F489164

General Info

Members Datasets Scaffolds Average Seq Length
1055 487 2110 398

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0020610|Ga0501032_0020610_2624_3979
Length 451
Sequence MRNRRSRKISAARFRFFSFSFNRLVATAGNLSLYSARNRPLNGGRQQQENKVATGIRDKVAILGMGCSKFGERWDAGAEELMVEAYLEALQDAGVETNQIQAAWFGTAIEEQHVGKGGTPMSVALRLPNIPVTRVENFCASGSEAFRGAVYAVAAGACDIALALGVEKLKDTGYGGLPQREGATLQPLWSANGSAPGNFAQLASAYRAKHNVSKEDLKRAIAHVSVKSHANGAKNPKAHLQKPITEEQCLKAPMIAEPLGLFDCCGVSDGSACAIVTTPEIARAMGKKDIITVKALQLSLSNGLESQHNSWDGSYFHTARIASKRAYEEAGIKDPRNDVSMIEVHDCFSITELVTMEDLHISREGEGWKDVMNGFYDADGQVPCQIDGGLKCFGHPIGASGLRMLYEMYLQLQGRAGARQLKNPKIGLTHNLGGAPMMNVCSVAIIGAQGA

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
189 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
222 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
223 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
224 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
258 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
259 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
260 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
261 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
266 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
270 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
271 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
318 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
319 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
325 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
326 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
353 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
370 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
371 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
372 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
377 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
382 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
388 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
389 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
390 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
391 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
392 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
393 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
394 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
397 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
398 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
399 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
400 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
401 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
402 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
403 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
404 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
407 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
408 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
409 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
410 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
411 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
412 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
413 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
414 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
417 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
420 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
421 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
422 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
423 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
424 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
425 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
426 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
427 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
428 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
429 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
430 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
431 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
432 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
436 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
437 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
438 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
439 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
440 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
441 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
442 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
443 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
444 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
445 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
446 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
447 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
448 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
449 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
450 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
451 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
452 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
453 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
454 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
455 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
456 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
457 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
458 2643221583 Caulobacter sp. Root655 Isolate Unclassified
459 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
460 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
461 2643221640 Caulobacter sp. Root342 Isolate Unclassified
462 2643221642 Caulobacter sp. Root343 Isolate Unclassified
463 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
464 2643221683 Variovorax sp. Root473 Isolate Unclassified
465 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
466 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
467 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
468 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
469 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
470 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
471 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
472 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
473 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
474 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
475 2849560528 Caulobacter zeae 410 Isolate Unclassified
476 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
477 2851153111 Caulobacter radicis 736 Isolate Unclassified
478 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
479 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
480 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
481 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
482 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
483 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
484 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
485 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
486 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
487 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.93
Metatranscriptomes 1.04
Isolates 5.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.04
Nodule 0.28
Rhizoplane 6.26
Rhizosphere 74.31
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0020610 3300049569 Bacteria 4590
2 SwRhRL2b_contig_464563 2162886007 Bacteria 2552
3 rootH1_10071863 3300003316 Bacteria 4375
4 rootH2_10014120 3300003320 Bacteria 22102
5 Ga0055524_1001209 3300003775 Bacteria 15317
6 Ga0055536_1000097 3300003781 Bacteria 75926
7 Ga0055536_1000556 3300003781 Bacteria 25567
8 Ga0055536_1000610 3300003781 Bacteria 24362
9 Ga0055528_1004791 3300003790 Bacteria 6441
10 Ga0055530_10000405 3300003791 Bacteria 38619
11 Ga0055531_10000224 3300003794 Bacteria 62709
12 Ga0055531_10002410 3300003794 Bacteria 12551
13 Ga0065714_10065692 3300005288 Bacteria 8844
14 Ga0065707_10086567 3300005295 Bacteria 5399
15 Ga0070658_10200567 3300005327 Bacteria 1683
16 Ga0070690_100005911 3300005330 Bacteria 6903
17 Ga0070690_100092446 3300005330 Bacteria 1995
18 Ga0070670_100060610 3300005331 Bacteria 3249
19 Ga0070680_100000037 3300005336 Bacteria 66957
20 Ga0070680_100116452 3300005336 Bacteria 2228
21 Ga0070691_10002785 3300005341 Bacteria 7799
22 Ga0070691_10008294 3300005341 Bacteria 4759
23 Ga0070691_10027477 3300005341 Bacteria 2655
24 Ga0070691_10034490 3300005341 Bacteria 2382
25 Ga0070687_100179246 3300005343 Bacteria 1268
26 Ga0070661_100001403 3300005344 Bacteria 16824
27 Ga0070668_100002600 3300005347 Bacteria 13266
28 Ga0070668_100009767 3300005347 Bacteria 7113
29 Ga0070671_100101684 3300005355 Bacteria 2412
30 Ga0070671_100164234 3300005355 Bacteria 1877
31 Ga0070673_100037265 3300005364 Bacteria 3704
32 Ga0070667_100001761 3300005367 Bacteria 19299
33 Ga0070703_10000621 3300005406 Bacteria 12565
34 Ga0070703_10000776 3300005406 Bacteria 10516
35 Ga0070709_10000229 3300005434 Bacteria 36348
36 Ga0070709_10000292 3300005434 Bacteria 31816
37 Ga0070714_100036015 3300005435 Bacteria 4149
38 Ga0070714_100428336 3300005435 Bacteria 1254
39 Ga0070713_100000003 3300005436 Bacteria 245840
40 Ga0070713_100001423 3300005436 Bacteria 15342
41 Ga0070713_100048254 3300005436 Bacteria 3505
42 Ga0070710_10055254 3300005437 Bacteria 2243
43 Ga0070711_100000006 3300005439 Bacteria 187224
44 Ga0070711_100010191 3300005439 Bacteria 5809
45 Ga0070705_100000042 3300005440 Bacteria 64569
46 Ga0070705_100000089 3300005440 Bacteria 50973
47 Ga0070700_100014332 3300005441 Bacteria 4474
48 Ga0070700_100038168 3300005441 Bacteria 2926
49 Ga0070694_100012470 3300005444 Bacteria 5285
50 Ga0070694_100063969 3300005444 Bacteria 2517
51 Ga0070694_100068036 3300005444 Bacteria 2446
52 Ga0070708_100007273 3300005445 Bacteria 8854
53 Ga0070663_100187467 3300005455 Bacteria 1608
54 Ga0070678_100083634 3300005456 Bacteria 2426
55 Ga0070681_10000001 3300005458 Bacteria 946857
56 Ga0070706_100000274 3300005467 Bacteria 62620
57 Ga0070706_100041613 3300005467 Bacteria 4242
58 Ga0070706_100087025 3300005467 Bacteria 2896
59 Ga0070707_100000600 3300005468 Bacteria 36171
60 Ga0070698_100151341 3300005471 Bacteria 2268
61 Ga0070698_100413015 3300005471 Bacteria 1284
62 Ga0070699_100000182 3300005518 Bacteria 60940
63 Ga0070699_100001677 3300005518 Bacteria 20184
64 Ga0070679_100000096 3300005530 Bacteria 67304
65 Ga0070679_100049818 3300005530 Bacteria 4172
66 Ga0070697_100004703 3300005536 Bacteria 10464
67 Ga0070697_100023202 3300005536 Bacteria 4934
68 Ga0070697_100210378 3300005536 Bacteria 1655
69 Ga0068853_100002100 3300005539 Bacteria 14778
70 Ga0068853_100005959 3300005539 Bacteria 9631
71 Ga0068853_100152758 3300005539 Bacteria 2079
72 Ga0068853_100284586 3300005539 Bacteria 1524
73 Ga0070686_100157794 3300005544 Bacteria 1595
74 Ga0070695_100006839 3300005545 Bacteria 6752
75 Ga0070695_100010336 3300005545 Bacteria 5570
76 Ga0070695_100018280 3300005545 Bacteria 4256
77 Ga0070696_100000288 3300005546 Bacteria 30410
78 Ga0070696_100000617 3300005546 Bacteria 22863
79 Ga0070696_100048863 3300005546 Bacteria 2937
80 Ga0070696_100066166 3300005546 Bacteria 2534
81 Ga0070696_100087370 3300005546 Bacteria 2215
82 Ga0070693_100005054 3300005547 Bacteria 6303
83 Ga0070693_100018955 3300005547 Bacteria 3601
84 Ga0070693_100167326 3300005547 Bacteria 1405
85 Ga0070665_100010876 3300005548 Bacteria 9204
86 Ga0070665_100014067 3300005548 Bacteria 8044
87 Ga0070665_100021647 3300005548 Bacteria 6465
88 Ga0070665_100033055 3300005548 Bacteria 5204
89 Ga0070704_100000232 3300005549 Bacteria 23667
90 Ga0070704_100004402 3300005549 Bacteria 8135
91 Ga0070704_100218602 3300005549 Bacteria 1548
92 Ga0068855_100000010 3300005563 Bacteria 246022
93 Ga0068855_100005574 3300005563 Bacteria 15362
94 Ga0068855_100006001 3300005563 Bacteria 14821
95 Ga0068855_100094932 3300005563 Bacteria 3438
96 Ga0068855_100122997 3300005563 Bacteria 2969
97 Ga0070664_100023136 3300005564 Bacteria 5130
98 Ga0070664_100035491 3300005564 Bacteria 4186
99 Ga0068857_100006105 3300005577 Bacteria 10291
100 Ga0068857_100022564 3300005577 Bacteria 5537
101 Ga0068854_100002041 3300005578 Bacteria 12380
102 Ga0068854_100019233 3300005578 Bacteria 4599
103 Ga0068856_100000075 3300005614 Bacteria 94156
104 Ga0068856_100000569 3300005614 Bacteria 40404
105 Ga0068856_100002154 3300005614 Bacteria 20395
106 Ga0068856_100022862 3300005614 Bacteria 6080
107 Ga0068852_100011109 3300005616 Bacteria 6762
108 Ga0068852_100160792 3300005616 Bacteria 2097
109 Ga0068852_100175999 3300005616 Bacteria 2009
110 Ga0068859_100002952 3300005617 Bacteria 17252
111 Ga0068859_100026387 3300005617 Bacteria 5824
112 Ga0068859_100028131 3300005617 Bacteria 5636
113 Ga0068859_100050057 3300005617 Bacteria 4197
114 Ga0068859_100272416 3300005617 Bacteria 1785
115 Ga0068864_100057575 3300005618 Bacteria 3358
116 Ga0068864_100409362 3300005618 Bacteria 1290
117 Ga0068851_10002585 3300005834 Bacteria 7971
118 Ga0068851_10111235 3300005834 Bacteria 1462
119 Ga0068863_100003097 3300005841 Bacteria 16424
120 Ga0068863_100024925 3300005841 Bacteria 5706
121 Ga0068863_100025061 3300005841 Bacteria 5689
122 Ga0068863_100043597 3300005841 Bacteria 4258
123 Ga0068863_100130527 3300005841 Bacteria 2399
124 Ga0068858_100014190 3300005842 Bacteria 7513
125 Ga0068858_100078471 3300005842 Bacteria 3068
126 Ga0068858_100180237 3300005842 Bacteria 1994
127 Ga0068860_100000028 3300005843 Bacteria 266461
128 Ga0068860_100000032 3300005843 Bacteria 251624
129 Ga0068860_100013934 3300005843 Bacteria 7881
130 Ga0068860_100028256 3300005843 Bacteria 5398
131 Ga0068860_100082902 3300005843 Bacteria 3049
132 Ga0068860_100097696 3300005843 Bacteria 2800
133 Ga0068860_100109627 3300005843 Bacteria 2638
134 Ga0068862_100001018 3300005844 Bacteria 26950
135 Ga0068862_100021065 3300005844 Bacteria 5448
136 Ga0068862_100085502 3300005844 Unclassified 2741
137 Ga0068862_100119011 3300005844 Archaea 2326
138 Ga0068862_100224553 3300005844 Bacteria 1701
139 Ga0081455_10001326 3300005937 Bacteria 30601
140 Ga0081455_10002294 3300005937 Bacteria 22790
141 Ga0081455_10003139 3300005937 Bacteria 19212
142 Ga0081538_10054561 3300005981 Bacteria 2362
143 Ga0081540_1001742 3300005983 Bacteria 18317
144 Ga0081540_1028171 3300005983 Bacteria 3162
145 Ga0081539_10001914 3300005985 Bacteria 32227
146 Ga0081539_10013380 3300005985 Bacteria 6187
147 Ga0081539_10052874 3300005985 Bacteria 2277
148 Ga0081539_10115600 3300005985 Bacteria 1342
149 Ga0075368_10072859 3300006042 Bacteria 1389
150 Ga0075363_100000521 3300006048 Bacteria 12370
151 Ga0070716_100024116 3300006173 Bacteria 3235
152 Ga0070712_100000027 3300006175 Bacteria 77007
153 Ga0070712_100001822 3300006175 Bacteria 12980
154 Ga0070712_100004188 3300006175 Bacteria 8873
155 Ga0075367_10000520 3300006178 Bacteria 14497
156 Ga0075367_10015224 3300006178 Bacteria 4175
157 Ga0075369_10007727 3300006186 Bacteria 4109
158 Ga0075369_10030881 3300006186 Bacteria 2258
159 Ga0075369_10032518 3300006186 Bacteria 2207
160 Ga0075366_10008672 3300006195 Bacteria 5661
161 Ga0097621_100010821 3300006237 Bacteria 6693
162 Ga0075370_10009113 3300006353 Bacteria 5135
163 Ga0075370_10055967 3300006353 Bacteria 2241
164 Ga0068871_100002451 3300006358 Bacteria 12671
165 Ga0075428_100006408 3300006844 Bacteria 13094
166 Ga0075428_100009476 3300006844 Bacteria 10808
167 Ga0075428_100010017 3300006844 Bacteria 10527
168 Ga0075428_100084017 3300006844 Bacteria 3474
169 Ga0075430_100080242 3300006846 Bacteria 2733
170 Ga0075431_100010582 3300006847 Bacteria 9276
171 Ga0075431_100010694 3300006847 Bacteria 9221
172 Ga0075433_10011348 3300006852 Bacteria 7171
173 Ga0075433_10015023 3300006852 Bacteria 6337
174 Ga0075433_10139155 3300006852 Unclassified 2158
175 Ga0075434_100004616 3300006871 Bacteria 12443
176 Ga0075434_100377390 3300006871 Unclassified 1439
177 Ga0075429_100095542 3300006880 Bacteria 2592
178 Ga0068865_100008468 3300006881 Bacteria 6358
179 Ga0068865_100045580 3300006881 Bacteria 3006
180 Ga0068865_100249939 3300006881 Bacteria 1399
181 Ga0075436_100000038 3300006914 Bacteria 82918
182 Ga0075436_100000820 3300006914 Bacteria 20670
183 Ga0075436_100005599 3300006914 Bacteria 8618
184 Ga0097620_100002952 3300006931 Bacteria 17252
185 Ga0097620_100026387 3300006931 Bacteria 5824
186 Ga0097620_100028132 3300006931 Bacteria 5636
187 Ga0097620_100050057 3300006931 Bacteria 4197
188 Ga0097620_100272429 3300006931 Bacteria 1785
189 Ga0075435_100003260 3300007076 Bacteria 10993
190 Ga0075435_100019175 3300007076 Bacteria 5217
191 Ga0099794_10022855 3300007265 Bacteria 2854
192 Ga0099794_10070331 3300007265 Bacteria 1713
193 Ga0099795_10000235 3300007788 Bacteria 9762
194 Ga0105240_10000189 3300009093 Bacteria 125396
195 Ga0105240_10006687 3300009093 Bacteria 16904
196 Ga0105240_10012045 3300009093 Bacteria 11986
197 Ga0105240_10015182 3300009093 Bacteria 10481
198 Ga0105240_10015309 3300009093 Bacteria 10435
199 Ga0105240_10018751 3300009093 Bacteria 9269
200 Ga0105240_10025885 3300009093 Bacteria 7703
201 Ga0105240_10055553 3300009093 Bacteria 4957
202 Ga0105240_10071493 3300009093 Bacteria 4291
203 Ga0111539_10030909 3300009094 Bacteria 6508
204 Ga0111539_10073034 3300009094 Bacteria 4045
205 Ga0111539_10077333 3300009094 Bacteria 3917
206 Ga0111539_10287823 3300009094 Bacteria 1912
207 Ga0111539_10411681 3300009094 Bacteria 1575
208 Ga0111539_10468913 3300009094 Bacteria 1466
209 Ga0105245_10014018 3300009098 Bacteria 6981
210 Ga0105247_10016215 3300009101 Bacteria 4464
211 Ga0105247_10081842 3300009101 Bacteria 2036
212 Ga0114129_10064342 3300009147 Bacteria 5118
213 Ga0114129_10157671 3300009147 Bacteria 3103
214 Ga0114129_10173376 3300009147 Unclassified 2939
215 Ga0114129_10420599 3300009147 Bacteria 1757
216 Ga0105243_10071304 3300009148 Bacteria 2809
217 Ga0105243_10091667 3300009148 Bacteria 2503
218 Ga0105243_10124888 3300009148 Bacteria 2175
219 Ga0105241_10025127 3300009174 Bacteria 4427
220 Ga0105241_10040227 3300009174 Bacteria 3529
221 Ga0105241_10219464 3300009174 Bacteria 1597
222 Ga0105242_10000830 3300009176 Bacteria 24033
223 Ga0105248_10000001 3300009177 Bacteria 1881304
224 Ga0105248_10128355 3300009177 Bacteria 2860
225 Ga0105248_10327048 3300009177 Bacteria 1727
226 Ga0105237_10000304 3300009545 Bacteria 68213
227 Ga0105237_10000443 3300009545 Bacteria 58933
228 Ga0105237_10012505 3300009545 Bacteria 8942
229 Ga0105238_10016013 3300009551 Bacteria 7584
230 Ga0105238_10031136 3300009551 Bacteria 5431
231 Ga0105238_10081652 3300009551 Bacteria 3222
232 Ga0105238_10125859 3300009551 Bacteria 2541
233 Ga0105249_10000305 3300009553 Bacteria 49977
234 Ga0105249_10012411 3300009553 Bacteria 7511
235 Ga0105249_10060693 3300009553 Bacteria 3469
236 Ga0099796_10000154 3300010159 Bacteria 10174
237 Ga0099796_10006478 3300010159 Bacteria 2999
238 Ga0105239_10003215 3300010375 Bacteria 20207
239 Ga0105239_10008512 3300010375 Bacteria 11663
240 Ga0105239_10016434 3300010375 Bacteria 8183
241 Ga0105239_10022608 3300010375 Bacteria 6932
242 Ga0105239_10046524 3300010375 Bacteria 4755
243 Ga0105239_10048125 3300010375 Bacteria 4675
244 Ga0105239_10232498 3300010375 Bacteria 2068
245 Ga0105246_10069574 3300011119 Bacteria 2472
246 Ga0157373_10000340 3300013100 Bacteria 37871
247 Ga0157373_10000686 3300013100 Bacteria 26568
248 Ga0157373_10014411 3300013100 Bacteria 5795
249 Ga0157373_10071323 3300013100 Bacteria 2454
250 Ga0157369_10055553 3300013105 Bacteria 4274
251 Ga0157369_10060202 3300013105 Bacteria 4095
252 Ga0157369_10166168 3300013105 Bacteria 2327
253 Ga0157374_10038241 3300013296 Bacteria 4410
254 Ga0157378_10002709 3300013297 Bacteria 15778
255 Ga0163162_10021263 3300013306 Bacteria 6386
256 Ga0157372_10005699 3300013307 Bacteria 13257
257 Ga0157375_10041951 3300013308 Bacteria 4423
258 Ga0157375_10102579 3300013308 Bacteria 2946
259 Ga0157375_10181588 3300013308 Bacteria 2256
260 Ga0163163_10001576 3300014325 Bacteria 19224
261 Ga0163163_10015060 3300014325 Bacteria 7133
262 Ga0163163_10082445 3300014325 Bacteria 3219
263 Ga0163163_10292800 3300014325 Bacteria 1680
264 Ga0157380_10195128 3300014326 Bacteria 1791
265 Ga0182008_10000207 3300014497 Bacteria 46359
266 Ga0157379_10005876 3300014968 Bacteria 10558
267 Ga0157379_10016970 3300014968 Bacteria 6408
268 Ga0157379_10053130 3300014968 Bacteria 3620
269 Ga0157379_10189838 3300014968 Bacteria 1857
270 Ga0157379_10437339 3300014968 Bacteria 1206
271 Ga0197907_10728211 3300020069 Bacteria 1802
272 Ga0206352_11247993 3300020078 Bacteria 1620
273 Ga0213876_10000316 3300021384 Bacteria 42531
274 Ga0213876_10000431 3300021384 Bacteria 34586
275 Ga0213876_10002998 3300021384 Bacteria 9772
276 Ga0213875_10000117 3300021388 Bacteria 89143
277 Ga0213871_10012583 3300021441 Bacteria 1970
278 Ga0224712_10024255 3300022467 Bacteria 2116
279 Ga0209565_1000414 3300025263 Bacteria 35246
280 Ga0209673_1001894 3300025273 Bacteria 16797
281 Ga0209676_1000031 3300025292 Bacteria 478976
282 Ga0209676_1000057 3300025292 Bacteria 361061
283 Ga0209676_1000077 3300025292 Bacteria 298831
284 Ga0209676_1006896 3300025292 Bacteria 5487
285 Ga0209025_1000029 3300025294 Bacteria 488571
286 Ga0209758_1006233 3300025297 Bacteria 8699
287 Ga0209050_1000087 3300025298 Bacteria 261460
288 Ga0209050_1000096 3300025298 Bacteria 240109
289 Ga0209050_1008634 3300025298 Bacteria 5390
290 Ga0209256_1000353 3300025299 Bacteria 74809
291 Ga0209051_1005874 3300025303 Bacteria 7055
292 Ga0209257_1000050 3300025304 Bacteria 439325
293 Ga0209257_1000130 3300025304 Bacteria 212188
294 Ga0209257_1007067 3300025304 Bacteria 6936
295 Ga0207697_10029271 3300025315 Bacteria 2253
296 Ga0207655_1018995 3300025728 Bacteria 3617
297 Ga0207653_10000115 3300025885 Bacteria 56386
298 Ga0207692_10028032 3300025898 Bacteria 2659
299 Ga0207647_10000943 3300025904 Bacteria 22491
300 Ga0207647_10006279 3300025904 Bacteria 8653
301 Ga0207647_10058361 3300025904 Bacteria 2363
302 Ga0207699_10000031 3300025906 Bacteria 137708
303 Ga0207699_10000425 3300025906 Bacteria 21588
304 Ga0207645_10166571 3300025907 Bacteria 1443
305 Ga0207705_10000608 3300025909 Bacteria 30010
306 Ga0207705_10086367 3300025909 Bacteria 2293
307 Ga0207684_10000174 3300025910 Bacteria 106440
308 Ga0207684_10151851 3300025910 Bacteria 1993
309 Ga0207654_10054778 3300025911 Bacteria 2306
310 Ga0207707_10000001 3300025912 Bacteria 1212482
311 Ga0207707_10003660 3300025912 Bacteria 13634
312 Ga0207707_10083776 3300025912 Bacteria 2784
313 Ga0207707_10084843 3300025912 Bacteria 2767
314 Ga0207707_10182384 3300025912 Bacteria 1832
315 Ga0207695_10000003 3300025913 Bacteria 1368691
316 Ga0207695_10015409 3300025913 Bacteria 9001
317 Ga0207695_10020718 3300025913 Bacteria 7523
318 Ga0207695_10071991 3300025913 Bacteria 3529
319 Ga0207695_10072200 3300025913 Bacteria 3523
320 Ga0207695_10078597 3300025913 Bacteria 3347
321 Ga0207671_10000996 3300025914 Bacteria 34857
322 Ga0207671_10034164 3300025914 Bacteria 3780
323 Ga0207693_10000299 3300025915 Bacteria 46202
324 Ga0207693_10003652 3300025915 Bacteria 13135
325 Ga0207693_10010227 3300025915 Bacteria 7618
326 Ga0207693_10071335 3300025915 Bacteria 2719
327 Ga0207693_10139979 3300025915 Bacteria 1903
328 Ga0207663_10000064 3300025916 Bacteria 52339
329 Ga0207663_10019212 3300025916 Bacteria 3844
330 Ga0207660_10000271 3300025917 Bacteria 34033
331 Ga0207660_10000869 3300025917 Bacteria 19963
332 Ga0207660_10001144 3300025917 Bacteria 17687
333 Ga0207662_10054252 3300025918 Bacteria 2390
334 Ga0207662_10145430 3300025918 Bacteria 1504
335 Ga0207657_10043459 3300025919 Bacteria 3957
336 Ga0207657_10069329 3300025919 Bacteria 2993
337 Ga0207657_10112394 3300025919 Bacteria 2248
338 Ga0207649_10000073 3300025920 Bacteria 86636
339 Ga0207652_10000201 3300025921 Bacteria 63129
340 Ga0207646_10000955 3300025922 Bacteria 37224
341 Ga0207646_10185920 3300025922 Bacteria 1877
342 Ga0207681_10107659 3300025923 Bacteria 2022
343 Ga0207694_10000011 3300025924 Bacteria 417640
344 Ga0207694_10024807 3300025924 Bacteria 4554
345 Ga0207694_10077962 3300025924 Bacteria 2597
346 Ga0207694_10135056 3300025924 Bacteria 1980
347 Ga0207650_10020873 3300025925 Bacteria 4626
348 Ga0207659_10029064 3300025926 Bacteria 3763
349 Ga0207700_10000010 3300025928 Bacteria 298473
350 Ga0207700_10179334 3300025928 Bacteria 1773
351 Ga0207664_10045659 3300025929 Bacteria 3436
352 Ga0207664_10223974 3300025929 Bacteria 1632
353 Ga0207644_10001940 3300025931 Bacteria 13423
354 Ga0207706_10041166 3300025933 Bacteria 4096
355 Ga0207706_10074972 3300025933 Bacteria 2975
356 Ga0207686_10008224 3300025934 Bacteria 5630
357 Ga0207709_10030712 3300025935 Bacteria 3129
358 Ga0207709_10142067 3300025935 Bacteria 1651
359 Ga0207704_10013874 3300025938 Bacteria 4051
360 Ga0207704_10018865 3300025938 Bacteria 3611
361 Ga0207665_10008683 3300025939 Bacteria 6685
362 Ga0207665_10032169 3300025939 Bacteria 3473
363 Ga0207665_10136015 3300025939 Bacteria 1749
364 Ga0207691_10127561 3300025940 Bacteria 2250
365 Ga0207691_10292332 3300025940 Bacteria 1401
366 Ga0207711_10000002 3300025941 Bacteria 1228676
367 Ga0207711_10084414 3300025941 Bacteria 2780
368 Ga0207689_10178824 3300025942 Bacteria 1750
369 Ga0207661_10147264 3300025944 Bacteria 2033
370 Ga0207679_10014729 3300025945 Bacteria 5150
371 Ga0207667_10000093 3300025949 Bacteria 145814
372 Ga0207667_10003109 3300025949 Bacteria 20539
373 Ga0207667_10003876 3300025949 Bacteria 18396
374 Ga0207667_10007215 3300025949 Bacteria 13410
375 Ga0207667_10019181 3300025949 Bacteria 7649
376 Ga0207667_10178808 3300025949 Bacteria 2179
377 Ga0207667_10396611 3300025949 Bacteria 1405
378 Ga0207712_10029350 3300025961 Bacteria 3689
379 Ga0207712_10051323 3300025961 Bacteria 2884
380 Ga0207668_10005799 3300025972 Bacteria 7275
381 Ga0207668_10024219 3300025972 Bacteria 3914
382 Ga0207668_10035882 3300025972 Bacteria 3306
383 Ga0207640_10017526 3300025981 Bacteria 4193
384 Ga0207640_10022855 3300025981 Bacteria 3749
385 Ga0207658_10000413 3300025986 Bacteria 40641
386 Ga0207658_10003527 3300025986 Bacteria 11040
387 Ga0207658_10095771 3300025986 Bacteria 2313
388 Ga0207658_10144713 3300025986 Bacteria 1928
389 Ga0207703_10008184 3300026035 Bacteria 8262
390 Ga0207703_10067720 3300026035 Bacteria 2939
391 Ga0207703_10231597 3300026035 Bacteria 1656
392 Ga0207703_10319770 3300026035 Bacteria 1421
393 Ga0207639_10002625 3300026041 Bacteria 12062
394 Ga0207639_10055932 3300026041 Bacteria 3021
395 Ga0207639_10251479 3300026041 Bacteria 1541
396 Ga0207678_10020172 3300026067 Bacteria 5853
397 Ga0207708_10010918 3300026075 Bacteria 6755
398 Ga0207708_10025380 3300026075 Bacteria 4482
399 Ga0207708_10094347 3300026075 Bacteria 2310
400 Ga0207702_10000013 3300026078 Bacteria 257468
401 Ga0207702_10000911 3300026078 Bacteria 30601
402 Ga0207702_10031997 3300026078 Bacteria 4387
403 Ga0207702_10158180 3300026078 Bacteria 2067
404 Ga0207641_10002755 3300026088 Bacteria 16035
405 Ga0207641_10104666 3300026088 Bacteria 2499
406 Ga0207641_10113084 3300026088 Bacteria 2410
407 Ga0207641_10322570 3300026088 Bacteria 1465
408 Ga0207676_10058036 3300026095 Bacteria 3051
409 Ga0207676_10277592 3300026095 Bacteria 1520
410 Ga0207676_10299225 3300026095 Bacteria 1468
411 Ga0207674_10002517 3300026116 Bacteria 23099
412 Ga0207674_10008737 3300026116 Bacteria 11663
413 Ga0207674_10013600 3300026116 Bacteria 9016
414 Ga0207674_10014644 3300026116 Bacteria 8649
415 Ga0207674_10042429 3300026116 Bacteria 4698
416 Ga0207674_10148907 3300026116 Bacteria 2298
417 Ga0207675_100064397 3300026118 Bacteria 3426
418 Ga0207683_10211259 3300026121 Bacteria 1766
419 Ga0207698_10007581 3300026142 Bacteria 6804
420 Ga0207698_10015630 3300026142 Bacteria 5090
421 Ga0207698_10151213 3300026142 Bacteria 2015
422 Ga0207698_10204543 3300026142 Bacteria 1771
423 Ga0207698_10314253 3300026142 Bacteria 1464
424 Ga0209179_1000002 3300027512 Bacteria 124932
425 Ga0207428_10017230 3300027907 Bacteria 6204
426 Ga0207428_10091798 3300027907 Bacteria 2357
427 Ga0207428_10128445 3300027907 Bacteria 1941
428 Ga0268266_10017674 3300028379 Bacteria 6081
429 Ga0268266_10098466 3300028379 Bacteria 2573
430 Ga0268266_10268389 3300028379 Bacteria 1583
431 Ga0268265_10004878 3300028380 Bacteria 9242
432 Ga0268265_10013328 3300028380 Bacteria 5585
433 Ga0268265_10021695 3300028380 Bacteria 4503
434 Ga0268265_10081210 3300028380 Bacteria 2559
435 Ga0268264_10000045 3300028381 Bacteria 364764
436 Ga0268264_10000066 3300028381 Bacteria 285125
437 Ga0268264_10007343 3300028381 Bacteria 9210
438 Ga0268264_10010641 3300028381 Bacteria 7601
439 Ga0268264_10018782 3300028381 Bacteria 5653
440 Ga0268264_10092459 3300028381 Bacteria 2611
441 Ga0265334_10005936 3300028573 Bacteria 5314
442 Ga0265334_10008584 3300028573 Bacteria 4340
443 Ga0265318_10000018 3300028577 Bacteria 173038
444 Ga0265318_10009405 3300028577 Bacteria 4299
445 Ga0307515_10077040 3300028794 Bacteria 4410
446 Ga0307515_10104909 3300028794 Bacteria 3371
447 Ga0265338_10000014 3300028800 Bacteria 378751
448 Ga0265338_10005551 3300028800 Bacteria 16418
449 Ga0265338_10037990 3300028800 Bacteria 4571
450 Ga0307511_10004718 3300030521 Bacteria 13934
451 Ga0307511_10024288 3300030521 Bacteria 5621
452 Ga0265320_10028747 3300031240 Bacteria 2884
453 Ga0265325_10000001 3300031241 Bacteria 726814
454 Ga0265325_10003363 3300031241 Bacteria 10494
455 Ga0265325_10004801 3300031241 Bacteria 8465
456 Ga0265340_10000584 3300031247 Bacteria 20240
457 Ga0265340_10023840 3300031247 Bacteria 3114
458 Ga0265340_10036101 3300031247 Bacteria 2451
459 Ga0265340_10050005 3300031247 Bacteria 2029
460 Ga0265339_10000135 3300031249 Bacteria 60639
461 Ga0265339_10000912 3300031249 Bacteria 22718
462 Ga0265331_10000006 3300031250 Bacteria 418907
463 Ga0265331_10000419 3300031250 Bacteria 43019
464 Ga0265331_10016760 3300031250 Bacteria 3839
465 Ga0265327_10000074 3300031251 Bacteria 214435
466 Ga0265316_10110635 3300031344 Bacteria 2080
467 Ga0307513_10086621 3300031456 Bacteria 3210
468 Ga0307513_10102065 3300031456 Bacteria 2888
469 Ga0307509_10000013 3300031507 Bacteria 283027
470 Ga0307509_10000500 3300031507 Bacteria 66483
471 Ga0307408_100338802 3300031548 Bacteria 1272
472 Ga0265313_10003117 3300031595 Bacteria 13696
473 Ga0265313_10009233 3300031595 Bacteria 6427
474 Ga0265313_10086774 3300031595 Bacteria 1412
475 Ga0307508_10027770 3300031616 Bacteria 5121
476 Ga0307508_10104370 3300031616 Bacteria 2431
477 Ga0316575_10000104 3300031665 Bacteria 21155
478 Ga0316575_10003913 3300031665 Bacteria 5205
479 Ga0316575_10007114 3300031665 Bacteria 4048
480 Ga0316575_10014560 3300031665 Bacteria 2955
481 Ga0316579_10001369 3300031691 Bacteria 8834
482 Ga0316579_10008387 3300031691 Bacteria 4305
483 Ga0316579_10026682 3300031691 Bacteria 2617
484 Ga0316579_10093212 3300031691 Bacteria 1439
485 Ga0265314_10000370 3300031711 Bacteria 61431
486 Ga0265314_10019879 3300031711 Bacteria 5193
487 Ga0265314_10036733 3300031711 Bacteria 3556
488 Ga0265314_10043142 3300031711 Bacteria 3210
489 Ga0265342_10016644 3300031712 Bacteria 4799
490 Ga0265342_10040876 3300031712 Bacteria 2809
491 Ga0265342_10076603 3300031712 Bacteria 1939
492 Ga0316576_10000424 3300031727 Bacteria 19508
493 Ga0316576_10002167 3300031727 Bacteria 11079
494 Ga0316576_10013535 3300031727 Bacteria 5428
495 Ga0316576_10025772 3300031727 Bacteria 4119
496 Ga0316576_10069422 3300031727 Bacteria 2598
497 Ga0316576_10110088 3300031727 Bacteria 2064
498 Ga0316578_10000074 3300031728 Bacteria 22557
499 Ga0316578_10008537 3300031728 Bacteria 5221
500 Ga0316578_10048873 3300031728 Bacteria 2471
501 Ga0316578_10079150 3300031728 Bacteria 1954
502 Ga0307516_10000095 3300031730 Bacteria 99115
503 Ga0307516_10000099 3300031730 Bacteria 97472
504 Ga0307405_10014321 3300031731 Bacteria 4260
505 Ga0307405_10101810 3300031731 Bacteria 1928
506 Ga0316577_10000480 3300031733 Bacteria 15760
507 Ga0316577_10003948 3300031733 Bacteria 7581
508 Ga0316577_10018265 3300031733 Bacteria 3877
509 Ga0316577_10018907 3300031733 Bacteria 3812
510 Ga0316577_10035412 3300031733 Bacteria 2790
511 Ga0316577_10035878 3300031733 Bacteria 2772
512 Ga0316577_10045969 3300031733 Bacteria 2439
513 Ga0307413_10047983 3300031824 Bacteria 2550
514 Ga0307406_10131094 3300031901 Bacteria 1760
515 Ga0307412_10023232 3300031911 Bacteria 3812
516 Ga0307416_100056284 3300032002 Bacteria 3173
517 Ga0307414_10020609 3300032004 Bacteria 4113
518 Ga0307411_10015885 3300032005 Bacteria 4244
519 Ga0307415_100091431 3300032126 Bacteria 2204
520 Ga0316583_10001545 3300032133 Bacteria 7735
521 Ga0316583_10005386 3300032133 Bacteria 4593
522 Ga0316583_10063597 3300032133 Bacteria 1292
523 Ga0316585_10010759 3300032137 Bacteria 2689
524 Ga0316580_10008574 3300032139 Bacteria 3064
525 Ga0316593_10007913 3300032168 Bacteria 2940
526 Ga0307510_10000003 3300033180 Bacteria 756654
527 Ga0316592_1004221 3300033524 Bacteria 2656
528 Ga0316586_1001568 3300033527 Bacteria 2664
529 Ga0316586_1001613 3300033527 Bacteria 2639
530 Ga0316588_1004434 3300033528 Bacteria 2658
531 Ga0316587_1001975 3300033529 Bacteria 2658
532 Ga0373944_0004452 3300035089 Bacteria 3650
533 Ga0373951_0020609 3300035091 Bacteria 1510
534 Ga0373952_0010918 3300035092 Bacteria 1764
535 Ga0373936_0003172 3300035113 Bacteria 6155
536 Ga0373939_0002211 3300035114 Bacteria 4605
537 Ga0373939_0033072 3300035114 Bacteria 1507
538 Ga0373960_0008324 3300035121 Bacteria 2483
539 Ga0373943_0009757 3300035170 Bacteria 4299
540 Ga0373946_0023948 3300035171 Bacteria 2389
541 Ga0373955_0032738 3300035172 Bacteria 2732
542 Ga0373942_0004075 3300035207 Bacteria 3408
543 Ga0373961_0029968 3300035241 Bacteria 1510
544 Ga0316574_0001352 3300035398 Bacteria 11538
545 Ga0316574_0047504 3300035398 Bacteria 2664
546 Ga0316574_0051815 3300035398 Bacteria 2558
547 Ga0316574_0057347 3300035398 Bacteria 2438
548 Ga0373931_0000492 3300035691 Bacteria 16117
549 Ga0373931_0005836 3300035691 Bacteria 5728
550 Ga0373935_0033002 3300035692 Bacteria 3220
551 Ga0373935_0190318 3300035692 Bacteria 1413
552 Ga0373927_0000452 3300035695 Bacteria 31376
553 Ga0373927_0027785 3300035695 Bacteria 3694
554 Ga0373927_0068113 3300035695 Bacteria 2303
555 Ga0373933_0027534 3300035724 Bacteria 3274
556 Ga0373947_0019131 3300035725 Bacteria 3947
557 Ga0373937_0037105 3300036401 Bacteria 4441
558 Ga0373937_0040197 3300036401 Bacteria 4263
559 Ga0373937_0218055 3300036401 Bacteria 1796
560 Ga0373937_0231484 3300036401 Bacteria 1740
561 Ga0316582_0000536 3300036647 Bacteria 14479
562 Ga0316582_0005483 3300036647 Bacteria 6541
563 Ga0316582_0009637 3300036647 Bacteria 5250
564 Ga0316582_0019403 3300036647 Bacteria 3978
565 Ga0316582_0029095 3300036647 Bacteria 3354
566 Ga0316582_0043414 3300036647 Bacteria 2820
567 Ga0316582_0100342 3300036647 Bacteria 1916
568 Ga0316582_0153266 3300036647 Unclassified 1559
569 Ga0316584_0012961 3300036712 Bacteria 5890
570 Ga0316584_0021157 3300036712 Bacteria 4723
571 Ga0316584_0025801 3300036712 Unclassified 4313
572 Ga0316584_0043726 3300036712 Bacteria 3341
573 Ga0316584_0113768 3300036712 Bacteria 2024
574 Ga0316584_0118285 3300036712 Bacteria 1981
575 Ga0316584_0148136 3300036712 Bacteria 1748
576 Ga0373925_0000173 3300037068 Bacteria 69877
577 Ga0373925_0192651 3300037068 Bacteria 1618
578 Ga0395900_0052656 3300037418 Bacteria 4190
579 Ga0395900_0067352 3300037418 Bacteria 3678
580 Ga0395900_0242719 3300037418 Bacteria 1806
581 Ga0395898_0006599 3300037466 Bacteria 12370
582 Ga0395898_0119619 3300037466 Bacteria 2523
583 Ga0395905_0000042 3300037471 Bacteria 247894
584 Ga0316581_0001321 3300037588 Bacteria 5502
585 Ga0316581_0001549 3300037588 Bacteria 5219
586 Ga0316581_0010798 3300037588 Bacteria 2540
587 Ga0316581_0012137 3300037588 Bacteria 2422
588 Ga0316581_0037575 3300037588 Bacteria 1471
589 Ga0436364_0410618 3300037853 Bacteria 84995
590 Ga0436364_0700727 3300037853 Bacteria 4107
591 Ga0436364_1101563 3300037853 Bacteria 8996
592 Ga0395901_0003446 3300038443 Bacteria 15944
593 Ga0395901_0023659 3300038443 Bacteria 6298
594 Ga0395901_0247044 3300038443 Bacteria 1860
595 Ga0395901_0267845 3300038443 Bacteria 1777
596 Ga0237819_02732 3300038705 Bacteria 3406
597 Ga0400490_09265 3300038726 Bacteria 2477
598 Ga0400490_14729 3300038726 Bacteria 1672
599 Ga0400488_28709 3300038741 Bacteria 1384
600 Ga0400488_55998 3300038741 Bacteria 3672
601 Ga0400483_101319 3300039062 Bacteria 11553
602 Ga0400489_47030 3300039093 Bacteria 10620
603 Ga0400489_67259 3300039093 Bacteria 31816
604 Ga0400489_72336 3300039093 Bacteria 113152
605 Ga0400489_83150 3300039093 Bacteria 1372
606 Ga0436365_0131305 3300039437 Bacteria 51128
607 Ga0436365_0411002 3300039437 Bacteria 12397
608 Ga0436365_0585577 3300039437 Bacteria 67545
609 Ga0436365_1518071 3300039437 Bacteria 2768
610 Ga0436363_0717745 3300039450 Bacteria 3865
611 Ga0439436_0006472 3300041404 Bacteria 3595
612 Ga0439438_000037 3300041405 Bacteria 66914
613 Ga0439447_000082 3300041407 Bacteria 33762
614 Ga0439432_031639 3300042006 Bacteria 1710
615 Ga0439449_0002362 3300042007 Bacteria 7391
616 Ga0439451_000016 3300042009 Bacteria 40219
617 Ga0439434_0015057 3300042435 Bacteria 2304
618 Ga0439435_0040848 3300042436 Bacteria 1297
619 Ga0451577_0029064 3300042876 Bacteria 4998
620 Ga0453683_0004087 3300044673 Bacteria 10489
621 Ga0453683_0070467 3300044673 Bacteria 2187
622 Ga0466963_0104316 3300044694 Bacteria 1942
623 Ga0453684_0396898 3300044712 Bacteria 1545
624 Ga0451576_0000492 3300045051 Bacteria 87364
625 Ga0466967_0082680 3300045976 Bacteria 2902
626 Ga0495617_038475 3300046452 Bacteria 1600
627 Ga0495627_000901 3300046453 Bacteria 20743
628 Ga0495627_012316 3300046453 Bacteria 3041
629 Ga0495603_0080442 3300046455 Bacteria 1910
630 Ga0495629_0028809 3300046459 Bacteria 3942
631 Ga0495629_0149057 3300046459 Bacteria 1626
632 Ga0495638_0000016 3300046460 Bacteria 396505
633 Ga0495638_0000351 3300046460 Bacteria 57664
634 Ga0495638_0000672 3300046460 Bacteria 37144
635 Ga0495651_0154315 3300046462 Bacteria 1652
636 Ga0495650_0000007 3300046471 Bacteria 718072
637 Ga0495580_0000006 3300046472 Bacteria 105024
638 Ga0495580_0002873 3300046472 Bacteria 14828
639 Ga0495580_0006825 3300046472 Bacteria 9245
640 Ga0495580_0007177 3300046472 Bacteria 8969
641 Ga0495580_0013230 3300046472 Bacteria 6307
642 Ga0495580_0189012 3300046472 Bacteria 1421
643 Ga0495639_0074889 3300046475 Bacteria 1569
644 Ga0495664_0007589 3300046477 Bacteria 6029
645 Ga0495584_0018115 3300046491 Bacteria 3580
646 Ga0495594_0013880 3300046499 Bacteria 4214
647 Ga0495596_0001169 3300046500 Bacteria 15394
648 Ga0495583_0000024 3300046506 Bacteria 274122
649 Ga0495583_0000094 3300046506 Bacteria 153549
650 Ga0495583_0003214 3300046506 Bacteria 12787
651 Ga0495606_0005968 3300046507 Bacteria 11425
652 Ga0495610_0000029 3300046512 Bacteria 271137
653 Ga0495610_0000057 3300046512 Bacteria 138069
654 Ga0495610_0001407 3300046512 Bacteria 21348
655 Ga0495610_0023433 3300046512 Bacteria 3356
656 Ga0495610_0033100 3300046512 Bacteria 2675
657 Ga0495616_0000032 3300046513 Bacteria 130692
658 Ga0495616_0000122 3300046513 Bacteria 67299
659 Ga0495616_0067526 3300046513 Bacteria 1738
660 Ga0495620_0000079 3300046515 Bacteria 80460
661 Ga0495631_0003669 3300046518 Bacteria 8382
662 Ga0495632_0000001 3300046519 Bacteria 873295
663 Ga0495632_0000440 3300046519 Bacteria 39608
664 Ga0495632_0027463 3300046519 Bacteria 2981
665 Ga0495632_0091752 3300046519 Bacteria 1439
666 Ga0495637_0000108 3300046520 Bacteria 60028
667 Ga0495637_0007300 3300046520 Bacteria 5493
668 Ga0495637_0007592 3300046520 Bacteria 5366
669 Ga0495637_0010009 3300046520 Bacteria 4605
670 Ga0495637_0026018 3300046520 Bacteria 2633
671 Ga0495643_0000020 3300046522 Bacteria 294973
672 Ga0495643_0000039 3300046522 Bacteria 235175
673 Ga0495643_0001980 3300046522 Bacteria 17167
674 Ga0495643_0006160 3300046522 Bacteria 7966
675 Ga0495643_0015680 3300046522 Bacteria 4471
676 Ga0495643_0018907 3300046522 Bacteria 3991
677 Ga0495648_0000013 3300046524 Bacteria 289090
678 Ga0495648_0000094 3300046524 Bacteria 110608
679 Ga0495648_0000120 3300046524 Bacteria 94692
680 Ga0495663_0000002 3300046525 Bacteria 495384
681 Ga0495663_0006255 3300046525 Bacteria 3287
682 Ga0495666_0017567 3300046526 Bacteria 3562
683 Ga0495654_0000116 3300046530 Bacteria 90109
684 Ga0495654_0001448 3300046530 Bacteria 16298
685 Ga0495665_0031297 3300046531 Bacteria 2847
686 Ga0495586_0129046 3300046535 Bacteria 1415
687 Ga0495597_0001842 3300046542 Bacteria 14497
688 Ga0495597_0010048 3300046542 Bacteria 4644
689 Ga0495597_0034020 3300046542 Bacteria 2304
690 Ga0495622_0000513 3300046557 Bacteria 23837
691 Ga0495622_0001984 3300046557 Bacteria 10014
692 Ga0495622_0009640 3300046557 Bacteria 4465
693 Ga0495633_0000376 3300046558 Bacteria 47585
694 Ga0495633_0000712 3300046558 Bacteria 30211
695 Ga0495633_0003559 3300046558 Bacteria 10307
696 Ga0495633_0010455 3300046558 Bacteria 5062
697 Ga0495633_0109472 3300046558 Bacteria 1281
698 Ga0495668_0000019 3300046616 Bacteria 416042
699 Ga0495668_0002477 3300046616 Bacteria 15159
700 Ga0495668_0004380 3300046616 Bacteria 10063
701 Ga0495668_0008371 3300046616 Bacteria 6468
702 Ga0495668_0009371 3300046616 Bacteria 6018
703 Ga0495668_0021325 3300046616 Bacteria 3717
704 Ga0495668_0038425 3300046616 Bacteria 2674
705 Ga0495668_0094317 3300046616 Bacteria 1638
706 Ga0495668_0123051 3300046616 Bacteria 1419
707 Ga0495611_0045036 3300046648 Bacteria 1975
708 Ga0495625_0004722 3300046660 Bacteria 12757
709 Ga0495625_0007110 3300046660 Bacteria 9830
710 Ga0495625_0089921 3300046660 Bacteria 2125
711 Ga0495657_0122744 3300046675 Bacteria 1634
712 Ga0495599_0149726 3300046678 Bacteria 1446
713 Ga0495658_0000506 3300046683 Bacteria 21468
714 Ga0495669_0019399 3300046684 Bacteria 2935
715 Ga0495669_0029325 3300046684 Bacteria 2412
716 Ga0495670_0010313 3300046691 Bacteria 4590
717 Ga0495671_0000016 3300046692 Bacteria 294821
718 Ga0495671_0000018 3300046692 Bacteria 291470
719 Ga0495671_0005174 3300046692 Bacteria 7676
720 Ga0495671_0005379 3300046692 Bacteria 7503
721 Ga0495671_0014146 3300046692 Bacteria 4299
722 Ga0495671_0030168 3300046692 Bacteria 2779
723 Ga0495671_0040996 3300046692 Bacteria 2333
724 Ga0495671_0041953 3300046692 Bacteria 2302
725 Ga0495649_0011295 3300046694 Bacteria 5245
726 Ga0495589_0007335 3300046794 Bacteria 5777
727 Ga0495604_0035969 3300047317 Bacteria 3907
728 Ga0495672_0000299 3300047320 Bacteria 67952
729 Ga0495672_0003601 3300047320 Bacteria 13159
730 Ga0495672_0003684 3300047320 Bacteria 12953
731 Ga0495680_0039616 3300047322 Bacteria 3757
732 Ga0495680_0145014 3300047322 Bacteria 1735
733 Ga0495675_0037437 3300047444 Bacteria 3090
734 Ga0495679_039048 3300047446 Bacteria 1482
735 Ga0495673_0000082 3300047469 Bacteria 199141
736 Ga0495673_0000205 3300047469 Bacteria 89721
737 Ga0495673_0000233 3300047469 Bacteria 81103
738 Ga0495673_0000241 3300047469 Bacteria 77386
739 Ga0495673_0000435 3300047469 Bacteria 46845
740 Ga0495681_0005243 3300047470 Bacteria 8706
741 Ga0495684_0140472 3300047471 Bacteria 1811
742 Ga0495686_0001872 3300047472 Bacteria 21070
743 Ga0495686_0004265 3300047472 Bacteria 11855
744 Ga0495686_0033589 3300047472 Bacteria 3311
745 Ga0495615_0000011 3300048090 Bacteria 65444
746 Ga0495615_0000013 3300048090 Bacteria 61661
747 Ga0495615_0000173 3300048090 Bacteria 16012
748 Ga0496100_0022209 3300048903 Bacteria 3837
749 Ga0496100_0086461 3300048903 Bacteria 2130
750 Ga0496101_0049872 3300048904 Bacteria 3012
751 Ga0496101_0060109 3300048904 Bacteria 2757
752 Ga0496102_0003237 3300048905 Bacteria 13815
753 Ga0496102_0013184 3300048905 Bacteria 7151
754 Ga0496102_0046931 3300048905 Bacteria 3924
755 Ga0496102_0257001 3300048905 Bacteria 1647
756 Ga0496103_0077727 3300048906 Bacteria 2084
757 Ga0496103_0082740 3300048906 Bacteria 2020
758 Ga0496104_0014316 3300048907 Bacteria 7163
759 Ga0496104_0015386 3300048907 Bacteria 6928
760 Ga0496104_0037396 3300048907 Bacteria 4539
761 Ga0496104_0046656 3300048907 Bacteria 4081
762 Ga0496104_0080458 3300048907 Bacteria 3106
763 Ga0496105_0002153 3300048908 Bacteria 14259
764 Ga0496105_0019377 3300048908 Bacteria 5487
765 Ga0496105_0049000 3300048908 Bacteria 3487
766 Ga0496105_0051492 3300048908 Bacteria 3402
767 Ga0496105_0057122 3300048908 Bacteria 3223
768 Ga0496105_0165458 3300048908 Bacteria 1814
769 Ga0496106_0001275 3300048909 Bacteria 18881
770 Ga0496106_0001509 3300048909 Bacteria 17498
771 Ga0496106_0049184 3300048909 Bacteria 3176
772 Ga0496106_0088657 3300048909 Bacteria 2385
773 Ga0496107_0000089 3300048910 Bacteria 43926
774 Ga0496107_0001523 3300048910 Bacteria 14398
775 Ga0496107_0019005 3300048910 Bacteria 4846
776 Ga0496107_0067756 3300048910 Bacteria 2590
777 Ga0496107_0078243 3300048910 Bacteria 2409
778 Ga0496108_0025050 3300048911 Bacteria 4915
779 Ga0496108_0033787 3300048911 Bacteria 4248
780 Ga0496108_0084868 3300048911 Bacteria 2688
781 Ga0496109_0031198 3300048912 Bacteria 4781
782 Ga0496109_0055283 3300048912 Bacteria 3621
783 Ga0496109_0077236 3300048912 Bacteria 3064
784 Ga0496110_0040365 3300048913 Bacteria 4067
785 Ga0496110_0094885 3300048913 Bacteria 2671
786 Ga0496110_0109048 3300048913 Bacteria 2486
787 Ga0496110_0123214 3300048913 Bacteria 2337
788 Ga0496111_0024809 3300048914 Bacteria 4229
789 Ga0496111_0109752 3300048914 Bacteria 2031
790 Ga0496112_0006789 3300048915 Bacteria 10089
791 Ga0496112_0122062 3300048915 Bacteria 2576
792 Ga0496113_0043334 3300048916 Bacteria 3329
793 Ga0496113_0068605 3300048916 Bacteria 2691
794 Ga0496114_0001674 3300048917 Bacteria 16831
795 Ga0496114_0026423 3300048917 Bacteria 4752
796 Ga0496115_0013071 3300048918 Bacteria 6269
797 Ga0496115_0018415 3300048918 Bacteria 5362
798 Ga0496115_0020700 3300048918 Bacteria 5075
799 Ga0496115_0047939 3300048918 Bacteria 3417
800 Ga0496115_0078234 3300048918 Bacteria 2690
801 Ga0496121_0000854 3300048924 Bacteria 55170
802 Ga0496121_0001004 3300048924 Bacteria 50403
803 Ga0496121_0001267 3300048924 Bacteria 43589
804 Ga0496122_0003350 3300048925 Bacteria 21138
805 Ga0496122_0003557 3300048925 Bacteria 20365
806 Ga0496122_0071294 3300048925 Bacteria 2477
807 Ga0496123_0001182 3300048926 Bacteria 38436
808 Ga0496123_0002402 3300048926 Bacteria 23389
809 Ga0496124_0018457 3300048927 Bacteria 6532
810 Ga0496124_0075076 3300048927 Bacteria 2793
811 Ga0496125_0003664 3300048928 Bacteria 18356
812 Ga0496125_0044969 3300048928 Bacteria 3724
813 Ga0496126_0006009 3300048929 Bacteria 13637
814 Ga0495678_001389 3300049459 Bacteria 19255
815 Ga0495682_0000881 3300049460 Bacteria 18617
816 Ga0495682_0012476 3300049460 Bacteria 3258
817 Ga0495682_0050036 3300049460 Bacteria 1522
818 Ga0501031_0026790 3300049568 Bacteria 3758
819 Ga0501031_0074582 3300049568 Bacteria 2209
820 Ga0501032_0009322 3300049569 Bacteria 7109
821 Ga0501034_0058256 3300049571 Bacteria 3882
822 Ga0501034_0088235 3300049571 Bacteria 3100
823 Ga0501034_0127005 3300049571 Bacteria 2535
824 Ga0501034_0169827 3300049571 Bacteria 2149
825 Ga0501036_0016246 3300049572 Bacteria 6217
826 Ga0501037_0056217 3300049573 Bacteria 2875
827 Ga0501039_0266125 3300049575 Bacteria 1347
828 Ga0501042_0070844 3300049578 Bacteria 2494
829 Ga0501043_0061676 3300049579 Bacteria 2944
830 Ga0501046_0089984 3300049580 Bacteria 2362
831 Ga0501047_0000199 3300049581 Bacteria 72531
832 Ga0501047_0026120 3300049581 Bacteria 5617
833 Ga0501047_0033365 3300049581 Bacteria 4969
834 Ga0501047_0060011 3300049581 Bacteria 3672
835 Ga0501047_0066696 3300049581 Bacteria 3469
836 Ga0501047_0326230 3300049581 Bacteria 1374
837 Ga0501047_0372584 3300049581 Bacteria 1263
838 Ga0501048_0033468 3300049582 Unclassified 3713
839 Ga0501067_0003209 3300049583 Bacteria 9011
840 Ga0501067_0013312 3300049583 Bacteria 4555
841 Ga0501070_0000157 3300049586 Bacteria 62720
842 Ga0501070_0010829 3300049586 Bacteria 7704
843 Ga0501070_0024895 3300049586 Bacteria 5019
844 Ga0501070_0061913 3300049586 Bacteria 3100
845 Ga0501072_0004693 3300049588 Bacteria 10410
846 Ga0501073_0003405 3300049589 Bacteria 11962
847 Ga0501073_0025163 3300049589 Bacteria 4271
848 Ga0501075_0127330 3300049591 Bacteria 1939
849 Ga0501238_008224 3300049671 Bacteria 1368
850 Ga0501249_000144 3300049679 Bacteria 22227
851 Ga0501257_001956 3300049686 Bacteria 4294
852 Ga0501079_0033972 3300049741 Bacteria 3924
853 Ga0501079_0046269 3300049741 Bacteria 3357
854 Ga0501079_0179672 3300049741 Bacteria 1651
855 Ga0501080_0000976 3300049742 Bacteria 23417
856 Ga0501080_0010691 3300049742 Bacteria 8397
857 Ga0501080_0012290 3300049742 Bacteria 7843
858 Ga0501080_0064523 3300049742 Bacteria 3406
859 Ga0501080_0222608 3300049742 Bacteria 1726
860 Ga0501080_0260355 3300049742 Bacteria 1580
861 Ga0501035_0001970 3300049822 Bacteria 20561
862 Ga0501035_0009390 3300049822 Bacteria 9093
863 Ga0501035_0173600 3300049822 Bacteria 1861
864 Ga0501044_0001051 3300049823 Bacteria 33192
865 Ga0501044_0003875 3300049823 Bacteria 16766
866 Ga0501044_0015912 3300049823 Bacteria 8095
867 Ga0501044_0019682 3300049823 Bacteria 7214
868 Ga0501044_0039045 3300049823 Bacteria 4955
869 Ga0501044_0040270 3300049823 Bacteria 4870
870 Ga0501044_0150811 3300049823 Bacteria 2307
871 nmdc:mga03683_21577_c1 3300050489 Bacteria 2485
872 nmdc:mga0yw44_64730_c1 3300050492 Bacteria 2251
873 nmdc:mga0k408_1551_c1 3300050493 Bacteria 12396
874 nmdc:mga0k408_502_c1 3300050493 Bacteria 21491
875 nmdc:mga0k408_51160_c1 3300050493 Bacteria 2393
876 nmdc:mga07m45_1182_c1 3300050496 Bacteria 11771
877 nmdc:mga07m45_15563_c1 3300050496 Bacteria 4062
878 nmdc:mga05p37_169892_c1 3300050507 Bacteria 2660
879 nmdc:mga05p37_234048_c1 3300050507 Unclassified 2212
880 nmdc:mga05p37_310846_c1 3300050507 Bacteria 1868
881 nmdc:mga05p37_31537_c1 3300050507 Bacteria 6474
882 nmdc:mga05p37_531968_c1 3300050507 Bacteria 1342
883 nmdc:mga09592_108959_c1 3300050508 Bacteria 2376
884 nmdc:mga09592_140223_c1 3300050508 Bacteria 2083
885 nmdc:mga09592_244684_c1 3300050508 Bacteria 1554
886 nmdc:mga0qj67_10651_c1 3300050509 Bacteria 6870
887 nmdc:mga0qj67_32353_c1 3300050509 Bacteria 4078
888 nmdc:mga06r32_13474_c1 3300050510 Bacteria 7408
889 nmdc:mga06r32_139327_c1 3300050510 Bacteria 2402
890 nmdc:mga06r32_14791_c1 3300050510 Bacteria 7081
891 nmdc:mga06r32_38670_c1 3300050510 Bacteria 4522
892 nmdc:mga06r32_48483_c1 3300050510 Bacteria 4060
893 nmdc:mga08y16_119837_c1 3300050511 Bacteria 2739
894 nmdc:mga08y16_218228_c1 3300050511 Bacteria 1975
895 nmdc:mga08y16_24421_c1 3300050511 Bacteria 6379
896 nmdc:mga08y16_54792_c1 3300050511 Bacteria 4167
897 nmdc:mga08y16_68648_c1 3300050511 Bacteria 3696
898 nmdc:mga0n895_17944_c1 3300050512 Bacteria 6540
899 nmdc:mga0n895_19382_c1 3300050512 Bacteria 6322
900 nmdc:mga0rr50_133828_c1 3300050513 Bacteria 1988
901 nmdc:mga0rr50_16174_c1 3300050513 Bacteria 4946
902 nmdc:mga0rr50_28349_c1 3300050513 Bacteria 3935
903 nmdc:mga08x19_120624_c1 3300050514 Bacteria 1757
904 nmdc:mga08x19_130136_c1 3300050514 Bacteria 1692
905 nmdc:mga08x19_15_c1 3300050514 Bacteria 354290
906 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
907 nmdc:mga08x19_5876_c1 3300050514 Bacteria 7259
908 nmdc:mga0a205_11907_c1 3300050515 Bacteria 8029
909 nmdc:mga0sz30_429_c1 3300050516 Bacteria 15872
910 Ga0500635_0000142 3300053080 Bacteria 40782
911 Ga0500578_0000035 3300053086 Bacteria 136406
912 Ga0500643_000957 3300053087 Bacteria 17922
913 Ga0500643_007828 3300053087 Bacteria 4257
914 Ga0500644_0000134 3300053088 Bacteria 45635
915 Ga0500646_0004556 3300053090 Bacteria 3505
916 Ga0500651_0122080 3300053093 Bacteria 1581
917 Ga0500651_0122696 3300053093 Bacteria 1576
918 Ga0500641_0012215 3300053096 Bacteria 3132
919 Ga0500554_003364 3300053102 Bacteria 3266
920 Ga0500555_000647 3300053103 Bacteria 13337
921 Ga0500556_0000687 3300053104 Bacteria 20837
922 Ga0500556_0021774 3300053104 Bacteria 2072
923 Ga0500562_000364 3300053108 Bacteria 10937
924 Ga0500562_004497 3300053108 Bacteria 3525
925 Ga0500562_006796 3300053108 Bacteria 2885
926 Ga0500562_012980 3300053108 Bacteria 2121
927 Ga0500569_020140 3300053109 Bacteria 1745
928 Ga0500592_000004 3300053116 Bacteria 128088
929 Ga0500592_000016 3300053116 Bacteria 62404
930 Ga0500592_002464 3300053116 Bacteria 2982
931 Ga0500592_004414 3300053116 Bacteria 2243
932 Ga0500593_000702 3300053117 Bacteria 12769
933 Ga0500594_0000115 3300053118 Bacteria 22812
934 Ga0500594_0005721 3300053118 Bacteria 2765
935 Ga0500595_002983 3300053119 Bacteria 8051
936 Ga0500607_001611 3300053121 Bacteria 19933
937 Ga0500607_016588 3300053121 Bacteria 4219
938 Ga0500607_031759 3300053121 Bacteria 2903
939 Ga0500608_000004 3300053122 Bacteria 108109
940 Ga0500608_000778 3300053122 Bacteria 11664
941 Ga0500608_002848 3300053122 Bacteria 6392
942 Ga0500614_002849 3300053123 Bacteria 3799
943 Ga0500618_000110 3300053125 Bacteria 66025
944 Ga0500642_0000408 3300053130 Bacteria 14103
945 Ga0500642_0013154 3300053130 Bacteria 3031
946 Ga0500655_003243 3300053133 Bacteria 2945
947 Ga0500658_0001807 3300053134 Bacteria 8446
948 Ga0500658_0026094 3300053134 Bacteria 2249
949 Ga0500658_0036406 3300053134 Bacteria 1952
950 Ga0500559_0000055 3300053136 Bacteria 89392
951 Ga0500559_0002897 3300053136 Bacteria 8639
952 Ga0500559_0004196 3300053136 Bacteria 6909
953 Ga0500564_000277 3300053138 Bacteria 14194
954 Ga0500564_010247 3300053138 Bacteria 4105
955 Ga0500568_0000019 3300053139 Bacteria 195696
956 Ga0500590_000885 3300053148 Bacteria 11340
957 Ga0500604_0000196 3300053151 Bacteria 17280
958 Ga0500604_0002657 3300053151 Bacteria 4862
959 Ga0500604_0005332 3300053151 Bacteria 3393
960 Ga0500616_0002247 3300053153 Bacteria 16514
961 Ga0500616_0028952 3300053153 Bacteria 3050
962 Ga0500622_0000474 3300053156 Bacteria 37843
963 Ga0500622_0002770 3300053156 Bacteria 12338
964 Ga0500622_0022106 3300053156 Bacteria 3373
965 Ga0500622_0023914 3300053156 Bacteria 3234
966 Ga0500624_000094 3300053157 Bacteria 43313
967 Ga0500624_000220 3300053157 Bacteria 21139
968 Ga0500624_005835 3300053157 Bacteria 1650
969 Ga0500627_0000044 3300053158 Bacteria 62047
970 Ga0500627_0000340 3300053158 Bacteria 12663
971 Ga0500627_0000454 3300053158 Bacteria 11112
972 Ga0500627_0027131 3300053158 Bacteria 2368
973 Ga0500639_016078 3300053163 Bacteria 3944
974 Ga0500639_067787 3300053163 Bacteria 1825
975 Ga0500636_0000048 3300053177 Bacteria 57866
976 Ga0500636_0005629 3300053177 Bacteria 7159
977 Ga0500636_0009494 3300053177 Bacteria 5655
978 Ga0500636_0011315 3300053177 Bacteria 5223
979 Ga0500637_0000199 3300053178 Bacteria 22445
980 Ga0500637_0000276 3300053178 Bacteria 19168
981 Ga0500637_0000831 3300053178 Bacteria 12341
982 Ga0500637_0003856 3300053178 Bacteria 6990
983 Ga0500637_0004943 3300053178 Bacteria 6405
984 Ga0500637_0006696 3300053178 Bacteria 5698
985 Ga0500567_000358 3300053723 Bacteria 14925
986 Ga0500570_000131 3300053724 Bacteria 22227
987 Ga0500625_000038 3300053729 Bacteria 43903
988 Ga0500625_006345 3300053729 Bacteria 5032
989 Ga0500625_041332 3300053729 Bacteria 2166
990 Ga0500625_046845 3300053729 Bacteria 2013
991 Ga0500625_086103 3300053729 Bacteria 1358
992 Ga0500645_004021 3300053730 Bacteria 5777
993 Ga0500552_000893 3300053733 Bacteria 2809
994 Ga0500596_004767 3300053735 Bacteria 2453
995 Ga0501084_0001458 3300054114 Bacteria 18747
996 Ga0501084_0006709 3300054114 Bacteria 9465
997 Ga0501084_0018707 3300054114 Bacteria 5768
998 Ga0501084_0364331 3300054114 Bacteria 1221
999 Ga0587066_010053 3300059490 Bacteria 1355
1000 Ga0587111_0012431 3300060346 Bacteria 1504
1001 Ga0501082_0019023 3300060353 Bacteria 5917
1002 Ga0501082_0163764 3300060353 Bacteria 1932
1003 2511124747 2510917020 Bacteria 5657507
1004 2513592749 2513237087 Bacteria 5817514
1005 2515692453 2515154123 Bacteria 6387382
1006 2585149349 2582581279 Bacteria 4980720
1007 2585153262 2582581280 Bacteria 5994497
1008 2585196951 2582581293 Bacteria 5907401
1009 2587916347 2585428106 Bacteria 5179711
1010 2599501902 2599185188 Bacteria 6164180
1011 2599773434 2599185248 Bacteria 6696816
1012 2599884385 2599185289 Bacteria 6778765
1013 2599896436 2599185291 Bacteria 6775623
1014 2599958330 2599185305 Bacteria 6748700
1015 2599964198 2599185306 Bacteria 6637356
1016 2599976320 2599185308 Bacteria 6621546
1017 2600003609 2599185313 Bacteria 6658188
1018 2600009913 2599185314 Bacteria 6621749
1019 2600016045 2599185315 Bacteria 6771107
1020 2600051251 2599185321 Bacteria 6764560
1021 2600069340 2599185324 Bacteria 6590677
1022 2643727383 2643221541 Bacteria 5498788
1023 2643750505 2643221545 Bacteria 5083237
1024 2643820854 2643221560 Bacteria 4801179
1025 2643834729 2643221563 Bacteria 4726935
1026 2643923370 2643221583 Bacteria 5218014
1027 2644041457 2643221606 Bacteria 5588032
1028 2644055656 2643221608 Bacteria 4724829
1029 2644226144 2643221640 Bacteria 5258820
1030 2644235632 2643221642 Bacteria 5357871
1031 2644394997 2643221671 Bacteria 5496681
1032 2644464310 2643221683 Bacteria 5749203
1033 2644509600 2643221691 Bacteria 5093099
1034 2671089131 2667528170 Bacteria 6786960
1035 2792460649 2791355048 Bacteria 5832535
1036 2824618512 2824617872 Bacteria 8814715
1037 2824627273 2824626560 Bacteria 8813858
1038 2824635511 2824635225 Bacteria 8785348
1039 2824644348 2824644064 Bacteria 8743947
1040 2824720638 2824714736 Bacteria 8717648
1041 2824725477 2824723954 Bacteria 8758240
1042 2843747748 2843744320 Bacteria 5659202
1043 2849565381 2849560528 Bacteria 5393480
1044 2849578390 2849573788 Bacteria 5421256
1045 2851153833 2851153111 Bacteria 5542585
1046 2857509033 2857504554 Bacteria 5369913
1047 2884964872 2884960567 Bacteria 5437054
1048 2896256538 2896253425 Bacteria 3418029
1049 2898329494 2898329390 Bacteria 5168154
1050 2898910500 2898907183 Bacteria 4067722
1051 2903772488 2903768456 Bacteria 9749579
1052 2906650136 2906643746 Bacteria 8722424
1053 2928535077 2928531327 Bacteria 5101314
1054 2939634904 2939631187 Bacteria 6118131
1055 8055272718 8055266321 Bacteria 7999742
1056 Ga0501032_0020610
1057 SwRhRL2b_contig_464563
1058 rootH1_10071863
1059 rootH2_10014120
1060 Ga0055524_1001209
1061 Ga0055536_1000097
1062 Ga0055536_1000556
1063 Ga0055536_1000610
1064 Ga0055528_1004791
1065 Ga0055530_10000405
1066 Ga0055531_10000224
1067 Ga0055531_10002410
1068 Ga0065714_10065692
1069 Ga0065707_10086567
1070 Ga0070658_10200567
1071 Ga0070690_100005911
1072 Ga0070690_100092446
1073 Ga0070670_100060610
1074 Ga0070680_100000037
1075 Ga0070680_100116452
1076 Ga0070691_10002785
1077 Ga0070691_10008294
1078 Ga0070691_10027477
1079 Ga0070691_10034490
1080 Ga0070687_100179246
1081 Ga0070661_100001403
1082 Ga0070668_100002600
1083 Ga0070668_100009767
1084 Ga0070671_100101684
1085 Ga0070671_100164234
1086 Ga0070673_100037265
1087 Ga0070667_100001761
1088 Ga0070703_10000621
1089 Ga0070703_10000776
1090 Ga0070709_10000229
1091 Ga0070709_10000292
1092 Ga0070714_100036015
1093 Ga0070714_100428336
1094 Ga0070713_100000003
1095 Ga0070713_100001423
1096 Ga0070713_100048254
1097 Ga0070710_10055254
1098 Ga0070711_100000006
1099 Ga0070711_100010191
1100 Ga0070705_100000042
1101 Ga0070705_100000089
1102 Ga0070700_100014332
1103 Ga0070700_100038168
1104 Ga0070694_100012470
1105 Ga0070694_100063969
1106 Ga0070694_100068036
1107 Ga0070708_100007273
1108 Ga0070663_100187467
1109 Ga0070678_100083634
1110 Ga0070681_10000001
1111 Ga0070706_100000274
1112 Ga0070706_100041613
1113 Ga0070706_100087025
1114 Ga0070707_100000600
1115 Ga0070698_100151341
1116 Ga0070698_100413015
1117 Ga0070699_100000182
1118 Ga0070699_100001677
1119 Ga0070679_100000096
1120 Ga0070679_100049818
1121 Ga0070697_100004703
1122 Ga0070697_100023202
1123 Ga0070697_100210378
1124 Ga0068853_100002100
1125 Ga0068853_100005959
1126 Ga0068853_100152758
1127 Ga0068853_100284586
1128 Ga0070686_100157794
1129 Ga0070695_100006839
1130 Ga0070695_100010336
1131 Ga0070695_100018280
1132 Ga0070696_100000288
1133 Ga0070696_100000617
1134 Ga0070696_100048863
1135 Ga0070696_100066166
1136 Ga0070696_100087370
1137 Ga0070693_100005054
1138 Ga0070693_100018955
1139 Ga0070693_100167326
1140 Ga0070665_100010876
1141 Ga0070665_100014067
1142 Ga0070665_100021647
1143 Ga0070665_100033055
1144 Ga0070704_100000232
1145 Ga0070704_100004402
1146 Ga0070704_100218602
1147 Ga0068855_100000010
1148 Ga0068855_100005574
1149 Ga0068855_100006001
1150 Ga0068855_100094932
1151 Ga0068855_100122997
1152 Ga0070664_100023136
1153 Ga0070664_100035491
1154 Ga0068857_100006105
1155 Ga0068857_100022564
1156 Ga0068854_100002041
1157 Ga0068854_100019233
1158 Ga0068856_100000075
1159 Ga0068856_100000569
1160 Ga0068856_100002154
1161 Ga0068856_100022862
1162 Ga0068852_100011109
1163 Ga0068852_100160792
1164 Ga0068852_100175999
1165 Ga0068859_100002952
1166 Ga0068859_100026387
1167 Ga0068859_100028131
1168 Ga0068859_100050057
1169 Ga0068859_100272416
1170 Ga0068864_100057575
1171 Ga0068864_100409362
1172 Ga0068851_10002585
1173 Ga0068851_10111235
1174 Ga0068863_100003097
1175 Ga0068863_100024925
1176 Ga0068863_100025061
1177 Ga0068863_100043597
1178 Ga0068863_100130527
1179 Ga0068858_100014190
1180 Ga0068858_100078471
1181 Ga0068858_100180237
1182 Ga0068860_100000028
1183 Ga0068860_100000032
1184 Ga0068860_100013934
1185 Ga0068860_100028256
1186 Ga0068860_100082902
1187 Ga0068860_100097696
1188 Ga0068860_100109627
1189 Ga0068862_100001018
1190 Ga0068862_100021065
1191 Ga0068862_100085502
1192 Ga0068862_100119011
1193 Ga0068862_100224553
1194 Ga0081455_10001326
1195 Ga0081455_10002294
1196 Ga0081455_10003139
1197 Ga0081538_10054561
1198 Ga0081540_1001742
1199 Ga0081540_1028171
1200 Ga0081539_10001914
1201 Ga0081539_10013380
1202 Ga0081539_10052874
1203 Ga0081539_10115600
1204 Ga0075368_10072859
1205 Ga0075363_100000521
1206 Ga0070716_100024116
1207 Ga0070712_100000027
1208 Ga0070712_100001822
1209 Ga0070712_100004188
1210 Ga0075367_10000520
1211 Ga0075367_10015224
1212 Ga0075369_10007727
1213 Ga0075369_10030881
1214 Ga0075369_10032518
1215 Ga0075366_10008672
1216 Ga0097621_100010821
1217 Ga0075370_10009113
1218 Ga0075370_10055967
1219 Ga0068871_100002451
1220 Ga0075428_100006408
1221 Ga0075428_100009476
1222 Ga0075428_100010017
1223 Ga0075428_100084017
1224 Ga0075430_100080242
1225 Ga0075431_100010582
1226 Ga0075431_100010694
1227 Ga0075433_10011348
1228 Ga0075433_10015023
1229 Ga0075433_10139155
1230 Ga0075434_100004616
1231 Ga0075434_100377390
1232 Ga0075429_100095542
1233 Ga0068865_100008468
1234 Ga0068865_100045580
1235 Ga0068865_100249939
1236 Ga0075436_100000038
1237 Ga0075436_100000820
1238 Ga0075436_100005599
1239 Ga0097620_100002952
1240 Ga0097620_100026387
1241 Ga0097620_100028132
1242 Ga0097620_100050057
1243 Ga0097620_100272429
1244 Ga0075435_100003260
1245 Ga0075435_100019175
1246 Ga0099794_10022855
1247 Ga0099794_10070331
1248 Ga0099795_10000235
1249 Ga0105240_10000189
1250 Ga0105240_10006687
1251 Ga0105240_10012045
1252 Ga0105240_10015182
1253 Ga0105240_10015309
1254 Ga0105240_10018751
1255 Ga0105240_10025885
1256 Ga0105240_10055553
1257 Ga0105240_10071493
1258 Ga0111539_10030909
1259 Ga0111539_10073034
1260 Ga0111539_10077333
1261 Ga0111539_10287823
1262 Ga0111539_10411681
1263 Ga0111539_10468913
1264 Ga0105245_10014018
1265 Ga0105247_10016215
1266 Ga0105247_10081842
1267 Ga0114129_10064342
1268 Ga0114129_10157671
1269 Ga0114129_10173376
1270 Ga0114129_10420599
1271 Ga0105243_10071304
1272 Ga0105243_10091667
1273 Ga0105243_10124888
1274 Ga0105241_10025127
1275 Ga0105241_10040227
1276 Ga0105241_10219464
1277 Ga0105242_10000830
1278 Ga0105248_10000001
1279 Ga0105248_10128355
1280 Ga0105248_10327048
1281 Ga0105237_10000304
1282 Ga0105237_10000443
1283 Ga0105237_10012505
1284 Ga0105238_10016013
1285 Ga0105238_10031136
1286 Ga0105238_10081652
1287 Ga0105238_10125859
1288 Ga0105249_10000305
1289 Ga0105249_10012411
1290 Ga0105249_10060693
1291 Ga0099796_10000154
1292 Ga0099796_10006478
1293 Ga0105239_10003215
1294 Ga0105239_10008512
1295 Ga0105239_10016434
1296 Ga0105239_10022608
1297 Ga0105239_10046524
1298 Ga0105239_10048125
1299 Ga0105239_10232498
1300 Ga0105246_10069574
1301 Ga0157373_10000340
1302 Ga0157373_10000686
1303 Ga0157373_10014411
1304 Ga0157373_10071323
1305 Ga0157369_10055553
1306 Ga0157369_10060202
1307 Ga0157369_10166168
1308 Ga0157374_10038241
1309 Ga0157378_10002709
1310 Ga0163162_10021263
1311 Ga0157372_10005699
1312 Ga0157375_10041951
1313 Ga0157375_10102579
1314 Ga0157375_10181588
1315 Ga0163163_10001576
1316 Ga0163163_10015060
1317 Ga0163163_10082445
1318 Ga0163163_10292800
1319 Ga0157380_10195128
1320 Ga0182008_10000207
1321 Ga0157379_10005876
1322 Ga0157379_10016970
1323 Ga0157379_10053130
1324 Ga0157379_10189838
1325 Ga0157379_10437339
1326 Ga0197907_10728211
1327 Ga0206352_11247993
1328 Ga0213876_10000316
1329 Ga0213876_10000431
1330 Ga0213876_10002998
1331 Ga0213875_10000117
1332 Ga0213871_10012583
1333 Ga0224712_10024255
1334 Ga0209565_1000414
1335 Ga0209673_1001894
1336 Ga0209676_1000031
1337 Ga0209676_1000057
1338 Ga0209676_1000077
1339 Ga0209676_1006896
1340 Ga0209025_1000029
1341 Ga0209758_1006233
1342 Ga0209050_1000087
1343 Ga0209050_1000096
1344 Ga0209050_1008634
1345 Ga0209256_1000353
1346 Ga0209051_1005874
1347 Ga0209257_1000050
1348 Ga0209257_1000130
1349 Ga0209257_1007067
1350 Ga0207697_10029271
1351 Ga0207655_1018995
1352 Ga0207653_10000115
1353 Ga0207692_10028032
1354 Ga0207647_10000943
1355 Ga0207647_10006279
1356 Ga0207647_10058361
1357 Ga0207699_10000031
1358 Ga0207699_10000425
1359 Ga0207645_10166571
1360 Ga0207705_10000608
1361 Ga0207705_10086367
1362 Ga0207684_10000174
1363 Ga0207684_10151851
1364 Ga0207654_10054778
1365 Ga0207707_10000001
1366 Ga0207707_10003660
1367 Ga0207707_10083776
1368 Ga0207707_10084843
1369 Ga0207707_10182384
1370 Ga0207695_10000003
1371 Ga0207695_10015409
1372 Ga0207695_10020718
1373 Ga0207695_10071991
1374 Ga0207695_10072200
1375 Ga0207695_10078597
1376 Ga0207671_10000996
1377 Ga0207671_10034164
1378 Ga0207693_10000299
1379 Ga0207693_10003652
1380 Ga0207693_10010227
1381 Ga0207693_10071335
1382 Ga0207693_10139979
1383 Ga0207663_10000064
1384 Ga0207663_10019212
1385 Ga0207660_10000271
1386 Ga0207660_10000869
1387 Ga0207660_10001144
1388 Ga0207662_10054252
1389 Ga0207662_10145430
1390 Ga0207657_10043459
1391 Ga0207657_10069329
1392 Ga0207657_10112394
1393 Ga0207649_10000073
1394 Ga0207652_10000201
1395 Ga0207646_10000955
1396 Ga0207646_10185920
1397 Ga0207681_10107659
1398 Ga0207694_10000011
1399 Ga0207694_10024807
1400 Ga0207694_10077962
1401 Ga0207694_10135056
1402 Ga0207650_10020873
1403 Ga0207659_10029064
1404 Ga0207700_10000010
1405 Ga0207700_10179334
1406 Ga0207664_10045659
1407 Ga0207664_10223974
1408 Ga0207644_10001940
1409 Ga0207706_10041166
1410 Ga0207706_10074972
1411 Ga0207686_10008224
1412 Ga0207709_10030712
1413 Ga0207709_10142067
1414 Ga0207704_10013874
1415 Ga0207704_10018865
1416 Ga0207665_10008683
1417 Ga0207665_10032169
1418 Ga0207665_10136015
1419 Ga0207691_10127561
1420 Ga0207691_10292332
1421 Ga0207711_10000002
1422 Ga0207711_10084414
1423 Ga0207689_10178824
1424 Ga0207661_10147264
1425 Ga0207679_10014729
1426 Ga0207667_10000093
1427 Ga0207667_10003109
1428 Ga0207667_10003876
1429 Ga0207667_10007215
1430 Ga0207667_10019181
1431 Ga0207667_10178808
1432 Ga0207667_10396611
1433 Ga0207712_10029350
1434 Ga0207712_10051323
1435 Ga0207668_10005799
1436 Ga0207668_10024219
1437 Ga0207668_10035882
1438 Ga0207640_10017526
1439 Ga0207640_10022855
1440 Ga0207658_10000413
1441 Ga0207658_10003527
1442 Ga0207658_10095771
1443 Ga0207658_10144713
1444 Ga0207703_10008184
1445 Ga0207703_10067720
1446 Ga0207703_10231597
1447 Ga0207703_10319770
1448 Ga0207639_10002625
1449 Ga0207639_10055932
1450 Ga0207639_10251479
1451 Ga0207678_10020172
1452 Ga0207708_10010918
1453 Ga0207708_10025380
1454 Ga0207708_10094347
1455 Ga0207702_10000013
1456 Ga0207702_10000911
1457 Ga0207702_10031997
1458 Ga0207702_10158180
1459 Ga0207641_10002755
1460 Ga0207641_10104666
1461 Ga0207641_10113084
1462 Ga0207641_10322570
1463 Ga0207676_10058036
1464 Ga0207676_10277592
1465 Ga0207676_10299225
1466 Ga0207674_10002517
1467 Ga0207674_10008737
1468 Ga0207674_10013600
1469 Ga0207674_10014644
1470 Ga0207674_10042429
1471 Ga0207674_10148907
1472 Ga0207675_100064397
1473 Ga0207683_10211259
1474 Ga0207698_10007581
1475 Ga0207698_10015630
1476 Ga0207698_10151213
1477 Ga0207698_10204543
1478 Ga0207698_10314253
1479 Ga0209179_1000002
1480 Ga0207428_10017230
1481 Ga0207428_10091798
1482 Ga0207428_10128445
1483 Ga0268266_10017674
1484 Ga0268266_10098466
1485 Ga0268266_10268389
1486 Ga0268265_10004878
1487 Ga0268265_10013328
1488 Ga0268265_10021695
1489 Ga0268265_10081210
1490 Ga0268264_10000045
1491 Ga0268264_10000066
1492 Ga0268264_10007343
1493 Ga0268264_10010641
1494 Ga0268264_10018782
1495 Ga0268264_10092459
1496 Ga0265334_10005936
1497 Ga0265334_10008584
1498 Ga0265318_10000018
1499 Ga0265318_10009405
1500 Ga0307515_10077040
1501 Ga0307515_10104909
1502 Ga0265338_10000014
1503 Ga0265338_10005551
1504 Ga0265338_10037990
1505 Ga0307511_10004718
1506 Ga0307511_10024288
1507 Ga0265320_10028747
1508 Ga0265325_10000001
1509 Ga0265325_10003363
1510 Ga0265325_10004801
1511 Ga0265340_10000584
1512 Ga0265340_10023840
1513 Ga0265340_10036101
1514 Ga0265340_10050005
1515 Ga0265339_10000135
1516 Ga0265339_10000912
1517 Ga0265331_10000006
1518 Ga0265331_10000419
1519 Ga0265331_10016760
1520 Ga0265327_10000074
1521 Ga0265316_10110635
1522 Ga0307513_10086621
1523 Ga0307513_10102065
1524 Ga0307509_10000013
1525 Ga0307509_10000500
1526 Ga0307408_100338802
1527 Ga0265313_10003117
1528 Ga0265313_10009233
1529 Ga0265313_10086774
1530 Ga0307508_10027770
1531 Ga0307508_10104370
1532 Ga0316575_10000104
1533 Ga0316575_10003913
1534 Ga0316575_10007114
1535 Ga0316575_10014560
1536 Ga0316579_10001369
1537 Ga0316579_10008387
1538 Ga0316579_10026682
1539 Ga0316579_10093212
1540 Ga0265314_10000370
1541 Ga0265314_10019879
1542 Ga0265314_10036733
1543 Ga0265314_10043142
1544 Ga0265342_10016644
1545 Ga0265342_10040876
1546 Ga0265342_10076603
1547 Ga0316576_10000424
1548 Ga0316576_10002167
1549 Ga0316576_10013535
1550 Ga0316576_10025772
1551 Ga0316576_10069422
1552 Ga0316576_10110088
1553 Ga0316578_10000074
1554 Ga0316578_10008537
1555 Ga0316578_10048873
1556 Ga0316578_10079150
1557 Ga0307516_10000095
1558 Ga0307516_10000099
1559 Ga0307405_10014321
1560 Ga0307405_10101810
1561 Ga0316577_10000480
1562 Ga0316577_10003948
1563 Ga0316577_10018265
1564 Ga0316577_10018907
1565 Ga0316577_10035412
1566 Ga0316577_10035878
1567 Ga0316577_10045969
1568 Ga0307413_10047983
1569 Ga0307406_10131094
1570 Ga0307412_10023232
1571 Ga0307416_100056284
1572 Ga0307414_10020609
1573 Ga0307411_10015885
1574 Ga0307415_100091431
1575 Ga0316583_10001545
1576 Ga0316583_10005386
1577 Ga0316583_10063597
1578 Ga0316585_10010759
1579 Ga0316580_10008574
1580 Ga0316593_10007913
1581 Ga0307510_10000003
1582 Ga0316592_1004221
1583 Ga0316586_1001568
1584 Ga0316586_1001613
1585 Ga0316588_1004434
1586 Ga0316587_1001975
1587 Ga0373944_0004452
1588 Ga0373951_0020609
1589 Ga0373952_0010918
1590 Ga0373936_0003172
1591 Ga0373939_0002211
1592 Ga0373939_0033072
1593 Ga0373960_0008324
1594 Ga0373943_0009757
1595 Ga0373946_0023948
1596 Ga0373955_0032738
1597 Ga0373942_0004075
1598 Ga0373961_0029968
1599 Ga0316574_0001352
1600 Ga0316574_0047504
1601 Ga0316574_0051815
1602 Ga0316574_0057347
1603 Ga0373931_0000492
1604 Ga0373931_0005836
1605 Ga0373935_0033002
1606 Ga0373935_0190318
1607 Ga0373927_0000452
1608 Ga0373927_0027785
1609 Ga0373927_0068113
1610 Ga0373933_0027534
1611 Ga0373947_0019131
1612 Ga0373937_0037105
1613 Ga0373937_0040197
1614 Ga0373937_0218055
1615 Ga0373937_0231484
1616 Ga0316582_0000536
1617 Ga0316582_0005483
1618 Ga0316582_0009637
1619 Ga0316582_0019403
1620 Ga0316582_0029095
1621 Ga0316582_0043414
1622 Ga0316582_0100342
1623 Ga0316582_0153266
1624 Ga0316584_0012961
1625 Ga0316584_0021157
1626 Ga0316584_0025801
1627 Ga0316584_0043726
1628 Ga0316584_0113768
1629 Ga0316584_0118285
1630 Ga0316584_0148136
1631 Ga0373925_0000173
1632 Ga0373925_0192651
1633 Ga0395900_0052656
1634 Ga0395900_0067352
1635 Ga0395900_0242719
1636 Ga0395898_0006599
1637 Ga0395898_0119619
1638 Ga0395905_0000042
1639 Ga0316581_0001321
1640 Ga0316581_0001549
1641 Ga0316581_0010798
1642 Ga0316581_0012137
1643 Ga0316581_0037575
1644 Ga0436364_0410618
1645 Ga0436364_0700727
1646 Ga0436364_1101563
1647 Ga0395901_0003446
1648 Ga0395901_0023659
1649 Ga0395901_0247044
1650 Ga0395901_0267845
1651 Ga0237819_02732
1652 Ga0400490_09265
1653 Ga0400490_14729
1654 Ga0400488_28709
1655 Ga0400488_55998
1656 Ga0400483_101319
1657 Ga0400489_47030
1658 Ga0400489_67259
1659 Ga0400489_72336
1660 Ga0400489_83150
1661 Ga0436365_0131305
1662 Ga0436365_0411002
1663 Ga0436365_0585577
1664 Ga0436365_1518071
1665 Ga0436363_0717745
1666 Ga0439436_0006472
1667 Ga0439438_000037
1668 Ga0439447_000082
1669 Ga0439432_031639
1670 Ga0439449_0002362
1671 Ga0439451_000016
1672 Ga0439434_0015057
1673 Ga0439435_0040848
1674 Ga0451577_0029064
1675 Ga0453683_0004087
1676 Ga0453683_0070467
1677 Ga0466963_0104316
1678 Ga0453684_0396898
1679 Ga0451576_0000492
1680 Ga0466967_0082680
1681 Ga0495617_038475
1682 Ga0495627_000901
1683 Ga0495627_012316
1684 Ga0495603_0080442
1685 Ga0495629_0028809
1686 Ga0495629_0149057
1687 Ga0495638_0000016
1688 Ga0495638_0000351
1689 Ga0495638_0000672
1690 Ga0495651_0154315
1691 Ga0495650_0000007
1692 Ga0495580_0000006
1693 Ga0495580_0002873
1694 Ga0495580_0006825
1695 Ga0495580_0007177
1696 Ga0495580_0013230
1697 Ga0495580_0189012
1698 Ga0495639_0074889
1699 Ga0495664_0007589
1700 Ga0495584_0018115
1701 Ga0495594_0013880
1702 Ga0495596_0001169
1703 Ga0495583_0000024
1704 Ga0495583_0000094
1705 Ga0495583_0003214
1706 Ga0495606_0005968
1707 Ga0495610_0000029
1708 Ga0495610_0000057
1709 Ga0495610_0001407
1710 Ga0495610_0023433
1711 Ga0495610_0033100
1712 Ga0495616_0000032
1713 Ga0495616_0000122
1714 Ga0495616_0067526
1715 Ga0495620_0000079
1716 Ga0495631_0003669
1717 Ga0495632_0000001
1718 Ga0495632_0000440
1719 Ga0495632_0027463
1720 Ga0495632_0091752
1721 Ga0495637_0000108
1722 Ga0495637_0007300
1723 Ga0495637_0007592
1724 Ga0495637_0010009
1725 Ga0495637_0026018
1726 Ga0495643_0000020
1727 Ga0495643_0000039
1728 Ga0495643_0001980
1729 Ga0495643_0006160
1730 Ga0495643_0015680
1731 Ga0495643_0018907
1732 Ga0495648_0000013
1733 Ga0495648_0000094
1734 Ga0495648_0000120
1735 Ga0495663_0000002
1736 Ga0495663_0006255
1737 Ga0495666_0017567
1738 Ga0495654_0000116
1739 Ga0495654_0001448
1740 Ga0495665_0031297
1741 Ga0495586_0129046
1742 Ga0495597_0001842
1743 Ga0495597_0010048
1744 Ga0495597_0034020
1745 Ga0495622_0000513
1746 Ga0495622_0001984
1747 Ga0495622_0009640
1748 Ga0495633_0000376
1749 Ga0495633_0000712
1750 Ga0495633_0003559
1751 Ga0495633_0010455
1752 Ga0495633_0109472
1753 Ga0495668_0000019
1754 Ga0495668_0002477
1755 Ga0495668_0004380
1756 Ga0495668_0008371
1757 Ga0495668_0009371
1758 Ga0495668_0021325
1759 Ga0495668_0038425
1760 Ga0495668_0094317
1761 Ga0495668_0123051
1762 Ga0495611_0045036
1763 Ga0495625_0004722
1764 Ga0495625_0007110
1765 Ga0495625_0089921
1766 Ga0495657_0122744
1767 Ga0495599_0149726
1768 Ga0495658_0000506
1769 Ga0495669_0019399
1770 Ga0495669_0029325
1771 Ga0495670_0010313
1772 Ga0495671_0000016
1773 Ga0495671_0000018
1774 Ga0495671_0005174
1775 Ga0495671_0005379
1776 Ga0495671_0014146
1777 Ga0495671_0030168
1778 Ga0495671_0040996
1779 Ga0495671_0041953
1780 Ga0495649_0011295
1781 Ga0495589_0007335
1782 Ga0495604_0035969
1783 Ga0495672_0000299
1784 Ga0495672_0003601
1785 Ga0495672_0003684
1786 Ga0495680_0039616
1787 Ga0495680_0145014
1788 Ga0495675_0037437
1789 Ga0495679_039048
1790 Ga0495673_0000082
1791 Ga0495673_0000205
1792 Ga0495673_0000233
1793 Ga0495673_0000241
1794 Ga0495673_0000435
1795 Ga0495681_0005243
1796 Ga0495684_0140472
1797 Ga0495686_0001872
1798 Ga0495686_0004265
1799 Ga0495686_0033589
1800 Ga0495615_0000011
1801 Ga0495615_0000013
1802 Ga0495615_0000173
1803 Ga0496100_0022209
1804 Ga0496100_0086461
1805 Ga0496101_0049872
1806 Ga0496101_0060109
1807 Ga0496102_0003237
1808 Ga0496102_0013184
1809 Ga0496102_0046931
1810 Ga0496102_0257001
1811 Ga0496103_0077727
1812 Ga0496103_0082740
1813 Ga0496104_0014316
1814 Ga0496104_0015386
1815 Ga0496104_0037396
1816 Ga0496104_0046656
1817 Ga0496104_0080458
1818 Ga0496105_0002153
1819 Ga0496105_0019377
1820 Ga0496105_0049000
1821 Ga0496105_0051492
1822 Ga0496105_0057122
1823 Ga0496105_0165458
1824 Ga0496106_0001275
1825 Ga0496106_0001509
1826 Ga0496106_0049184
1827 Ga0496106_0088657
1828 Ga0496107_0000089
1829 Ga0496107_0001523
1830 Ga0496107_0019005
1831 Ga0496107_0067756
1832 Ga0496107_0078243
1833 Ga0496108_0025050
1834 Ga0496108_0033787
1835 Ga0496108_0084868
1836 Ga0496109_0031198
1837 Ga0496109_0055283
1838 Ga0496109_0077236
1839 Ga0496110_0040365
1840 Ga0496110_0094885
1841 Ga0496110_0109048
1842 Ga0496110_0123214
1843 Ga0496111_0024809
1844 Ga0496111_0109752
1845 Ga0496112_0006789
1846 Ga0496112_0122062
1847 Ga0496113_0043334
1848 Ga0496113_0068605
1849 Ga0496114_0001674
1850 Ga0496114_0026423
1851 Ga0496115_0013071
1852 Ga0496115_0018415
1853 Ga0496115_0020700
1854 Ga0496115_0047939
1855 Ga0496115_0078234
1856 Ga0496121_0000854
1857 Ga0496121_0001004
1858 Ga0496121_0001267
1859 Ga0496122_0003350
1860 Ga0496122_0003557
1861 Ga0496122_0071294
1862 Ga0496123_0001182
1863 Ga0496123_0002402
1864 Ga0496124_0018457
1865 Ga0496124_0075076
1866 Ga0496125_0003664
1867 Ga0496125_0044969
1868 Ga0496126_0006009
1869 Ga0495678_001389
1870 Ga0495682_0000881
1871 Ga0495682_0012476
1872 Ga0495682_0050036
1873 Ga0501031_0026790
1874 Ga0501031_0074582
1875 Ga0501032_0009322
1876 Ga0501034_0058256
1877 Ga0501034_0088235
1878 Ga0501034_0127005
1879 Ga0501034_0169827
1880 Ga0501036_0016246
1881 Ga0501037_0056217
1882 Ga0501039_0266125
1883 Ga0501042_0070844
1884 Ga0501043_0061676
1885 Ga0501046_0089984
1886 Ga0501047_0000199
1887 Ga0501047_0026120
1888 Ga0501047_0033365
1889 Ga0501047_0060011
1890 Ga0501047_0066696
1891 Ga0501047_0326230
1892 Ga0501047_0372584
1893 Ga0501048_0033468
1894 Ga0501067_0003209
1895 Ga0501067_0013312
1896 Ga0501070_0000157
1897 Ga0501070_0010829
1898 Ga0501070_0024895
1899 Ga0501070_0061913
1900 Ga0501072_0004693
1901 Ga0501073_0003405
1902 Ga0501073_0025163
1903 Ga0501075_0127330
1904 Ga0501238_008224
1905 Ga0501249_000144
1906 Ga0501257_001956
1907 Ga0501079_0033972
1908 Ga0501079_0046269
1909 Ga0501079_0179672
1910 Ga0501080_0000976
1911 Ga0501080_0010691
1912 Ga0501080_0012290
1913 Ga0501080_0064523
1914 Ga0501080_0222608
1915 Ga0501080_0260355
1916 Ga0501035_0001970
1917 Ga0501035_0009390
1918 Ga0501035_0173600
1919 Ga0501044_0001051
1920 Ga0501044_0003875
1921 Ga0501044_0015912
1922 Ga0501044_0019682
1923 Ga0501044_0039045
1924 Ga0501044_0040270
1925 Ga0501044_0150811
1926 nmdc:mga03683_21577_c1
1927 nmdc:mga0yw44_64730_c1
1928 nmdc:mga0k408_1551_c1
1929 nmdc:mga0k408_502_c1
1930 nmdc:mga0k408_51160_c1
1931 nmdc:mga07m45_1182_c1
1932 nmdc:mga07m45_15563_c1
1933 nmdc:mga05p37_169892_c1
1934 nmdc:mga05p37_234048_c1
1935 nmdc:mga05p37_310846_c1
1936 nmdc:mga05p37_31537_c1
1937 nmdc:mga05p37_531968_c1
1938 nmdc:mga09592_108959_c1
1939 nmdc:mga09592_140223_c1
1940 nmdc:mga09592_244684_c1
1941 nmdc:mga0qj67_10651_c1
1942 nmdc:mga0qj67_32353_c1
1943 nmdc:mga06r32_13474_c1
1944 nmdc:mga06r32_139327_c1
1945 nmdc:mga06r32_14791_c1
1946 nmdc:mga06r32_38670_c1
1947 nmdc:mga06r32_48483_c1
1948 nmdc:mga08y16_119837_c1
1949 nmdc:mga08y16_218228_c1
1950 nmdc:mga08y16_24421_c1
1951 nmdc:mga08y16_54792_c1
1952 nmdc:mga08y16_68648_c1
1953 nmdc:mga0n895_17944_c1
1954 nmdc:mga0n895_19382_c1
1955 nmdc:mga0rr50_133828_c1
1956 nmdc:mga0rr50_16174_c1
1957 nmdc:mga0rr50_28349_c1
1958 nmdc:mga08x19_120624_c1
1959 nmdc:mga08x19_130136_c1
1960 nmdc:mga08x19_15_c1
1961 nmdc:mga08x19_4_c1
1962 nmdc:mga08x19_5876_c1
1963 nmdc:mga0a205_11907_c1
1964 nmdc:mga0sz30_429_c1
1965 Ga0500635_0000142
1966 Ga0500578_0000035
1967 Ga0500643_000957
1968 Ga0500643_007828
1969 Ga0500644_0000134
1970 Ga0500646_0004556
1971 Ga0500651_0122080
1972 Ga0500651_0122696
1973 Ga0500641_0012215
1974 Ga0500554_003364
1975 Ga0500555_000647
1976 Ga0500556_0000687
1977 Ga0500556_0021774
1978 Ga0500562_000364
1979 Ga0500562_004497
1980 Ga0500562_006796
1981 Ga0500562_012980
1982 Ga0500569_020140
1983 Ga0500592_000004
1984 Ga0500592_000016
1985 Ga0500592_002464
1986 Ga0500592_004414
1987 Ga0500593_000702
1988 Ga0500594_0000115
1989 Ga0500594_0005721
1990 Ga0500595_002983
1991 Ga0500607_001611
1992 Ga0500607_016588
1993 Ga0500607_031759
1994 Ga0500608_000004
1995 Ga0500608_000778
1996 Ga0500608_002848
1997 Ga0500614_002849
1998 Ga0500618_000110
1999 Ga0500642_0000408
2000 Ga0500642_0013154
2001 Ga0500655_003243
2002 Ga0500658_0001807
2003 Ga0500658_0026094
2004 Ga0500658_0036406
2005 Ga0500559_0000055
2006 Ga0500559_0002897
2007 Ga0500559_0004196
2008 Ga0500564_000277
2009 Ga0500564_010247
2010 Ga0500568_0000019
2011 Ga0500590_000885
2012 Ga0500604_0000196
2013 Ga0500604_0002657
2014 Ga0500604_0005332
2015 Ga0500616_0002247
2016 Ga0500616_0028952
2017 Ga0500622_0000474
2018 Ga0500622_0002770
2019 Ga0500622_0022106
2020 Ga0500622_0023914
2021 Ga0500624_000094
2022 Ga0500624_000220
2023 Ga0500624_005835
2024 Ga0500627_0000044
2025 Ga0500627_0000340
2026 Ga0500627_0000454
2027 Ga0500627_0027131
2028 Ga0500639_016078
2029 Ga0500639_067787
2030 Ga0500636_0000048
2031 Ga0500636_0005629
2032 Ga0500636_0009494
2033 Ga0500636_0011315
2034 Ga0500637_0000199
2035 Ga0500637_0000276
2036 Ga0500637_0000831
2037 Ga0500637_0003856
2038 Ga0500637_0004943
2039 Ga0500637_0006696
2040 Ga0500567_000358
2041 Ga0500570_000131
2042 Ga0500625_000038
2043 Ga0500625_006345
2044 Ga0500625_041332
2045 Ga0500625_046845
2046 Ga0500625_086103
2047 Ga0500645_004021
2048 Ga0500552_000893
2049 Ga0500596_004767
2050 Ga0501084_0001458
2051 Ga0501084_0006709
2052 Ga0501084_0018707
2053 Ga0501084_0364331
2054 Ga0587066_010053
2055 Ga0587111_0012431
2056 Ga0501082_0019023
2057 Ga0501082_0163764
2058 2511124747
2059 2513592749
2060 2515692453
2061 2585149349
2062 2585153262
2063 2585196951
2064 2587916347
2065 2599501902
2066 2599773434
2067 2599884385
2068 2599896436
2069 2599958330
2070 2599964198
2071 2599976320
2072 2600003609
2073 2600009913
2074 2600016045
2075 2600051251
2076 2600069340
2077 2643727383
2078 2643750505
2079 2643820854
2080 2643834729
2081 2643923370
2082 2644041457
2083 2644055656
2084 2644226144
2085 2644235632
2086 2644394997
2087 2644464310
2088 2644509600
2089 2671089131
2090 2792460649
2091 2824618512
2092 2824627273
2093 2824635511
2094 2824644348
2095 2824720638
2096 2824725477
2097 2843747748
2098 2849565381
2099 2849578390
2100 2851153833
2101 2857509033
2102 2884964872
2103 2896256538
2104 2898329494
2105 2898910500
2106 2903772488
2107 2906650136
2108 2928535077
2109 2939634904
2110 8055272718

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

307

434

0.91

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

303

447

0.91

PF00108

Thiolase_N

Thiolase, N-terminal domain

60

280

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yzo-assembly2.cif.gz_D crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.9472 10 396
4yzo-assembly2.cif.gz_D crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.934 10 396
7yvy-assembly3.cif.gz_C crystal structure of thiolase pfc_04095 from pyrococcus furiosus 0.9276 8 396
4yzo-assembly2.cif.gz_B crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.9271 10 396
7yvy-assembly2.cif.gz_B crystal structure of thiolase pfc_04095 from pyrococcus furiosus 0.9209 7 396
ID Description Score Start End Superfamily
4yzoB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9254 10 396 3.40.47.10
4yzoB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9126 10 396 3.40.47.10
af_I6YGD8_6_387_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9084 10 396 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8996 9 396 3.40.47.10
af_I6YGD8_6_387_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8992 10 396 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A0S8D4F8-F1-model_v4 Acetyl-CoA acetyltransferase 0.9911 145 400 GO:0016746
AF-A0A3B9YVT6-F1-model_v4 Acetyl-CoA acetyltransferase 0.9879 248 399 GO:0016746
AF-A0A2M8GD56-F1-model_v4 Acetyl-CoA acetyltransferase 0.986 259 398 GO:0016746
AF-A0A2S6T8A1-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9847 226 400 GO:0016746
AF-A0A661V9R6-F1-model_v4 Acetyl-CoA acetyltransferase 0.9847 1 107 GO:0016747

Map