 3300050493 Bacteria 1726
928 nmdc:mga06z11_21913_c2 3300050494 Bacteria 2652
929 nmdc:mga07m45_10234_c1 3300050496 Bacteria 4892
930 nmdc:mga07m45_29854_c1 3300050496 Bacteria 3018
931 nmdc:mga07m45_2992_c2 3300050496 Bacteria 7393
932 nmdc:mga07m45_2998_c1 3300050496 Bacteria 1502
933 nmdc:mga07m45_3088_c1 3300050496 Bacteria 7964
934 nmdc:mga07m45_3233_c1 3300050496 Bacteria 7824
935 nmdc:mga07m45_4705_c1 3300050496 Bacteria 6701
936 nmdc:mga07m45_6187_c1 3300050496 Bacteria 6038
937 nmdc:mga07m45_64416_c1 3300050496 Bacteria 2080
938 nmdc:mga07m45_6836_c1 3300050496 Bacteria 5800
939 nmdc:mga07m45_9468_c1 3300050496 Bacteria 5056
940 nmdc:mga09592_174_c1 3300050508 Bacteria 45665
941 nmdc:mga0sz30_35023_c1 3300050516 Bacteria 2093
942 nmdc:mga0sz30_42066_c1 3300050516 Bacteria 1922
943 Ga0500635_0000070 3300053080 Bacteria 67480
944 Ga0500578_0000417 3300053086 Bacteria 52045
945 Ga0500651_0000093 3300053093 Bacteria 55843
946 Ga0500651_0001098 3300053093 Bacteria 13378
947 Ga0500651_0065399 3300053093 Bacteria 2266
948 Ga0500566_0106332 3300053094 Bacteria 1531
949 Ga0500562_002046 3300053108 Bacteria 5042
950 Ga0500571_000137 3300053110 Bacteria 24800
951 Ga0500593_000471 3300053117 Bacteria 16019
952 Ga0500593_000805 3300053117 Bacteria 11731
953 Ga0500593_001574 3300053117 Bacteria 8215
954 Ga0500594_0005325 3300053118 Bacteria 2851
955 Ga0500607_004111 3300053121 Bacteria 10178
956 Ga0500608_006080 3300053122 Bacteria 4875
957 Ga0500608_010693 3300053122 Bacteria 3949
958 Ga0500642_0008356 3300053130 Bacteria 3538
959 Ga0500642_0020754 3300053130 Bacteria 2588
960 Ga0500652_001084 3300053131 Bacteria 8794
961 Ga0500652_064140 3300053131 Bacteria 1516
962 Ga0500655_000776 3300053133 Bacteria 6285
963 Ga0500658_0000827 3300053134 Bacteria 12740
964 Ga0500658_0011664 3300053134 Bacteria 3238
965 Ga0500658_0029034 3300053134 Bacteria 2149
966 Ga0500559_0000097 3300053136 Bacteria 70124
967 Ga0500559_0004744 3300053136 Bacteria 6381
968 Ga0500559_0023297 3300053136 Bacteria 2628
969 Ga0500568_0004144 3300053139 Bacteria 7832
970 Ga0500568_0004342 3300053139 Bacteria 7602
971 Ga0500568_0007402 3300053139 Bacteria 5388
972 Ga0500568_0015839 3300053139 Bacteria 3364
973 Ga0500590_064552 3300053148 Bacteria 1833
974 Ga0500622_0000198 3300053156 Bacteria 63633
975 Ga0500622_0005315 3300053156 Bacteria 7764
976 Ga0500627_0002058 3300053158 Bacteria 5820
977 Ga0500645_000259 3300053730 Bacteria 38655
978 Ga0500645_002355 3300053730 Bacteria 8513
979 Ga0500587_000676 3300053739 Bacteria 4338
980 Ga0500661_008021 3300055283 Bacteria 1946
981 Ga0466962_0003983 3300061719 Bacteria 7072
982 2511245341 2511231002 Bacteria 5042903
983 2548500276 2547132374 Bacteria 5530232
984 2587725949 2585428057 Bacteria 6737412
985 2587735600 2585428058 Bacteria 6853932
986 2588292838 2588253510 Bacteria 6901809
987 2599621793 2599185214 Bacteria 8209958
988 2599670523 2599185226 Bacteria 8233575
989 2599679013 2599185227 Bacteria 8246414
990 2599691304 2599185229 Bacteria 8216126
991 2643744049 2643221544 Bacteria 5886209
992 2643864692 2643221570 Bacteria 5103772
993 2643932478 2643221585 Bacteria 5812563
994 2643992696 2643221596 Bacteria 5006805
995 2644058399 2643221609 Bacteria 6756331
996 2644073450 2643221611 Bacteria 6820941
997 2644163726 2643221628 Bacteria 5745828
998 2644219892 2643221639 Bacteria 6649903
999 2644247189 2643221644 Bacteria 6865017
1000 2644260990 2643221646 Bacteria 6433402
1001 2644296484 2643221652 Bacteria 5140275
1002 2644301004 2643221654 Bacteria 5273570
1003 2644313729 2643221656 Bacteria 5809961
1004 2644327043 2643221658 Bacteria 6064537
1005 2644339818 2643221660 Bacteria 4208257
1006 2644398846 2643221672 Bacteria 6322190
1007 2644466527 2643221683 Bacteria 5749203
1008 2644647171 2643221717 Bacteria 5676132
1009 2735818178 2734482258 Unclassified 2930739
1010 2738721855 2738541277 Bacteria 7458140
1011 2738882029 2738541307 Bacteria 8606193
1012 2739054795 2738541337 Bacteria 6183410
1013 2739247033 2738543012 Bacteria 7115078
1014 2739247829 2738543013 Bacteria 5618633
1015 2739282219 2738543019 Bacteria 7459457
1016 2740032516 2739367866 Bacteria 4215900
1017 2787508467 2786546548 Bacteria 4745694
1018 2816469687 2816332133 Bacteria 7249298
1019 2819597962 2818991446 Bacteria 7757362
1020 2831268951 2831265667 Bacteria 7184833
1021 2831867635 2831864461 Bacteria 6502356
1022 2838058379 2838054893 Bacteria 7451788
1023 2842678299 2842677519 Bacteria 5615038
1024 2842720649 2842718218 Bacteria 4560148
1025 2842738632 2842733646 Bacteria 5716726
1026 2881104357 2881101125 Bacteria 4590519
1027 2881645022 2881644220 Bacteria 5302661
1028 2885203881 2885198086 Bacteria 7212419
1029 2885217784 2885211737 Bacteria 7212420
1030 2886854914 2886848708 Bacteria 5632523
1031 2899929381 2899924645 Bacteria 7487985
1032 2904451123 2904449895 Bacteria 6927402
1033 2904457977 2904456579 Bacteria 6819253
1034 2904546720 2904541872 Bacteria 8915136
1035 2919465672 2919462493 Bacteria 5817112
1036 2928040175 2928037797 Bacteria 7273642
1037 2928047076 2928044640 Bacteria 7271509
1038 2928057720 2928051484 Bacteria 7773759
1039 2928067897 2928064002 Bacteria 7419480
1040 2928072461 2928070936 Bacteria 8062541
1041 2928085660 2928084124 Bacteria 7159212
1042 2928118830 2928115317 Bacteria 6477646
1043 2928520417 2928519762 Bacteria 1953908
1044 2929166169 2929160207 Bacteria 9075316
1045 2929526408 2929520902 Bacteria 6765052
1046 2939615677 2939615513 Bacteria 2384962
1047 2939634697 2939631187 Bacteria 6118131
1048 2945915015 2945909444 Bacteria 7065066
1049 2945950962 2945945610 Bacteria 5951079
1050 2945974401 2945972063 Bacteria 6086495
1051 2945989587 2945984333 Bacteria 7358892
1052 2990715271 2990710928 Bacteria 5002431
1053 3001271207 3001267043 Bacteria 4823521
1054 3001272105 3001272096 Bacteria 4729684
1055 3006978298 3006973921 Bacteria 4423788
1056 3006992730 3006988479 Bacteria 4767936
1057 Ga0451853_4042678
1058 JGI24740J21852_10007049
1059 JGI24740J21852_10016505
1060 JGI24739J22299_10006314
1061 JGI25155J39150_1000037
1062 JGI25156J39149_1000024
1063 JGI25156J39149_1000273
1064 JGI25154J39366_1000043
1065 JGI25154J39366_1001641
1066 JGI25158J39367_1005090
1067 JGI25157J39369_1000031
1068 JGI25157J39369_1000141
1069 JGI25152J39213_1007178
1070 JGI25150J39212_1002395
1071 JGI25150J39212_1004345
1072 JGI25159J45721_1004996
1073 JGI25159J45721_1007712
1074 JGI25151J46595_10001536
1075 JGI25151J46595_10002156
1076 JGI25151J46595_10002752
1077 JGI25151J46595_10011019
1078 JGI25151J46595_10019115
1079 JGI25153J46596_10001676
1080 JGI25153J46596_10003840
1081 JGI25153J46596_10016969
1082 rootH1_10000170
1083 rootH1_10002432
1084 rootH1_10043915
1085 rootL2_10001066
1086 rootL2_10090276
1087 rootH1_10002491
1088 JGI25160J50197_1000172
1089 JGI25160J50197_1011812
1090 JGI25161J50226_1000007
1091 JGI25161J50226_1003544
1092 JGI25161J50226_1005059
1093 Ga0006562J51391_1039805
1094 Ga0006562J51391_1039806
1095 Ga0006562J51391_1066746
1096 Ga0006562J51391_1066748
1097 Ga0055539_1000219
1098 Ga0055533_1000008
1099 Ga0055525_1000054
1100 Ga0055525_1001100
1101 Ga0055535_1000271
1102 Ga0055535_1000995
1103 Ga0055535_1007207
1104 Ga0055542_1000003
1105 Ga0055529_1000321
1106 Ga0055526_1001240
1107 Ga0055526_1014459
1108 Ga0055526_1015438
1109 Ga0055526_1015538
1110 Ga0055526_1017593
1111 Ga0055537_1000356
1112 Ga0055537_1001103
1113 Ga0055537_1007183
1114 Ga0055524_1000140
1115 Ga0055524_1000213
1116 Ga0055524_1000550
1117 Ga0055524_1014230
1118 Ga0055524_1015505
1119 Ga0055536_1002468
1120 Ga0055536_1006719
1121 Ga0055536_1009794
1122 Ga0055536_1015963
1123 Ga0055536_1021287
1124 Ga0055534_1000346
1125 Ga0055534_1001067
1126 Ga0055534_1001587
1127 Ga0055534_1009018
1128 Ga0055528_1000846
1129 Ga0055528_1001593
1130 Ga0055528_1015691
1131 Ga0055530_10000763
1132 Ga0055530_10003145
1133 Ga0055530_10003770
1134 Ga0055530_10015503
1135 Ga0055540_1000133
1136 Ga0055540_1000504
1137 Ga0055540_1000765
1138 Ga0055540_1003891
1139 Ga0055540_1007562
1140 Ga0055540_1007906
1141 Ga0055540_1011179
1142 Ga0055531_10000469
1143 Ga0055531_10000973
1144 Ga0055531_10002263
1145 Ga0055531_10003310
1146 Ga0055531_10004604
1147 Ga0055531_10012397
1148 Ga0055531_10018174
1149 Ga0055531_10018180
1150 Ga0055543_1000061
1151 Ga0055543_1001261
1152 Ga0055543_1005771
1153 Ga0055543_1005778
1154 Ga0065165_1000474
1155 Ga0065165_1000621
1156 Ga0065165_1005479
1157 Ga0065165_1006179
1158 Ga0065165_1008900
1159 Ga0065165_1014201
1160 Ga0070658_10008606
1161 Ga0070658_10022214
1162 Ga0070658_10040585
1163 Ga0070658_10104791
1164 Ga0070676_10019300
1165 Ga0070676_10147765
1166 Ga0070690_100012795
1167 Ga0070670_100040263
1168 Ga0070670_100061187
1169 Ga0070670_100080010
1170 Ga0070670_100098308
1171 Ga0070670_100155303
1172 Ga0070670_100199120
1173 Ga0068869_100049108
1174 Ga0068869_100226830
1175 Ga0070666_10048516
1176 Ga0070666_10095199
1177 Ga0070680_100096268
1178 Ga0068868_100017925
1179 Ga0068868_100024364
1180 Ga0068868_100055588
1181 Ga0070660_100166540
1182 Ga0070689_100045943
1183 Ga0070689_100124259
1184 Ga0070661_100018267
1185 Ga0070661_100110471
1186 Ga0070668_100020579
1187 Ga0070675_100004369
1188 Ga0070675_100089027
1189 Ga0070675_100111069
1190 Ga0070675_100238362
1191 Ga0070671_100007073
1192 Ga0070671_100017702
1193 Ga0070671_100020190
1194 Ga0070671_100023028
1195 Ga0070674_100054573
1196 Ga0070674_100085143
1197 Ga0070673_100001467
1198 Ga0070673_100007248
1199 Ga0070673_100014291
1200 Ga0070673_100020089
1201 Ga0070659_100021184
1202 Ga0070659_100168799
1203 Ga0070667_100006934
1204 Ga0070667_100180339
1205 Ga0070667_100272942
1206 Ga0070714_100318394
1207 Ga0070663_100020950
1208 Ga0070663_100188131
1209 Ga0070678_100034556
1210 Ga0070662_100012766
1211 Ga0070662_100021970
1212 Ga0070662_100051373
1213 Ga0068867_100000245
1214 Ga0068867_100000605
1215 Ga0068867_100011924
1216 Ga0068867_100021133
1217 Ga0070706_100002995
1218 Ga0070707_100067782
1219 Ga0070679_100039040
1220 Ga0070684_100199409
1221 Ga0068853_100036201
1222 Ga0068853_100071427
1223 Ga0068853_100077168
1224 Ga0070672_100002136
1225 Ga0070672_100010450
1226 Ga0070672_100029290
1227 Ga0070672_100068866
1228 Ga0070672_100117681
1229 Ga0070665_100005540
1230 Ga0070665_100008298
1231 Ga0070665_100057790
1232 Ga0070665_100291979
1233 Ga0068855_100011340
1234 Ga0068855_100046322
1235 Ga0068855_100237784
1236 Ga0068855_100412193
1237 Ga0070664_100002435
1238 Ga0070664_100048553
1239 Ga0068857_100028700
1240 Ga0068857_100031742
1241 Ga0068857_100039422
1242 Ga0068857_100055364
1243 Ga0068854_100047028
1244 Ga0068854_100101013
1245 Ga0068854_100171813
1246 Ga0068856_100000135
1247 Ga0068856_100027773
1248 Ga0068856_100399115
1249 Ga0068852_100008014
1250 Ga0068852_100023462
1251 Ga0068852_100113592
1252 Ga0068852_100286729
1253 Ga0068864_100039478
1254 Ga0068861_100022363
1255 Ga0068851_10018422
1256 Ga0068851_10065776
1257 Ga0068863_100017699
1258 Ga0068858_100347127
1259 Ga0068860_100000384
1260 Ga0068860_100097440
1261 Ga0068860_100272194
1262 Ga0068862_100037567
1263 Ga0075365_10027748
1264 Ga0075365_10100168
1265 Ga0075368_10048762
1266 Ga0075363_100029235
1267 Ga0075363_100090501
1268 Ga0075363_100139801
1269 Ga0075364_10012964
1270 Ga0075364_10053774
1271 Ga0075364_10207369
1272 Ga0075362_10001785
1273 Ga0075362_10005324
1274 Ga0075362_10009607
1275 Ga0075362_10053518
1276 Ga0075367_10159630
1277 Ga0075369_10010982
1278 Ga0075369_10046293
1279 Ga0075366_10002666
1280 Ga0075366_10011244
1281 Ga0075366_10017453
1282 Ga0075366_10029529
1283 Ga0075366_10032812
1284 Ga0075366_10042553
1285 Ga0075366_10077926
1286 Ga0075366_10092230
1287 Ga0075366_10093239
1288 Ga0097621_100140511
1289 Ga0075370_10003469
1290 Ga0075370_10004178
1291 Ga0075370_10006062
1292 Ga0075370_10011470
1293 Ga0075370_10012670
1294 Ga0075370_10032077
1295 Ga0075370_10042272
1296 Ga0075429_100000224
1297 Ga0068865_100002745
1298 Ga0068865_100017355
1299 Ga0099823_1000005
1300 Ga0079104_1000053
1301 Ga0099826_10000959
1302 Ga0105244_10002315
1303 Ga0105240_10002477
1304 Ga0105240_10009882
1305 Ga0105240_10146487
1306 Ga0105240_10332956
1307 Ga0105240_10433567
1308 Ga0105245_10026119
1309 Ga0105245_10042445
1310 Ga0105245_10048303
1311 Ga0105243_10004228
1312 Ga0105243_10006082
1313 Ga0105243_10061212
1314 Ga0105243_10067374
1315 Ga0105243_10095301
1316 Ga0105243_10138475
1317 Ga0105243_10148545
1318 Ga0105241_10243781
1319 Ga0105241_10257780
1320 Ga0105242_10016941
1321 Ga0105248_10001355
1322 Ga0105237_10000668
1323 Ga0105237_10011246
1324 Ga0105237_10028106
1325 Ga0105237_10046071
1326 Ga0105238_10007313
1327 Ga0105238_10061434
1328 Ga0105238_10106330
1329 Ga0105238_10180384
1330 Ga0105249_10017117
1331 Ga0105239_10020399
1332 Ga0105239_10021874
1333 Ga0105239_10025029
1334 Ga0105239_10032539
1335 Ga0105246_10038570
1336 Ga0105246_10119579
1337 Ga0157317_1001054
1338 Ga0157319_1000005
1339 Ga0157373_10023614
1340 Ga0157371_10118626
1341 Ga0157370_10231461
1342 Ga0157369_10143197
1343 Ga0157369_10211029
1344 Ga0157374_10183833
1345 Ga0157378_10096431
1346 Ga0157378_10357565
1347 Ga0163162_10000794
1348 Ga0163162_10001355
1349 Ga0157372_10556056
1350 Ga0157375_10040833
1351 Ga0157375_10197055
1352 Ga0163163_10096492
1353 Ga0157380_10012894
1354 Ga0157380_10183432
1355 Ga0157380_10335850
1356 Ga0182008_10004921
1357 Ga0182008_10010747
1358 Ga0157377_10000034
1359 Ga0157379_10009090
1360 Ga0157379_10073730
1361 Ga0157379_10083761
1362 Ga0157376_10083963
1363 Ga0157376_10269892
1364 Ga0182006_1001345
1365 Ga0182006_1063506
1366 Ga0182007_10000317
1367 Ga0182007_10001372
1368 Ga0183362_10004
1369 Ga0163161_10000361
1370 Ga0163161_10011636
1371 Ga0163161_10096335
1372 Ga0213872_10001003
1373 Ga0213872_10004509
1374 Ga0213872_10012188
1375 Ga0213872_10017132
1376 Ga0213876_10095098
1377 Ga0213875_10060163
1378 Ga0209435_100008
1379 Ga0209674_100015
1380 Ga0209672_101139
1381 Ga0209563_100017
1382 Ga0209563_100075
1383 Ga0207427_100444
1384 Ga0209258_100015
1385 Ga0209258_100025
1386 Ga0209258_100726
1387 Ga0207425_1000570
1388 Ga0207425_1002945
1389 Ga0207425_1006495
1390 Ga0207425_1007181
1391 Ga0209646_1000079
1392 Ga0209646_1000438
1393 Ga0209026_1000028
1394 Ga0209026_1000067
1395 Ga0209677_100037
1396 Ga0209677_100113
1397 Ga0209677_101296
1398 Ga0209148_1000028
1399 Ga0209759_1000021
1400 Ga0209759_1000056
1401 Ga0209759_1001016
1402 Ga0209759_1001538
1403 Ga0209129_1000049
1404 Ga0209129_1000158
1405 Ga0209129_1002921
1406 Ga0209129_1011570
1407 Ga0209565_1000041
1408 Ga0209565_1000259
1409 Ga0209565_1000333
1410 Ga0209565_1002282
1411 Ga0209565_1004128
1412 Ga0209565_1007247
1413 Ga0209455_1000166
1414 Ga0209673_1000193
1415 Ga0209673_1000364
1416 Ga0209673_1004816
1417 Ga0209673_1005119
1418 Ga0209673_1014689
1419 Ga0209673_1021019
1420 Ga0209673_1033619
1421 Ga0209130_1000245
1422 Ga0209130_1000708
1423 Ga0209130_1001785
1424 Ga0209130_1002505
1425 Ga0209130_1002770
1426 Ga0209675_1000220
1427 Ga0209675_1000316
1428 Ga0209675_1003708
1429 Ga0209675_1015740
1430 Ga0209676_1000013
1431 Ga0209676_1000074
1432 Ga0209676_1000209
1433 Ga0209676_1000689
1434 Ga0209676_1002936
1435 Ga0209676_1006483
1436 Ga0209676_1014369
1437 Ga0209676_1027482
1438 Ga0209025_1000283
1439 Ga0209025_1001092
1440 Ga0209025_1001101
1441 Ga0209025_1003444
1442 Ga0209025_1003852
1443 Ga0209025_1022772
1444 Ga0209025_1025542
1445 Ga0209025_1029710
1446 Ga0209025_1054573
1447 Ga0209564_1000021
1448 Ga0209564_1000282
1449 Ga0209564_1000363
1450 Ga0209564_1001279
1451 Ga0209564_1001670
1452 Ga0209564_1003353
1453 Ga0209564_1013238
1454 Ga0209758_1000496
1455 Ga0209758_1000815
1456 Ga0209758_1000910
1457 Ga0209758_1009742
1458 Ga0209050_1000008
1459 Ga0209050_1000015
1460 Ga0209050_1000996
1461 Ga0209050_1001406
1462 Ga0209050_1002179
1463 Ga0209050_1002987
1464 Ga0209050_1006789
1465 Ga0209256_1000003
1466 Ga0209256_1000045
1467 Ga0209256_1000264
1468 Ga0209256_1000304
1469 Ga0209256_1000309
1470 Ga0209256_1001207
1471 Ga0209256_1027278
1472 Ga0207426_1000091
1473 Ga0207426_1000108
1474 Ga0207426_1000130
1475 Ga0207426_1002234
1476 Ga0209051_1000004
1477 Ga0209051_1000005
1478 Ga0209051_1000010
1479 Ga0209051_1000156
1480 Ga0209051_1000306
1481 Ga0209051_1000621
1482 Ga0209051_1000680
1483 Ga0209051_1001349
1484 Ga0209051_1006701
1485 Ga0209051_1019395
1486 Ga0209257_1000015
1487 Ga0209257_1000016
1488 Ga0209257_1000026
1489 Ga0209257_1000048
1490 Ga0209257_1000172
1491 Ga0209257_1000315
1492 Ga0209257_1000981
1493 Ga0209257_1003138
1494 Ga0209257_1014093
1495 Ga0209257_1016709
1496 Ga0207697_10000321
1497 Ga0207655_1001367
1498 Ga0207682_10029747
1499 Ga0207688_10001947
1500 Ga0207645_10005998
1501 Ga0207645_10045667
1502 Ga0207643_10030070
1503 Ga0207705_10019722
1504 Ga0207705_10166511
1505 Ga0207684_10045694
1506 Ga0207684_10049002
1507 Ga0207695_10004981
1508 Ga0207695_10007014
1509 Ga0207695_10047957
1510 Ga0207695_10057931
1511 Ga0207695_10124467
1512 Ga0207671_10021969
1513 Ga0207671_10145514
1514 Ga0207660_10061622
1515 Ga0207657_10017128
1516 Ga0207657_10105000
1517 Ga0207649_10000614
1518 Ga0207652_10069419
1519 Ga0207652_10076312
1520 Ga0207681_10079142
1521 Ga0207681_10191266
1522 Ga0207694_10028649
1523 Ga0207650_10054134
1524 Ga0207650_10071989
1525 Ga0207659_10228316
1526 Ga0207659_10252640
1527 Ga0207687_10009833
1528 Ga0207687_10038401
1529 Ga0207687_10115900
1530 Ga0207687_10250675
1531 Ga0207664_10029018
1532 Ga0207644_10017792
1533 Ga0207644_10026836
1534 Ga0207644_10158156
1535 Ga0207690_10009309
1536 Ga0207690_10013071
1537 Ga0207706_10002180
1538 Ga0207706_10032088
1539 Ga0207706_10173593
1540 Ga0207686_10000960
1541 Ga0207709_10000433
1542 Ga0207709_10000838
1543 Ga0207709_10001092
1544 Ga0207709_10012723
1545 Ga0207709_10061034
1546 Ga0207669_10049782
1547 Ga0207704_10023252
1548 Ga0207665_10145960
1549 Ga0207691_10004655
1550 Ga0207691_10005007
1551 Ga0207711_10146343
1552 Ga0207689_10018687
1553 Ga0207689_10169441
1554 Ga0207661_10133563
1555 Ga0207679_10000077
1556 Ga0207679_10095392
1557 Ga0207679_10125626
1558 Ga0207667_10003517
1559 Ga0207667_10040596
1560 Ga0207667_10189447
1561 Ga0207667_10297476
1562 Ga0207651_10004806
1563 Ga0207651_10078807
1564 Ga0207651_10232572
1565 Ga0207712_10009930
1566 Ga0207640_10032295
1567 Ga0207640_10133252
1568 Ga0207658_10029648
1569 Ga0207658_10036634
1570 Ga0207677_10021042
1571 Ga0207677_10028704
1572 Ga0207703_10041044
1573 Ga0207639_10040814
1574 Ga0207678_10037832
1575 Ga0207678_10052599
1576 Ga0207678_10061958
1577 Ga0207708_10060111
1578 Ga0207702_10001523
1579 Ga0207702_10024832
1580 Ga0207702_10136882
1581 Ga0207702_10196605
1582 Ga0207648_10000054
1583 Ga0207648_10002852
1584 Ga0207648_10004823
1585 Ga0207648_10016725
1586 Ga0207648_10030389
1587 Ga0207648_10149976
1588 Ga0207676_10027619
1589 Ga0207676_10054808
1590 Ga0207676_10280172
1591 Ga0207674_10005841
1592 Ga0207674_10008175
1593 Ga0207674_10016268
1594 Ga0207674_10054882
1595 Ga0207675_100025649
1596 Ga0207675_100036742
1597 Ga0207683_10023817
1598 Ga0207683_10136967
1599 Ga0207683_10296511
1600 Ga0207698_10019411
1601 Ga0207698_10035266
1602 Ga0207698_10036734
1603 Ga0207698_10050766
1604 Ga0207698_10175478
1605 Ga0207698_10191700
1606 Ga0207698_10339731
1607 Ga0209281_1000147
1608 Ga0209389_1000295
1609 Ga0209968_1000628
1610 Ga0209970_1001072
1611 Ga0209282_1000107
1612 Ga0209966_1000117
1613 Ga0209974_10032873
1614 Ga0268266_10005478
1615 Ga0268266_10030341
1616 Ga0268266_10042256
1617 Ga0268265_10003306
1618 Ga0268265_10135271
1619 Ga0268265_10181367
1620 Ga0268264_10001034
1621 Ga0268264_10062691
1622 Ga0268264_10095775
1623 Ga0265336_10000274
1624 Ga0307517_10072069
1625 Ga0307517_10121377
1626 Ga0307515_10000139
1627 Ga0307515_10004822
1628 Ga0307515_10005936
1629 Ga0307515_10011641
1630 Ga0307515_10060941
1631 Ga0307515_10081261
1632 Ga0307515_10157352
1633 Ga0265324_10022676
1634 Ga0307512_10010416
1635 Ga0307512_10044434
1636 Ga0316177_1147685
1637 Ga0316176_1019717
1638 Ga0316179_1045655
1639 Ga0316183_1086347
1640 Ga0316182_1395773
1641 Ga0265330_10000174
1642 Ga0265330_10009612
1643 Ga0265332_10000048
1644 Ga0265328_10006713
1645 Ga0265328_10019614
1646 Ga0265325_10006440
1647 Ga0265331_10022083
1648 Ga0265327_10000080
1649 Ga0265327_10000925
1650 Ga0265327_10002797
1651 Ga0265327_10011216
1652 Ga0265316_10000176
1653 Ga0307513_10004491
1654 Ga0307513_10004870
1655 Ga0307513_10005821
1656 Ga0307513_10008739
1657 Ga0307513_10046962
1658 Ga0307513_10086947
1659 Ga0307509_10000698
1660 Ga0307509_10039083
1661 Ga0307509_10250815
1662 Ga0307408_100000012
1663 Ga0307408_100031021
1664 Ga0307408_100060389
1665 Ga0307408_100159554
1666 Ga0307408_100178395
1667 Ga0307408_100229417
1668 Ga0307508_10000504
1669 Ga0307514_10000339
1670 Ga0307514_10002566
1671 Ga0307514_10003227
1672 Ga0307514_10007369
1673 Ga0265314_10000132
1674 Ga0265314_10000882
1675 Ga0307516_10001199
1676 Ga0307516_10007072
1677 Ga0307516_10034081
1678 Ga0307516_10041822
1679 Ga0307516_10133884
1680 Ga0307516_10256683
1681 Ga0307405_10071205
1682 Ga0307410_10016446
1683 Ga0307406_10020825
1684 Ga0307406_10101144
1685 Ga0307412_10086029
1686 Ga0307412_10093686
1687 Ga0307416_100018698
1688 Ga0307416_100070883
1689 Ga0307416_100092169
1690 Ga0307416_100219979
1691 Ga0307414_10035032
1692 Ga0307414_10066493
1693 Ga0307411_10005248
1694 Ga0307411_10092065
1695 Ga0316593_10018061
1696 Ga0307507_10080161
1697 Ga0307510_10000426
1698 Ga0307510_10027810
1699 Ga0307510_10033683
1700 Ga0373939_0000047
1701 Ga0373960_0001152
1702 Ga0373961_0020937
1703 Ga0373931_0000579
1704 Ga0373931_0022811
1705 Ga0373931_0054113
1706 Ga0316582_0140047
1707 Ga0395899_0008314
1708 Ga0395899_0014983
1709 Ga0395900_0001308
1710 Ga0395900_0019620
1711 Ga0395900_0036461
1712 Ga0395900_0092989
1713 Ga0395898_0002912
1714 Ga0395898_0008455
1715 Ga0395898_0013070
1716 Ga0395898_0025264
1717 Ga0395898_0028823
1718 Ga0395905_0000432
1719 Ga0395905_0000504
1720 Ga0395905_0002540
1721 Ga0395905_0004034
1722 Ga0395905_0005387
1723 Ga0395905_0011861
1724 Ga0395905_0028947
1725 Ga0395905_0029755
1726 Ga0395905_0034159
1727 Ga0395905_0038030
1728 Ga0395905_0040851
1729 Ga0395905_0061234
1730 Ga0395905_0083148
1731 Ga0395905_0128803
1732 Ga0316581_0007161
1733 Ga0436364_0241783
1734 Ga0436364_1356834
1735 Ga0395901_0006507
1736 Ga0395901_0024911
1737 Ga0395901_0053630
1738 Ga0395901_0084582
1739 Ga0395901_0359346
1740 Ga0400483_062160
1741 Ga0400483_158300
1742 Ga0400483_160107
1743 Ga0436365_0112515
1744 Ga0436365_0287923
1745 Ga0436365_0974771
1746 Ga0436361_0156562
1747 Ga0436361_0264437
1748 Ga0436361_0272384
1749 Ga0436361_0827051
1750 Ga0439436_0011478
1751 Ga0439436_0020293
1752 Ga0439466_0018087
1753 Ga0439465_0007667
1754 Ga0451793_1547269
1755 Ga0451839_1626730
1756 Ga0451851_0584746
1757 Ga0439442_001212
1758 Ga0439442_002138
1759 Ga0439445_0023936
1760 Ga0439445_0025144
1761 Ga0439432_009856
1762 Ga0439449_0003996
1763 Ga0439452_006839
1764 Ga0439462_0001911
1765 Ga0450911_001157
1766 Ga0450917_000309
1767 Ga0450919_000132
1768 Ga0450920_005304
1769 Ga0450920_010904
1770 Ga0450923_000606
1771 Ga0450923_001222
1772 Ga0450888_000258
1773 Ga0450890_000482
1774 Ga0450890_001454
1775 Ga0450890_001951
1776 Ga0450891_001653
1777 Ga0450892_000718
1778 Ga0450894_002761
1779 Ga0450896_002019
1780 Ga0450898_001291
1781 Ga0450898_011820
1782 Ga0450889_000025
1783 Ga0450906_000686
1784 Ga0450906_001537
1785 Ga0450910_000244
1786 Ga0450908_000233
1787 Ga0450908_008161
1788 Ga0450909_010803
1789 Ga0439459_0000990
1790 Ga0450916_005246
1791 Ga0450918_000057
1792 Ga0450918_004991
1793 Ga0450893_0002098
1794 Ga0451577_0000126
1795 Ga0451577_0006685
1796 Ga0451577_0018745
1797 Ga0451577_0086850
1798 Ga0466969_0000018
1799 Ga0466969_0007499
1800 Ga0466969_0024919
1801 Ga0466972_0005104
1802 Ga0453683_0007182
1803 Ga0466965_0054848
1804 Ga0466966_0014306
1805 Ga0466966_0035444
1806 Ga0466966_0123612
1807 Ga0466961_0006521
1808 Ga0466961_0046171
1809 Ga0466961_0078138
1810 Ga0466963_0017494
1811 Ga0466963_0066522
1812 Ga0466963_0089148
1813 Ga0466964_0016300
1814 Ga0453684_0000365
1815 Ga0453684_0008286
1816 Ga0453684_0026097
1817 Ga0453684_0035441
1818 Ga0466971_0034133
1819 Ga0466968_0016365
1820 Ga0466968_0043870
1821 Ga0466970_0048635
1822 Ga0466970_0049986
1823 Ga0466957_0004358
1824 Ga0466959_0009769
1825 Ga0466959_0024616
1826 Ga0466959_0031472
1827 Ga0466959_0167643
1828 Ga0451576_0000627
1829 Ga0451576_0010718
1830 Ga0451576_0048235
1831 Ga0451576_0065287
1832 Ga0451576_0073572
1833 Ga0451576_0085485
1834 Ga0451576_0126862
1835 Ga0466958_0009242
1836 Ga0495592_0000499
1837 Ga0495590_0003163
1838 Ga0495638_0030970
1839 Ga0495638_0077223
1840 Ga0495650_0009623
1841 Ga0495650_0065547
1842 Ga0495583_0000428
1843 Ga0495606_0000821
1844 Ga0495608_0066591
1845 Ga0495610_0019230
1846 Ga0495616_0001020
1847 Ga0495620_0016702
1848 Ga0495631_0000803
1849 Ga0495632_0002352
1850 Ga0495632_0020371
1851 Ga0495632_0106906
1852 Ga0495637_0002174
1853 Ga0495643_0033985
1854 Ga0495654_0001492
1855 Ga0495654_0018028
1856 Ga0495621_0009162
1857 Ga0495621_0027194
1858 Ga0495597_0007542
1859 Ga0495645_0037182
1860 Ga0495656_0001009
1861 Ga0495668_0017953
1862 Ga0495668_0021362
1863 Ga0495625_0000098
1864 Ga0495625_0000827
1865 Ga0495625_0013529
1866 Ga0495625_0091088
1867 Ga0495659_0048833
1868 Ga0495588_0053425
1869 Ga0495647_0005177
1870 Ga0495658_0032461
1871 Ga0495669_0041763
1872 Ga0495671_0006329
1873 Ga0495649_0000380
1874 Ga0495649_0003008
1875 Ga0495589_0062792
1876 Ga0495660_0026773
1877 Ga0495674_0053355
1878 Ga0495687_000850
1879 Ga0495687_008280
1880 Ga0495685_012460
1881 Ga0495686_0023279
1882 Ga0496100_0053208
1883 Ga0496101_0003712
1884 Ga0496102_0003201
1885 Ga0496102_0040796
1886 Ga0496103_0049276
1887 Ga0496104_0098843
1888 Ga0496104_0126968
1889 Ga0496106_0025782
1890 Ga0496108_0052454
1891 Ga0496109_0000810
1892 Ga0496109_0005617
1893 Ga0496109_0045569
1894 Ga0496109_0097926
1895 Ga0496109_0214464
1896 Ga0496111_0024896
1897 Ga0496112_0009640
1898 Ga0496113_0137469
1899 Ga0496114_0056418
1900 Ga0496114_0085310
1901 Ga0496114_0301106
1902 Ga0496115_0008890
1903 Ga0496116_0008159
1904 Ga0496116_0020369
1905 Ga0496117_0000029
1906 Ga0496117_0029813
1907 Ga0496117_0039574
1908 Ga0496118_0022033
1909 Ga0496118_0026467
1910 Ga0496121_0003335
1911 Ga0496121_0015328
1912 Ga0496121_0080422
1913 Ga0496122_0069768
1914 Ga0496122_0114005
1915 Ga0496123_0030703
1916 Ga0496123_0057303
1917 Ga0496123_0155100
1918 Ga0496123_0180729
1919 Ga0496124_0000733
1920 Ga0496124_0046785
1921 Ga0496124_0056407
1922 Ga0496124_0076165
1923 Ga0496125_0017746
1924 Ga0496125_0017837
1925 Ga0496125_0046766
1926 Ga0496125_0051955
1927 Ga0496125_0054939
1928 Ga0501291_003279
1929 Ga0501292_009696
1930 Ga0501031_0001713
1931 Ga0501031_0029305
1932 Ga0501034_0345305
1933 Ga0501036_0117354
1934 Ga0501039_0293249
1935 Ga0501041_0084458
1936 Ga0501043_0000058
1937 Ga0501046_0000051
1938 Ga0501047_0000003
1939 Ga0501047_0016202
1940 Ga0501047_0287546
1941 Ga0501070_0147670
1942 Ga0501075_0032839
1943 Ga0501076_0079761
1944 Ga0501076_0296899
1945 Ga0501198_000007
1946 Ga0501222_000005
1947 Ga0501249_004367
1948 Ga0501225_0024202
1949 Ga0501229_000685
1950 Ga0501080_0202514
1951 Ga0501081_0099489
1952 Ga0501083_0025871
1953 Ga0501267_002227
1954 Ga0501044_0004830
1955 Ga0501045_0015123
1956 Ga0501045_0210284
1957 nmdc:mga03683_29128_c1
1958 nmdc:mga03683_59943_c1
1959 nmdc:mga03683_916_c1
1960 nmdc:mga03n38_117193_c1
1961 nmdc:mga03n38_21764_c1
1962 nmdc:mga03n38_45913_c1
1963 nmdc:mga03n38_56000_c1
1964 nmdc:mga03n38_58155_c1
1965 nmdc:mga03n38_70573_c1
1966 nmdc:mga00v17_31205_c1
1967 nmdc:mga0yw44_88132_c1
1968 nmdc:mga0k408_103336_c1
1969 nmdc:mga0k408_103779_c1
1970 nmdc:mga0k408_10449_c1
1971 nmdc:mga0k408_10776_c1
1972 nmdc:mga0k408_134114_c1
1973 nmdc:mga0k408_1536_c1
1974 nmdc:mga0k408_196283_c1
1975 nmdc:mga0k408_21153_c1
1976 nmdc:mga0k408_35374_c1
1977 nmdc:mga0k408_366_c1
1978 nmdc:mga0k408_49562_c1
1979 nmdc:mga0k408_8221_c1
1980 nmdc:mga0k408_83171_c1
1981 nmdc:mga0k408_87039_c1
1982 nmdc:mga0k408_98163_c1
1983 nmdc:mga06z11_21913_c2
1984 nmdc:mga07m45_10234_c1
1985 nmdc:mga07m45_29854_c1
1986 nmdc:mga07m45_2992_c2
1987 nmdc:mga07m45_2998_c1
1988 nmdc:mga07m45_3088_c1
1989 nmdc:mga07m45_3233_c1
1990 nmdc:mga07m45_4705_c1
1991 nmdc:mga07m45_6187_c1
1992 nmdc:mga07m45_64416_c1
1993 nmdc:mga07m45_6836_c1
1994 nmdc:mga07m45_9468_c1
1995 nmdc:mga09592_174_c1
1996 nmdc:mga0sz30_35023_c1
1997 nmdc:mga0sz30_42066_c1
1998 Ga0500635_0000070
1999 Ga0500578_0000417
2000 Ga0500651_0000093
2001 Ga0500651_0001098
2002 Ga0500651_0065399
2003 Ga0500566_0106332
2004 Ga0500562_002046
2005 Ga0500571_000137
2006 Ga0500593_000471
2007 Ga0500593_000805
2008 Ga0500593_001574
2009 Ga0500594_0005325
2010 Ga0500607_004111
2011 Ga0500608_006080
2012 Ga0500608_010693
2013 Ga0500642_0008356
2014 Ga0500642_0020754
2015 Ga0500652_001084
2016 Ga0500652_064140
2017 Ga0500655_000776
2018 Ga0500658_0000827
2019 Ga0500658_0011664
2020 Ga0500658_0029034
2021 Ga0500559_0000097
2022 Ga0500559_0004744
2023 Ga0500559_0023297
2024 Ga0500568_0004144
2025 Ga0500568_0004342
2026 Ga0500568_0007402
2027 Ga0500568_0015839
2028 Ga0500590_064552
2029 Ga0500622_0000198
2030 Ga0500622_0005315
2031 Ga0500627_0002058
2032 Ga0500645_000259
2033 Ga0500645_002355
2034 Ga0500587_000676
2035 Ga0500661_008021
2036 Ga0466962_0003983
2037 2511245341
2038 2548500276
2039 2587725949
2040 2587735600
2041 2588292838
2042 2599621793
2043 2599670523
2044 2599679013
2045 2599691304
2046 2643744049
2047 2643864692
2048 2643932478
2049 2643992696
2050 2644058399
2051 2644073450
2052 2644163726
2053 2644219892
2054 2644247189
2055 2644260990
2056 2644296484
2057 2644301004
2058 2644313729
2059 2644327043
2060 2644339818
2061 2644398846
2062 2644466527
2063 2644647171
2064 2735818178
2065 2738721855
2066 2738882029
2067 2739054795
2068 2739247033
2069 2739247829
2070 2739282219
2071 2740032516
2072 2787508467
2073 2816469687
2074 2819597962
2075 2831268951
2076 2831867635
2077 2838058379
2078 2842678299
2079 2842720649
2080 2842738632
2081 2881104357
2082 2881645022
2083 2885203881
2084 2885217784
2085 2886854914
2086 2899929381
2087 2904451123
2088 2904457977
2089 2904546720
2090 2919465672
2091 2928040175
2092 2928047076
2093 2928057720
2094 2928067897
2095 2928072461
2096 2928085660
2097 2928118830
2098 2928520417
2099 2929166169
2100 2929526408
2101 2939615677
2102 2939634697
2103 2945915015
2104 2945950962
2105 2945974401
2106 2945989587
2107 2990715271
2108 3001271207
2109 3001272105
2110 3006978298
2111 3006992730

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22660

RS_preATP-grasp-like

Ribonucleotide synthetase preATP-grasp domain

29

126

0.99

PF02222

ATP-grasp

ATP-grasp domain

145

317

0.95

PF17769

PurK_C

Phosphoribosylaminoimidazole carboxylase C-terminal domain

343

406

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4izo-assembly1.cif.gz_A crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis 0.9659 8 398
4izo-assembly1.cif.gz_A crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis 0.9609 8 398
4e4t-assembly1.cif.gz_B crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.959 8 399
4e4t-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.9579 8 399
4e4t-assembly1.cif.gz_B crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.9541 8 399
ID Description Score Start End Superfamily
4izoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9892 8 117 3.40.50.20
4izoA03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9754 189 397 3.30.470.20
3v4sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9722 10 117 3.40.50.20
4izoA03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9706 189 397 3.30.470.20
3aw8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9605 16 110 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A4Q5WH15-F1-model_v4 deleted 0.998 8 314
AF-A0A3C1MWY2-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide synthase 0.9952 10 117 GO:0005829
AF-A0A4Q5WH15-F1-model_v4 deleted 0.9884 8 314
AF-A0A1I7Y3B8-F1-model_v4 Multifunctional fusion protein 0.9778 22 398 GO:0004638
GO:0004639
GO:0005524
GO:0005829
GO:0005975
GO:0006189
GO:0008270
GO:0016832
AF-A0A7C5KY93-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.9774 1 395 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872

Map