F489164
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 487 | 2110 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0020610|Ga0501032_0020610_2624_3979 |
| Length | 451 |
| Sequence | MRNRRSRKISAARFRFFSFSFNRLVATAGNLSLYSARNRPLNGGRQQQENKVATGIRDKVAILGMGCSKFGERWDAGAEELMVEAYLEALQDAGVETNQIQAAWFGTAIEEQHVGKGGTPMSVALRLPNIPVTRVENFCASGSEAFRGAVYAVAAGACDIALALGVEKLKDTGYGGLPQREGATLQPLWSANGSAPGNFAQLASAYRAKHNVSKEDLKRAIAHVSVKSHANGAKNPKAHLQKPITEEQCLKAPMIAEPLGLFDCCGVSDGSACAIVTTPEIARAMGKKDIITVKALQLSLSNGLESQHNSWDGSYFHTARIASKRAYEEAGIKDPRNDVSMIEVHDCFSITELVTMEDLHISREGEGWKDVMNGFYDADGQVPCQIDGGLKCFGHPIGASGLRMLYEMYLQLQGRAGARQLKNPKIGLTHNLGGAPMMNVCSVAIIGAQGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 206 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 210 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 222 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 223 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 224 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 235 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 258 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 259 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 260 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 261 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 265 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 266 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 267 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 268 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 269 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 270 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 271 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 348 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 370 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 371 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 372 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 392 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 395 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 396 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 397 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 398 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 401 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 402 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 405 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 406 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 407 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 408 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 409 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 411 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 412 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 414 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 420 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 421 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 425 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 426 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 427 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 428 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 430 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 431 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 436 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 437 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 438 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 439 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 440 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 441 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 442 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 443 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 444 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 445 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 446 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 447 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 448 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 449 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 450 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 451 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 452 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 453 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 454 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 455 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 456 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 457 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 458 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 459 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 460 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 461 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 462 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 463 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 464 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 465 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 466 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 467 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 468 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 469 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 470 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 471 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 472 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 473 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 474 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 475 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 476 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 477 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 478 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 479 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 480 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 481 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 482 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 483 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 484 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 485 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 486 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 487 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.93 |
| Metatranscriptomes | 1.04 |
| Isolates | 5.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.04 |
| Nodule | 0.28 |
| Rhizoplane | 6.26 |
| Rhizosphere | 74.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0020610 | 3300049569 | Bacteria | 4590 |
| 2 | SwRhRL2b_contig_464563 | 2162886007 | Bacteria | 2552 |
| 3 | rootH1_10071863 | 3300003316 | Bacteria | 4375 |
| 4 | rootH2_10014120 | 3300003320 | Bacteria | 22102 |
| 5 | Ga0055524_1001209 | 3300003775 | Bacteria | 15317 |
| 6 | Ga0055536_1000097 | 3300003781 | Bacteria | 75926 |
| 7 | Ga0055536_1000556 | 3300003781 | Bacteria | 25567 |
| 8 | Ga0055536_1000610 | 3300003781 | Bacteria | 24362 |
| 9 | Ga0055528_1004791 | 3300003790 | Bacteria | 6441 |
| 10 | Ga0055530_10000405 | 3300003791 | Bacteria | 38619 |
| 11 | Ga0055531_10000224 | 3300003794 | Bacteria | 62709 |
| 12 | Ga0055531_10002410 | 3300003794 | Bacteria | 12551 |
| 13 | Ga0065714_10065692 | 3300005288 | Bacteria | 8844 |
| 14 | Ga0065707_10086567 | 3300005295 | Bacteria | 5399 |
| 15 | Ga0070658_10200567 | 3300005327 | Bacteria | 1683 |
| 16 | Ga0070690_100005911 | 3300005330 | Bacteria | 6903 |
| 17 | Ga0070690_100092446 | 3300005330 | Bacteria | 1995 |
| 18 | Ga0070670_100060610 | 3300005331 | Bacteria | 3249 |
| 19 | Ga0070680_100000037 | 3300005336 | Bacteria | 66957 |
| 20 | Ga0070680_100116452 | 3300005336 | Bacteria | 2228 |
| 21 | Ga0070691_10002785 | 3300005341 | Bacteria | 7799 |
| 22 | Ga0070691_10008294 | 3300005341 | Bacteria | 4759 |
| 23 | Ga0070691_10027477 | 3300005341 | Bacteria | 2655 |
| 24 | Ga0070691_10034490 | 3300005341 | Bacteria | 2382 |
| 25 | Ga0070687_100179246 | 3300005343 | Bacteria | 1268 |
| 26 | Ga0070661_100001403 | 3300005344 | Bacteria | 16824 |
| 27 | Ga0070668_100002600 | 3300005347 | Bacteria | 13266 |
| 28 | Ga0070668_100009767 | 3300005347 | Bacteria | 7113 |
| 29 | Ga0070671_100101684 | 3300005355 | Bacteria | 2412 |
| 30 | Ga0070671_100164234 | 3300005355 | Bacteria | 1877 |
| 31 | Ga0070673_100037265 | 3300005364 | Bacteria | 3704 |
| 32 | Ga0070667_100001761 | 3300005367 | Bacteria | 19299 |
| 33 | Ga0070703_10000621 | 3300005406 | Bacteria | 12565 |
| 34 | Ga0070703_10000776 | 3300005406 | Bacteria | 10516 |
| 35 | Ga0070709_10000229 | 3300005434 | Bacteria | 36348 |
| 36 | Ga0070709_10000292 | 3300005434 | Bacteria | 31816 |
| 37 | Ga0070714_100036015 | 3300005435 | Bacteria | 4149 |
| 38 | Ga0070714_100428336 | 3300005435 | Bacteria | 1254 |
| 39 | Ga0070713_100000003 | 3300005436 | Bacteria | 245840 |
| 40 | Ga0070713_100001423 | 3300005436 | Bacteria | 15342 |
| 41 | Ga0070713_100048254 | 3300005436 | Bacteria | 3505 |
| 42 | Ga0070710_10055254 | 3300005437 | Bacteria | 2243 |
| 43 | Ga0070711_100000006 | 3300005439 | Bacteria | 187224 |
| 44 | Ga0070711_100010191 | 3300005439 | Bacteria | 5809 |
| 45 | Ga0070705_100000042 | 3300005440 | Bacteria | 64569 |
| 46 | Ga0070705_100000089 | 3300005440 | Bacteria | 50973 |
| 47 | Ga0070700_100014332 | 3300005441 | Bacteria | 4474 |
| 48 | Ga0070700_100038168 | 3300005441 | Bacteria | 2926 |
| 49 | Ga0070694_100012470 | 3300005444 | Bacteria | 5285 |
| 50 | Ga0070694_100063969 | 3300005444 | Bacteria | 2517 |
| 51 | Ga0070694_100068036 | 3300005444 | Bacteria | 2446 |
| 52 | Ga0070708_100007273 | 3300005445 | Bacteria | 8854 |
| 53 | Ga0070663_100187467 | 3300005455 | Bacteria | 1608 |
| 54 | Ga0070678_100083634 | 3300005456 | Bacteria | 2426 |
| 55 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 56 | Ga0070706_100000274 | 3300005467 | Bacteria | 62620 |
| 57 | Ga0070706_100041613 | 3300005467 | Bacteria | 4242 |
| 58 | Ga0070706_100087025 | 3300005467 | Bacteria | 2896 |
| 59 | Ga0070707_100000600 | 3300005468 | Bacteria | 36171 |
| 60 | Ga0070698_100151341 | 3300005471 | Bacteria | 2268 |
| 61 | Ga0070698_100413015 | 3300005471 | Bacteria | 1284 |
| 62 | Ga0070699_100000182 | 3300005518 | Bacteria | 60940 |
| 63 | Ga0070699_100001677 | 3300005518 | Bacteria | 20184 |
| 64 | Ga0070679_100000096 | 3300005530 | Bacteria | 67304 |
| 65 | Ga0070679_100049818 | 3300005530 | Bacteria | 4172 |
| 66 | Ga0070697_100004703 | 3300005536 | Bacteria | 10464 |
| 67 | Ga0070697_100023202 | 3300005536 | Bacteria | 4934 |
| 68 | Ga0070697_100210378 | 3300005536 | Bacteria | 1655 |
| 69 | Ga0068853_100002100 | 3300005539 | Bacteria | 14778 |
| 70 | Ga0068853_100005959 | 3300005539 | Bacteria | 9631 |
| 71 | Ga0068853_100152758 | 3300005539 | Bacteria | 2079 |
| 72 | Ga0068853_100284586 | 3300005539 | Bacteria | 1524 |
| 73 | Ga0070686_100157794 | 3300005544 | Bacteria | 1595 |
| 74 | Ga0070695_100006839 | 3300005545 | Bacteria | 6752 |
| 75 | Ga0070695_100010336 | 3300005545 | Bacteria | 5570 |
| 76 | Ga0070695_100018280 | 3300005545 | Bacteria | 4256 |
| 77 | Ga0070696_100000288 | 3300005546 | Bacteria | 30410 |
| 78 | Ga0070696_100000617 | 3300005546 | Bacteria | 22863 |
| 79 | Ga0070696_100048863 | 3300005546 | Bacteria | 2937 |
| 80 | Ga0070696_100066166 | 3300005546 | Bacteria | 2534 |
| 81 | Ga0070696_100087370 | 3300005546 | Bacteria | 2215 |
| 82 | Ga0070693_100005054 | 3300005547 | Bacteria | 6303 |
| 83 | Ga0070693_100018955 | 3300005547 | Bacteria | 3601 |
| 84 | Ga0070693_100167326 | 3300005547 | Bacteria | 1405 |
| 85 | Ga0070665_100010876 | 3300005548 | Bacteria | 9204 |
| 86 | Ga0070665_100014067 | 3300005548 | Bacteria | 8044 |
| 87 | Ga0070665_100021647 | 3300005548 | Bacteria | 6465 |
| 88 | Ga0070665_100033055 | 3300005548 | Bacteria | 5204 |
| 89 | Ga0070704_100000232 | 3300005549 | Bacteria | 23667 |
| 90 | Ga0070704_100004402 | 3300005549 | Bacteria | 8135 |
| 91 | Ga0070704_100218602 | 3300005549 | Bacteria | 1548 |
| 92 | Ga0068855_100000010 | 3300005563 | Bacteria | 246022 |
| 93 | Ga0068855_100005574 | 3300005563 | Bacteria | 15362 |
| 94 | Ga0068855_100006001 | 3300005563 | Bacteria | 14821 |
| 95 | Ga0068855_100094932 | 3300005563 | Bacteria | 3438 |
| 96 | Ga0068855_100122997 | 3300005563 | Bacteria | 2969 |
| 97 | Ga0070664_100023136 | 3300005564 | Bacteria | 5130 |
| 98 | Ga0070664_100035491 | 3300005564 | Bacteria | 4186 |
| 99 | Ga0068857_100006105 | 3300005577 | Bacteria | 10291 |
| 100 | Ga0068857_100022564 | 3300005577 | Bacteria | 5537 |
| 101 | Ga0068854_100002041 | 3300005578 | Bacteria | 12380 |
| 102 | Ga0068854_100019233 | 3300005578 | Bacteria | 4599 |
| 103 | Ga0068856_100000075 | 3300005614 | Bacteria | 94156 |
| 104 | Ga0068856_100000569 | 3300005614 | Bacteria | 40404 |
| 105 | Ga0068856_100002154 | 3300005614 | Bacteria | 20395 |
| 106 | Ga0068856_100022862 | 3300005614 | Bacteria | 6080 |
| 107 | Ga0068852_100011109 | 3300005616 | Bacteria | 6762 |
| 108 | Ga0068852_100160792 | 3300005616 | Bacteria | 2097 |
| 109 | Ga0068852_100175999 | 3300005616 | Bacteria | 2009 |
| 110 | Ga0068859_100002952 | 3300005617 | Bacteria | 17252 |
| 111 | Ga0068859_100026387 | 3300005617 | Bacteria | 5824 |
| 112 | Ga0068859_100028131 | 3300005617 | Bacteria | 5636 |
| 113 | Ga0068859_100050057 | 3300005617 | Bacteria | 4197 |
| 114 | Ga0068859_100272416 | 3300005617 | Bacteria | 1785 |
| 115 | Ga0068864_100057575 | 3300005618 | Bacteria | 3358 |
| 116 | Ga0068864_100409362 | 3300005618 | Bacteria | 1290 |
| 117 | Ga0068851_10002585 | 3300005834 | Bacteria | 7971 |
| 118 | Ga0068851_10111235 | 3300005834 | Bacteria | 1462 |
| 119 | Ga0068863_100003097 | 3300005841 | Bacteria | 16424 |
| 120 | Ga0068863_100024925 | 3300005841 | Bacteria | 5706 |
| 121 | Ga0068863_100025061 | 3300005841 | Bacteria | 5689 |
| 122 | Ga0068863_100043597 | 3300005841 | Bacteria | 4258 |
| 123 | Ga0068863_100130527 | 3300005841 | Bacteria | 2399 |
| 124 | Ga0068858_100014190 | 3300005842 | Bacteria | 7513 |
| 125 | Ga0068858_100078471 | 3300005842 | Bacteria | 3068 |
| 126 | Ga0068858_100180237 | 3300005842 | Bacteria | 1994 |
| 127 | Ga0068860_100000028 | 3300005843 | Bacteria | 266461 |
| 128 | Ga0068860_100000032 | 3300005843 | Bacteria | 251624 |
| 129 | Ga0068860_100013934 | 3300005843 | Bacteria | 7881 |
| 130 | Ga0068860_100028256 | 3300005843 | Bacteria | 5398 |
| 131 | Ga0068860_100082902 | 3300005843 | Bacteria | 3049 |
| 132 | Ga0068860_100097696 | 3300005843 | Bacteria | 2800 |
| 133 | Ga0068860_100109627 | 3300005843 | Bacteria | 2638 |
| 134 | Ga0068862_100001018 | 3300005844 | Bacteria | 26950 |
| 135 | Ga0068862_100021065 | 3300005844 | Bacteria | 5448 |
| 136 | Ga0068862_100085502 | 3300005844 | Unclassified | 2741 |
| 137 | Ga0068862_100119011 | 3300005844 | Archaea | 2326 |
| 138 | Ga0068862_100224553 | 3300005844 | Bacteria | 1701 |
| 139 | Ga0081455_10001326 | 3300005937 | Bacteria | 30601 |
| 140 | Ga0081455_10002294 | 3300005937 | Bacteria | 22790 |
| 141 | Ga0081455_10003139 | 3300005937 | Bacteria | 19212 |
| 142 | Ga0081538_10054561 | 3300005981 | Bacteria | 2362 |
| 143 | Ga0081540_1001742 | 3300005983 | Bacteria | 18317 |
| 144 | Ga0081540_1028171 | 3300005983 | Bacteria | 3162 |
| 145 | Ga0081539_10001914 | 3300005985 | Bacteria | 32227 |
| 146 | Ga0081539_10013380 | 3300005985 | Bacteria | 6187 |
| 147 | Ga0081539_10052874 | 3300005985 | Bacteria | 2277 |
| 148 | Ga0081539_10115600 | 3300005985 | Bacteria | 1342 |
| 149 | Ga0075368_10072859 | 3300006042 | Bacteria | 1389 |
| 150 | Ga0075363_100000521 | 3300006048 | Bacteria | 12370 |
| 151 | Ga0070716_100024116 | 3300006173 | Bacteria | 3235 |
| 152 | Ga0070712_100000027 | 3300006175 | Bacteria | 77007 |
| 153 | Ga0070712_100001822 | 3300006175 | Bacteria | 12980 |
| 154 | Ga0070712_100004188 | 3300006175 | Bacteria | 8873 |
| 155 | Ga0075367_10000520 | 3300006178 | Bacteria | 14497 |
| 156 | Ga0075367_10015224 | 3300006178 | Bacteria | 4175 |
| 157 | Ga0075369_10007727 | 3300006186 | Bacteria | 4109 |
| 158 | Ga0075369_10030881 | 3300006186 | Bacteria | 2258 |
| 159 | Ga0075369_10032518 | 3300006186 | Bacteria | 2207 |
| 160 | Ga0075366_10008672 | 3300006195 | Bacteria | 5661 |
| 161 | Ga0097621_100010821 | 3300006237 | Bacteria | 6693 |
| 162 | Ga0075370_10009113 | 3300006353 | Bacteria | 5135 |
| 163 | Ga0075370_10055967 | 3300006353 | Bacteria | 2241 |
| 164 | Ga0068871_100002451 | 3300006358 | Bacteria | 12671 |
| 165 | Ga0075428_100006408 | 3300006844 | Bacteria | 13094 |
| 166 | Ga0075428_100009476 | 3300006844 | Bacteria | 10808 |
| 167 | Ga0075428_100010017 | 3300006844 | Bacteria | 10527 |
| 168 | Ga0075428_100084017 | 3300006844 | Bacteria | 3474 |
| 169 | Ga0075430_100080242 | 3300006846 | Bacteria | 2733 |
| 170 | Ga0075431_100010582 | 3300006847 | Bacteria | 9276 |
| 171 | Ga0075431_100010694 | 3300006847 | Bacteria | 9221 |
| 172 | Ga0075433_10011348 | 3300006852 | Bacteria | 7171 |
| 173 | Ga0075433_10015023 | 3300006852 | Bacteria | 6337 |
| 174 | Ga0075433_10139155 | 3300006852 | Unclassified | 2158 |
| 175 | Ga0075434_100004616 | 3300006871 | Bacteria | 12443 |
| 176 | Ga0075434_100377390 | 3300006871 | Unclassified | 1439 |
| 177 | Ga0075429_100095542 | 3300006880 | Bacteria | 2592 |
| 178 | Ga0068865_100008468 | 3300006881 | Bacteria | 6358 |
| 179 | Ga0068865_100045580 | 3300006881 | Bacteria | 3006 |
| 180 | Ga0068865_100249939 | 3300006881 | Bacteria | 1399 |
| 181 | Ga0075436_100000038 | 3300006914 | Bacteria | 82918 |
| 182 | Ga0075436_100000820 | 3300006914 | Bacteria | 20670 |
| 183 | Ga0075436_100005599 | 3300006914 | Bacteria | 8618 |
| 184 | Ga0097620_100002952 | 3300006931 | Bacteria | 17252 |
| 185 | Ga0097620_100026387 | 3300006931 | Bacteria | 5824 |
| 186 | Ga0097620_100028132 | 3300006931 | Bacteria | 5636 |
| 187 | Ga0097620_100050057 | 3300006931 | Bacteria | 4197 |
| 188 | Ga0097620_100272429 | 3300006931 | Bacteria | 1785 |
| 189 | Ga0075435_100003260 | 3300007076 | Bacteria | 10993 |
| 190 | Ga0075435_100019175 | 3300007076 | Bacteria | 5217 |
| 191 | Ga0099794_10022855 | 3300007265 | Bacteria | 2854 |
| 192 | Ga0099794_10070331 | 3300007265 | Bacteria | 1713 |
| 193 | Ga0099795_10000235 | 3300007788 | Bacteria | 9762 |
| 194 | Ga0105240_10000189 | 3300009093 | Bacteria | 125396 |
| 195 | Ga0105240_10006687 | 3300009093 | Bacteria | 16904 |
| 196 | Ga0105240_10012045 | 3300009093 | Bacteria | 11986 |
| 197 | Ga0105240_10015182 | 3300009093 | Bacteria | 10481 |
| 198 | Ga0105240_10015309 | 3300009093 | Bacteria | 10435 |
| 199 | Ga0105240_10018751 | 3300009093 | Bacteria | 9269 |
| 200 | Ga0105240_10025885 | 3300009093 | Bacteria | 7703 |
| 201 | Ga0105240_10055553 | 3300009093 | Bacteria | 4957 |
| 202 | Ga0105240_10071493 | 3300009093 | Bacteria | 4291 |
| 203 | Ga0111539_10030909 | 3300009094 | Bacteria | 6508 |
| 204 | Ga0111539_10073034 | 3300009094 | Bacteria | 4045 |
| 205 | Ga0111539_10077333 | 3300009094 | Bacteria | 3917 |
| 206 | Ga0111539_10287823 | 3300009094 | Bacteria | 1912 |
| 207 | Ga0111539_10411681 | 3300009094 | Bacteria | 1575 |
| 208 | Ga0111539_10468913 | 3300009094 | Bacteria | 1466 |
| 209 | Ga0105245_10014018 | 3300009098 | Bacteria | 6981 |
| 210 | Ga0105247_10016215 | 3300009101 | Bacteria | 4464 |
| 211 | Ga0105247_10081842 | 3300009101 | Bacteria | 2036 |
| 212 | Ga0114129_10064342 | 3300009147 | Bacteria | 5118 |
| 213 | Ga0114129_10157671 | 3300009147 | Bacteria | 3103 |
| 214 | Ga0114129_10173376 | 3300009147 | Unclassified | 2939 |
| 215 | Ga0114129_10420599 | 3300009147 | Bacteria | 1757 |
| 216 | Ga0105243_10071304 | 3300009148 | Bacteria | 2809 |
| 217 | Ga0105243_10091667 | 3300009148 | Bacteria | 2503 |
| 218 | Ga0105243_10124888 | 3300009148 | Bacteria | 2175 |
| 219 | Ga0105241_10025127 | 3300009174 | Bacteria | 4427 |
| 220 | Ga0105241_10040227 | 3300009174 | Bacteria | 3529 |
| 221 | Ga0105241_10219464 | 3300009174 | Bacteria | 1597 |
| 222 | Ga0105242_10000830 | 3300009176 | Bacteria | 24033 |
| 223 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 224 | Ga0105248_10128355 | 3300009177 | Bacteria | 2860 |
| 225 | Ga0105248_10327048 | 3300009177 | Bacteria | 1727 |
| 226 | Ga0105237_10000304 | 3300009545 | Bacteria | 68213 |
| 227 | Ga0105237_10000443 | 3300009545 | Bacteria | 58933 |
| 228 | Ga0105237_10012505 | 3300009545 | Bacteria | 8942 |
| 229 | Ga0105238_10016013 | 3300009551 | Bacteria | 7584 |
| 230 | Ga0105238_10031136 | 3300009551 | Bacteria | 5431 |
| 231 | Ga0105238_10081652 | 3300009551 | Bacteria | 3222 |
| 232 | Ga0105238_10125859 | 3300009551 | Bacteria | 2541 |
| 233 | Ga0105249_10000305 | 3300009553 | Bacteria | 49977 |
| 234 | Ga0105249_10012411 | 3300009553 | Bacteria | 7511 |
| 235 | Ga0105249_10060693 | 3300009553 | Bacteria | 3469 |
| 236 | Ga0099796_10000154 | 3300010159 | Bacteria | 10174 |
| 237 | Ga0099796_10006478 | 3300010159 | Bacteria | 2999 |
| 238 | Ga0105239_10003215 | 3300010375 | Bacteria | 20207 |
| 239 | Ga0105239_10008512 | 3300010375 | Bacteria | 11663 |
| 240 | Ga0105239_10016434 | 3300010375 | Bacteria | 8183 |
| 241 | Ga0105239_10022608 | 3300010375 | Bacteria | 6932 |
| 242 | Ga0105239_10046524 | 3300010375 | Bacteria | 4755 |
| 243 | Ga0105239_10048125 | 3300010375 | Bacteria | 4675 |
| 244 | Ga0105239_10232498 | 3300010375 | Bacteria | 2068 |
| 245 | Ga0105246_10069574 | 3300011119 | Bacteria | 2472 |
| 246 | Ga0157373_10000340 | 3300013100 | Bacteria | 37871 |
| 247 | Ga0157373_10000686 | 3300013100 | Bacteria | 26568 |
| 248 | Ga0157373_10014411 | 3300013100 | Bacteria | 5795 |
| 249 | Ga0157373_10071323 | 3300013100 | Bacteria | 2454 |
| 250 | Ga0157369_10055553 | 3300013105 | Bacteria | 4274 |
| 251 | Ga0157369_10060202 | 3300013105 | Bacteria | 4095 |
| 252 | Ga0157369_10166168 | 3300013105 | Bacteria | 2327 |
| 253 | Ga0157374_10038241 | 3300013296 | Bacteria | 4410 |
| 254 | Ga0157378_10002709 | 3300013297 | Bacteria | 15778 |
| 255 | Ga0163162_10021263 | 3300013306 | Bacteria | 6386 |
| 256 | Ga0157372_10005699 | 3300013307 | Bacteria | 13257 |
| 257 | Ga0157375_10041951 | 3300013308 | Bacteria | 4423 |
| 258 | Ga0157375_10102579 | 3300013308 | Bacteria | 2946 |
| 259 | Ga0157375_10181588 | 3300013308 | Bacteria | 2256 |
| 260 | Ga0163163_10001576 | 3300014325 | Bacteria | 19224 |
| 261 | Ga0163163_10015060 | 3300014325 | Bacteria | 7133 |
| 262 | Ga0163163_10082445 | 3300014325 | Bacteria | 3219 |
| 263 | Ga0163163_10292800 | 3300014325 | Bacteria | 1680 |
| 264 | Ga0157380_10195128 | 3300014326 | Bacteria | 1791 |
| 265 | Ga0182008_10000207 | 3300014497 | Bacteria | 46359 |
| 266 | Ga0157379_10005876 | 3300014968 | Bacteria | 10558 |
| 267 | Ga0157379_10016970 | 3300014968 | Bacteria | 6408 |
| 268 | Ga0157379_10053130 | 3300014968 | Bacteria | 3620 |
| 269 | Ga0157379_10189838 | 3300014968 | Bacteria | 1857 |
| 270 | Ga0157379_10437339 | 3300014968 | Bacteria | 1206 |
| 271 | Ga0197907_10728211 | 3300020069 | Bacteria | 1802 |
| 272 | Ga0206352_11247993 | 3300020078 | Bacteria | 1620 |
| 273 | Ga0213876_10000316 | 3300021384 | Bacteria | 42531 |
| 274 | Ga0213876_10000431 | 3300021384 | Bacteria | 34586 |
| 275 | Ga0213876_10002998 | 3300021384 | Bacteria | 9772 |
| 276 | Ga0213875_10000117 | 3300021388 | Bacteria | 89143 |
| 277 | Ga0213871_10012583 | 3300021441 | Bacteria | 1970 |
| 278 | Ga0224712_10024255 | 3300022467 | Bacteria | 2116 |
| 279 | Ga0209565_1000414 | 3300025263 | Bacteria | 35246 |
| 280 | Ga0209673_1001894 | 3300025273 | Bacteria | 16797 |
| 281 | Ga0209676_1000031 | 3300025292 | Bacteria | 478976 |
| 282 | Ga0209676_1000057 | 3300025292 | Bacteria | 361061 |
| 283 | Ga0209676_1000077 | 3300025292 | Bacteria | 298831 |
| 284 | Ga0209676_1006896 | 3300025292 | Bacteria | 5487 |
| 285 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 286 | Ga0209758_1006233 | 3300025297 | Bacteria | 8699 |
| 287 | Ga0209050_1000087 | 3300025298 | Bacteria | 261460 |
| 288 | Ga0209050_1000096 | 3300025298 | Bacteria | 240109 |
| 289 | Ga0209050_1008634 | 3300025298 | Bacteria | 5390 |
| 290 | Ga0209256_1000353 | 3300025299 | Bacteria | 74809 |
| 291 | Ga0209051_1005874 | 3300025303 | Bacteria | 7055 |
| 292 | Ga0209257_1000050 | 3300025304 | Bacteria | 439325 |
| 293 | Ga0209257_1000130 | 3300025304 | Bacteria | 212188 |
| 294 | Ga0209257_1007067 | 3300025304 | Bacteria | 6936 |
| 295 | Ga0207697_10029271 | 3300025315 | Bacteria | 2253 |
| 296 | Ga0207655_1018995 | 3300025728 | Bacteria | 3617 |
| 297 | Ga0207653_10000115 | 3300025885 | Bacteria | 56386 |
| 298 | Ga0207692_10028032 | 3300025898 | Bacteria | 2659 |
| 299 | Ga0207647_10000943 | 3300025904 | Bacteria | 22491 |
| 300 | Ga0207647_10006279 | 3300025904 | Bacteria | 8653 |
| 301 | Ga0207647_10058361 | 3300025904 | Bacteria | 2363 |
| 302 | Ga0207699_10000031 | 3300025906 | Bacteria | 137708 |
| 303 | Ga0207699_10000425 | 3300025906 | Bacteria | 21588 |
| 304 | Ga0207645_10166571 | 3300025907 | Bacteria | 1443 |
| 305 | Ga0207705_10000608 | 3300025909 | Bacteria | 30010 |
| 306 | Ga0207705_10086367 | 3300025909 | Bacteria | 2293 |
| 307 | Ga0207684_10000174 | 3300025910 | Bacteria | 106440 |
| 308 | Ga0207684_10151851 | 3300025910 | Bacteria | 1993 |
| 309 | Ga0207654_10054778 | 3300025911 | Bacteria | 2306 |
| 310 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 311 | Ga0207707_10003660 | 3300025912 | Bacteria | 13634 |
| 312 | Ga0207707_10083776 | 3300025912 | Bacteria | 2784 |
| 313 | Ga0207707_10084843 | 3300025912 | Bacteria | 2767 |
| 314 | Ga0207707_10182384 | 3300025912 | Bacteria | 1832 |
| 315 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 316 | Ga0207695_10015409 | 3300025913 | Bacteria | 9001 |
| 317 | Ga0207695_10020718 | 3300025913 | Bacteria | 7523 |
| 318 | Ga0207695_10071991 | 3300025913 | Bacteria | 3529 |
| 319 | Ga0207695_10072200 | 3300025913 | Bacteria | 3523 |
| 320 | Ga0207695_10078597 | 3300025913 | Bacteria | 3347 |
| 321 | Ga0207671_10000996 | 3300025914 | Bacteria | 34857 |
| 322 | Ga0207671_10034164 | 3300025914 | Bacteria | 3780 |
| 323 | Ga0207693_10000299 | 3300025915 | Bacteria | 46202 |
| 324 | Ga0207693_10003652 | 3300025915 | Bacteria | 13135 |
| 325 | Ga0207693_10010227 | 3300025915 | Bacteria | 7618 |
| 326 | Ga0207693_10071335 | 3300025915 | Bacteria | 2719 |
| 327 | Ga0207693_10139979 | 3300025915 | Bacteria | 1903 |
| 328 | Ga0207663_10000064 | 3300025916 | Bacteria | 52339 |
| 329 | Ga0207663_10019212 | 3300025916 | Bacteria | 3844 |
| 330 | Ga0207660_10000271 | 3300025917 | Bacteria | 34033 |
| 331 | Ga0207660_10000869 | 3300025917 | Bacteria | 19963 |
| 332 | Ga0207660_10001144 | 3300025917 | Bacteria | 17687 |
| 333 | Ga0207662_10054252 | 3300025918 | Bacteria | 2390 |
| 334 | Ga0207662_10145430 | 3300025918 | Bacteria | 1504 |
| 335 | Ga0207657_10043459 | 3300025919 | Bacteria | 3957 |
| 336 | Ga0207657_10069329 | 3300025919 | Bacteria | 2993 |
| 337 | Ga0207657_10112394 | 3300025919 | Bacteria | 2248 |
| 338 | Ga0207649_10000073 | 3300025920 | Bacteria | 86636 |
| 339 | Ga0207652_10000201 | 3300025921 | Bacteria | 63129 |
| 340 | Ga0207646_10000955 | 3300025922 | Bacteria | 37224 |
| 341 | Ga0207646_10185920 | 3300025922 | Bacteria | 1877 |
| 342 | Ga0207681_10107659 | 3300025923 | Bacteria | 2022 |
| 343 | Ga0207694_10000011 | 3300025924 | Bacteria | 417640 |
| 344 | Ga0207694_10024807 | 3300025924 | Bacteria | 4554 |
| 345 | Ga0207694_10077962 | 3300025924 | Bacteria | 2597 |
| 346 | Ga0207694_10135056 | 3300025924 | Bacteria | 1980 |
| 347 | Ga0207650_10020873 | 3300025925 | Bacteria | 4626 |
| 348 | Ga0207659_10029064 | 3300025926 | Bacteria | 3763 |
| 349 | Ga0207700_10000010 | 3300025928 | Bacteria | 298473 |
| 350 | Ga0207700_10179334 | 3300025928 | Bacteria | 1773 |
| 351 | Ga0207664_10045659 | 3300025929 | Bacteria | 3436 |
| 352 | Ga0207664_10223974 | 3300025929 | Bacteria | 1632 |
| 353 | Ga0207644_10001940 | 3300025931 | Bacteria | 13423 |
| 354 | Ga0207706_10041166 | 3300025933 | Bacteria | 4096 |
| 355 | Ga0207706_10074972 | 3300025933 | Bacteria | 2975 |
| 356 | Ga0207686_10008224 | 3300025934 | Bacteria | 5630 |
| 357 | Ga0207709_10030712 | 3300025935 | Bacteria | 3129 |
| 358 | Ga0207709_10142067 | 3300025935 | Bacteria | 1651 |
| 359 | Ga0207704_10013874 | 3300025938 | Bacteria | 4051 |
| 360 | Ga0207704_10018865 | 3300025938 | Bacteria | 3611 |
| 361 | Ga0207665_10008683 | 3300025939 | Bacteria | 6685 |
| 362 | Ga0207665_10032169 | 3300025939 | Bacteria | 3473 |
| 363 | Ga0207665_10136015 | 3300025939 | Bacteria | 1749 |
| 364 | Ga0207691_10127561 | 3300025940 | Bacteria | 2250 |
| 365 | Ga0207691_10292332 | 3300025940 | Bacteria | 1401 |
| 366 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 367 | Ga0207711_10084414 | 3300025941 | Bacteria | 2780 |
| 368 | Ga0207689_10178824 | 3300025942 | Bacteria | 1750 |
| 369 | Ga0207661_10147264 | 3300025944 | Bacteria | 2033 |
| 370 | Ga0207679_10014729 | 3300025945 | Bacteria | 5150 |
| 371 | Ga0207667_10000093 | 3300025949 | Bacteria | 145814 |
| 372 | Ga0207667_10003109 | 3300025949 | Bacteria | 20539 |
| 373 | Ga0207667_10003876 | 3300025949 | Bacteria | 18396 |
| 374 | Ga0207667_10007215 | 3300025949 | Bacteria | 13410 |
| 375 | Ga0207667_10019181 | 3300025949 | Bacteria | 7649 |
| 376 | Ga0207667_10178808 | 3300025949 | Bacteria | 2179 |
| 377 | Ga0207667_10396611 | 3300025949 | Bacteria | 1405 |
| 378 | Ga0207712_10029350 | 3300025961 | Bacteria | 3689 |
| 379 | Ga0207712_10051323 | 3300025961 | Bacteria | 2884 |
| 380 | Ga0207668_10005799 | 3300025972 | Bacteria | 7275 |
| 381 | Ga0207668_10024219 | 3300025972 | Bacteria | 3914 |
| 382 | Ga0207668_10035882 | 3300025972 | Bacteria | 3306 |
| 383 | Ga0207640_10017526 | 3300025981 | Bacteria | 4193 |
| 384 | Ga0207640_10022855 | 3300025981 | Bacteria | 3749 |
| 385 | Ga0207658_10000413 | 3300025986 | Bacteria | 40641 |
| 386 | Ga0207658_10003527 | 3300025986 | Bacteria | 11040 |
| 387 | Ga0207658_10095771 | 3300025986 | Bacteria | 2313 |
| 388 | Ga0207658_10144713 | 3300025986 | Bacteria | 1928 |
| 389 | Ga0207703_10008184 | 3300026035 | Bacteria | 8262 |
| 390 | Ga0207703_10067720 | 3300026035 | Bacteria | 2939 |
| 391 | Ga0207703_10231597 | 3300026035 | Bacteria | 1656 |
| 392 | Ga0207703_10319770 | 3300026035 | Bacteria | 1421 |
| 393 | Ga0207639_10002625 | 3300026041 | Bacteria | 12062 |
| 394 | Ga0207639_10055932 | 3300026041 | Bacteria | 3021 |
| 395 | Ga0207639_10251479 | 3300026041 | Bacteria | 1541 |
| 396 | Ga0207678_10020172 | 3300026067 | Bacteria | 5853 |
| 397 | Ga0207708_10010918 | 3300026075 | Bacteria | 6755 |
| 398 | Ga0207708_10025380 | 3300026075 | Bacteria | 4482 |
| 399 | Ga0207708_10094347 | 3300026075 | Bacteria | 2310 |
| 400 | Ga0207702_10000013 | 3300026078 | Bacteria | 257468 |
| 401 | Ga0207702_10000911 | 3300026078 | Bacteria | 30601 |
| 402 | Ga0207702_10031997 | 3300026078 | Bacteria | 4387 |
| 403 | Ga0207702_10158180 | 3300026078 | Bacteria | 2067 |
| 404 | Ga0207641_10002755 | 3300026088 | Bacteria | 16035 |
| 405 | Ga0207641_10104666 | 3300026088 | Bacteria | 2499 |
| 406 | Ga0207641_10113084 | 3300026088 | Bacteria | 2410 |
| 407 | Ga0207641_10322570 | 3300026088 | Bacteria | 1465 |
| 408 | Ga0207676_10058036 | 3300026095 | Bacteria | 3051 |
| 409 | Ga0207676_10277592 | 3300026095 | Bacteria | 1520 |
| 410 | Ga0207676_10299225 | 3300026095 | Bacteria | 1468 |
| 411 | Ga0207674_10002517 | 3300026116 | Bacteria | 23099 |
| 412 | Ga0207674_10008737 | 3300026116 | Bacteria | 11663 |
| 413 | Ga0207674_10013600 | 3300026116 | Bacteria | 9016 |
| 414 | Ga0207674_10014644 | 3300026116 | Bacteria | 8649 |
| 415 | Ga0207674_10042429 | 3300026116 | Bacteria | 4698 |
| 416 | Ga0207674_10148907 | 3300026116 | Bacteria | 2298 |
| 417 | Ga0207675_100064397 | 3300026118 | Bacteria | 3426 |
| 418 | Ga0207683_10211259 | 3300026121 | Bacteria | 1766 |
| 419 | Ga0207698_10007581 | 3300026142 | Bacteria | 6804 |
| 420 | Ga0207698_10015630 | 3300026142 | Bacteria | 5090 |
| 421 | Ga0207698_10151213 | 3300026142 | Bacteria | 2015 |
| 422 | Ga0207698_10204543 | 3300026142 | Bacteria | 1771 |
| 423 | Ga0207698_10314253 | 3300026142 | Bacteria | 1464 |
| 424 | Ga0209179_1000002 | 3300027512 | Bacteria | 124932 |
| 425 | Ga0207428_10017230 | 3300027907 | Bacteria | 6204 |
| 426 | Ga0207428_10091798 | 3300027907 | Bacteria | 2357 |
| 427 | Ga0207428_10128445 | 3300027907 | Bacteria | 1941 |
| 428 | Ga0268266_10017674 | 3300028379 | Bacteria | 6081 |
| 429 | Ga0268266_10098466 | 3300028379 | Bacteria | 2573 |
| 430 | Ga0268266_10268389 | 3300028379 | Bacteria | 1583 |
| 431 | Ga0268265_10004878 | 3300028380 | Bacteria | 9242 |
| 432 | Ga0268265_10013328 | 3300028380 | Bacteria | 5585 |
| 433 | Ga0268265_10021695 | 3300028380 | Bacteria | 4503 |
| 434 | Ga0268265_10081210 | 3300028380 | Bacteria | 2559 |
| 435 | Ga0268264_10000045 | 3300028381 | Bacteria | 364764 |
| 436 | Ga0268264_10000066 | 3300028381 | Bacteria | 285125 |
| 437 | Ga0268264_10007343 | 3300028381 | Bacteria | 9210 |
| 438 | Ga0268264_10010641 | 3300028381 | Bacteria | 7601 |
| 439 | Ga0268264_10018782 | 3300028381 | Bacteria | 5653 |
| 440 | Ga0268264_10092459 | 3300028381 | Bacteria | 2611 |
| 441 | Ga0265334_10005936 | 3300028573 | Bacteria | 5314 |
| 442 | Ga0265334_10008584 | 3300028573 | Bacteria | 4340 |
| 443 | Ga0265318_10000018 | 3300028577 | Bacteria | 173038 |
| 444 | Ga0265318_10009405 | 3300028577 | Bacteria | 4299 |
| 445 | Ga0307515_10077040 | 3300028794 | Bacteria | 4410 |
| 446 | Ga0307515_10104909 | 3300028794 | Bacteria | 3371 |
| 447 | Ga0265338_10000014 | 3300028800 | Bacteria | 378751 |
| 448 | Ga0265338_10005551 | 3300028800 | Bacteria | 16418 |
| 449 | Ga0265338_10037990 | 3300028800 | Bacteria | 4571 |
| 450 | Ga0307511_10004718 | 3300030521 | Bacteria | 13934 |
| 451 | Ga0307511_10024288 | 3300030521 | Bacteria | 5621 |
| 452 | Ga0265320_10028747 | 3300031240 | Bacteria | 2884 |
| 453 | Ga0265325_10000001 | 3300031241 | Bacteria | 726814 |
| 454 | Ga0265325_10003363 | 3300031241 | Bacteria | 10494 |
| 455 | Ga0265325_10004801 | 3300031241 | Bacteria | 8465 |
| 456 | Ga0265340_10000584 | 3300031247 | Bacteria | 20240 |
| 457 | Ga0265340_10023840 | 3300031247 | Bacteria | 3114 |
| 458 | Ga0265340_10036101 | 3300031247 | Bacteria | 2451 |
| 459 | Ga0265340_10050005 | 3300031247 | Bacteria | 2029 |
| 460 | Ga0265339_10000135 | 3300031249 | Bacteria | 60639 |
| 461 | Ga0265339_10000912 | 3300031249 | Bacteria | 22718 |
| 462 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 463 | Ga0265331_10000419 | 3300031250 | Bacteria | 43019 |
| 464 | Ga0265331_10016760 | 3300031250 | Bacteria | 3839 |
| 465 | Ga0265327_10000074 | 3300031251 | Bacteria | 214435 |
| 466 | Ga0265316_10110635 | 3300031344 | Bacteria | 2080 |
| 467 | Ga0307513_10086621 | 3300031456 | Bacteria | 3210 |
| 468 | Ga0307513_10102065 | 3300031456 | Bacteria | 2888 |
| 469 | Ga0307509_10000013 | 3300031507 | Bacteria | 283027 |
| 470 | Ga0307509_10000500 | 3300031507 | Bacteria | 66483 |
| 471 | Ga0307408_100338802 | 3300031548 | Bacteria | 1272 |
| 472 | Ga0265313_10003117 | 3300031595 | Bacteria | 13696 |
| 473 | Ga0265313_10009233 | 3300031595 | Bacteria | 6427 |
| 474 | Ga0265313_10086774 | 3300031595 | Bacteria | 1412 |
| 475 | Ga0307508_10027770 | 3300031616 | Bacteria | 5121 |
| 476 | Ga0307508_10104370 | 3300031616 | Bacteria | 2431 |
| 477 | Ga0316575_10000104 | 3300031665 | Bacteria | 21155 |
| 478 | Ga0316575_10003913 | 3300031665 | Bacteria | 5205 |
| 479 | Ga0316575_10007114 | 3300031665 | Bacteria | 4048 |
| 480 | Ga0316575_10014560 | 3300031665 | Bacteria | 2955 |
| 481 | Ga0316579_10001369 | 3300031691 | Bacteria | 8834 |
| 482 | Ga0316579_10008387 | 3300031691 | Bacteria | 4305 |
| 483 | Ga0316579_10026682 | 3300031691 | Bacteria | 2617 |
| 484 | Ga0316579_10093212 | 3300031691 | Bacteria | 1439 |
| 485 | Ga0265314_10000370 | 3300031711 | Bacteria | 61431 |
| 486 | Ga0265314_10019879 | 3300031711 | Bacteria | 5193 |
| 487 | Ga0265314_10036733 | 3300031711 | Bacteria | 3556 |
| 488 | Ga0265314_10043142 | 3300031711 | Bacteria | 3210 |
| 489 | Ga0265342_10016644 | 3300031712 | Bacteria | 4799 |
| 490 | Ga0265342_10040876 | 3300031712 | Bacteria | 2809 |
| 491 | Ga0265342_10076603 | 3300031712 | Bacteria | 1939 |
| 492 | Ga0316576_10000424 | 3300031727 | Bacteria | 19508 |
| 493 | Ga0316576_10002167 | 3300031727 | Bacteria | 11079 |
| 494 | Ga0316576_10013535 | 3300031727 | Bacteria | 5428 |
| 495 | Ga0316576_10025772 | 3300031727 | Bacteria | 4119 |
| 496 | Ga0316576_10069422 | 3300031727 | Bacteria | 2598 |
| 497 | Ga0316576_10110088 | 3300031727 | Bacteria | 2064 |
| 498 | Ga0316578_10000074 | 3300031728 | Bacteria | 22557 |
| 499 | Ga0316578_10008537 | 3300031728 | Bacteria | 5221 |
| 500 | Ga0316578_10048873 | 3300031728 | Bacteria | 2471 |
| 501 | Ga0316578_10079150 | 3300031728 | Bacteria | 1954 |
| 502 | Ga0307516_10000095 | 3300031730 | Bacteria | 99115 |
| 503 | Ga0307516_10000099 | 3300031730 | Bacteria | 97472 |
| 504 | Ga0307405_10014321 | 3300031731 | Bacteria | 4260 |
| 505 | Ga0307405_10101810 | 3300031731 | Bacteria | 1928 |
| 506 | Ga0316577_10000480 | 3300031733 | Bacteria | 15760 |
| 507 | Ga0316577_10003948 | 3300031733 | Bacteria | 7581 |
| 508 | Ga0316577_10018265 | 3300031733 | Bacteria | 3877 |
| 509 | Ga0316577_10018907 | 3300031733 | Bacteria | 3812 |
| 510 | Ga0316577_10035412 | 3300031733 | Bacteria | 2790 |
| 511 | Ga0316577_10035878 | 3300031733 | Bacteria | 2772 |
| 512 | Ga0316577_10045969 | 3300031733 | Bacteria | 2439 |
| 513 | Ga0307413_10047983 | 3300031824 | Bacteria | 2550 |
| 514 | Ga0307406_10131094 | 3300031901 | Bacteria | 1760 |
| 515 | Ga0307412_10023232 | 3300031911 | Bacteria | 3812 |
| 516 | Ga0307416_100056284 | 3300032002 | Bacteria | 3173 |
| 517 | Ga0307414_10020609 | 3300032004 | Bacteria | 4113 |
| 518 | Ga0307411_10015885 | 3300032005 | Bacteria | 4244 |
| 519 | Ga0307415_100091431 | 3300032126 | Bacteria | 2204 |
| 520 | Ga0316583_10001545 | 3300032133 | Bacteria | 7735 |
| 521 | Ga0316583_10005386 | 3300032133 | Bacteria | 4593 |
| 522 | Ga0316583_10063597 | 3300032133 | Bacteria | 1292 |
| 523 | Ga0316585_10010759 | 3300032137 | Bacteria | 2689 |
| 524 | Ga0316580_10008574 | 3300032139 | Bacteria | 3064 |
| 525 | Ga0316593_10007913 | 3300032168 | Bacteria | 2940 |
| 526 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 527 | Ga0316592_1004221 | 3300033524 | Bacteria | 2656 |
| 528 | Ga0316586_1001568 | 3300033527 | Bacteria | 2664 |
| 529 | Ga0316586_1001613 | 3300033527 | Bacteria | 2639 |
| 530 | Ga0316588_1004434 | 3300033528 | Bacteria | 2658 |
| 531 | Ga0316587_1001975 | 3300033529 | Bacteria | 2658 |
| 532 | Ga0373944_0004452 | 3300035089 | Bacteria | 3650 |
| 533 | Ga0373951_0020609 | 3300035091 | Bacteria | 1510 |
| 534 | Ga0373952_0010918 | 3300035092 | Bacteria | 1764 |
| 535 | Ga0373936_0003172 | 3300035113 | Bacteria | 6155 |
| 536 | Ga0373939_0002211 | 3300035114 | Bacteria | 4605 |
| 537 | Ga0373939_0033072 | 3300035114 | Bacteria | 1507 |
| 538 | Ga0373960_0008324 | 3300035121 | Bacteria | 2483 |
| 539 | Ga0373943_0009757 | 3300035170 | Bacteria | 4299 |
| 540 | Ga0373946_0023948 | 3300035171 | Bacteria | 2389 |
| 541 | Ga0373955_0032738 | 3300035172 | Bacteria | 2732 |
| 542 | Ga0373942_0004075 | 3300035207 | Bacteria | 3408 |
| 543 | Ga0373961_0029968 | 3300035241 | Bacteria | 1510 |
| 544 | Ga0316574_0001352 | 3300035398 | Bacteria | 11538 |
| 545 | Ga0316574_0047504 | 3300035398 | Bacteria | 2664 |
| 546 | Ga0316574_0051815 | 3300035398 | Bacteria | 2558 |
| 547 | Ga0316574_0057347 | 3300035398 | Bacteria | 2438 |
| 548 | Ga0373931_0000492 | 3300035691 | Bacteria | 16117 |
| 549 | Ga0373931_0005836 | 3300035691 | Bacteria | 5728 |
| 550 | Ga0373935_0033002 | 3300035692 | Bacteria | 3220 |
| 551 | Ga0373935_0190318 | 3300035692 | Bacteria | 1413 |
| 552 | Ga0373927_0000452 | 3300035695 | Bacteria | 31376 |
| 553 | Ga0373927_0027785 | 3300035695 | Bacteria | 3694 |
| 554 | Ga0373927_0068113 | 3300035695 | Bacteria | 2303 |
| 555 | Ga0373933_0027534 | 3300035724 | Bacteria | 3274 |
| 556 | Ga0373947_0019131 | 3300035725 | Bacteria | 3947 |
| 557 | Ga0373937_0037105 | 3300036401 | Bacteria | 4441 |
| 558 | Ga0373937_0040197 | 3300036401 | Bacteria | 4263 |
| 559 | Ga0373937_0218055 | 3300036401 | Bacteria | 1796 |
| 560 | Ga0373937_0231484 | 3300036401 | Bacteria | 1740 |
| 561 | Ga0316582_0000536 | 3300036647 | Bacteria | 14479 |
| 562 | Ga0316582_0005483 | 3300036647 | Bacteria | 6541 |
| 563 | Ga0316582_0009637 | 3300036647 | Bacteria | 5250 |
| 564 | Ga0316582_0019403 | 3300036647 | Bacteria | 3978 |
| 565 | Ga0316582_0029095 | 3300036647 | Bacteria | 3354 |
| 566 | Ga0316582_0043414 | 3300036647 | Bacteria | 2820 |
| 567 | Ga0316582_0100342 | 3300036647 | Bacteria | 1916 |
| 568 | Ga0316582_0153266 | 3300036647 | Unclassified | 1559 |
| 569 | Ga0316584_0012961 | 3300036712 | Bacteria | 5890 |
| 570 | Ga0316584_0021157 | 3300036712 | Bacteria | 4723 |
| 571 | Ga0316584_0025801 | 3300036712 | Unclassified | 4313 |
| 572 | Ga0316584_0043726 | 3300036712 | Bacteria | 3341 |
| 573 | Ga0316584_0113768 | 3300036712 | Bacteria | 2024 |
| 574 | Ga0316584_0118285 | 3300036712 | Bacteria | 1981 |
| 575 | Ga0316584_0148136 | 3300036712 | Bacteria | 1748 |
| 576 | Ga0373925_0000173 | 3300037068 | Bacteria | 69877 |
| 577 | Ga0373925_0192651 | 3300037068 | Bacteria | 1618 |
| 578 | Ga0395900_0052656 | 3300037418 | Bacteria | 4190 |
| 579 | Ga0395900_0067352 | 3300037418 | Bacteria | 3678 |
| 580 | Ga0395900_0242719 | 3300037418 | Bacteria | 1806 |
| 581 | Ga0395898_0006599 | 3300037466 | Bacteria | 12370 |
| 582 | Ga0395898_0119619 | 3300037466 | Bacteria | 2523 |
| 583 | Ga0395905_0000042 | 3300037471 | Bacteria | 247894 |
| 584 | Ga0316581_0001321 | 3300037588 | Bacteria | 5502 |
| 585 | Ga0316581_0001549 | 3300037588 | Bacteria | 5219 |
| 586 | Ga0316581_0010798 | 3300037588 | Bacteria | 2540 |
| 587 | Ga0316581_0012137 | 3300037588 | Bacteria | 2422 |
| 588 | Ga0316581_0037575 | 3300037588 | Bacteria | 1471 |
| 589 | Ga0436364_0410618 | 3300037853 | Bacteria | 84995 |
| 590 | Ga0436364_0700727 | 3300037853 | Bacteria | 4107 |
| 591 | Ga0436364_1101563 | 3300037853 | Bacteria | 8996 |
| 592 | Ga0395901_0003446 | 3300038443 | Bacteria | 15944 |
| 593 | Ga0395901_0023659 | 3300038443 | Bacteria | 6298 |
| 594 | Ga0395901_0247044 | 3300038443 | Bacteria | 1860 |
| 595 | Ga0395901_0267845 | 3300038443 | Bacteria | 1777 |
| 596 | Ga0237819_02732 | 3300038705 | Bacteria | 3406 |
| 597 | Ga0400490_09265 | 3300038726 | Bacteria | 2477 |
| 598 | Ga0400490_14729 | 3300038726 | Bacteria | 1672 |
| 599 | Ga0400488_28709 | 3300038741 | Bacteria | 1384 |
| 600 | Ga0400488_55998 | 3300038741 | Bacteria | 3672 |
| 601 | Ga0400483_101319 | 3300039062 | Bacteria | 11553 |
| 602 | Ga0400489_47030 | 3300039093 | Bacteria | 10620 |
| 603 | Ga0400489_67259 | 3300039093 | Bacteria | 31816 |
| 604 | Ga0400489_72336 | 3300039093 | Bacteria | 113152 |
| 605 | Ga0400489_83150 | 3300039093 | Bacteria | 1372 |
| 606 | Ga0436365_0131305 | 3300039437 | Bacteria | 51128 |
| 607 | Ga0436365_0411002 | 3300039437 | Bacteria | 12397 |
| 608 | Ga0436365_0585577 | 3300039437 | Bacteria | 67545 |
| 609 | Ga0436365_1518071 | 3300039437 | Bacteria | 2768 |
| 610 | Ga0436363_0717745 | 3300039450 | Bacteria | 3865 |
| 611 | Ga0439436_0006472 | 3300041404 | Bacteria | 3595 |
| 612 | Ga0439438_000037 | 3300041405 | Bacteria | 66914 |
| 613 | Ga0439447_000082 | 3300041407 | Bacteria | 33762 |
| 614 | Ga0439432_031639 | 3300042006 | Bacteria | 1710 |
| 615 | Ga0439449_0002362 | 3300042007 | Bacteria | 7391 |
| 616 | Ga0439451_000016 | 3300042009 | Bacteria | 40219 |
| 617 | Ga0439434_0015057 | 3300042435 | Bacteria | 2304 |
| 618 | Ga0439435_0040848 | 3300042436 | Bacteria | 1297 |
| 619 | Ga0451577_0029064 | 3300042876 | Bacteria | 4998 |
| 620 | Ga0453683_0004087 | 3300044673 | Bacteria | 10489 |
| 621 | Ga0453683_0070467 | 3300044673 | Bacteria | 2187 |
| 622 | Ga0466963_0104316 | 3300044694 | Bacteria | 1942 |
| 623 | Ga0453684_0396898 | 3300044712 | Bacteria | 1545 |
| 624 | Ga0451576_0000492 | 3300045051 | Bacteria | 87364 |
| 625 | Ga0466967_0082680 | 3300045976 | Bacteria | 2902 |
| 626 | Ga0495617_038475 | 3300046452 | Bacteria | 1600 |
| 627 | Ga0495627_000901 | 3300046453 | Bacteria | 20743 |
| 628 | Ga0495627_012316 | 3300046453 | Bacteria | 3041 |
| 629 | Ga0495603_0080442 | 3300046455 | Bacteria | 1910 |
| 630 | Ga0495629_0028809 | 3300046459 | Bacteria | 3942 |
| 631 | Ga0495629_0149057 | 3300046459 | Bacteria | 1626 |
| 632 | Ga0495638_0000016 | 3300046460 | Bacteria | 396505 |
| 633 | Ga0495638_0000351 | 3300046460 | Bacteria | 57664 |
| 634 | Ga0495638_0000672 | 3300046460 | Bacteria | 37144 |
| 635 | Ga0495651_0154315 | 3300046462 | Bacteria | 1652 |
| 636 | Ga0495650_0000007 | 3300046471 | Bacteria | 718072 |
| 637 | Ga0495580_0000006 | 3300046472 | Bacteria | 105024 |
| 638 | Ga0495580_0002873 | 3300046472 | Bacteria | 14828 |
| 639 | Ga0495580_0006825 | 3300046472 | Bacteria | 9245 |
| 640 | Ga0495580_0007177 | 3300046472 | Bacteria | 8969 |
| 641 | Ga0495580_0013230 | 3300046472 | Bacteria | 6307 |
| 642 | Ga0495580_0189012 | 3300046472 | Bacteria | 1421 |
| 643 | Ga0495639_0074889 | 3300046475 | Bacteria | 1569 |
| 644 | Ga0495664_0007589 | 3300046477 | Bacteria | 6029 |
| 645 | Ga0495584_0018115 | 3300046491 | Bacteria | 3580 |
| 646 | Ga0495594_0013880 | 3300046499 | Bacteria | 4214 |
| 647 | Ga0495596_0001169 | 3300046500 | Bacteria | 15394 |
| 648 | Ga0495583_0000024 | 3300046506 | Bacteria | 274122 |
| 649 | Ga0495583_0000094 | 3300046506 | Bacteria | 153549 |
| 650 | Ga0495583_0003214 | 3300046506 | Bacteria | 12787 |
| 651 | Ga0495606_0005968 | 3300046507 | Bacteria | 11425 |
| 652 | Ga0495610_0000029 | 3300046512 | Bacteria | 271137 |
| 653 | Ga0495610_0000057 | 3300046512 | Bacteria | 138069 |
| 654 | Ga0495610_0001407 | 3300046512 | Bacteria | 21348 |
| 655 | Ga0495610_0023433 | 3300046512 | Bacteria | 3356 |
| 656 | Ga0495610_0033100 | 3300046512 | Bacteria | 2675 |
| 657 | Ga0495616_0000032 | 3300046513 | Bacteria | 130692 |
| 658 | Ga0495616_0000122 | 3300046513 | Bacteria | 67299 |
| 659 | Ga0495616_0067526 | 3300046513 | Bacteria | 1738 |
| 660 | Ga0495620_0000079 | 3300046515 | Bacteria | 80460 |
| 661 | Ga0495631_0003669 | 3300046518 | Bacteria | 8382 |
| 662 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 663 | Ga0495632_0000440 | 3300046519 | Bacteria | 39608 |
| 664 | Ga0495632_0027463 | 3300046519 | Bacteria | 2981 |
| 665 | Ga0495632_0091752 | 3300046519 | Bacteria | 1439 |
| 666 | Ga0495637_0000108 | 3300046520 | Bacteria | 60028 |
| 667 | Ga0495637_0007300 | 3300046520 | Bacteria | 5493 |
| 668 | Ga0495637_0007592 | 3300046520 | Bacteria | 5366 |
| 669 | Ga0495637_0010009 | 3300046520 | Bacteria | 4605 |
| 670 | Ga0495637_0026018 | 3300046520 | Bacteria | 2633 |
| 671 | Ga0495643_0000020 | 3300046522 | Bacteria | 294973 |
| 672 | Ga0495643_0000039 | 3300046522 | Bacteria | 235175 |
| 673 | Ga0495643_0001980 | 3300046522 | Bacteria | 17167 |
| 674 | Ga0495643_0006160 | 3300046522 | Bacteria | 7966 |
| 675 | Ga0495643_0015680 | 3300046522 | Bacteria | 4471 |
| 676 | Ga0495643_0018907 | 3300046522 | Bacteria | 3991 |
| 677 | Ga0495648_0000013 | 3300046524 | Bacteria | 289090 |
| 678 | Ga0495648_0000094 | 3300046524 | Bacteria | 110608 |
| 679 | Ga0495648_0000120 | 3300046524 | Bacteria | 94692 |
| 680 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 681 | Ga0495663_0006255 | 3300046525 | Bacteria | 3287 |
| 682 | Ga0495666_0017567 | 3300046526 | Bacteria | 3562 |
| 683 | Ga0495654_0000116 | 3300046530 | Bacteria | 90109 |
| 684 | Ga0495654_0001448 | 3300046530 | Bacteria | 16298 |
| 685 | Ga0495665_0031297 | 3300046531 | Bacteria | 2847 |
| 686 | Ga0495586_0129046 | 3300046535 | Bacteria | 1415 |
| 687 | Ga0495597_0001842 | 3300046542 | Bacteria | 14497 |
| 688 | Ga0495597_0010048 | 3300046542 | Bacteria | 4644 |
| 689 | Ga0495597_0034020 | 3300046542 | Bacteria | 2304 |
| 690 | Ga0495622_0000513 | 3300046557 | Bacteria | 23837 |
| 691 | Ga0495622_0001984 | 3300046557 | Bacteria | 10014 |
| 692 | Ga0495622_0009640 | 3300046557 | Bacteria | 4465 |
| 693 | Ga0495633_0000376 | 3300046558 | Bacteria | 47585 |
| 694 | Ga0495633_0000712 | 3300046558 | Bacteria | 30211 |
| 695 | Ga0495633_0003559 | 3300046558 | Bacteria | 10307 |
| 696 | Ga0495633_0010455 | 3300046558 | Bacteria | 5062 |
| 697 | Ga0495633_0109472 | 3300046558 | Bacteria | 1281 |
| 698 | Ga0495668_0000019 | 3300046616 | Bacteria | 416042 |
| 699 | Ga0495668_0002477 | 3300046616 | Bacteria | 15159 |
| 700 | Ga0495668_0004380 | 3300046616 | Bacteria | 10063 |
| 701 | Ga0495668_0008371 | 3300046616 | Bacteria | 6468 |
| 702 | Ga0495668_0009371 | 3300046616 | Bacteria | 6018 |
| 703 | Ga0495668_0021325 | 3300046616 | Bacteria | 3717 |
| 704 | Ga0495668_0038425 | 3300046616 | Bacteria | 2674 |
| 705 | Ga0495668_0094317 | 3300046616 | Bacteria | 1638 |
| 706 | Ga0495668_0123051 | 3300046616 | Bacteria | 1419 |
| 707 | Ga0495611_0045036 | 3300046648 | Bacteria | 1975 |
| 708 | Ga0495625_0004722 | 3300046660 | Bacteria | 12757 |
| 709 | Ga0495625_0007110 | 3300046660 | Bacteria | 9830 |
| 710 | Ga0495625_0089921 | 3300046660 | Bacteria | 2125 |
| 711 | Ga0495657_0122744 | 3300046675 | Bacteria | 1634 |
| 712 | Ga0495599_0149726 | 3300046678 | Bacteria | 1446 |
| 713 | Ga0495658_0000506 | 3300046683 | Bacteria | 21468 |
| 714 | Ga0495669_0019399 | 3300046684 | Bacteria | 2935 |
| 715 | Ga0495669_0029325 | 3300046684 | Bacteria | 2412 |
| 716 | Ga0495670_0010313 | 3300046691 | Bacteria | 4590 |
| 717 | Ga0495671_0000016 | 3300046692 | Bacteria | 294821 |
| 718 | Ga0495671_0000018 | 3300046692 | Bacteria | 291470 |
| 719 | Ga0495671_0005174 | 3300046692 | Bacteria | 7676 |
| 720 | Ga0495671_0005379 | 3300046692 | Bacteria | 7503 |
| 721 | Ga0495671_0014146 | 3300046692 | Bacteria | 4299 |
| 722 | Ga0495671_0030168 | 3300046692 | Bacteria | 2779 |
| 723 | Ga0495671_0040996 | 3300046692 | Bacteria | 2333 |
| 724 | Ga0495671_0041953 | 3300046692 | Bacteria | 2302 |
| 725 | Ga0495649_0011295 | 3300046694 | Bacteria | 5245 |
| 726 | Ga0495589_0007335 | 3300046794 | Bacteria | 5777 |
| 727 | Ga0495604_0035969 | 3300047317 | Bacteria | 3907 |
| 728 | Ga0495672_0000299 | 3300047320 | Bacteria | 67952 |
| 729 | Ga0495672_0003601 | 3300047320 | Bacteria | 13159 |
| 730 | Ga0495672_0003684 | 3300047320 | Bacteria | 12953 |
| 731 | Ga0495680_0039616 | 3300047322 | Bacteria | 3757 |
| 732 | Ga0495680_0145014 | 3300047322 | Bacteria | 1735 |
| 733 | Ga0495675_0037437 | 3300047444 | Bacteria | 3090 |
| 734 | Ga0495679_039048 | 3300047446 | Bacteria | 1482 |
| 735 | Ga0495673_0000082 | 3300047469 | Bacteria | 199141 |
| 736 | Ga0495673_0000205 | 3300047469 | Bacteria | 89721 |
| 737 | Ga0495673_0000233 | 3300047469 | Bacteria | 81103 |
| 738 | Ga0495673_0000241 | 3300047469 | Bacteria | 77386 |
| 739 | Ga0495673_0000435 | 3300047469 | Bacteria | 46845 |
| 740 | Ga0495681_0005243 | 3300047470 | Bacteria | 8706 |
| 741 | Ga0495684_0140472 | 3300047471 | Bacteria | 1811 |
| 742 | Ga0495686_0001872 | 3300047472 | Bacteria | 21070 |
| 743 | Ga0495686_0004265 | 3300047472 | Bacteria | 11855 |
| 744 | Ga0495686_0033589 | 3300047472 | Bacteria | 3311 |
| 745 | Ga0495615_0000011 | 3300048090 | Bacteria | 65444 |
| 746 | Ga0495615_0000013 | 3300048090 | Bacteria | 61661 |
| 747 | Ga0495615_0000173 | 3300048090 | Bacteria | 16012 |
| 748 | Ga0496100_0022209 | 3300048903 | Bacteria | 3837 |
| 749 | Ga0496100_0086461 | 3300048903 | Bacteria | 2130 |
| 750 | Ga0496101_0049872 | 3300048904 | Bacteria | 3012 |
| 751 | Ga0496101_0060109 | 3300048904 | Bacteria | 2757 |
| 752 | Ga0496102_0003237 | 3300048905 | Bacteria | 13815 |
| 753 | Ga0496102_0013184 | 3300048905 | Bacteria | 7151 |
| 754 | Ga0496102_0046931 | 3300048905 | Bacteria | 3924 |
| 755 | Ga0496102_0257001 | 3300048905 | Bacteria | 1647 |
| 756 | Ga0496103_0077727 | 3300048906 | Bacteria | 2084 |
| 757 | Ga0496103_0082740 | 3300048906 | Bacteria | 2020 |
| 758 | Ga0496104_0014316 | 3300048907 | Bacteria | 7163 |
| 759 | Ga0496104_0015386 | 3300048907 | Bacteria | 6928 |
| 760 | Ga0496104_0037396 | 3300048907 | Bacteria | 4539 |
| 761 | Ga0496104_0046656 | 3300048907 | Bacteria | 4081 |
| 762 | Ga0496104_0080458 | 3300048907 | Bacteria | 3106 |
| 763 | Ga0496105_0002153 | 3300048908 | Bacteria | 14259 |
| 764 | Ga0496105_0019377 | 3300048908 | Bacteria | 5487 |
| 765 | Ga0496105_0049000 | 3300048908 | Bacteria | 3487 |
| 766 | Ga0496105_0051492 | 3300048908 | Bacteria | 3402 |
| 767 | Ga0496105_0057122 | 3300048908 | Bacteria | 3223 |
| 768 | Ga0496105_0165458 | 3300048908 | Bacteria | 1814 |
| 769 | Ga0496106_0001275 | 3300048909 | Bacteria | 18881 |
| 770 | Ga0496106_0001509 | 3300048909 | Bacteria | 17498 |
| 771 | Ga0496106_0049184 | 3300048909 | Bacteria | 3176 |
| 772 | Ga0496106_0088657 | 3300048909 | Bacteria | 2385 |
| 773 | Ga0496107_0000089 | 3300048910 | Bacteria | 43926 |
| 774 | Ga0496107_0001523 | 3300048910 | Bacteria | 14398 |
| 775 | Ga0496107_0019005 | 3300048910 | Bacteria | 4846 |
| 776 | Ga0496107_0067756 | 3300048910 | Bacteria | 2590 |
| 777 | Ga0496107_0078243 | 3300048910 | Bacteria | 2409 |
| 778 | Ga0496108_0025050 | 3300048911 | Bacteria | 4915 |
| 779 | Ga0496108_0033787 | 3300048911 | Bacteria | 4248 |
| 780 | Ga0496108_0084868 | 3300048911 | Bacteria | 2688 |
| 781 | Ga0496109_0031198 | 3300048912 | Bacteria | 4781 |
| 782 | Ga0496109_0055283 | 3300048912 | Bacteria | 3621 |
| 783 | Ga0496109_0077236 | 3300048912 | Bacteria | 3064 |
| 784 | Ga0496110_0040365 | 3300048913 | Bacteria | 4067 |
| 785 | Ga0496110_0094885 | 3300048913 | Bacteria | 2671 |
| 786 | Ga0496110_0109048 | 3300048913 | Bacteria | 2486 |
| 787 | Ga0496110_0123214 | 3300048913 | Bacteria | 2337 |
| 788 | Ga0496111_0024809 | 3300048914 | Bacteria | 4229 |
| 789 | Ga0496111_0109752 | 3300048914 | Bacteria | 2031 |
| 790 | Ga0496112_0006789 | 3300048915 | Bacteria | 10089 |
| 791 | Ga0496112_0122062 | 3300048915 | Bacteria | 2576 |
| 792 | Ga0496113_0043334 | 3300048916 | Bacteria | 3329 |
| 793 | Ga0496113_0068605 | 3300048916 | Bacteria | 2691 |
| 794 | Ga0496114_0001674 | 3300048917 | Bacteria | 16831 |
| 795 | Ga0496114_0026423 | 3300048917 | Bacteria | 4752 |
| 796 | Ga0496115_0013071 | 3300048918 | Bacteria | 6269 |
| 797 | Ga0496115_0018415 | 3300048918 | Bacteria | 5362 |
| 798 | Ga0496115_0020700 | 3300048918 | Bacteria | 5075 |
| 799 | Ga0496115_0047939 | 3300048918 | Bacteria | 3417 |
| 800 | Ga0496115_0078234 | 3300048918 | Bacteria | 2690 |
| 801 | Ga0496121_0000854 | 3300048924 | Bacteria | 55170 |
| 802 | Ga0496121_0001004 | 3300048924 | Bacteria | 50403 |
| 803 | Ga0496121_0001267 | 3300048924 | Bacteria | 43589 |
| 804 | Ga0496122_0003350 | 3300048925 | Bacteria | 21138 |
| 805 | Ga0496122_0003557 | 3300048925 | Bacteria | 20365 |
| 806 | Ga0496122_0071294 | 3300048925 | Bacteria | 2477 |
| 807 | Ga0496123_0001182 | 3300048926 | Bacteria | 38436 |
| 808 | Ga0496123_0002402 | 3300048926 | Bacteria | 23389 |
| 809 | Ga0496124_0018457 | 3300048927 | Bacteria | 6532 |
| 810 | Ga0496124_0075076 | 3300048927 | Bacteria | 2793 |
| 811 | Ga0496125_0003664 | 3300048928 | Bacteria | 18356 |
| 812 | Ga0496125_0044969 | 3300048928 | Bacteria | 3724 |
| 813 | Ga0496126_0006009 | 3300048929 | Bacteria | 13637 |
| 814 | Ga0495678_001389 | 3300049459 | Bacteria | 19255 |
| 815 | Ga0495682_0000881 | 3300049460 | Bacteria | 18617 |
| 816 | Ga0495682_0012476 | 3300049460 | Bacteria | 3258 |
| 817 | Ga0495682_0050036 | 3300049460 | Bacteria | 1522 |
| 818 | Ga0501031_0026790 | 3300049568 | Bacteria | 3758 |
| 819 | Ga0501031_0074582 | 3300049568 | Bacteria | 2209 |
| 820 | Ga0501032_0009322 | 3300049569 | Bacteria | 7109 |
| 821 | Ga0501034_0058256 | 3300049571 | Bacteria | 3882 |
| 822 | Ga0501034_0088235 | 3300049571 | Bacteria | 3100 |
| 823 | Ga0501034_0127005 | 3300049571 | Bacteria | 2535 |
| 824 | Ga0501034_0169827 | 3300049571 | Bacteria | 2149 |
| 825 | Ga0501036_0016246 | 3300049572 | Bacteria | 6217 |
| 826 | Ga0501037_0056217 | 3300049573 | Bacteria | 2875 |
| 827 | Ga0501039_0266125 | 3300049575 | Bacteria | 1347 |
| 828 | Ga0501042_0070844 | 3300049578 | Bacteria | 2494 |
| 829 | Ga0501043_0061676 | 3300049579 | Bacteria | 2944 |
| 830 | Ga0501046_0089984 | 3300049580 | Bacteria | 2362 |
| 831 | Ga0501047_0000199 | 3300049581 | Bacteria | 72531 |
| 832 | Ga0501047_0026120 | 3300049581 | Bacteria | 5617 |
| 833 | Ga0501047_0033365 | 3300049581 | Bacteria | 4969 |
| 834 | Ga0501047_0060011 | 3300049581 | Bacteria | 3672 |
| 835 | Ga0501047_0066696 | 3300049581 | Bacteria | 3469 |
| 836 | Ga0501047_0326230 | 3300049581 | Bacteria | 1374 |
| 837 | Ga0501047_0372584 | 3300049581 | Bacteria | 1263 |
| 838 | Ga0501048_0033468 | 3300049582 | Unclassified | 3713 |
| 839 | Ga0501067_0003209 | 3300049583 | Bacteria | 9011 |
| 840 | Ga0501067_0013312 | 3300049583 | Bacteria | 4555 |
| 841 | Ga0501070_0000157 | 3300049586 | Bacteria | 62720 |
| 842 | Ga0501070_0010829 | 3300049586 | Bacteria | 7704 |
| 843 | Ga0501070_0024895 | 3300049586 | Bacteria | 5019 |
| 844 | Ga0501070_0061913 | 3300049586 | Bacteria | 3100 |
| 845 | Ga0501072_0004693 | 3300049588 | Bacteria | 10410 |
| 846 | Ga0501073_0003405 | 3300049589 | Bacteria | 11962 |
| 847 | Ga0501073_0025163 | 3300049589 | Bacteria | 4271 |
| 848 | Ga0501075_0127330 | 3300049591 | Bacteria | 1939 |
| 849 | Ga0501238_008224 | 3300049671 | Bacteria | 1368 |
| 850 | Ga0501249_000144 | 3300049679 | Bacteria | 22227 |
| 851 | Ga0501257_001956 | 3300049686 | Bacteria | 4294 |
| 852 | Ga0501079_0033972 | 3300049741 | Bacteria | 3924 |
| 853 | Ga0501079_0046269 | 3300049741 | Bacteria | 3357 |
| 854 | Ga0501079_0179672 | 3300049741 | Bacteria | 1651 |
| 855 | Ga0501080_0000976 | 3300049742 | Bacteria | 23417 |
| 856 | Ga0501080_0010691 | 3300049742 | Bacteria | 8397 |
| 857 | Ga0501080_0012290 | 3300049742 | Bacteria | 7843 |
| 858 | Ga0501080_0064523 | 3300049742 | Bacteria | 3406 |
| 859 | Ga0501080_0222608 | 3300049742 | Bacteria | 1726 |
| 860 | Ga0501080_0260355 | 3300049742 | Bacteria | 1580 |
| 861 | Ga0501035_0001970 | 3300049822 | Bacteria | 20561 |
| 862 | Ga0501035_0009390 | 3300049822 | Bacteria | 9093 |
| 863 | Ga0501035_0173600 | 3300049822 | Bacteria | 1861 |
| 864 | Ga0501044_0001051 | 3300049823 | Bacteria | 33192 |
| 865 | Ga0501044_0003875 | 3300049823 | Bacteria | 16766 |
| 866 | Ga0501044_0015912 | 3300049823 | Bacteria | 8095 |
| 867 | Ga0501044_0019682 | 3300049823 | Bacteria | 7214 |
| 868 | Ga0501044_0039045 | 3300049823 | Bacteria | 4955 |
| 869 | Ga0501044_0040270 | 3300049823 | Bacteria | 4870 |
| 870 | Ga0501044_0150811 | 3300049823 | Bacteria | 2307 |
| 871 | nmdc:mga03683_21577_c1 | 3300050489 | Bacteria | 2485 |
| 872 | nmdc:mga0yw44_64730_c1 | 3300050492 | Bacteria | 2251 |
| 873 | nmdc:mga0k408_1551_c1 | 3300050493 | Bacteria | 12396 |
| 874 | nmdc:mga0k408_502_c1 | 3300050493 | Bacteria | 21491 |
| 875 | nmdc:mga0k408_51160_c1 | 3300050493 | Bacteria | 2393 |
| 876 | nmdc:mga07m45_1182_c1 | 3300050496 | Bacteria | 11771 |
| 877 | nmdc:mga07m45_15563_c1 | 3300050496 | Bacteria | 4062 |
| 878 | nmdc:mga05p37_169892_c1 | 3300050507 | Bacteria | 2660 |
| 879 | nmdc:mga05p37_234048_c1 | 3300050507 | Unclassified | 2212 |
| 880 | nmdc:mga05p37_310846_c1 | 3300050507 | Bacteria | 1868 |
| 881 | nmdc:mga05p37_31537_c1 | 3300050507 | Bacteria | 6474 |
| 882 | nmdc:mga05p37_531968_c1 | 3300050507 | Bacteria | 1342 |
| 883 | nmdc:mga09592_108959_c1 | 3300050508 | Bacteria | 2376 |
| 884 | nmdc:mga09592_140223_c1 | 3300050508 | Bacteria | 2083 |
| 885 | nmdc:mga09592_244684_c1 | 3300050508 | Bacteria | 1554 |
| 886 | nmdc:mga0qj67_10651_c1 | 3300050509 | Bacteria | 6870 |
| 887 | nmdc:mga0qj67_32353_c1 | 3300050509 | Bacteria | 4078 |
| 888 | nmdc:mga06r32_13474_c1 | 3300050510 | Bacteria | 7408 |
| 889 | nmdc:mga06r32_139327_c1 | 3300050510 | Bacteria | 2402 |
| 890 | nmdc:mga06r32_14791_c1 | 3300050510 | Bacteria | 7081 |
| 891 | nmdc:mga06r32_38670_c1 | 3300050510 | Bacteria | 4522 |
| 892 | nmdc:mga06r32_48483_c1 | 3300050510 | Bacteria | 4060 |
| 893 | nmdc:mga08y16_119837_c1 | 3300050511 | Bacteria | 2739 |
| 894 | nmdc:mga08y16_218228_c1 | 3300050511 | Bacteria | 1975 |
| 895 | nmdc:mga08y16_24421_c1 | 3300050511 | Bacteria | 6379 |
| 896 | nmdc:mga08y16_54792_c1 | 3300050511 | Bacteria | 4167 |
| 897 | nmdc:mga08y16_68648_c1 | 3300050511 | Bacteria | 3696 |
| 898 | nmdc:mga0n895_17944_c1 | 3300050512 | Bacteria | 6540 |
| 899 | nmdc:mga0n895_19382_c1 | 3300050512 | Bacteria | 6322 |
| 900 | nmdc:mga0rr50_133828_c1 | 3300050513 | Bacteria | 1988 |
| 901 | nmdc:mga0rr50_16174_c1 | 3300050513 | Bacteria | 4946 |
| 902 | nmdc:mga0rr50_28349_c1 | 3300050513 | Bacteria | 3935 |
| 903 | nmdc:mga08x19_120624_c1 | 3300050514 | Bacteria | 1757 |
| 904 | nmdc:mga08x19_130136_c1 | 3300050514 | Bacteria | 1692 |
| 905 | nmdc:mga08x19_15_c1 | 3300050514 | Bacteria | 354290 |
| 906 | nmdc:mga08x19_4_c1 | 3300050514 | Bacteria | 335979 |
| 907 | nmdc:mga08x19_5876_c1 | 3300050514 | Bacteria | 7259 |
| 908 | nmdc:mga0a205_11907_c1 | 3300050515 | Bacteria | 8029 |
| 909 | nmdc:mga0sz30_429_c1 | 3300050516 | Bacteria | 15872 |
| 910 | Ga0500635_0000142 | 3300053080 | Bacteria | 40782 |
| 911 | Ga0500578_0000035 | 3300053086 | Bacteria | 136406 |
| 912 | Ga0500643_000957 | 3300053087 | Bacteria | 17922 |
| 913 | Ga0500643_007828 | 3300053087 | Bacteria | 4257 |
| 914 | Ga0500644_0000134 | 3300053088 | Bacteria | 45635 |
| 915 | Ga0500646_0004556 | 3300053090 | Bacteria | 3505 |
| 916 | Ga0500651_0122080 | 3300053093 | Bacteria | 1581 |
| 917 | Ga0500651_0122696 | 3300053093 | Bacteria | 1576 |
| 918 | Ga0500641_0012215 | 3300053096 | Bacteria | 3132 |
| 919 | Ga0500554_003364 | 3300053102 | Bacteria | 3266 |
| 920 | Ga0500555_000647 | 3300053103 | Bacteria | 13337 |
| 921 | Ga0500556_0000687 | 3300053104 | Bacteria | 20837 |
| 922 | Ga0500556_0021774 | 3300053104 | Bacteria | 2072 |
| 923 | Ga0500562_000364 | 3300053108 | Bacteria | 10937 |
| 924 | Ga0500562_004497 | 3300053108 | Bacteria | 3525 |
| 925 | Ga0500562_006796 | 3300053108 | Bacteria | 2885 |
| 926 | Ga0500562_012980 | 3300053108 | Bacteria | 2121 |
| 927 | Ga0500569_020140 | 3300053109 | Bacteria | 1745 |
| 928 | Ga0500592_000004 | 3300053116 | Bacteria | 128088 |
| 929 | Ga0500592_000016 | 3300053116 | Bacteria | 62404 |
| 930 | Ga0500592_002464 | 3300053116 | Bacteria | 2982 |
| 931 | Ga0500592_004414 | 3300053116 | Bacteria | 2243 |
| 932 | Ga0500593_000702 | 3300053117 | Bacteria | 12769 |
| 933 | Ga0500594_0000115 | 3300053118 | Bacteria | 22812 |
| 934 | Ga0500594_0005721 | 3300053118 | Bacteria | 2765 |
| 935 | Ga0500595_002983 | 3300053119 | Bacteria | 8051 |
| 936 | Ga0500607_001611 | 3300053121 | Bacteria | 19933 |
| 937 | Ga0500607_016588 | 3300053121 | Bacteria | 4219 |
| 938 | Ga0500607_031759 | 3300053121 | Bacteria | 2903 |
| 939 | Ga0500608_000004 | 3300053122 | Bacteria | 108109 |
| 940 | Ga0500608_000778 | 3300053122 | Bacteria | 11664 |
| 941 | Ga0500608_002848 | 3300053122 | Bacteria | 6392 |
| 942 | Ga0500614_002849 | 3300053123 | Bacteria | 3799 |
| 943 | Ga0500618_000110 | 3300053125 | Bacteria | 66025 |
| 944 | Ga0500642_0000408 | 3300053130 | Bacteria | 14103 |
| 945 | Ga0500642_0013154 | 3300053130 | Bacteria | 3031 |
| 946 | Ga0500655_003243 | 3300053133 | Bacteria | 2945 |
| 947 | Ga0500658_0001807 | 3300053134 | Bacteria | 8446 |
| 948 | Ga0500658_0026094 | 3300053134 | Bacteria | 2249 |
| 949 | Ga0500658_0036406 | 3300053134 | Bacteria | 1952 |
| 950 | Ga0500559_0000055 | 3300053136 | Bacteria | 89392 |
| 951 | Ga0500559_0002897 | 3300053136 | Bacteria | 8639 |
| 952 | Ga0500559_0004196 | 3300053136 | Bacteria | 6909 |
| 953 | Ga0500564_000277 | 3300053138 | Bacteria | 14194 |
| 954 | Ga0500564_010247 | 3300053138 | Bacteria | 4105 |
| 955 | Ga0500568_0000019 | 3300053139 | Bacteria | 195696 |
| 956 | Ga0500590_000885 | 3300053148 | Bacteria | 11340 |
| 957 | Ga0500604_0000196 | 3300053151 | Bacteria | 17280 |
| 958 | Ga0500604_0002657 | 3300053151 | Bacteria | 4862 |
| 959 | Ga0500604_0005332 | 3300053151 | Bacteria | 3393 |
| 960 | Ga0500616_0002247 | 3300053153 | Bacteria | 16514 |
| 961 | Ga0500616_0028952 | 3300053153 | Bacteria | 3050 |
| 962 | Ga0500622_0000474 | 3300053156 | Bacteria | 37843 |
| 963 | Ga0500622_0002770 | 3300053156 | Bacteria | 12338 |
| 964 | Ga0500622_0022106 | 3300053156 | Bacteria | 3373 |
| 965 | Ga0500622_0023914 | 3300053156 | Bacteria | 3234 |
| 966 | Ga0500624_000094 | 3300053157 | Bacteria | 43313 |
| 967 | Ga0500624_000220 | 3300053157 | Bacteria | 21139 |
| 968 | Ga0500624_005835 | 3300053157 | Bacteria | 1650 |
| 969 | Ga0500627_0000044 | 3300053158 | Bacteria | 62047 |
| 970 | Ga0500627_0000340 | 3300053158 | Bacteria | 12663 |
| 971 | Ga0500627_0000454 | 3300053158 | Bacteria | 11112 |
| 972 | Ga0500627_0027131 | 3300053158 | Bacteria | 2368 |
| 973 | Ga0500639_016078 | 3300053163 | Bacteria | 3944 |
| 974 | Ga0500639_067787 | 3300053163 | Bacteria | 1825 |
| 975 | Ga0500636_0000048 | 3300053177 | Bacteria | 57866 |
| 976 | Ga0500636_0005629 | 3300053177 | Bacteria | 7159 |
| 977 | Ga0500636_0009494 | 3300053177 | Bacteria | 5655 |
| 978 | Ga0500636_0011315 | 3300053177 | Bacteria | 5223 |
| 979 | Ga0500637_0000199 | 3300053178 | Bacteria | 22445 |
| 980 | Ga0500637_0000276 | 3300053178 | Bacteria | 19168 |
| 981 | Ga0500637_0000831 | 3300053178 | Bacteria | 12341 |
| 982 | Ga0500637_0003856 | 3300053178 | Bacteria | 6990 |
| 983 | Ga0500637_0004943 | 3300053178 | Bacteria | 6405 |
| 984 | Ga0500637_0006696 | 3300053178 | Bacteria | 5698 |
| 985 | Ga0500567_000358 | 3300053723 | Bacteria | 14925 |
| 986 | Ga0500570_000131 | 3300053724 | Bacteria | 22227 |
| 987 | Ga0500625_000038 | 3300053729 | Bacteria | 43903 |
| 988 | Ga0500625_006345 | 3300053729 | Bacteria | 5032 |
| 989 | Ga0500625_041332 | 3300053729 | Bacteria | 2166 |
| 990 | Ga0500625_046845 | 3300053729 | Bacteria | 2013 |
| 991 | Ga0500625_086103 | 3300053729 | Bacteria | 1358 |
| 992 | Ga0500645_004021 | 3300053730 | Bacteria | 5777 |
| 993 | Ga0500552_000893 | 3300053733 | Bacteria | 2809 |
| 994 | Ga0500596_004767 | 3300053735 | Bacteria | 2453 |
| 995 | Ga0501084_0001458 | 3300054114 | Bacteria | 18747 |
| 996 | Ga0501084_0006709 | 3300054114 | Bacteria | 9465 |
| 997 | Ga0501084_0018707 | 3300054114 | Bacteria | 5768 |
| 998 | Ga0501084_0364331 | 3300054114 | Bacteria | 1221 |
| 999 | Ga0587066_010053 | 3300059490 | Bacteria | 1355 |
| 1000 | Ga0587111_0012431 | 3300060346 | Bacteria | 1504 |
| 1001 | Ga0501082_0019023 | 3300060353 | Bacteria | 5917 |
| 1002 | Ga0501082_0163764 | 3300060353 | Bacteria | 1932 |
| 1003 | 2511124747 | 2510917020 | Bacteria | 5657507 |
| 1004 | 2513592749 | 2513237087 | Bacteria | 5817514 |
| 1005 | 2515692453 | 2515154123 | Bacteria | 6387382 |
| 1006 | 2585149349 | 2582581279 | Bacteria | 4980720 |
| 1007 | 2585153262 | 2582581280 | Bacteria | 5994497 |
| 1008 | 2585196951 | 2582581293 | Bacteria | 5907401 |
| 1009 | 2587916347 | 2585428106 | Bacteria | 5179711 |
| 1010 | 2599501902 | 2599185188 | Bacteria | 6164180 |
| 1011 | 2599773434 | 2599185248 | Bacteria | 6696816 |
| 1012 | 2599884385 | 2599185289 | Bacteria | 6778765 |
| 1013 | 2599896436 | 2599185291 | Bacteria | 6775623 |
| 1014 | 2599958330 | 2599185305 | Bacteria | 6748700 |
| 1015 | 2599964198 | 2599185306 | Bacteria | 6637356 |
| 1016 | 2599976320 | 2599185308 | Bacteria | 6621546 |
| 1017 | 2600003609 | 2599185313 | Bacteria | 6658188 |
| 1018 | 2600009913 | 2599185314 | Bacteria | 6621749 |
| 1019 | 2600016045 | 2599185315 | Bacteria | 6771107 |
| 1020 | 2600051251 | 2599185321 | Bacteria | 6764560 |
| 1021 | 2600069340 | 2599185324 | Bacteria | 6590677 |
| 1022 | 2643727383 | 2643221541 | Bacteria | 5498788 |
| 1023 | 2643750505 | 2643221545 | Bacteria | 5083237 |
| 1024 | 2643820854 | 2643221560 | Bacteria | 4801179 |
| 1025 | 2643834729 | 2643221563 | Bacteria | 4726935 |
| 1026 | 2643923370 | 2643221583 | Bacteria | 5218014 |
| 1027 | 2644041457 | 2643221606 | Bacteria | 5588032 |
| 1028 | 2644055656 | 2643221608 | Bacteria | 4724829 |
| 1029 | 2644226144 | 2643221640 | Bacteria | 5258820 |
| 1030 | 2644235632 | 2643221642 | Bacteria | 5357871 |
| 1031 | 2644394997 | 2643221671 | Bacteria | 5496681 |
| 1032 | 2644464310 | 2643221683 | Bacteria | 5749203 |
| 1033 | 2644509600 | 2643221691 | Bacteria | 5093099 |
| 1034 | 2671089131 | 2667528170 | Bacteria | 6786960 |
| 1035 | 2792460649 | 2791355048 | Bacteria | 5832535 |
| 1036 | 2824618512 | 2824617872 | Bacteria | 8814715 |
| 1037 | 2824627273 | 2824626560 | Bacteria | 8813858 |
| 1038 | 2824635511 | 2824635225 | Bacteria | 8785348 |
| 1039 | 2824644348 | 2824644064 | Bacteria | 8743947 |
| 1040 | 2824720638 | 2824714736 | Bacteria | 8717648 |
| 1041 | 2824725477 | 2824723954 | Bacteria | 8758240 |
| 1042 | 2843747748 | 2843744320 | Bacteria | 5659202 |
| 1043 | 2849565381 | 2849560528 | Bacteria | 5393480 |
| 1044 | 2849578390 | 2849573788 | Bacteria | 5421256 |
| 1045 | 2851153833 | 2851153111 | Bacteria | 5542585 |
| 1046 | 2857509033 | 2857504554 | Bacteria | 5369913 |
| 1047 | 2884964872 | 2884960567 | Bacteria | 5437054 |
| 1048 | 2896256538 | 2896253425 | Bacteria | 3418029 |
| 1049 | 2898329494 | 2898329390 | Bacteria | 5168154 |
| 1050 | 2898910500 | 2898907183 | Bacteria | 4067722 |
| 1051 | 2903772488 | 2903768456 | Bacteria | 9749579 |
| 1052 | 2906650136 | 2906643746 | Bacteria | 8722424 |
| 1053 | 2928535077 | 2928531327 | Bacteria | 5101314 |
| 1054 | 2939634904 | 2939631187 | Bacteria | 6118131 |
| 1055 | 8055272718 | 8055266321 | Bacteria | 7999742 |
| 1056 | Ga0501032_0020610 | |||
| 1057 | SwRhRL2b_contig_464563 | |||
| 1058 | rootH1_10071863 | |||
| 1059 | rootH2_10014120 | |||
| 1060 | Ga0055524_1001209 | |||
| 1061 | Ga0055536_1000097 | |||
| 1062 | Ga0055536_1000556 | |||
| 1063 | Ga0055536_1000610 | |||
| 1064 | Ga0055528_1004791 | |||
| 1065 | Ga0055530_10000405 | |||
| 1066 | Ga0055531_10000224 | |||
| 1067 | Ga0055531_10002410 | |||
| 1068 | Ga0065714_10065692 | |||
| 1069 | Ga0065707_10086567 | |||
| 1070 | Ga0070658_10200567 | |||
| 1071 | Ga0070690_100005911 | |||
| 1072 | Ga0070690_100092446 | |||
| 1073 | Ga0070670_100060610 | |||
| 1074 | Ga0070680_100000037 | |||
| 1075 | Ga0070680_100116452 | |||
| 1076 | Ga0070691_10002785 | |||
| 1077 | Ga0070691_10008294 | |||
| 1078 | Ga0070691_10027477 | |||
| 1079 | Ga0070691_10034490 | |||
| 1080 | Ga0070687_100179246 | |||
| 1081 | Ga0070661_100001403 | |||
| 1082 | Ga0070668_100002600 | |||
| 1083 | Ga0070668_100009767 | |||
| 1084 | Ga0070671_100101684 | |||
| 1085 | Ga0070671_100164234 | |||
| 1086 | Ga0070673_100037265 | |||
| 1087 | Ga0070667_100001761 | |||
| 1088 | Ga0070703_10000621 | |||
| 1089 | Ga0070703_10000776 | |||
| 1090 | Ga0070709_10000229 | |||
| 1091 | Ga0070709_10000292 | |||
| 1092 | Ga0070714_100036015 | |||
| 1093 | Ga0070714_100428336 | |||
| 1094 | Ga0070713_100000003 | |||
| 1095 | Ga0070713_100001423 | |||
| 1096 | Ga0070713_100048254 | |||
| 1097 | Ga0070710_10055254 | |||
| 1098 | Ga0070711_100000006 | |||
| 1099 | Ga0070711_100010191 | |||
| 1100 | Ga0070705_100000042 | |||
| 1101 | Ga0070705_100000089 | |||
| 1102 | Ga0070700_100014332 | |||
| 1103 | Ga0070700_100038168 | |||
| 1104 | Ga0070694_100012470 | |||
| 1105 | Ga0070694_100063969 | |||
| 1106 | Ga0070694_100068036 | |||
| 1107 | Ga0070708_100007273 | |||
| 1108 | Ga0070663_100187467 | |||
| 1109 | Ga0070678_100083634 | |||
| 1110 | Ga0070681_10000001 | |||
| 1111 | Ga0070706_100000274 | |||
| 1112 | Ga0070706_100041613 | |||
| 1113 | Ga0070706_100087025 | |||
| 1114 | Ga0070707_100000600 | |||
| 1115 | Ga0070698_100151341 | |||
| 1116 | Ga0070698_100413015 | |||
| 1117 | Ga0070699_100000182 | |||
| 1118 | Ga0070699_100001677 | |||
| 1119 | Ga0070679_100000096 | |||
| 1120 | Ga0070679_100049818 | |||
| 1121 | Ga0070697_100004703 | |||
| 1122 | Ga0070697_100023202 | |||
| 1123 | Ga0070697_100210378 | |||
| 1124 | Ga0068853_100002100 | |||
| 1125 | Ga0068853_100005959 | |||
| 1126 | Ga0068853_100152758 | |||
| 1127 | Ga0068853_100284586 | |||
| 1128 | Ga0070686_100157794 | |||
| 1129 | Ga0070695_100006839 | |||
| 1130 | Ga0070695_100010336 | |||
| 1131 | Ga0070695_100018280 | |||
| 1132 | Ga0070696_100000288 | |||
| 1133 | Ga0070696_100000617 | |||
| 1134 | Ga0070696_100048863 | |||
| 1135 | Ga0070696_100066166 | |||
| 1136 | Ga0070696_100087370 | |||
| 1137 | Ga0070693_100005054 | |||
| 1138 | Ga0070693_100018955 | |||
| 1139 | Ga0070693_100167326 | |||
| 1140 | Ga0070665_100010876 | |||
| 1141 | Ga0070665_100014067 | |||
| 1142 | Ga0070665_100021647 | |||
| 1143 | Ga0070665_100033055 | |||
| 1144 | Ga0070704_100000232 | |||
| 1145 | Ga0070704_100004402 | |||
| 1146 | Ga0070704_100218602 | |||
| 1147 | Ga0068855_100000010 | |||
| 1148 | Ga0068855_100005574 | |||
| 1149 | Ga0068855_100006001 | |||
| 1150 | Ga0068855_100094932 | |||
| 1151 | Ga0068855_100122997 | |||
| 1152 | Ga0070664_100023136 | |||
| 1153 | Ga0070664_100035491 | |||
| 1154 | Ga0068857_100006105 | |||
| 1155 | Ga0068857_100022564 | |||
| 1156 | Ga0068854_100002041 | |||
| 1157 | Ga0068854_100019233 | |||
| 1158 | Ga0068856_100000075 | |||
| 1159 | Ga0068856_100000569 | |||
| 1160 | Ga0068856_100002154 | |||
| 1161 | Ga0068856_100022862 | |||
| 1162 | Ga0068852_100011109 | |||
| 1163 | Ga0068852_100160792 | |||
| 1164 | Ga0068852_100175999 | |||
| 1165 | Ga0068859_100002952 | |||
| 1166 | Ga0068859_100026387 | |||
| 1167 | Ga0068859_100028131 | |||
| 1168 | Ga0068859_100050057 | |||
| 1169 | Ga0068859_100272416 | |||
| 1170 | Ga0068864_100057575 | |||
| 1171 | Ga0068864_100409362 | |||
| 1172 | Ga0068851_10002585 | |||
| 1173 | Ga0068851_10111235 | |||
| 1174 | Ga0068863_100003097 | |||
| 1175 | Ga0068863_100024925 | |||
| 1176 | Ga0068863_100025061 | |||
| 1177 | Ga0068863_100043597 | |||
| 1178 | Ga0068863_100130527 | |||
| 1179 | Ga0068858_100014190 | |||
| 1180 | Ga0068858_100078471 | |||
| 1181 | Ga0068858_100180237 | |||
| 1182 | Ga0068860_100000028 | |||
| 1183 | Ga0068860_100000032 | |||
| 1184 | Ga0068860_100013934 | |||
| 1185 | Ga0068860_100028256 | |||
| 1186 | Ga0068860_100082902 | |||
| 1187 | Ga0068860_100097696 | |||
| 1188 | Ga0068860_100109627 | |||
| 1189 | Ga0068862_100001018 | |||
| 1190 | Ga0068862_100021065 | |||
| 1191 | Ga0068862_100085502 | |||
| 1192 | Ga0068862_100119011 | |||
| 1193 | Ga0068862_100224553 | |||
| 1194 | Ga0081455_10001326 | |||
| 1195 | Ga0081455_10002294 | |||
| 1196 | Ga0081455_10003139 | |||
| 1197 | Ga0081538_10054561 | |||
| 1198 | Ga0081540_1001742 | |||
| 1199 | Ga0081540_1028171 | |||
| 1200 | Ga0081539_10001914 | |||
| 1201 | Ga0081539_10013380 | |||
| 1202 | Ga0081539_10052874 | |||
| 1203 | Ga0081539_10115600 | |||
| 1204 | Ga0075368_10072859 | |||
| 1205 | Ga0075363_100000521 | |||
| 1206 | Ga0070716_100024116 | |||
| 1207 | Ga0070712_100000027 | |||
| 1208 | Ga0070712_100001822 | |||
| 1209 | Ga0070712_100004188 | |||
| 1210 | Ga0075367_10000520 | |||
| 1211 | Ga0075367_10015224 | |||
| 1212 | Ga0075369_10007727 | |||
| 1213 | Ga0075369_10030881 | |||
| 1214 | Ga0075369_10032518 | |||
| 1215 | Ga0075366_10008672 | |||
| 1216 | Ga0097621_100010821 | |||
| 1217 | Ga0075370_10009113 | |||
| 1218 | Ga0075370_10055967 | |||
| 1219 | Ga0068871_100002451 | |||
| 1220 | Ga0075428_100006408 | |||
| 1221 | Ga0075428_100009476 | |||
| 1222 | Ga0075428_100010017 | |||
| 1223 | Ga0075428_100084017 | |||
| 1224 | Ga0075430_100080242 | |||
| 1225 | Ga0075431_100010582 | |||
| 1226 | Ga0075431_100010694 | |||
| 1227 | Ga0075433_10011348 | |||
| 1228 | Ga0075433_10015023 | |||
| 1229 | Ga0075433_10139155 | |||
| 1230 | Ga0075434_100004616 | |||
| 1231 | Ga0075434_100377390 | |||
| 1232 | Ga0075429_100095542 | |||
| 1233 | Ga0068865_100008468 | |||
| 1234 | Ga0068865_100045580 | |||
| 1235 | Ga0068865_100249939 | |||
| 1236 | Ga0075436_100000038 | |||
| 1237 | Ga0075436_100000820 | |||
| 1238 | Ga0075436_100005599 | |||
| 1239 | Ga0097620_100002952 | |||
| 1240 | Ga0097620_100026387 | |||
| 1241 | Ga0097620_100028132 | |||
| 1242 | Ga0097620_100050057 | |||
| 1243 | Ga0097620_100272429 | |||
| 1244 | Ga0075435_100003260 | |||
| 1245 | Ga0075435_100019175 | |||
| 1246 | Ga0099794_10022855 | |||
| 1247 | Ga0099794_10070331 | |||
| 1248 | Ga0099795_10000235 | |||
| 1249 | Ga0105240_10000189 | |||
| 1250 | Ga0105240_10006687 | |||
| 1251 | Ga0105240_10012045 | |||
| 1252 | Ga0105240_10015182 | |||
| 1253 | Ga0105240_10015309 | |||
| 1254 | Ga0105240_10018751 | |||
| 1255 | Ga0105240_10025885 | |||
| 1256 | Ga0105240_10055553 | |||
| 1257 | Ga0105240_10071493 | |||
| 1258 | Ga0111539_10030909 | |||
| 1259 | Ga0111539_10073034 | |||
| 1260 | Ga0111539_10077333 | |||
| 1261 | Ga0111539_10287823 | |||
| 1262 | Ga0111539_10411681 | |||
| 1263 | Ga0111539_10468913 | |||
| 1264 | Ga0105245_10014018 | |||
| 1265 | Ga0105247_10016215 | |||
| 1266 | Ga0105247_10081842 | |||
| 1267 | Ga0114129_10064342 | |||
| 1268 | Ga0114129_10157671 | |||
| 1269 | Ga0114129_10173376 | |||
| 1270 | Ga0114129_10420599 | |||
| 1271 | Ga0105243_10071304 | |||
| 1272 | Ga0105243_10091667 | |||
| 1273 | Ga0105243_10124888 | |||
| 1274 | Ga0105241_10025127 | |||
| 1275 | Ga0105241_10040227 | |||
| 1276 | Ga0105241_10219464 | |||
| 1277 | Ga0105242_10000830 | |||
| 1278 | Ga0105248_10000001 | |||
| 1279 | Ga0105248_10128355 | |||
| 1280 | Ga0105248_10327048 | |||
| 1281 | Ga0105237_10000304 | |||
| 1282 | Ga0105237_10000443 | |||
| 1283 | Ga0105237_10012505 | |||
| 1284 | Ga0105238_10016013 | |||
| 1285 | Ga0105238_10031136 | |||
| 1286 | Ga0105238_10081652 | |||
| 1287 | Ga0105238_10125859 | |||
| 1288 | Ga0105249_10000305 | |||
| 1289 | Ga0105249_10012411 | |||
| 1290 | Ga0105249_10060693 | |||
| 1291 | Ga0099796_10000154 | |||
| 1292 | Ga0099796_10006478 | |||
| 1293 | Ga0105239_10003215 | |||
| 1294 | Ga0105239_10008512 | |||
| 1295 | Ga0105239_10016434 | |||
| 1296 | Ga0105239_10022608 | |||
| 1297 | Ga0105239_10046524 | |||
| 1298 | Ga0105239_10048125 | |||
| 1299 | Ga0105239_10232498 | |||
| 1300 | Ga0105246_10069574 | |||
| 1301 | Ga0157373_10000340 | |||
| 1302 | Ga0157373_10000686 | |||
| 1303 | Ga0157373_10014411 | |||
| 1304 | Ga0157373_10071323 | |||
| 1305 | Ga0157369_10055553 | |||
| 1306 | Ga0157369_10060202 | |||
| 1307 | Ga0157369_10166168 | |||
| 1308 | Ga0157374_10038241 | |||
| 1309 | Ga0157378_10002709 | |||
| 1310 | Ga0163162_10021263 | |||
| 1311 | Ga0157372_10005699 | |||
| 1312 | Ga0157375_10041951 | |||
| 1313 | Ga0157375_10102579 | |||
| 1314 | Ga0157375_10181588 | |||
| 1315 | Ga0163163_10001576 | |||
| 1316 | Ga0163163_10015060 | |||
| 1317 | Ga0163163_10082445 | |||
| 1318 | Ga0163163_10292800 | |||
| 1319 | Ga0157380_10195128 | |||
| 1320 | Ga0182008_10000207 | |||
| 1321 | Ga0157379_10005876 | |||
| 1322 | Ga0157379_10016970 | |||
| 1323 | Ga0157379_10053130 | |||
| 1324 | Ga0157379_10189838 | |||
| 1325 | Ga0157379_10437339 | |||
| 1326 | Ga0197907_10728211 | |||
| 1327 | Ga0206352_11247993 | |||
| 1328 | Ga0213876_10000316 | |||
| 1329 | Ga0213876_10000431 | |||
| 1330 | Ga0213876_10002998 | |||
| 1331 | Ga0213875_10000117 | |||
| 1332 | Ga0213871_10012583 | |||
| 1333 | Ga0224712_10024255 | |||
| 1334 | Ga0209565_1000414 | |||
| 1335 | Ga0209673_1001894 | |||
| 1336 | Ga0209676_1000031 | |||
| 1337 | Ga0209676_1000057 | |||
| 1338 | Ga0209676_1000077 | |||
| 1339 | Ga0209676_1006896 | |||
| 1340 | Ga0209025_1000029 | |||
| 1341 | Ga0209758_1006233 | |||
| 1342 | Ga0209050_1000087 | |||
| 1343 | Ga0209050_1000096 | |||
| 1344 | Ga0209050_1008634 | |||
| 1345 | Ga0209256_1000353 | |||
| 1346 | Ga0209051_1005874 | |||
| 1347 | Ga0209257_1000050 | |||
| 1348 | Ga0209257_1000130 | |||
| 1349 | Ga0209257_1007067 | |||
| 1350 | Ga0207697_10029271 | |||
| 1351 | Ga0207655_1018995 | |||
| 1352 | Ga0207653_10000115 | |||
| 1353 | Ga0207692_10028032 | |||
| 1354 | Ga0207647_10000943 | |||
| 1355 | Ga0207647_10006279 | |||
| 1356 | Ga0207647_10058361 | |||
| 1357 | Ga0207699_10000031 | |||
| 1358 | Ga0207699_10000425 | |||
| 1359 | Ga0207645_10166571 | |||
| 1360 | Ga0207705_10000608 | |||
| 1361 | Ga0207705_10086367 | |||
| 1362 | Ga0207684_10000174 | |||
| 1363 | Ga0207684_10151851 | |||
| 1364 | Ga0207654_10054778 | |||
| 1365 | Ga0207707_10000001 | |||
| 1366 | Ga0207707_10003660 | |||
| 1367 | Ga0207707_10083776 | |||
| 1368 | Ga0207707_10084843 | |||
| 1369 | Ga0207707_10182384 | |||
| 1370 | Ga0207695_10000003 | |||
| 1371 | Ga0207695_10015409 | |||
| 1372 | Ga0207695_10020718 | |||
| 1373 | Ga0207695_10071991 | |||
| 1374 | Ga0207695_10072200 | |||
| 1375 | Ga0207695_10078597 | |||
| 1376 | Ga0207671_10000996 | |||
| 1377 | Ga0207671_10034164 | |||
| 1378 | Ga0207693_10000299 | |||
| 1379 | Ga0207693_10003652 | |||
| 1380 | Ga0207693_10010227 | |||
| 1381 | Ga0207693_10071335 | |||
| 1382 | Ga0207693_10139979 | |||
| 1383 | Ga0207663_10000064 | |||
| 1384 | Ga0207663_10019212 | |||
| 1385 | Ga0207660_10000271 | |||
| 1386 | Ga0207660_10000869 | |||
| 1387 | Ga0207660_10001144 | |||
| 1388 | Ga0207662_10054252 | |||
| 1389 | Ga0207662_10145430 | |||
| 1390 | Ga0207657_10043459 | |||
| 1391 | Ga0207657_10069329 | |||
| 1392 | Ga0207657_10112394 | |||
| 1393 | Ga0207649_10000073 | |||
| 1394 | Ga0207652_10000201 | |||
| 1395 | Ga0207646_10000955 | |||
| 1396 | Ga0207646_10185920 | |||
| 1397 | Ga0207681_10107659 | |||
| 1398 | Ga0207694_10000011 | |||
| 1399 | Ga0207694_10024807 | |||
| 1400 | Ga0207694_10077962 | |||
| 1401 | Ga0207694_10135056 | |||
| 1402 | Ga0207650_10020873 | |||
| 1403 | Ga0207659_10029064 | |||
| 1404 | Ga0207700_10000010 | |||
| 1405 | Ga0207700_10179334 | |||
| 1406 | Ga0207664_10045659 | |||
| 1407 | Ga0207664_10223974 | |||
| 1408 | Ga0207644_10001940 | |||
| 1409 | Ga0207706_10041166 | |||
| 1410 | Ga0207706_10074972 | |||
| 1411 | Ga0207686_10008224 | |||
| 1412 | Ga0207709_10030712 | |||
| 1413 | Ga0207709_10142067 | |||
| 1414 | Ga0207704_10013874 | |||
| 1415 | Ga0207704_10018865 | |||
| 1416 | Ga0207665_10008683 | |||
| 1417 | Ga0207665_10032169 | |||
| 1418 | Ga0207665_10136015 | |||
| 1419 | Ga0207691_10127561 | |||
| 1420 | Ga0207691_10292332 | |||
| 1421 | Ga0207711_10000002 | |||
| 1422 | Ga0207711_10084414 | |||
| 1423 | Ga0207689_10178824 | |||
| 1424 | Ga0207661_10147264 | |||
| 1425 | Ga0207679_10014729 | |||
| 1426 | Ga0207667_10000093 | |||
| 1427 | Ga0207667_10003109 | |||
| 1428 | Ga0207667_10003876 | |||
| 1429 | Ga0207667_10007215 | |||
| 1430 | Ga0207667_10019181 | |||
| 1431 | Ga0207667_10178808 | |||
| 1432 | Ga0207667_10396611 | |||
| 1433 | Ga0207712_10029350 | |||
| 1434 | Ga0207712_10051323 | |||
| 1435 | Ga0207668_10005799 | |||
| 1436 | Ga0207668_10024219 | |||
| 1437 | Ga0207668_10035882 | |||
| 1438 | Ga0207640_10017526 | |||
| 1439 | Ga0207640_10022855 | |||
| 1440 | Ga0207658_10000413 | |||
| 1441 | Ga0207658_10003527 | |||
| 1442 | Ga0207658_10095771 | |||
| 1443 | Ga0207658_10144713 | |||
| 1444 | Ga0207703_10008184 | |||
| 1445 | Ga0207703_10067720 | |||
| 1446 | Ga0207703_10231597 | |||
| 1447 | Ga0207703_10319770 | |||
| 1448 | Ga0207639_10002625 | |||
| 1449 | Ga0207639_10055932 | |||
| 1450 | Ga0207639_10251479 | |||
| 1451 | Ga0207678_10020172 | |||
| 1452 | Ga0207708_10010918 | |||
| 1453 | Ga0207708_10025380 | |||
| 1454 | Ga0207708_10094347 | |||
| 1455 | Ga0207702_10000013 | |||
| 1456 | Ga0207702_10000911 | |||
| 1457 | Ga0207702_10031997 | |||
| 1458 | Ga0207702_10158180 | |||
| 1459 | Ga0207641_10002755 | |||
| 1460 | Ga0207641_10104666 | |||
| 1461 | Ga0207641_10113084 | |||
| 1462 | Ga0207641_10322570 | |||
| 1463 | Ga0207676_10058036 | |||
| 1464 | Ga0207676_10277592 | |||
| 1465 | Ga0207676_10299225 | |||
| 1466 | Ga0207674_10002517 | |||
| 1467 | Ga0207674_10008737 | |||
| 1468 | Ga0207674_10013600 | |||
| 1469 | Ga0207674_10014644 | |||
| 1470 | Ga0207674_10042429 | |||
| 1471 | Ga0207674_10148907 | |||
| 1472 | Ga0207675_100064397 | |||
| 1473 | Ga0207683_10211259 | |||
| 1474 | Ga0207698_10007581 | |||
| 1475 | Ga0207698_10015630 | |||
| 1476 | Ga0207698_10151213 | |||
| 1477 | Ga0207698_10204543 | |||
| 1478 | Ga0207698_10314253 | |||
| 1479 | Ga0209179_1000002 | |||
| 1480 | Ga0207428_10017230 | |||
| 1481 | Ga0207428_10091798 | |||
| 1482 | Ga0207428_10128445 | |||
| 1483 | Ga0268266_10017674 | |||
| 1484 | Ga0268266_10098466 | |||
| 1485 | Ga0268266_10268389 | |||
| 1486 | Ga0268265_10004878 | |||
| 1487 | Ga0268265_10013328 | |||
| 1488 | Ga0268265_10021695 | |||
| 1489 | Ga0268265_10081210 | |||
| 1490 | Ga0268264_10000045 | |||
| 1491 | Ga0268264_10000066 | |||
| 1492 | Ga0268264_10007343 | |||
| 1493 | Ga0268264_10010641 | |||
| 1494 | Ga0268264_10018782 | |||
| 1495 | Ga0268264_10092459 | |||
| 1496 | Ga0265334_10005936 | |||
| 1497 | Ga0265334_10008584 | |||
| 1498 | Ga0265318_10000018 | |||
| 1499 | Ga0265318_10009405 | |||
| 1500 | Ga0307515_10077040 | |||
| 1501 | Ga0307515_10104909 | |||
| 1502 | Ga0265338_10000014 | |||
| 1503 | Ga0265338_10005551 | |||
| 1504 | Ga0265338_10037990 | |||
| 1505 | Ga0307511_10004718 | |||
| 1506 | Ga0307511_10024288 | |||
| 1507 | Ga0265320_10028747 | |||
| 1508 | Ga0265325_10000001 | |||
| 1509 | Ga0265325_10003363 | |||
| 1510 | Ga0265325_10004801 | |||
| 1511 | Ga0265340_10000584 | |||
| 1512 | Ga0265340_10023840 | |||
| 1513 | Ga0265340_10036101 | |||
| 1514 | Ga0265340_10050005 | |||
| 1515 | Ga0265339_10000135 | |||
| 1516 | Ga0265339_10000912 | |||
| 1517 | Ga0265331_10000006 | |||
| 1518 | Ga0265331_10000419 | |||
| 1519 | Ga0265331_10016760 | |||
| 1520 | Ga0265327_10000074 | |||
| 1521 | Ga0265316_10110635 | |||
| 1522 | Ga0307513_10086621 | |||
| 1523 | Ga0307513_10102065 | |||
| 1524 | Ga0307509_10000013 | |||
| 1525 | Ga0307509_10000500 | |||
| 1526 | Ga0307408_100338802 | |||
| 1527 | Ga0265313_10003117 | |||
| 1528 | Ga0265313_10009233 | |||
| 1529 | Ga0265313_10086774 | |||
| 1530 | Ga0307508_10027770 | |||
| 1531 | Ga0307508_10104370 | |||
| 1532 | Ga0316575_10000104 | |||
| 1533 | Ga0316575_10003913 | |||
| 1534 | Ga0316575_10007114 | |||
| 1535 | Ga0316575_10014560 | |||
| 1536 | Ga0316579_10001369 | |||
| 1537 | Ga0316579_10008387 | |||
| 1538 | Ga0316579_10026682 | |||
| 1539 | Ga0316579_10093212 | |||
| 1540 | Ga0265314_10000370 | |||
| 1541 | Ga0265314_10019879 | |||
| 1542 | Ga0265314_10036733 | |||
| 1543 | Ga0265314_10043142 | |||
| 1544 | Ga0265342_10016644 | |||
| 1545 | Ga0265342_10040876 | |||
| 1546 | Ga0265342_10076603 | |||
| 1547 | Ga0316576_10000424 | |||
| 1548 | Ga0316576_10002167 | |||
| 1549 | Ga0316576_10013535 | |||
| 1550 | Ga0316576_10025772 | |||
| 1551 | Ga0316576_10069422 | |||
| 1552 | Ga0316576_10110088 | |||
| 1553 | Ga0316578_10000074 | |||
| 1554 | Ga0316578_10008537 | |||
| 1555 | Ga0316578_10048873 | |||
| 1556 | Ga0316578_10079150 | |||
| 1557 | Ga0307516_10000095 | |||
| 1558 | Ga0307516_10000099 | |||
| 1559 | Ga0307405_10014321 | |||
| 1560 | Ga0307405_10101810 | |||
| 1561 | Ga0316577_10000480 | |||
| 1562 | Ga0316577_10003948 | |||
| 1563 | Ga0316577_10018265 | |||
| 1564 | Ga0316577_10018907 | |||
| 1565 | Ga0316577_10035412 | |||
| 1566 | Ga0316577_10035878 | |||
| 1567 | Ga0316577_10045969 | |||
| 1568 | Ga0307413_10047983 | |||
| 1569 | Ga0307406_10131094 | |||
| 1570 | Ga0307412_10023232 | |||
| 1571 | Ga0307416_100056284 | |||
| 1572 | Ga0307414_10020609 | |||
| 1573 | Ga0307411_10015885 | |||
| 1574 | Ga0307415_100091431 | |||
| 1575 | Ga0316583_10001545 | |||
| 1576 | Ga0316583_10005386 | |||
| 1577 | Ga0316583_10063597 | |||
| 1578 | Ga0316585_10010759 | |||
| 1579 | Ga0316580_10008574 | |||
| 1580 | Ga0316593_10007913 | |||
| 1581 | Ga0307510_10000003 | |||
| 1582 | Ga0316592_1004221 | |||
| 1583 | Ga0316586_1001568 | |||
| 1584 | Ga0316586_1001613 | |||
| 1585 | Ga0316588_1004434 | |||
| 1586 | Ga0316587_1001975 | |||
| 1587 | Ga0373944_0004452 | |||
| 1588 | Ga0373951_0020609 | |||
| 1589 | Ga0373952_0010918 | |||
| 1590 | Ga0373936_0003172 | |||
| 1591 | Ga0373939_0002211 | |||
| 1592 | Ga0373939_0033072 | |||
| 1593 | Ga0373960_0008324 | |||
| 1594 | Ga0373943_0009757 | |||
| 1595 | Ga0373946_0023948 | |||
| 1596 | Ga0373955_0032738 | |||
| 1597 | Ga0373942_0004075 | |||
| 1598 | Ga0373961_0029968 | |||
| 1599 | Ga0316574_0001352 | |||
| 1600 | Ga0316574_0047504 | |||
| 1601 | Ga0316574_0051815 | |||
| 1602 | Ga0316574_0057347 | |||
| 1603 | Ga0373931_0000492 | |||
| 1604 | Ga0373931_0005836 | |||
| 1605 | Ga0373935_0033002 | |||
| 1606 | Ga0373935_0190318 | |||
| 1607 | Ga0373927_0000452 | |||
| 1608 | Ga0373927_0027785 | |||
| 1609 | Ga0373927_0068113 | |||
| 1610 | Ga0373933_0027534 | |||
| 1611 | Ga0373947_0019131 | |||
| 1612 | Ga0373937_0037105 | |||
| 1613 | Ga0373937_0040197 | |||
| 1614 | Ga0373937_0218055 | |||
| 1615 | Ga0373937_0231484 | |||
| 1616 | Ga0316582_0000536 | |||
| 1617 | Ga0316582_0005483 | |||
| 1618 | Ga0316582_0009637 | |||
| 1619 | Ga0316582_0019403 | |||
| 1620 | Ga0316582_0029095 | |||
| 1621 | Ga0316582_0043414 | |||
| 1622 | Ga0316582_0100342 | |||
| 1623 | Ga0316582_0153266 | |||
| 1624 | Ga0316584_0012961 | |||
| 1625 | Ga0316584_0021157 | |||
| 1626 | Ga0316584_0025801 | |||
| 1627 | Ga0316584_0043726 | |||
| 1628 | Ga0316584_0113768 | |||
| 1629 | Ga0316584_0118285 | |||
| 1630 | Ga0316584_0148136 | |||
| 1631 | Ga0373925_0000173 | |||
| 1632 | Ga0373925_0192651 | |||
| 1633 | Ga0395900_0052656 | |||
| 1634 | Ga0395900_0067352 | |||
| 1635 | Ga0395900_0242719 | |||
| 1636 | Ga0395898_0006599 | |||
| 1637 | Ga0395898_0119619 | |||
| 1638 | Ga0395905_0000042 | |||
| 1639 | Ga0316581_0001321 | |||
| 1640 | Ga0316581_0001549 | |||
| 1641 | Ga0316581_0010798 | |||
| 1642 | Ga0316581_0012137 | |||
| 1643 | Ga0316581_0037575 | |||
| 1644 | Ga0436364_0410618 | |||
| 1645 | Ga0436364_0700727 | |||
| 1646 | Ga0436364_1101563 | |||
| 1647 | Ga0395901_0003446 | |||
| 1648 | Ga0395901_0023659 | |||
| 1649 | Ga0395901_0247044 | |||
| 1650 | Ga0395901_0267845 | |||
| 1651 | Ga0237819_02732 | |||
| 1652 | Ga0400490_09265 | |||
| 1653 | Ga0400490_14729 | |||
| 1654 | Ga0400488_28709 | |||
| 1655 | Ga0400488_55998 | |||
| 1656 | Ga0400483_101319 | |||
| 1657 | Ga0400489_47030 | |||
| 1658 | Ga0400489_67259 | |||
| 1659 | Ga0400489_72336 | |||
| 1660 | Ga0400489_83150 | |||
| 1661 | Ga0436365_0131305 | |||
| 1662 | Ga0436365_0411002 | |||
| 1663 | Ga0436365_0585577 | |||
| 1664 | Ga0436365_1518071 | |||
| 1665 | Ga0436363_0717745 | |||
| 1666 | Ga0439436_0006472 | |||
| 1667 | Ga0439438_000037 | |||
| 1668 | Ga0439447_000082 | |||
| 1669 | Ga0439432_031639 | |||
| 1670 | Ga0439449_0002362 | |||
| 1671 | Ga0439451_000016 | |||
| 1672 | Ga0439434_0015057 | |||
| 1673 | Ga0439435_0040848 | |||
| 1674 | Ga0451577_0029064 | |||
| 1675 | Ga0453683_0004087 | |||
| 1676 | Ga0453683_0070467 | |||
| 1677 | Ga0466963_0104316 | |||
| 1678 | Ga0453684_0396898 | |||
| 1679 | Ga0451576_0000492 | |||
| 1680 | Ga0466967_0082680 | |||
| 1681 | Ga0495617_038475 | |||
| 1682 | Ga0495627_000901 | |||
| 1683 | Ga0495627_012316 | |||
| 1684 | Ga0495603_0080442 | |||
| 1685 | Ga0495629_0028809 | |||
| 1686 | Ga0495629_0149057 | |||
| 1687 | Ga0495638_0000016 | |||
| 1688 | Ga0495638_0000351 | |||
| 1689 | Ga0495638_0000672 | |||
| 1690 | Ga0495651_0154315 | |||
| 1691 | Ga0495650_0000007 | |||
| 1692 | Ga0495580_0000006 | |||
| 1693 | Ga0495580_0002873 | |||
| 1694 | Ga0495580_0006825 | |||
| 1695 | Ga0495580_0007177 | |||
| 1696 | Ga0495580_0013230 | |||
| 1697 | Ga0495580_0189012 | |||
| 1698 | Ga0495639_0074889 | |||
| 1699 | Ga0495664_0007589 | |||
| 1700 | Ga0495584_0018115 | |||
| 1701 | Ga0495594_0013880 | |||
| 1702 | Ga0495596_0001169 | |||
| 1703 | Ga0495583_0000024 | |||
| 1704 | Ga0495583_0000094 | |||
| 1705 | Ga0495583_0003214 | |||
| 1706 | Ga0495606_0005968 | |||
| 1707 | Ga0495610_0000029 | |||
| 1708 | Ga0495610_0000057 | |||
| 1709 | Ga0495610_0001407 | |||
| 1710 | Ga0495610_0023433 | |||
| 1711 | Ga0495610_0033100 | |||
| 1712 | Ga0495616_0000032 | |||
| 1713 | Ga0495616_0000122 | |||
| 1714 | Ga0495616_0067526 | |||
| 1715 | Ga0495620_0000079 | |||
| 1716 | Ga0495631_0003669 | |||
| 1717 | Ga0495632_0000001 | |||
| 1718 | Ga0495632_0000440 | |||
| 1719 | Ga0495632_0027463 | |||
| 1720 | Ga0495632_0091752 | |||
| 1721 | Ga0495637_0000108 | |||
| 1722 | Ga0495637_0007300 | |||
| 1723 | Ga0495637_0007592 | |||
| 1724 | Ga0495637_0010009 | |||
| 1725 | Ga0495637_0026018 | |||
| 1726 | Ga0495643_0000020 | |||
| 1727 | Ga0495643_0000039 | |||
| 1728 | Ga0495643_0001980 | |||
| 1729 | Ga0495643_0006160 | |||
| 1730 | Ga0495643_0015680 | |||
| 1731 | Ga0495643_0018907 | |||
| 1732 | Ga0495648_0000013 | |||
| 1733 | Ga0495648_0000094 | |||
| 1734 | Ga0495648_0000120 | |||
| 1735 | Ga0495663_0000002 | |||
| 1736 | Ga0495663_0006255 | |||
| 1737 | Ga0495666_0017567 | |||
| 1738 | Ga0495654_0000116 | |||
| 1739 | Ga0495654_0001448 | |||
| 1740 | Ga0495665_0031297 | |||
| 1741 | Ga0495586_0129046 | |||
| 1742 | Ga0495597_0001842 | |||
| 1743 | Ga0495597_0010048 | |||
| 1744 | Ga0495597_0034020 | |||
| 1745 | Ga0495622_0000513 | |||
| 1746 | Ga0495622_0001984 | |||
| 1747 | Ga0495622_0009640 | |||
| 1748 | Ga0495633_0000376 | |||
| 1749 | Ga0495633_0000712 | |||
| 1750 | Ga0495633_0003559 | |||
| 1751 | Ga0495633_0010455 | |||
| 1752 | Ga0495633_0109472 | |||
| 1753 | Ga0495668_0000019 | |||
| 1754 | Ga0495668_0002477 | |||
| 1755 | Ga0495668_0004380 | |||
| 1756 | Ga0495668_0008371 | |||
| 1757 | Ga0495668_0009371 | |||
| 1758 | Ga0495668_0021325 | |||
| 1759 | Ga0495668_0038425 | |||
| 1760 | Ga0495668_0094317 | |||
| 1761 | Ga0495668_0123051 | |||
| 1762 | Ga0495611_0045036 | |||
| 1763 | Ga0495625_0004722 | |||
| 1764 | Ga0495625_0007110 | |||
| 1765 | Ga0495625_0089921 | |||
| 1766 | Ga0495657_0122744 | |||
| 1767 | Ga0495599_0149726 | |||
| 1768 | Ga0495658_0000506 | |||
| 1769 | Ga0495669_0019399 | |||
| 1770 | Ga0495669_0029325 | |||
| 1771 | Ga0495670_0010313 | |||
| 1772 | Ga0495671_0000016 | |||
| 1773 | Ga0495671_0000018 | |||
| 1774 | Ga0495671_0005174 | |||
| 1775 | Ga0495671_0005379 | |||
| 1776 | Ga0495671_0014146 | |||
| 1777 | Ga0495671_0030168 | |||
| 1778 | Ga0495671_0040996 | |||
| 1779 | Ga0495671_0041953 | |||
| 1780 | Ga0495649_0011295 | |||
| 1781 | Ga0495589_0007335 | |||
| 1782 | Ga0495604_0035969 | |||
| 1783 | Ga0495672_0000299 | |||
| 1784 | Ga0495672_0003601 | |||
| 1785 | Ga0495672_0003684 | |||
| 1786 | Ga0495680_0039616 | |||
| 1787 | Ga0495680_0145014 | |||
| 1788 | Ga0495675_0037437 | |||
| 1789 | Ga0495679_039048 | |||
| 1790 | Ga0495673_0000082 | |||
| 1791 | Ga0495673_0000205 | |||
| 1792 | Ga0495673_0000233 | |||
| 1793 | Ga0495673_0000241 | |||
| 1794 | Ga0495673_0000435 | |||
| 1795 | Ga0495681_0005243 | |||
| 1796 | Ga0495684_0140472 | |||
| 1797 | Ga0495686_0001872 | |||
| 1798 | Ga0495686_0004265 | |||
| 1799 | Ga0495686_0033589 | |||
| 1800 | Ga0495615_0000011 | |||
| 1801 | Ga0495615_0000013 | |||
| 1802 | Ga0495615_0000173 | |||
| 1803 | Ga0496100_0022209 | |||
| 1804 | Ga0496100_0086461 | |||
| 1805 | Ga0496101_0049872 | |||
| 1806 | Ga0496101_0060109 | |||
| 1807 | Ga0496102_0003237 | |||
| 1808 | Ga0496102_0013184 | |||
| 1809 | Ga0496102_0046931 | |||
| 1810 | Ga0496102_0257001 | |||
| 1811 | Ga0496103_0077727 | |||
| 1812 | Ga0496103_0082740 | |||
| 1813 | Ga0496104_0014316 | |||
| 1814 | Ga0496104_0015386 | |||
| 1815 | Ga0496104_0037396 | |||
| 1816 | Ga0496104_0046656 | |||
| 1817 | Ga0496104_0080458 | |||
| 1818 | Ga0496105_0002153 | |||
| 1819 | Ga0496105_0019377 | |||
| 1820 | Ga0496105_0049000 | |||
| 1821 | Ga0496105_0051492 | |||
| 1822 | Ga0496105_0057122 | |||
| 1823 | Ga0496105_0165458 | |||
| 1824 | Ga0496106_0001275 | |||
| 1825 | Ga0496106_0001509 | |||
| 1826 | Ga0496106_0049184 | |||
| 1827 | Ga0496106_0088657 | |||
| 1828 | Ga0496107_0000089 | |||
| 1829 | Ga0496107_0001523 | |||
| 1830 | Ga0496107_0019005 | |||
| 1831 | Ga0496107_0067756 | |||
| 1832 | Ga0496107_0078243 | |||
| 1833 | Ga0496108_0025050 | |||
| 1834 | Ga0496108_0033787 | |||
| 1835 | Ga0496108_0084868 | |||
| 1836 | Ga0496109_0031198 | |||
| 1837 | Ga0496109_0055283 | |||
| 1838 | Ga0496109_0077236 | |||
| 1839 | Ga0496110_0040365 | |||
| 1840 | Ga0496110_0094885 | |||
| 1841 | Ga0496110_0109048 | |||
| 1842 | Ga0496110_0123214 | |||
| 1843 | Ga0496111_0024809 | |||
| 1844 | Ga0496111_0109752 | |||
| 1845 | Ga0496112_0006789 | |||
| 1846 | Ga0496112_0122062 | |||
| 1847 | Ga0496113_0043334 | |||
| 1848 | Ga0496113_0068605 | |||
| 1849 | Ga0496114_0001674 | |||
| 1850 | Ga0496114_0026423 | |||
| 1851 | Ga0496115_0013071 | |||
| 1852 | Ga0496115_0018415 | |||
| 1853 | Ga0496115_0020700 | |||
| 1854 | Ga0496115_0047939 | |||
| 1855 | Ga0496115_0078234 | |||
| 1856 | Ga0496121_0000854 | |||
| 1857 | Ga0496121_0001004 | |||
| 1858 | Ga0496121_0001267 | |||
| 1859 | Ga0496122_0003350 | |||
| 1860 | Ga0496122_0003557 | |||
| 1861 | Ga0496122_0071294 | |||
| 1862 | Ga0496123_0001182 | |||
| 1863 | Ga0496123_0002402 | |||
| 1864 | Ga0496124_0018457 | |||
| 1865 | Ga0496124_0075076 | |||
| 1866 | Ga0496125_0003664 | |||
| 1867 | Ga0496125_0044969 | |||
| 1868 | Ga0496126_0006009 | |||
| 1869 | Ga0495678_001389 | |||
| 1870 | Ga0495682_0000881 | |||
| 1871 | Ga0495682_0012476 | |||
| 1872 | Ga0495682_0050036 | |||
| 1873 | Ga0501031_0026790 | |||
| 1874 | Ga0501031_0074582 | |||
| 1875 | Ga0501032_0009322 | |||
| 1876 | Ga0501034_0058256 | |||
| 1877 | Ga0501034_0088235 | |||
| 1878 | Ga0501034_0127005 | |||
| 1879 | Ga0501034_0169827 | |||
| 1880 | Ga0501036_0016246 | |||
| 1881 | Ga0501037_0056217 | |||
| 1882 | Ga0501039_0266125 | |||
| 1883 | Ga0501042_0070844 | |||
| 1884 | Ga0501043_0061676 | |||
| 1885 | Ga0501046_0089984 | |||
| 1886 | Ga0501047_0000199 | |||
| 1887 | Ga0501047_0026120 | |||
| 1888 | Ga0501047_0033365 | |||
| 1889 | Ga0501047_0060011 | |||
| 1890 | Ga0501047_0066696 | |||
| 1891 | Ga0501047_0326230 | |||
| 1892 | Ga0501047_0372584 | |||
| 1893 | Ga0501048_0033468 | |||
| 1894 | Ga0501067_0003209 | |||
| 1895 | Ga0501067_0013312 | |||
| 1896 | Ga0501070_0000157 | |||
| 1897 | Ga0501070_0010829 | |||
| 1898 | Ga0501070_0024895 | |||
| 1899 | Ga0501070_0061913 | |||
| 1900 | Ga0501072_0004693 | |||
| 1901 | Ga0501073_0003405 | |||
| 1902 | Ga0501073_0025163 | |||
| 1903 | Ga0501075_0127330 | |||
| 1904 | Ga0501238_008224 | |||
| 1905 | Ga0501249_000144 | |||
| 1906 | Ga0501257_001956 | |||
| 1907 | Ga0501079_0033972 | |||
| 1908 | Ga0501079_0046269 | |||
| 1909 | Ga0501079_0179672 | |||
| 1910 | Ga0501080_0000976 | |||
| 1911 | Ga0501080_0010691 | |||
| 1912 | Ga0501080_0012290 | |||
| 1913 | Ga0501080_0064523 | |||
| 1914 | Ga0501080_0222608 | |||
| 1915 | Ga0501080_0260355 | |||
| 1916 | Ga0501035_0001970 | |||
| 1917 | Ga0501035_0009390 | |||
| 1918 | Ga0501035_0173600 | |||
| 1919 | Ga0501044_0001051 | |||
| 1920 | Ga0501044_0003875 | |||
| 1921 | Ga0501044_0015912 | |||
| 1922 | Ga0501044_0019682 | |||
| 1923 | Ga0501044_0039045 | |||
| 1924 | Ga0501044_0040270 | |||
| 1925 | Ga0501044_0150811 | |||
| 1926 | nmdc:mga03683_21577_c1 | |||
| 1927 | nmdc:mga0yw44_64730_c1 | |||
| 1928 | nmdc:mga0k408_1551_c1 | |||
| 1929 | nmdc:mga0k408_502_c1 | |||
| 1930 | nmdc:mga0k408_51160_c1 | |||
| 1931 | nmdc:mga07m45_1182_c1 | |||
| 1932 | nmdc:mga07m45_15563_c1 | |||
| 1933 | nmdc:mga05p37_169892_c1 | |||
| 1934 | nmdc:mga05p37_234048_c1 | |||
| 1935 | nmdc:mga05p37_310846_c1 | |||
| 1936 | nmdc:mga05p37_31537_c1 | |||
| 1937 | nmdc:mga05p37_531968_c1 | |||
| 1938 | nmdc:mga09592_108959_c1 | |||
| 1939 | nmdc:mga09592_140223_c1 | |||
| 1940 | nmdc:mga09592_244684_c1 | |||
| 1941 | nmdc:mga0qj67_10651_c1 | |||
| 1942 | nmdc:mga0qj67_32353_c1 | |||
| 1943 | nmdc:mga06r32_13474_c1 | |||
| 1944 | nmdc:mga06r32_139327_c1 | |||
| 1945 | nmdc:mga06r32_14791_c1 | |||
| 1946 | nmdc:mga06r32_38670_c1 | |||
| 1947 | nmdc:mga06r32_48483_c1 | |||
| 1948 | nmdc:mga08y16_119837_c1 | |||
| 1949 | nmdc:mga08y16_218228_c1 | |||
| 1950 | nmdc:mga08y16_24421_c1 | |||
| 1951 | nmdc:mga08y16_54792_c1 | |||
| 1952 | nmdc:mga08y16_68648_c1 | |||
| 1953 | nmdc:mga0n895_17944_c1 | |||
| 1954 | nmdc:mga0n895_19382_c1 | |||
| 1955 | nmdc:mga0rr50_133828_c1 | |||
| 1956 | nmdc:mga0rr50_16174_c1 | |||
| 1957 | nmdc:mga0rr50_28349_c1 | |||
| 1958 | nmdc:mga08x19_120624_c1 | |||
| 1959 | nmdc:mga08x19_130136_c1 | |||
| 1960 | nmdc:mga08x19_15_c1 | |||
| 1961 | nmdc:mga08x19_4_c1 | |||
| 1962 | nmdc:mga08x19_5876_c1 | |||
| 1963 | nmdc:mga0a205_11907_c1 | |||
| 1964 | nmdc:mga0sz30_429_c1 | |||
| 1965 | Ga0500635_0000142 | |||
| 1966 | Ga0500578_0000035 | |||
| 1967 | Ga0500643_000957 | |||
| 1968 | Ga0500643_007828 | |||
| 1969 | Ga0500644_0000134 | |||
| 1970 | Ga0500646_0004556 | |||
| 1971 | Ga0500651_0122080 | |||
| 1972 | Ga0500651_0122696 | |||
| 1973 | Ga0500641_0012215 | |||
| 1974 | Ga0500554_003364 | |||
| 1975 | Ga0500555_000647 | |||
| 1976 | Ga0500556_0000687 | |||
| 1977 | Ga0500556_0021774 | |||
| 1978 | Ga0500562_000364 | |||
| 1979 | Ga0500562_004497 | |||
| 1980 | Ga0500562_006796 | |||
| 1981 | Ga0500562_012980 | |||
| 1982 | Ga0500569_020140 | |||
| 1983 | Ga0500592_000004 | |||
| 1984 | Ga0500592_000016 | |||
| 1985 | Ga0500592_002464 | |||
| 1986 | Ga0500592_004414 | |||
| 1987 | Ga0500593_000702 | |||
| 1988 | Ga0500594_0000115 | |||
| 1989 | Ga0500594_0005721 | |||
| 1990 | Ga0500595_002983 | |||
| 1991 | Ga0500607_001611 | |||
| 1992 | Ga0500607_016588 | |||
| 1993 | Ga0500607_031759 | |||
| 1994 | Ga0500608_000004 | |||
| 1995 | Ga0500608_000778 | |||
| 1996 | Ga0500608_002848 | |||
| 1997 | Ga0500614_002849 | |||
| 1998 | Ga0500618_000110 | |||
| 1999 | Ga0500642_0000408 | |||
| 2000 | Ga0500642_0013154 | |||
| 2001 | Ga0500655_003243 | |||
| 2002 | Ga0500658_0001807 | |||
| 2003 | Ga0500658_0026094 | |||
| 2004 | Ga0500658_0036406 | |||
| 2005 | Ga0500559_0000055 | |||
| 2006 | Ga0500559_0002897 | |||
| 2007 | Ga0500559_0004196 | |||
| 2008 | Ga0500564_000277 | |||
| 2009 | Ga0500564_010247 | |||
| 2010 | Ga0500568_0000019 | |||
| 2011 | Ga0500590_000885 | |||
| 2012 | Ga0500604_0000196 | |||
| 2013 | Ga0500604_0002657 | |||
| 2014 | Ga0500604_0005332 | |||
| 2015 | Ga0500616_0002247 | |||
| 2016 | Ga0500616_0028952 | |||
| 2017 | Ga0500622_0000474 | |||
| 2018 | Ga0500622_0002770 | |||
| 2019 | Ga0500622_0022106 | |||
| 2020 | Ga0500622_0023914 | |||
| 2021 | Ga0500624_000094 | |||
| 2022 | Ga0500624_000220 | |||
| 2023 | Ga0500624_005835 | |||
| 2024 | Ga0500627_0000044 | |||
| 2025 | Ga0500627_0000340 | |||
| 2026 | Ga0500627_0000454 | |||
| 2027 | Ga0500627_0027131 | |||
| 2028 | Ga0500639_016078 | |||
| 2029 | Ga0500639_067787 | |||
| 2030 | Ga0500636_0000048 | |||
| 2031 | Ga0500636_0005629 | |||
| 2032 | Ga0500636_0009494 | |||
| 2033 | Ga0500636_0011315 | |||
| 2034 | Ga0500637_0000199 | |||
| 2035 | Ga0500637_0000276 | |||
| 2036 | Ga0500637_0000831 | |||
| 2037 | Ga0500637_0003856 | |||
| 2038 | Ga0500637_0004943 | |||
| 2039 | Ga0500637_0006696 | |||
| 2040 | Ga0500567_000358 | |||
| 2041 | Ga0500570_000131 | |||
| 2042 | Ga0500625_000038 | |||
| 2043 | Ga0500625_006345 | |||
| 2044 | Ga0500625_041332 | |||
| 2045 | Ga0500625_046845 | |||
| 2046 | Ga0500625_086103 | |||
| 2047 | Ga0500645_004021 | |||
| 2048 | Ga0500552_000893 | |||
| 2049 | Ga0500596_004767 | |||
| 2050 | Ga0501084_0001458 | |||
| 2051 | Ga0501084_0006709 | |||
| 2052 | Ga0501084_0018707 | |||
| 2053 | Ga0501084_0364331 | |||
| 2054 | Ga0587066_010053 | |||
| 2055 | Ga0587111_0012431 | |||
| 2056 | Ga0501082_0019023 | |||
| 2057 | Ga0501082_0163764 | |||
| 2058 | 2511124747 | |||
| 2059 | 2513592749 | |||
| 2060 | 2515692453 | |||
| 2061 | 2585149349 | |||
| 2062 | 2585153262 | |||
| 2063 | 2585196951 | |||
| 2064 | 2587916347 | |||
| 2065 | 2599501902 | |||
| 2066 | 2599773434 | |||
| 2067 | 2599884385 | |||
| 2068 | 2599896436 | |||
| 2069 | 2599958330 | |||
| 2070 | 2599964198 | |||
| 2071 | 2599976320 | |||
| 2072 | 2600003609 | |||
| 2073 | 2600009913 | |||
| 2074 | 2600016045 | |||
| 2075 | 2600051251 | |||
| 2076 | 2600069340 | |||
| 2077 | 2643727383 | |||
| 2078 | 2643750505 | |||
| 2079 | 2643820854 | |||
| 2080 | 2643834729 | |||
| 2081 | 2643923370 | |||
| 2082 | 2644041457 | |||
| 2083 | 2644055656 | |||
| 2084 | 2644226144 | |||
| 2085 | 2644235632 | |||
| 2086 | 2644394997 | |||
| 2087 | 2644464310 | |||
| 2088 | 2644509600 | |||
| 2089 | 2671089131 | |||
| 2090 | 2792460649 | |||
| 2091 | 2824618512 | |||
| 2092 | 2824627273 | |||
| 2093 | 2824635511 | |||
| 2094 | 2824644348 | |||
| 2095 | 2824720638 | |||
| 2096 | 2824725477 | |||
| 2097 | 2843747748 | |||
| 2098 | 2849565381 | |||
| 2099 | 2849578390 | |||
| 2100 | 2851153833 | |||
| 2101 | 2857509033 | |||
| 2102 | 2884964872 | |||
| 2103 | 2896256538 | |||
| 2104 | 2898329494 | |||
| 2105 | 2898910500 | |||
| 2106 | 2903772488 | |||
| 2107 | 2906650136 | |||
| 2108 | 2928535077 | |||
| 2109 | 2939634904 | |||
| 2110 | 8055272718 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yzo-assembly2.cif.gz_D | crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii | 0.9472 | 10 | 396 |
| 4yzo-assembly2.cif.gz_D | crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii | 0.934 | 10 | 396 |
| 7yvy-assembly3.cif.gz_C | crystal structure of thiolase pfc_04095 from pyrococcus furiosus | 0.9276 | 8 | 396 |
| 4yzo-assembly2.cif.gz_B | crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii | 0.9271 | 10 | 396 |
| 7yvy-assembly2.cif.gz_B | crystal structure of thiolase pfc_04095 from pyrococcus furiosus | 0.9209 | 7 | 396 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4yzoB00 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9254 | 10 | 396 | 3.40.47.10 |
| 4yzoB00 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9126 | 10 | 396 | 3.40.47.10 |
| af_I6YGD8_6_387_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9084 | 10 | 396 | 3.40.47.10 |
| af_Q58944_3_392_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.8996 | 9 | 396 | 3.40.47.10 |
| af_I6YGD8_6_387_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.8992 | 10 | 396 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S8D4F8-F1-model_v4 | Acetyl-CoA acetyltransferase | 0.9911 | 145 | 400 |
GO:0016746
|
| AF-A0A3B9YVT6-F1-model_v4 | Acetyl-CoA acetyltransferase | 0.9879 | 248 | 399 |
GO:0016746
|
| AF-A0A2M8GD56-F1-model_v4 | Acetyl-CoA acetyltransferase | 0.986 | 259 | 398 |
GO:0016746
|
| AF-A0A2S6T8A1-F1-model_v4 | Thiolase C-terminal domain-containing protein | 0.9847 | 226 | 400 |
GO:0016746
|
| AF-A0A661V9R6-F1-model_v4 | Acetyl-CoA acetyltransferase | 0.9847 | 1 | 107 |
GO:0016747
|