F489166

General Info

Members Datasets Scaffolds Average Seq Length
1055 349 2110 232

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0676784|Ga0501080_0676784_35_703
Length 222
Sequence MDFGKEFEKYAVKHRGISSNTIHGYKQHSITNLTPYIIEERPLNVASMDVFSRLMMDRIIFLGEPVDDYVANIVTAQLLFLDSTDRTRDIQMYINSPGGSVYTMQFVSPDVSTICTGIAASMAAILMCAGVKGKRSALKHSRIMLHQPFGSIGGQATDIEITAKEIRKIKHELYSIIAHHTEKDIEKVEADCDRDFWMNADESKAYGVVDEVLITNPRKDKK

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
205 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
206 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
207 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
208 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
209 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
210 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
211 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
252 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
253 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
254 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
255 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
256 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
279 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
280 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
281 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
282 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
283 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
286 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
287 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
288 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
291 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
292 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
293 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
294 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
295 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
296 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
297 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
298 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
299 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
300 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
301 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
302 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
305 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
309 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
310 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
311 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
312 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
313 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
314 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
318 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
319 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
327 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
331 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
332 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
336 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
339 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
340 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
344 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 2738541278 Niastella sp. CF465 Isolate Unclassified
347 2818991444 Filimonas endophytica 3197 Isolate Unclassified
348 2914759650 Rhizosphaericola mali Isolate Rhizosphere
349 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.33
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 0.95
Rhizosphere 93.74
Stem 0
Stem Tuber 0
Unclassified 8.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0676784 3300049742 Bacteria 911
2 MRS1b_contig_8282875 2162886011 Unclassified 932
3 MBSR1b_contig_807238 2162886012 Unclassified 1712
4 JGI24744J21845_10019960 3300002077 Bacteria 1324
5 JGI24033J26618_1007474 3300002155 Unclassified 1242
6 JGI24751J29686_10000409 3300002459 Bacteria 13652
7 JGI25406J46586_10000143 3300003203 Bacteria 31027
8 JGI25406J46586_10048452 3300003203 Bacteria 1440
9 rootH1_10024197 3300003316 Bacteria 5578
10 rootH2_10100492 3300003320 Bacteria 10831
11 rootL2_10216868 3300003322 Bacteria 2894
12 rootL2_10230147 3300003322 Bacteria 1702
13 rootH1_10014938 3300003323 Bacteria 2580
14 rootH1_10073697 3300003323 Bacteria 2436
15 rootH1_10104989 3300003323 Bacteria 1054
16 JGI25160J50197_1001273 3300003354 Bacteria 12786
17 Ga0065714_10090598 3300005288 Bacteria 1938
18 Ga0065704_10091559 3300005289 Bacteria 2703
19 Ga0065704_10149944 3300005289 Unclassified 1438
20 Ga0065712_10114193 3300005290 Unclassified 1750
21 Ga0065715_10008112 3300005293 Bacteria 3225
22 Ga0065715_10189048 3300005293 Unclassified 1426
23 Ga0065715_10381257 3300005293 Bacteria 907
24 Ga0070658_10117258 3300005327 Bacteria 2210
25 Ga0070658_10145098 3300005327 Bacteria 1984
26 Ga0070676_10000238 3300005328 Bacteria 23718
27 Ga0070676_10155426 3300005328 Bacteria 1468
28 Ga0070676_10173976 3300005328 Bacteria 1395
29 Ga0070676_10293962 3300005328 Unclassified 1099
30 Ga0070676_10341912 3300005328 Bacteria 1026
31 Ga0070683_100008594 3300005329 Bacteria 8678
32 Ga0070683_100243220 3300005329 Bacteria 1712
33 Ga0070683_100469055 3300005329 Bacteria 1202
34 Ga0070690_100018274 3300005330 Bacteria 4232
35 Ga0070690_100019279 3300005330 Bacteria 4136
36 Ga0070690_100206683 3300005330 Unclassified 1369
37 Ga0070670_100021331 3300005331 Bacteria 5572
38 Ga0070670_100042070 3300005331 Bacteria 3927
39 Ga0070670_100066171 3300005331 Unclassified 3100
40 Ga0070670_100088043 3300005331 Bacteria 2669
41 Ga0070670_100092922 3300005331 Unclassified 2594
42 Ga0070670_100257530 3300005331 Bacteria 1521
43 Ga0070670_100541003 3300005331 Bacteria 1038
44 Ga0070670_100633829 3300005331 Bacteria 958
45 Ga0070677_10011093 3300005333 Bacteria 3098
46 Ga0070677_10076810 3300005333 Bacteria 1419
47 Ga0068869_100005951 3300005334 Bacteria 7710
48 Ga0068869_100010616 3300005334 Bacteria 6012
49 Ga0068869_100011228 3300005334 Bacteria 5868
50 Ga0068869_100011620 3300005334 Bacteria 5782
51 Ga0068869_100017491 3300005334 Bacteria 4861
52 Ga0068869_100029659 3300005334 Bacteria 3835
53 Ga0068869_100081983 3300005334 Bacteria 2410
54 Ga0068869_100158273 3300005334 Bacteria 1762
55 Ga0068869_100318764 3300005334 Unclassified 1260
56 Ga0070666_10000019 3300005335 Bacteria 185877
57 Ga0070666_10000966 3300005335 Bacteria 17531
58 Ga0070666_10004456 3300005335 Bacteria 8528
59 Ga0070666_10103137 3300005335 Bacteria 1968
60 Ga0070666_10173240 3300005335 Bacteria 1512
61 Ga0070666_10232849 3300005335 Bacteria 1301
62 Ga0070680_100000930 3300005336 Bacteria 20720
63 Ga0070680_100034567 3300005336 Bacteria 4075
64 Ga0070680_100127533 3300005336 Bacteria 2126
65 Ga0070682_100000423 3300005337 Bacteria 27350
66 Ga0070682_100001176 3300005337 Bacteria 14932
67 Ga0070682_100079043 3300005337 Bacteria 2123
68 Ga0070682_100091788 3300005337 Bacteria 1988
69 Ga0070682_100259407 3300005337 Unclassified 1257
70 Ga0068868_100002525 3300005338 Bacteria 12711
71 Ga0068868_100004277 3300005338 Bacteria 9996
72 Ga0068868_100004975 3300005338 Bacteria 9332
73 Ga0068868_100019194 3300005338 Bacteria 5122
74 Ga0068868_100042310 3300005338 Bacteria 3555
75 Ga0068868_100062700 3300005338 Bacteria 2947
76 Ga0068868_100063169 3300005338 Bacteria 2937
77 Ga0068868_100144041 3300005338 Bacteria 1958
78 Ga0070660_100046558 3300005339 Bacteria 3324
79 Ga0070660_100122274 3300005339 Unclassified 2078
80 Ga0070660_100331338 3300005339 Bacteria 1252
81 Ga0070660_100533699 3300005339 Bacteria 978
82 Ga0070689_100023578 3300005340 Bacteria 4607
83 Ga0070689_100141821 3300005340 Bacteria 1933
84 Ga0070689_100188755 3300005340 Bacteria 1677
85 Ga0070687_100013338 3300005343 Bacteria 3660
86 Ga0070687_100080022 3300005343 Bacteria 1780
87 Ga0070661_100026648 3300005344 Bacteria 4158
88 Ga0070661_100596269 3300005344 Bacteria 893
89 Ga0070692_10255945 3300005345 Bacteria 1050
90 Ga0070668_100000981 3300005347 Bacteria 19999
91 Ga0070668_100016663 3300005347 Bacteria 5493
92 Ga0070668_100037453 3300005347 Bacteria 3704
93 Ga0070668_100140486 3300005347 Bacteria 1946
94 Ga0070668_100159587 3300005347 Unclassified 1829
95 Ga0070668_100235022 3300005347 Bacteria 1517
96 Ga0070668_100294963 3300005347 Bacteria 1358
97 Ga0070669_100000826 3300005353 Bacteria 22540
98 Ga0070669_100023785 3300005353 Bacteria 4390
99 Ga0070669_100096692 3300005353 Unclassified 2222
100 Ga0070669_100206721 3300005353 Unclassified 1547
101 Ga0070675_100011529 3300005354 Bacteria 6924
102 Ga0070675_100012707 3300005354 Bacteria 6603
103 Ga0070675_100069637 3300005354 Bacteria 2915
104 Ga0070675_100076970 3300005354 Bacteria 2776
105 Ga0070675_100281514 3300005354 Bacteria 1461
106 Ga0070675_100560982 3300005354 Bacteria 1033
107 Ga0070671_100032220 3300005355 Bacteria 4334
108 Ga0070671_100054717 3300005355 Bacteria 3318
109 Ga0070671_100224205 3300005355 Bacteria 1595
110 Ga0070671_100267854 3300005355 Unclassified 1452
111 Ga0070671_100641687 3300005355 Bacteria 919
112 Ga0070674_100136372 3300005356 Bacteria 1836
113 Ga0070674_100477639 3300005356 Bacteria 1034
114 Ga0070673_100001854 3300005364 Bacteria 12646
115 Ga0070673_100008764 3300005364 Bacteria 6751
116 Ga0070673_100012202 3300005364 Bacteria 5891
117 Ga0070673_100036038 3300005364 Bacteria 3757
118 Ga0070673_100079878 3300005364 Bacteria 2649
119 Ga0070673_100112347 3300005364 Bacteria 2261
120 Ga0070673_100130947 3300005364 Bacteria 2104
121 Ga0070673_100138587 3300005364 Bacteria 2050
122 Ga0070673_100219197 3300005364 Unclassified 1646
123 Ga0070673_100770808 3300005364 Bacteria 887
124 Ga0070688_100001299 3300005365 Bacteria 12452
125 Ga0070688_100002166 3300005365 Bacteria 9903
126 Ga0070688_100073887 3300005365 Bacteria 2188
127 Ga0070688_100253364 3300005365 Unclassified 1254
128 Ga0070659_100032456 3300005366 Bacteria 4050
129 Ga0070667_100001589 3300005367 Bacteria 20342
130 Ga0070667_100011530 3300005367 Bacteria 7307
131 Ga0070667_100012973 3300005367 Bacteria 6892
132 Ga0070667_100014864 3300005367 Bacteria 6430
133 Ga0070667_100022490 3300005367 Bacteria 5228
134 Ga0070667_100226056 3300005367 Bacteria 1667
135 Ga0070667_100242036 3300005367 Bacteria 1611
136 Ga0070667_100257172 3300005367 Bacteria 1562
137 Ga0070667_100355701 3300005367 Bacteria 1326
138 Ga0070667_100406789 3300005367 Unclassified 1239
139 Ga0070700_100148522 3300005441 Bacteria 1601
140 Ga0070694_100512318 3300005444 Bacteria 956
141 Ga0070663_100138358 3300005455 Bacteria 1856
142 Ga0070663_100263995 3300005455 Unclassified 1366
143 Ga0070663_100452975 3300005455 Unclassified 1058
144 Ga0070678_100003466 3300005456 Bacteria 8795
145 Ga0070678_100325856 3300005456 Bacteria 1313
146 Ga0070678_100478616 3300005456 Bacteria 1095
147 Ga0070662_100001906 3300005457 Bacteria 12809
148 Ga0070662_100002104 3300005457 Bacteria 12210
149 Ga0070662_100038623 3300005457 Bacteria 3392
150 Ga0070662_100237271 3300005457 Bacteria 1461
151 Ga0070662_100993694 3300005457 Bacteria 718
152 Ga0070681_10033798 3300005458 Bacteria 5133
153 Ga0070681_10078658 3300005458 Bacteria 3254
154 Ga0070681_10247465 3300005458 Bacteria 1696
155 Ga0070681_10389345 3300005458 Bacteria 1305
156 Ga0068867_100004334 3300005459 Bacteria 9990
157 Ga0068867_100011177 3300005459 Bacteria 6334
158 Ga0068867_100015145 3300005459 Bacteria 5468
159 Ga0068867_100028178 3300005459 Bacteria 4042
160 Ga0068867_100028654 3300005459 Bacteria 4010
161 Ga0068867_100054313 3300005459 Bacteria 2959
162 Ga0068867_100064586 3300005459 Bacteria 2722
163 Ga0068867_100108848 3300005459 Bacteria 2126
164 Ga0068867_100114652 3300005459 Bacteria 2075
165 Ga0068867_100117163 3300005459 Bacteria 2054
166 Ga0068867_100258067 3300005459 Unclassified 1420
167 Ga0068867_100338431 3300005459 Bacteria 1252
168 Ga0068867_100725156 3300005459 Bacteria 879
169 Ga0070685_10031812 3300005466 Bacteria 2950
170 Ga0070685_10128264 3300005466 Bacteria 1583
171 Ga0070706_100444877 3300005467 Bacteria 1206
172 Ga0070707_100148980 3300005468 Bacteria 2278
173 Ga0070698_100001267 3300005471 Bacteria 28207
174 Ga0070698_100019395 3300005471 Bacteria 7140
175 Ga0070698_100054424 3300005471 Bacteria 4062
176 Ga0070698_100066940 3300005471 Bacteria 3613
177 Ga0070698_100664676 3300005471 Unclassified 983
178 Ga0070699_100055087 3300005518 Unclassified 3444
179 Ga0070679_100054082 3300005530 Bacteria 3996
180 Ga0070679_100062849 3300005530 Bacteria 3701
181 Ga0070679_100104850 3300005530 Bacteria 2813
182 Ga0070684_100005645 3300005535 Bacteria 9611
183 Ga0070697_100334894 3300005536 Bacteria 1305
184 Ga0068853_100009326 3300005539 Bacteria 7912
185 Ga0068853_100085771 3300005539 Bacteria 2761
186 Ga0068853_100089920 3300005539 Bacteria 2698
187 Ga0068853_100165384 3300005539 Bacteria 1999
188 Ga0068853_100176568 3300005539 Bacteria 1935
189 Ga0068853_100346450 3300005539 Bacteria 1381
190 Ga0068853_100494491 3300005539 Bacteria 1154
191 Ga0070672_100001555 3300005543 Bacteria 14218
192 Ga0070672_100011979 3300005543 Bacteria 6064
193 Ga0070672_100058606 3300005543 Bacteria 3027
194 Ga0070672_100112553 3300005543 Bacteria 2220
195 Ga0070672_100238544 3300005543 Bacteria 1529
196 Ga0070672_100388203 3300005543 Bacteria 1195
197 Ga0070672_100539695 3300005543 Bacteria 1012
198 Ga0070686_100017757 3300005544 Bacteria 4163
199 Ga0070686_100145797 3300005544 Bacteria 1653
200 Ga0070686_100213621 3300005544 Unclassified 1390
201 Ga0070686_100475980 3300005544 Unclassified 965
202 Ga0070686_100477280 3300005544 Bacteria 963
203 Ga0070693_100071864 3300005547 Bacteria 2040
204 Ga0070693_100092842 3300005547 Bacteria 1823
205 Ga0070665_100002381 3300005548 Bacteria 20760
206 Ga0070665_100018175 3300005548 Bacteria 7052
207 Ga0070665_100418798 3300005548 Bacteria 1348
208 Ga0070665_100687807 3300005548 Bacteria 1036
209 Ga0068855_100005983 3300005563 Bacteria 14842
210 Ga0068855_100039366 3300005563 Bacteria 5612
211 Ga0068855_100083430 3300005563 Bacteria 3702
212 Ga0068855_100253182 3300005563 Bacteria 1964
213 Ga0070664_100061322 3300005564 Bacteria 3205
214 Ga0070664_100064495 3300005564 Bacteria 3124
215 Ga0070664_100074517 3300005564 Bacteria 2913
216 Ga0070664_100109408 3300005564 Bacteria 2410
217 Ga0070664_100533505 3300005564 Unclassified 1084
218 Ga0070664_100573254 3300005564 Bacteria 1045
219 Ga0070664_100651503 3300005564 Bacteria 979
220 Ga0068857_100023123 3300005577 Bacteria 5467
221 Ga0068857_100174400 3300005577 Bacteria 1955
222 Ga0068857_100597673 3300005577 Bacteria 1043
223 Ga0068857_100653403 3300005577 Bacteria 997
224 Ga0068854_100037680 3300005578 Bacteria 3395
225 Ga0068854_100189763 3300005578 Bacteria 1610
226 Ga0068854_100611099 3300005578 Unclassified 932
227 Ga0068856_100007851 3300005614 Bacteria 10420
228 Ga0070702_100066427 3300005615 Bacteria 2115
229 Ga0070702_100113874 3300005615 Bacteria 1682
230 Ga0068852_100031375 3300005616 Bacteria 4384
231 Ga0068852_100053358 3300005616 Bacteria 3480
232 Ga0068852_100102496 3300005616 Unclassified 2586
233 Ga0068852_100135178 3300005616 Bacteria 2276
234 Ga0068859_100000013 3300005617 Bacteria 291126
235 Ga0068859_100010041 3300005617 Bacteria 9549
236 Ga0068859_100019858 3300005617 Bacteria 6745
237 Ga0068859_100019894 3300005617 Bacteria 6738
238 Ga0068859_100029635 3300005617 Bacteria 5492
239 Ga0068859_100029925 3300005617 Bacteria 5462
240 Ga0068859_100038541 3300005617 Bacteria 4794
241 Ga0068859_100054597 3300005617 Bacteria 4018
242 Ga0068859_100058980 3300005617 Bacteria 3867
243 Ga0068859_100090332 3300005617 Bacteria 3114
244 Ga0068859_100131419 3300005617 Bacteria 2575
245 Ga0068859_100139162 3300005617 Bacteria 2501
246 Ga0068859_100284061 3300005617 Bacteria 1748
247 Ga0068859_100382405 3300005617 Bacteria 1503
248 Ga0068859_100632298 3300005617 Bacteria 1163
249 Ga0068864_100000357 3300005618 Bacteria 40219
250 Ga0068864_100001339 3300005618 Bacteria 20471
251 Ga0068864_100011141 3300005618 Bacteria 7432
252 Ga0068864_100029348 3300005618 Bacteria 4657
253 Ga0068864_100045286 3300005618 Bacteria 3774
254 Ga0068864_100450642 3300005618 Bacteria 1230
255 Ga0068864_100498590 3300005618 Bacteria 1171
256 Ga0068866_10003544 3300005718 Bacteria 6393
257 Ga0068866_10079890 3300005718 Bacteria 1753
258 Ga0068866_10217405 3300005718 Bacteria 1151
259 Ga0068861_100009344 3300005719 Bacteria 6767
260 Ga0068861_100014355 3300005719 Bacteria 5558
261 Ga0068861_100045063 3300005719 Bacteria 3319
262 Ga0068861_100110453 3300005719 Unclassified 2202
263 Ga0068861_100141357 3300005719 Bacteria 1965
264 Ga0068861_100279769 3300005719 Bacteria 1436
265 Ga0068861_100361218 3300005719 Bacteria 1277
266 Ga0068861_100372015 3300005719 Bacteria 1260
267 Ga0068851_10000433 3300005834 Bacteria 18684
268 Ga0068851_10025715 3300005834 Bacteria 2889
269 Ga0068851_10252166 3300005834 Bacteria 1001
270 Ga0068851_10255719 3300005834 Bacteria 995
271 Ga0068870_10001616 3300005840 Bacteria 9177
272 Ga0068870_10088732 3300005840 Bacteria 1724
273 Ga0068870_10436643 3300005840 Bacteria 860
274 Ga0068863_100001616 3300005841 Bacteria 22269
275 Ga0068863_100002217 3300005841 Bacteria 19295
276 Ga0068863_100026605 3300005841 Bacteria 5517
277 Ga0068863_100067788 3300005841 Bacteria 3375
278 Ga0068863_100110030 3300005841 Bacteria 2623
279 Ga0068863_100275815 3300005841 Bacteria 1628
280 Ga0068863_100299336 3300005841 Bacteria 1560
281 Ga0068863_100312215 3300005841 Bacteria 1526
282 Ga0068863_100352403 3300005841 Bacteria 1433
283 Ga0068863_100626159 3300005841 Bacteria 1066
284 Ga0068863_100931683 3300005841 Bacteria 870
285 Ga0068858_100006851 3300005842 Bacteria 11076
286 Ga0068858_100013114 3300005842 Bacteria 7815
287 Ga0068858_100102257 3300005842 Bacteria 2673
288 Ga0068858_100122844 3300005842 Bacteria 2430
289 Ga0068858_100126686 3300005842 Bacteria 2392
290 Ga0068858_100789562 3300005842 Unclassified 926
291 Ga0068860_100000948 3300005843 Bacteria 32094
292 Ga0068860_100002928 3300005843 Bacteria 17676
293 Ga0068860_100008208 3300005843 Bacteria 10394
294 Ga0068860_100011092 3300005843 Bacteria 8885
295 Ga0068860_100012904 3300005843 Bacteria 8209
296 Ga0068860_100019036 3300005843 Bacteria 6668
297 Ga0068860_100037012 3300005843 Bacteria 4672
298 Ga0068860_100151572 3300005843 Bacteria 2233
299 Ga0068860_100163293 3300005843 Bacteria 2149
300 Ga0068860_100174243 3300005843 Bacteria 2079
301 Ga0068860_100188881 3300005843 Bacteria 1993
302 Ga0068860_100283172 3300005843 Bacteria 1621
303 Ga0068860_100582336 3300005843 Unclassified 1123
304 Ga0068860_100616993 3300005843 Unclassified 1091
305 Ga0068862_100005077 3300005844 Bacteria 11082
306 Ga0068862_100040502 3300005844 Bacteria 3960
307 Ga0068862_100110877 3300005844 Bacteria 2408
308 Ga0068862_100111578 3300005844 Bacteria 2401
309 Ga0068862_100167921 3300005844 Unclassified 1963
310 Ga0068862_100452332 3300005844 Bacteria 1211
311 Ga0068862_100920125 3300005844 Bacteria 861
312 Ga0081539_10000402 3300005985 Bacteria 92866
313 Ga0081539_10026620 3300005985 Bacteria 3684
314 Ga0075366_10005580 3300006195 Bacteria 6821
315 Ga0075366_10010004 3300006195 Bacteria 5313
316 Ga0075366_10083828 3300006195 Bacteria 1905
317 Ga0075366_10244292 3300006195 Bacteria 1094
318 Ga0075366_10264951 3300006195 Bacteria 1049
319 Ga0097621_100000960 3300006237 Bacteria 20226
320 Ga0097621_100003944 3300006237 Bacteria 10276
321 Ga0097621_100017259 3300006237 Bacteria 5477
322 Ga0097621_100040578 3300006237 Bacteria 3742
323 Ga0097621_100104803 3300006237 Bacteria 2383
324 Ga0097621_100110271 3300006237 Bacteria 2325
325 Ga0075370_10147888 3300006353 Bacteria 1376
326 Ga0075370_10204252 3300006353 Bacteria 1166
327 Ga0068871_100000582 3300006358 Bacteria 25067
328 Ga0068871_100001510 3300006358 Bacteria 15596
329 Ga0068871_100001981 3300006358 Bacteria 13880
330 Ga0068871_100076476 3300006358 Bacteria 2765
331 Ga0068871_100116632 3300006358 Bacteria 2251
332 Ga0068871_100348634 3300006358 Unclassified 1309
333 Ga0068871_100353048 3300006358 Bacteria 1301
334 Ga0068871_100439543 3300006358 Bacteria 1168
335 Ga0068871_100564957 3300006358 Bacteria 1032
336 Ga0068871_100649722 3300006358 Bacteria 963
337 Ga0075428_100041147 3300006844 Bacteria 5083
338 Ga0075430_100005897 3300006846 Bacteria 10344
339 Ga0075431_100020982 3300006847 Bacteria 6676
340 Ga0075431_100317946 3300006847 Bacteria 1570
341 Ga0075429_100030293 3300006880 Bacteria 4700
342 Ga0075429_100157104 3300006880 Bacteria 1991
343 Ga0068865_100005767 3300006881 Bacteria 7527
344 Ga0068865_100018860 3300006881 Bacteria 4459
345 Ga0068865_100162117 3300006881 Bacteria 1707
346 Ga0097620_100000013 3300006931 Bacteria 291126
347 Ga0097620_100010041 3300006931 Bacteria 9549
348 Ga0097620_100019858 3300006931 Bacteria 6745
349 Ga0097620_100019895 3300006931 Bacteria 6738
350 Ga0097620_100029634 3300006931 Bacteria 5492
351 Ga0097620_100029926 3300006931 Bacteria 5462
352 Ga0097620_100038543 3300006931 Bacteria 4794
353 Ga0097620_100054597 3300006931 Bacteria 4018
354 Ga0097620_100058980 3300006931 Bacteria 3867
355 Ga0097620_100090336 3300006931 Bacteria 3114
356 Ga0097620_100131425 3300006931 Bacteria 2575
357 Ga0097620_100139165 3300006931 Bacteria 2501
358 Ga0097620_100284040 3300006931 Bacteria 1748
359 Ga0097620_100382392 3300006931 Bacteria 1503
360 Ga0097620_100632282 3300006931 Bacteria 1163
361 Ga0105240_10001908 3300009093 Bacteria 34614
362 Ga0111539_10028550 3300009094 Bacteria 6805
363 Ga0111539_10047620 3300009094 Bacteria 5123
364 Ga0111539_10114039 3300009094 Bacteria 3170
365 Ga0111539_10129092 3300009094 Bacteria 2960
366 Ga0111539_11278505 3300009094 Unclassified 852
367 Ga0105245_10051281 3300009098 Bacteria 3699
368 Ga0105245_10068267 3300009098 Bacteria 3221
369 Ga0105247_10000906 3300009101 Bacteria 22300
370 Ga0105247_10011607 3300009101 Bacteria 5307
371 Ga0114129_10033187 3300009147 Bacteria 7295
372 Ga0105243_10070257 3300009148 Bacteria 2827
373 Ga0105243_10073565 3300009148 Bacteria 2769
374 Ga0105241_10000858 3300009174 Bacteria 23051
375 Ga0105241_10005708 3300009174 Bacteria 9185
376 Ga0105241_10008625 3300009174 Bacteria 7491
377 Ga0105241_10097998 3300009174 Bacteria 2326
378 Ga0105241_10200902 3300009174 Bacteria 1665
379 Ga0105241_10323049 3300009174 Bacteria 1332
380 Ga0105241_10437512 3300009174 Bacteria 1154
381 Ga0105241_10619090 3300009174 Bacteria 980
382 Ga0105242_10010225 3300009176 Bacteria 7194
383 Ga0105242_10029115 3300009176 Bacteria 4402
384 Ga0105242_10042800 3300009176 Bacteria 3660
385 Ga0105242_10066209 3300009176 Bacteria 2983
386 Ga0105242_10164073 3300009176 Bacteria 1947
387 Ga0105242_10276328 3300009176 Bacteria 1524
388 Ga0105242_10331238 3300009176 Bacteria 1400
389 Ga0105242_10419863 3300009176 Bacteria 1253
390 Ga0105242_10537505 3300009176 Bacteria 1118
391 Ga0105242_10835750 3300009176 Unclassified 915
392 Ga0105248_10074758 3300009177 Bacteria 3808
393 Ga0105248_10085106 3300009177 Bacteria 3558
394 Ga0105237_10012709 3300009545 Bacteria 8858
395 Ga0105237_10026673 3300009545 Bacteria 5904
396 Ga0105237_10038845 3300009545 Bacteria 4807
397 Ga0105249_10000349 3300009553 Bacteria 46353
398 Ga0105249_10001507 3300009553 Bacteria 20425
399 Ga0105249_10001918 3300009553 Bacteria 18040
400 Ga0105249_10006005 3300009553 Bacteria 10522
401 Ga0105249_10011132 3300009553 Bacteria 7902
402 Ga0105249_10032555 3300009553 Bacteria 4717
403 Ga0105249_10052361 3300009553 Bacteria 3727
404 Ga0105249_10077670 3300009553 Bacteria 3079
405 Ga0105249_10109955 3300009553 Bacteria 2604
406 Ga0105249_10228135 3300009553 Bacteria 1836
407 Ga0105249_10240861 3300009553 Unclassified 1788
408 Ga0105239_10001102 3300010375 Bacteria 37330
409 Ga0105239_10049269 3300010375 Bacteria 4619
410 Ga0105239_10582044 3300010375 Bacteria 1276
411 Ga0105239_10726381 3300010375 Bacteria 1136
412 Ga0105246_10012996 3300011119 Bacteria 5210
413 Ga0105246_10204976 3300011119 Bacteria 1536
414 Ga0157373_10082601 3300013100 Bacteria 2265
415 Ga0157373_10190016 3300013100 Bacteria 1447
416 Ga0157371_10028376 3300013102 Bacteria 4053
417 Ga0157371_10049104 3300013102 Bacteria 2998
418 Ga0157371_10677130 3300013102 Bacteria 771
419 Ga0157370_10001507 3300013104 Bacteria 28750
420 Ga0157370_10004859 3300013104 Bacteria 15261
421 Ga0157370_10294963 3300013104 Bacteria 1497
422 Ga0157369_10040230 3300013105 Bacteria 5104
423 Ga0157374_10002251 3300013296 Bacteria 16254
424 Ga0157374_10002286 3300013296 Bacteria 16120
425 Ga0157374_10031984 3300013296 Bacteria 4787
426 Ga0157374_10053553 3300013296 Bacteria 3762
427 Ga0157374_10141538 3300013296 Bacteria 2335
428 Ga0157374_10249292 3300013296 Bacteria 1747
429 Ga0157374_10705627 3300013296 Unclassified 1022
430 Ga0157374_10983454 3300013296 Bacteria 863
431 Ga0157378_10011546 3300013297 Bacteria 7734
432 Ga0157378_10013523 3300013297 Bacteria 7138
433 Ga0157378_10015823 3300013297 Bacteria 6605
434 Ga0157378_10017243 3300013297 Bacteria 6333
435 Ga0157378_10018450 3300013297 Bacteria 6128
436 Ga0157378_10020057 3300013297 Bacteria 5879
437 Ga0157378_10029140 3300013297 Bacteria 4873
438 Ga0157378_10051030 3300013297 Bacteria 3681
439 Ga0157378_10073011 3300013297 Bacteria 3084
440 Ga0157378_10594185 3300013297 Unclassified 1117
441 Ga0157378_10670193 3300013297 Bacteria 1054
442 Ga0157378_10763422 3300013297 Bacteria 990
443 Ga0157378_10872330 3300013297 Bacteria 929
444 Ga0163162_10001002 3300013306 Bacteria 26238
445 Ga0163162_10001863 3300013306 Bacteria 19846
446 Ga0163162_10012341 3300013306 Bacteria 8343
447 Ga0163162_10026158 3300013306 Bacteria 5767
448 Ga0163162_10054538 3300013306 Bacteria 4021
449 Ga0163162_10153151 3300013306 Unclassified 2424
450 Ga0163162_10172942 3300013306 Bacteria 2285
451 Ga0163162_10359976 3300013306 Bacteria 1588
452 Ga0163162_10368078 3300013306 Bacteria 1570
453 Ga0157372_10053387 3300013307 Bacteria 4505
454 Ga0157372_10107240 3300013307 Bacteria 3196
455 Ga0157372_10130502 3300013307 Unclassified 2891
456 Ga0157372_10156597 3300013307 Bacteria 2632
457 Ga0157372_11165304 3300013307 Bacteria 891
458 Ga0157372_11372333 3300013307 Bacteria 815
459 Ga0157375_10000186 3300013308 Bacteria 58217
460 Ga0157375_10000827 3300013308 Bacteria 27101
461 Ga0157375_10035495 3300013308 Bacteria 4760
462 Ga0157375_10051538 3300013308 Bacteria 4042
463 Ga0157375_10133808 3300013308 Bacteria 2601
464 Ga0157375_10152272 3300013308 Bacteria 2449
465 Ga0157375_10211732 3300013308 Unclassified 2096
466 Ga0157375_10227395 3300013308 Bacteria 2024
467 Ga0157375_10282570 3300013308 Bacteria 1823
468 Ga0157375_10403786 3300013308 Bacteria 1533
469 Ga0157375_10503547 3300013308 Bacteria 1375
470 Ga0157375_10624499 3300013308 Bacteria 1235
471 Ga0163163_10001753 3300014325 Bacteria 18282
472 Ga0163163_10066412 3300014325 Bacteria 3583
473 Ga0163163_10140861 3300014325 Unclassified 2454
474 Ga0163163_10276699 3300014325 Bacteria 1730
475 Ga0163163_10352991 3300014325 Bacteria 1527
476 Ga0163163_10621308 3300014325 Bacteria 1144
477 Ga0157380_10000650 3300014326 Bacteria 21489
478 Ga0157380_10003052 3300014326 Bacteria 11413
479 Ga0157380_10025482 3300014326 Bacteria 4485
480 Ga0157380_10371768 3300014326 Bacteria 1346
481 Ga0157380_10444385 3300014326 Bacteria 1243
482 Ga0157380_10521547 3300014326 Bacteria 1159
483 Ga0157377_10000426 3300014745 Bacteria 18260
484 Ga0157377_10021575 3300014745 Bacteria 3389
485 Ga0157377_10026874 3300014745 Bacteria 3084
486 Ga0157377_10066059 3300014745 Unclassified 2079
487 Ga0157377_10083855 3300014745 Bacteria 1868
488 Ga0157379_10000976 3300014968 Bacteria 23195
489 Ga0157379_10015986 3300014968 Bacteria 6597
490 Ga0157379_10016659 3300014968 Bacteria 6464
491 Ga0157379_10037296 3300014968 Bacteria 4334
492 Ga0157379_10180962 3300014968 Bacteria 1904
493 Ga0157379_10429861 3300014968 Unclassified 1217
494 Ga0157376_10000650 3300014969 Bacteria 22495
495 Ga0157376_10008988 3300014969 Bacteria 7235
496 Ga0157376_10061038 3300014969 Bacteria 3168
497 Ga0157376_10124854 3300014969 Unclassified 2287
498 Ga0157376_10206340 3300014969 Unclassified 1811
499 Ga0157376_10543233 3300014969 Bacteria 1149
500 Ga0163161_10004470 3300017792 Bacteria 9736
501 Ga0163161_10025267 3300017792 Bacteria 4203
502 Ga0163161_10031410 3300017792 Bacteria 3784
503 Ga0163161_10039345 3300017792 Bacteria 3394
504 Ga0163161_10044628 3300017792 Bacteria 3194
505 Ga0163161_10409513 3300017792 Unclassified 1089
506 Ga0213876_10012974 3300021384 Bacteria 4429
507 Ga0207426_1000230 3300025302 Bacteria 128357
508 Ga0207697_10114295 3300025315 Bacteria 1157
509 Ga0207656_10001978 3300025321 Bacteria 6827
510 Ga0207656_10011320 3300025321 Bacteria 3368
511 Ga0207656_10034210 3300025321 Bacteria 2121
512 Ga0207656_10261089 3300025321 Bacteria 851
513 Ga0207682_10021187 3300025893 Bacteria 2556
514 Ga0207682_10025688 3300025893 Bacteria 2336
515 Ga0207682_10031701 3300025893 Unclassified 2123
516 Ga0207642_10006779 3300025899 Bacteria 3830
517 Ga0207710_10000417 3300025900 Bacteria 28186
518 Ga0207710_10103541 3300025900 Bacteria 1345
519 Ga0207688_10120088 3300025901 Bacteria 1533
520 Ga0207680_10000673 3300025903 Bacteria 16133
521 Ga0207680_10105322 3300025903 Bacteria 1819
522 Ga0207680_10204976 3300025903 Bacteria 1346
523 Ga0207680_10233803 3300025903 Bacteria 1264
524 Ga0207680_10234123 3300025903 Bacteria 1263
525 Ga0207680_10536183 3300025903 Bacteria 835
526 Ga0207647_10041916 3300025904 Bacteria 2874
527 Ga0207685_10128385 3300025905 Bacteria 1122
528 Ga0207645_10000684 3300025907 Bacteria 28112
529 Ga0207645_10001198 3300025907 Bacteria 21394
530 Ga0207645_10015549 3300025907 Bacteria 5054
531 Ga0207645_10046954 3300025907 Bacteria 2758
532 Ga0207645_10065076 3300025907 Bacteria 2330
533 Ga0207645_10082001 3300025907 Bacteria 2068
534 Ga0207645_10103782 3300025907 Bacteria 1836
535 Ga0207645_10157573 3300025907 Bacteria 1484
536 Ga0207645_10307144 3300025907 Bacteria 1057
537 Ga0207643_10010782 3300025908 Bacteria 4928
538 Ga0207643_10021449 3300025908 Bacteria 3549
539 Ga0207643_10304794 3300025908 Unclassified 992
540 Ga0207705_10010195 3300025909 Bacteria 6835
541 Ga0207654_10000569 3300025911 Bacteria 20920
542 Ga0207654_10002605 3300025911 Bacteria 9148
543 Ga0207654_10224234 3300025911 Bacteria 1248
544 Ga0207654_10304868 3300025911 Bacteria 1084
545 Ga0207654_10315026 3300025911 Bacteria 1068
546 Ga0207707_10000299 3300025912 Bacteria 52083
547 Ga0207707_10385436 3300025912 Bacteria 1204
548 Ga0207707_10386624 3300025912 Bacteria 1202
549 Ga0207707_10477052 3300025912 Bacteria 1066
550 Ga0207695_10014544 3300025913 Bacteria 9312
551 Ga0207671_10007851 3300025914 Bacteria 9169
552 Ga0207671_10018917 3300025914 Bacteria 5277
553 Ga0207671_10020567 3300025914 Bacteria 5022
554 Ga0207660_10004975 3300025917 Bacteria 8664
555 Ga0207660_10021310 3300025917 Bacteria 4358
556 Ga0207662_10000535 3300025918 Bacteria 16868
557 Ga0207657_10028682 3300025919 Bacteria 5073
558 Ga0207657_10088416 3300025919 Unclassified 2590
559 Ga0207657_10113696 3300025919 Unclassified 2233
560 Ga0207657_10419254 3300025919 Unclassified 1052
561 Ga0207649_10087229 3300025920 Bacteria 2035
562 Ga0207652_10013799 3300025921 Bacteria 6535
563 Ga0207652_10033484 3300025921 Bacteria 4327
564 Ga0207652_10222080 3300025921 Bacteria 1702
565 Ga0207646_10798337 3300025922 Bacteria 841
566 Ga0207681_10085979 3300025923 Unclassified 2233
567 Ga0207681_10097085 3300025923 Bacteria 2117
568 Ga0207681_10129501 3300025923 Unclassified 1863
569 Ga0207681_10225019 3300025923 Bacteria 1453
570 Ga0207681_10270733 3300025923 Unclassified 1333
571 Ga0207681_10355544 3300025923 Bacteria 1173
572 Ga0207650_10086314 3300025925 Bacteria 2389
573 Ga0207650_10095012 3300025925 Unclassified 2285
574 Ga0207650_10099351 3300025925 Unclassified 2237
575 Ga0207650_10114342 3300025925 Bacteria 2093
576 Ga0207650_10150942 3300025925 Bacteria 1834
577 Ga0207650_10271446 3300025925 Bacteria 1378
578 Ga0207650_10413451 3300025925 Bacteria 1118
579 Ga0207659_10009317 3300025926 Bacteria 6130
580 Ga0207659_10014000 3300025926 Bacteria 5161
581 Ga0207659_10014978 3300025926 Bacteria 5014
582 Ga0207659_10050875 3300025926 Bacteria 2945
583 Ga0207659_10055643 3300025926 Bacteria 2831
584 Ga0207659_10193585 3300025926 Unclassified 1619
585 Ga0207687_10283307 3300025927 Bacteria 1329
586 Ga0207644_10033752 3300025931 Bacteria 3579
587 Ga0207644_10198384 3300025931 Unclassified 1582
588 Ga0207644_10208113 3300025931 Bacteria 1546
589 Ga0207644_10548283 3300025931 Bacteria 957
590 Ga0207644_10614149 3300025931 Bacteria 903
591 Ga0207644_10782563 3300025931 Bacteria 798
592 Ga0207690_10000343 3300025932 Bacteria 31195
593 Ga0207690_10017765 3300025932 Bacteria 4351
594 Ga0207690_10084309 3300025932 Bacteria 2227
595 Ga0207690_10256772 3300025932 Unclassified 1352
596 Ga0207706_10005121 3300025933 Bacteria 12232
597 Ga0207706_10008686 3300025933 Bacteria 9357
598 Ga0207706_10027788 3300025933 Bacteria 5056
599 Ga0207706_10028286 3300025933 Bacteria 5007
600 Ga0207706_10111430 3300025933 Bacteria 2407
601 Ga0207706_10340490 3300025933 Bacteria 1305
602 Ga0207706_10817573 3300025933 Bacteria 791
603 Ga0207686_10001802 3300025934 Bacteria 11908
604 Ga0207686_10045206 3300025934 Bacteria 2708
605 Ga0207686_10147386 3300025934 Bacteria 1634
606 Ga0207686_10705821 3300025934 Bacteria 802
607 Ga0207709_10061250 3300025935 Bacteria 2351
608 Ga0207670_10136932 3300025936 Bacteria 1801
609 Ga0207670_10713195 3300025936 Bacteria 831
610 Ga0207669_10055077 3300025937 Bacteria 2406
611 Ga0207669_10093896 3300025937 Unclassified 1961
612 Ga0207669_10385712 3300025937 Bacteria 1093
613 Ga0207704_10037101 3300025938 Bacteria 2812
614 Ga0207704_10037235 3300025938 Bacteria 2809
615 Ga0207704_10093507 3300025938 Bacteria 1982
616 Ga0207704_10280838 3300025938 Bacteria 1266
617 Ga0207704_10620461 3300025938 Unclassified 887
618 Ga0207665_10454282 3300025939 Bacteria 984
619 Ga0207691_10000076 3300025940 Bacteria 83005
620 Ga0207691_10003310 3300025940 Bacteria 15699
621 Ga0207691_10026563 3300025940 Bacteria 5432
622 Ga0207691_10040327 3300025940 Bacteria 4315
623 Ga0207691_10072636 3300025940 Bacteria 3103
624 Ga0207691_10079309 3300025940 Bacteria 2955
625 Ga0207691_10089212 3300025940 Bacteria 2765
626 Ga0207691_10099507 3300025940 Bacteria 2596
627 Ga0207691_10669181 3300025940 Bacteria 876
628 Ga0207711_10109221 3300025941 Bacteria 2458
629 Ga0207711_10255166 3300025941 Unclassified 1611
630 Ga0207689_10001148 3300025942 Bacteria 25510
631 Ga0207689_10002202 3300025942 Bacteria 18273
632 Ga0207689_10004010 3300025942 Bacteria 13393
633 Ga0207689_10015942 3300025942 Bacteria 6361
634 Ga0207689_10017269 3300025942 Bacteria 6108
635 Ga0207689_10035934 3300025942 Bacteria 4113
636 Ga0207689_10156204 3300025942 Bacteria 1880
637 Ga0207689_10161836 3300025942 Bacteria 1844
638 Ga0207689_10167365 3300025942 Bacteria 1811
639 Ga0207689_10192959 3300025942 Bacteria 1681
640 Ga0207689_10196534 3300025942 Unclassified 1665
641 Ga0207689_10393235 3300025942 Bacteria 1155
642 Ga0207661_10373642 3300025944 Bacteria 1289
643 Ga0207661_10478636 3300025944 Bacteria 1136
644 Ga0207661_10806530 3300025944 Unclassified 864
645 Ga0207679_10002585 3300025945 Bacteria 11158
646 Ga0207679_10117752 3300025945 Bacteria 2109
647 Ga0207679_10557287 3300025945 Bacteria 1029
648 Ga0207679_10626190 3300025945 Bacteria 971
649 Ga0207679_10792209 3300025945 Bacteria 864
650 Ga0207667_10075896 3300025949 Bacteria 3489
651 Ga0207667_10086421 3300025949 Bacteria 3245
652 Ga0207667_10108676 3300025949 Bacteria 2861
653 Ga0207667_10147491 3300025949 Bacteria 2422
654 Ga0207651_10001378 3300025960 Bacteria 11009
655 Ga0207651_10032539 3300025960 Bacteria 3351
656 Ga0207651_10109564 3300025960 Bacteria 2069
657 Ga0207651_10122701 3300025960 Bacteria 1973
658 Ga0207651_10131231 3300025960 Unclassified 1918
659 Ga0207651_10172666 3300025960 Bacteria 1706
660 Ga0207651_10205281 3300025960 Bacteria 1582
661 Ga0207651_10232658 3300025960 Bacteria 1497
662 Ga0207651_10302024 3300025960 Bacteria 1331
663 Ga0207712_10003179 3300025961 Bacteria 10455
664 Ga0207712_10004545 3300025961 Bacteria 8758
665 Ga0207712_10008002 3300025961 Bacteria 6684
666 Ga0207712_10011029 3300025961 Bacteria 5754
667 Ga0207712_10063039 3300025961 Bacteria 2637
668 Ga0207712_10067357 3300025961 Bacteria 2562
669 Ga0207712_10205388 3300025961 Bacteria 1565
670 Ga0207668_10009407 3300025972 Bacteria 5856
671 Ga0207668_10290495 3300025972 Bacteria 1345
672 Ga0207668_10396971 3300025972 Bacteria 1165
673 Ga0207668_10522606 3300025972 Bacteria 1024
674 Ga0207640_10043487 3300025981 Bacteria 2872
675 Ga0207658_10003801 3300025986 Bacteria 10632
676 Ga0207658_10017334 3300025986 Bacteria 4961
677 Ga0207658_10025533 3300025986 Bacteria 4137
678 Ga0207658_10028133 3300025986 Bacteria 3957
679 Ga0207658_10058676 3300025986 Bacteria 2865
680 Ga0207658_10211973 3300025986 Unclassified 1624
681 Ga0207658_10543960 3300025986 Unclassified 1038
682 Ga0207677_10002528 3300026023 Bacteria 9587
683 Ga0207677_10044505 3300026023 Bacteria 2958
684 Ga0207677_10054223 3300026023 Bacteria 2734
685 Ga0207677_10100519 3300026023 Bacteria 2127
686 Ga0207677_10125779 3300026023 Bacteria 1937
687 Ga0207677_10173022 3300026023 Bacteria 1691
688 Ga0207677_10279216 3300026023 Bacteria 1370
689 Ga0207703_10002545 3300026035 Bacteria 15745
690 Ga0207703_10003606 3300026035 Bacteria 12919
691 Ga0207703_10339693 3300026035 Unclassified 1380
692 Ga0207639_10002738 3300026041 Bacteria 11827
693 Ga0207639_10009982 3300026041 Bacteria 6563
694 Ga0207639_10065405 3300026041 Bacteria 2823
695 Ga0207639_10086953 3300026041 Bacteria 2490
696 Ga0207639_10608182 3300026041 Bacteria 1008
697 Ga0207678_10063575 3300026067 Bacteria 3172
698 Ga0207678_10170807 3300026067 Bacteria 1856
699 Ga0207708_10016926 3300026075 Bacteria 5489
700 Ga0207708_10077631 3300026075 Bacteria 2549
701 Ga0207708_10517588 3300026075 Unclassified 1002
702 Ga0207708_10527723 3300026075 Bacteria 993
703 Ga0207641_10000184 3300026088 Bacteria 86994
704 Ga0207641_10003089 3300026088 Bacteria 14998
705 Ga0207641_10004182 3300026088 Bacteria 12574
706 Ga0207641_10046443 3300026088 Bacteria 3660
707 Ga0207641_10073835 3300026088 Bacteria 2940
708 Ga0207641_10311829 3300026088 Bacteria 1489
709 Ga0207641_10368053 3300026088 Bacteria 1374
710 Ga0207641_10519400 3300026088 Bacteria 1158
711 Ga0207648_10000488 3300026089 Bacteria 44152
712 Ga0207648_10006518 3300026089 Bacteria 11585
713 Ga0207648_10016043 3300026089 Bacteria 6862
714 Ga0207648_10024406 3300026089 Bacteria 5398
715 Ga0207648_10030559 3300026089 Bacteria 4768
716 Ga0207648_10034010 3300026089 Bacteria 4495
717 Ga0207648_10046889 3300026089 Bacteria 3788
718 Ga0207648_10079248 3300026089 Bacteria 2865
719 Ga0207648_10087305 3300026089 Bacteria 2722
720 Ga0207648_10830143 3300026089 Unclassified 861
721 Ga0207676_10003388 3300026095 Bacteria 11264
722 Ga0207676_10011316 3300026095 Bacteria 6377
723 Ga0207676_10030308 3300026095 Bacteria 4059
724 Ga0207676_10049366 3300026095 Bacteria 3273
725 Ga0207676_10069682 3300026095 Bacteria 2817
726 Ga0207676_10436645 3300026095 Bacteria 1231
727 Ga0207676_10549461 3300026095 Unclassified 1103
728 Ga0207674_10008650 3300026116 Bacteria 11727
729 Ga0207674_10027729 3300026116 Bacteria 5986
730 Ga0207674_10036746 3300026116 Bacteria 5099
731 Ga0207674_10076348 3300026116 Bacteria 3358
732 Ga0207674_10105672 3300026116 Unclassified 2793
733 Ga0207674_10277979 3300026116 Unclassified 1622
734 Ga0207674_10456867 3300026116 Bacteria 1234
735 Ga0207674_10555679 3300026116 Bacteria 1109
736 Ga0207674_10901502 3300026116 Bacteria 852
737 Ga0207675_100003643 3300026118 Bacteria 15015
738 Ga0207675_100007531 3300026118 Bacteria 10285
739 Ga0207675_100060176 3300026118 Bacteria 3546
740 Ga0207675_100063971 3300026118 Bacteria 3437
741 Ga0207675_100097749 3300026118 Bacteria 2765
742 Ga0207675_100238776 3300026118 Bacteria 1756
743 Ga0207675_100243594 3300026118 Bacteria 1738
744 Ga0207675_100330999 3300026118 Bacteria 1489
745 Ga0207675_100596880 3300026118 Bacteria 1107
746 Ga0207675_100607235 3300026118 Bacteria 1097
747 Ga0207683_10002620 3300026121 Bacteria 15710
748 Ga0207683_10026193 3300026121 Bacteria 5033
749 Ga0207683_10026625 3300026121 Bacteria 4993
750 Ga0207683_10047263 3300026121 Bacteria 3769
751 Ga0207683_10085974 3300026121 Bacteria 2796
752 Ga0207683_10093250 3300026121 Bacteria 2683
753 Ga0207683_10278135 3300026121 Bacteria 1530
754 Ga0207698_10097916 3300026142 Bacteria 2422
755 Ga0207698_10404643 3300026142 Bacteria 1305
756 Ga0207698_10422490 3300026142 Bacteria 1279
757 Ga0207698_10423485 3300026142 Bacteria 1278
758 Ga0207698_10762707 3300026142 Unclassified 967
759 Ga0207698_10769692 3300026142 Bacteria 963
760 Ga0207428_10013560 3300027907 Bacteria 7113
761 Ga0207428_10044663 3300027907 Bacteria 3573
762 Ga0268266_10003446 3300028379 Bacteria 15772
763 Ga0268266_10545767 3300028379 Bacteria 1110
764 Ga0268265_10019847 3300028380 Bacteria 4681
765 Ga0268265_10046626 3300028380 Bacteria 3241
766 Ga0268265_10095069 3300028380 Bacteria 2392
767 Ga0268265_10096767 3300028380 Bacteria 2373
768 Ga0268265_10266513 3300028380 Unclassified 1526
769 Ga0268265_10332197 3300028380 Bacteria 1381
770 Ga0268264_10002907 3300028381 Bacteria 14884
771 Ga0268264_10007740 3300028381 Bacteria 8946
772 Ga0268264_10012563 3300028381 Bacteria 6974
773 Ga0268264_10023693 3300028381 Bacteria 5005
774 Ga0268264_10025491 3300028381 Bacteria 4831
775 Ga0268264_10046502 3300028381 Bacteria 3604
776 Ga0268264_10068267 3300028381 Bacteria 3004
777 Ga0268264_10097640 3300028381 Bacteria 2547
778 Ga0268264_10113047 3300028381 Bacteria 2382
779 Ga0268264_10139237 3300028381 Bacteria 2162
780 Ga0268264_10171535 3300028381 Bacteria 1962
781 Ga0268264_10301685 3300028381 Bacteria 1508
782 Ga0268264_10491116 3300028381 Bacteria 1196
783 Ga0307515_10000455 3300028794 Bacteria 97670
784 Ga0316177_1064545 3300030731 Bacteria 1232
785 Ga0265327_10000013 3300031251 Bacteria 519549
786 Ga0265327_10000254 3300031251 Bacteria 106076
787 Ga0265327_10032002 3300031251 Bacteria 2950
788 Ga0265327_10062068 3300031251 Bacteria 1904
789 Ga0307513_10124861 3300031456 Bacteria 2532
790 Ga0307513_10463790 3300031456 Bacteria 989
791 Ga0307509_10043969 3300031507 Bacteria 4828
792 Ga0307509_10535933 3300031507 Bacteria 850
793 Ga0265313_10029162 3300031595 Bacteria 2858
794 Ga0307508_10000603 3300031616 Bacteria 43051
795 Ga0307406_10013998 3300031901 Bacteria 4607
796 Ga0307416_100157791 3300032002 Bacteria 2092
797 Ga0307416_100467654 3300032002 Bacteria 1318
798 Ga0307414_10150774 3300032004 Bacteria 1834
799 Ga0307414_10427274 3300032004 Bacteria 1157
800 Ga0307415_100129468 3300032126 Bacteria 1908
801 Ga0307415_100182501 3300032126 Bacteria 1648
802 Ga0373933_0013556 3300035724 Bacteria 4520
803 Ga0373933_0057220 3300035724 Unclassified 2343
804 Ga0373937_0000626 3300036401 Bacteria 31047
805 Ga0373937_0034742 3300036401 Bacteria 4585
806 Ga0373937_0154718 3300036401 Bacteria 2149
807 Ga0395899_0015685 3300037312 Bacteria 5777
808 Ga0395900_0047839 3300037418 Bacteria 4405
809 Ga0395900_0125735 3300037418 Bacteria 2630
810 Ga0395898_0015536 3300037466 Bacteria 7807
811 Ga0395901_0003272 3300038443 Bacteria 16313
812 Ga0436365_0298838 3300039437 Bacteria 7530
813 Ga0436365_1778757 3300039437 Bacteria 6021
814 Ga0436365_1889540 3300039437 Bacteria 1650
815 Ga0439436_0000413 3300041404 Bacteria 10744
816 Ga0451807_2402910 3300041486 Bacteria 1021
817 Ga0439441_014677 3300042001 Unclassified 1377
818 Ga0439449_0016026 3300042007 Bacteria 2818
819 Ga0439449_0017796 3300042007 Bacteria 2668
820 Ga0439457_003832 3300042014 Bacteria 4030
821 Ga0439457_014419 3300042014 Bacteria 1769
822 Ga0439462_0042841 3300042015 Bacteria 1209
823 Ga0450897_007222 3300042128 Bacteria 1010
824 Ga0450897_007938 3300042128 Bacteria 978
825 Ga0450894_014063 3300042131 Bacteria 1054
826 Ga0450898_030723 3300042134 Bacteria 985
827 Ga0450899_009011 3300042135 Bacteria 1096
828 Ga0439446_0024266 3300042156 Bacteria 1730
829 Ga0450893_0021987 3300042532 Bacteria 1103
830 Ga0451577_0020044 3300042876 Bacteria 6141
831 Ga0451577_0302370 3300042876 Bacteria 1450
832 Ga0451577_0538842 3300042876 Unclassified 1060
833 Ga0466969_0004123 3300044656 Bacteria 7712
834 Ga0466972_0000016 3300044658 Bacteria 208802
835 Ga0466972_0000104 3300044658 Bacteria 73886
836 Ga0466965_0189992 3300044683 Bacteria 1086
837 Ga0466966_0000193 3300044684 Bacteria 40730
838 Ga0466961_0211192 3300044693 Bacteria 1198
839 Ga0453684_0021387 3300044712 Bacteria 9667
840 Ga0453684_0038554 3300044712 Bacteria 6529
841 Ga0453684_0148150 3300044712 Bacteria 2793
842 Ga0453684_0734438 3300044712 Bacteria 1070
843 Ga0453684_0748184 3300044712 Bacteria 1058
844 Ga0466968_0010449 3300044735 Bacteria 3600
845 Ga0466970_0043550 3300044765 Bacteria 2388
846 Ga0466957_0001943 3300044842 Bacteria 10977
847 Ga0466957_0110513 3300044842 Bacteria 1742
848 Ga0466960_0054762 3300044901 Bacteria 1938
849 Ga0466959_0002486 3300045049 Bacteria 11803
850 Ga0451576_0133276 3300045051 Bacteria 2590
851 Ga0495592_0041592 3300046454 Bacteria 3445
852 Ga0495603_0170933 3300046455 Bacteria 1259
853 Ga0495638_0023753 3300046460 Bacteria 4005
854 Ga0495650_0029888 3300046471 Bacteria 2476
855 Ga0495618_0121311 3300046514 Bacteria 1674
856 Ga0495628_0032333 3300046516 Bacteria 4224
857 Ga0495630_0018495 3300046517 Bacteria 5119
858 Ga0495668_0000242 3300046616 Bacteria 78022
859 Ga0495668_0006585 3300046616 Bacteria 7580
860 Ga0495634_0131032 3300046642 Bacteria 1598
861 Ga0495635_0042972 3300046663 Bacteria 3120
862 Ga0495670_0010331 3300046691 Bacteria 4586
863 Ga0495674_0188469 3300047319 Unclassified 1715
864 Ga0495672_0005013 3300047320 Bacteria 10598
865 Ga0495672_0020050 3300047320 Bacteria 4392
866 Ga0495680_0128059 3300047322 Bacteria 1868
867 Ga0495684_0291467 3300047471 Bacteria 1174
868 Ga0495686_0011185 3300047472 Bacteria 6332
869 Ga0496100_0693337 3300048903 Bacteria 795
870 Ga0496101_0224250 3300048904 Unclassified 1459
871 Ga0496104_0339198 3300048907 Unclassified 1416
872 Ga0496105_0207097 3300048908 Bacteria 1600
873 Ga0496109_0014633 3300048912 Bacteria 6826
874 Ga0496109_0288820 3300048912 Bacteria 1546
875 Ga0496110_0065694 3300048913 Bacteria 3208
876 Ga0496110_0231067 3300048913 Bacteria 1682
877 Ga0496112_0328164 3300048915 Bacteria 1474
878 Ga0501306_016337 3300049127 Bacteria 996
879 Ga0501306_031780 3300049127 Bacteria 788
880 Ga0501306_033411 3300049127 Bacteria 773
881 Ga0501308_001539 3300049128 Bacteria 1869
882 Ga0501308_012590 3300049128 Bacteria 968
883 Ga0501305_030069 3300049161 Bacteria 843
884 Ga0501290_002235 3300049513 Bacteria 2515
885 Ga0501292_000995 3300049515 Bacteria 3442
886 Ga0501298_000530 3300049521 Bacteria 5175
887 Ga0501299_001303 3300049522 Bacteria 3168
888 Ga0501303_015565 3300049526 Bacteria 762
889 Ga0501312_002971 3300049528 Bacteria 1881
890 Ga0501312_024910 3300049528 Bacteria 909
891 Ga0501312_036890 3300049528 Bacteria 786
892 Ga0501314_009319 3300049530 Bacteria 899
893 Ga0501316_024174 3300049532 Bacteria 784
894 Ga0501324_016328 3300049540 Bacteria 728
895 Ga0501337_006885 3300049553 Bacteria 784
896 Ga0501031_0328658 3300049568 Bacteria 990
897 Ga0501031_0363715 3300049568 Bacteria 936
898 Ga0501032_0004313 3300049569 Bacteria 10742
899 Ga0501032_0045286 3300049569 Bacteria 2976
900 Ga0501032_0098945 3300049569 Bacteria 1932
901 Ga0501032_0201334 3300049569 Unclassified 1299
902 Ga0501033_0006858 3300049570 Bacteria 8892
903 Ga0501033_0094311 3300049570 Bacteria 2189
904 Ga0501033_0214437 3300049570 Bacteria 1372
905 Ga0501034_0000002 3300049571 Bacteria 565510
906 Ga0501034_0008447 3300049571 Bacteria 10876
907 Ga0501034_0012890 3300049571 Bacteria 8623
908 Ga0501034_0022986 3300049571 Bacteria 6353
909 Ga0501034_0031289 3300049571 Bacteria 5405
910 Ga0501034_0039862 3300049571 Bacteria 4757
911 Ga0501034_0097671 3300049571 Bacteria 2933
912 Ga0501034_0098127 3300049571 Bacteria 2925
913 Ga0501034_0106927 3300049571 Bacteria 2790
914 Ga0501036_0041557 3300049572 Bacteria 3889
915 Ga0501037_0020352 3300049573 Bacteria 4899
916 Ga0501037_0036949 3300049573 Bacteria 3599
917 Ga0501037_0042976 3300049573 Bacteria 3321
918 Ga0501037_0175444 3300049573 Unclassified 1522
919 Ga0501038_0005400 3300049574 Bacteria 11880
920 Ga0501038_0039893 3300049574 Bacteria 4104
921 Ga0501038_0062216 3300049574 Bacteria 3189
922 Ga0501038_0100211 3300049574 Bacteria 2414
923 Ga0501038_0478766 3300049574 Bacteria 954
924 Ga0501039_0008583 3300049575 Bacteria 7792
925 Ga0501039_0039599 3300049575 Bacteria 3640
926 Ga0501043_0004656 3300049579 Bacteria 11119
927 Ga0501043_0013445 3300049579 Bacteria 6401
928 Ga0501043_0059217 3300049579 Bacteria 3006
929 Ga0501043_0160558 3300049579 Bacteria 1756
930 Ga0501046_0003336 3300049580 Bacteria 14755
931 Ga0501046_0026201 3300049580 Bacteria 4763
932 Ga0501047_0002513 3300049581 Bacteria 17487
933 Ga0501047_0088741 3300049581 Bacteria 2969
934 Ga0501047_0160319 3300049581 Bacteria 2121
935 Ga0501047_0167032 3300049581 Bacteria 2071
936 Ga0501047_0199458 3300049581 Bacteria 1862
937 Ga0501048_0390018 3300049582 Bacteria 995
938 Ga0501069_0080213 3300049585 Bacteria 1838
939 Ga0501070_0006730 3300049586 Bacteria 9787
940 Ga0501070_0103596 3300049586 Bacteria 2353
941 Ga0501070_0396254 3300049586 Unclassified 1117
942 Ga0501072_0013863 3300049588 Bacteria 6176
943 Ga0501072_0526879 3300049588 Bacteria 934
944 Ga0501073_0001665 3300049589 Bacteria 16470
945 Ga0501073_0093194 3300049589 Bacteria 2093
946 Ga0501074_0102143 3300049590 Bacteria 2052
947 Ga0501198_000711 3300049649 Bacteria 4137
948 Ga0501198_011403 3300049649 Bacteria 1326
949 Ga0501201_000337 3300049651 Bacteria 4292
950 Ga0501202_005557 3300049652 Bacteria 2233
951 Ga0501206_007100 3300049653 Bacteria 1465
952 Ga0501207_001019 3300049654 Bacteria 3409
953 Ga0501216_001931 3300049660 Bacteria 2876
954 Ga0501217_000623 3300049661 Bacteria 5967
955 Ga0501217_008287 3300049661 Bacteria 2242
956 Ga0501222_009960 3300049662 Bacteria 1255
957 Ga0501223_000612 3300049663 Bacteria 8570
958 Ga0501227_013552 3300049665 Bacteria 1798
959 Ga0501228_005443 3300049666 Bacteria 1129
960 Ga0501233_036779 3300049668 Bacteria 1134
961 Ga0501235_001816 3300049669 Bacteria 4582
962 Ga0501235_023363 3300049669 Bacteria 1378
963 Ga0501236_008339 3300049670 Bacteria 1315
964 Ga0501240_000563 3300049673 Bacteria 3098
965 Ga0501242_002993 3300049674 Bacteria 1805
966 Ga0501242_009611 3300049674 Bacteria 1146
967 Ga0501243_000175 3300049675 Bacteria 7506
968 Ga0501251_001086 3300049681 Bacteria 2501
969 Ga0501252_000056 3300049682 Bacteria 5790
970 Ga0501253_004251 3300049683 Bacteria 1792
971 Ga0501257_030121 3300049686 Bacteria 1305
972 Ga0501259_000471 3300049688 Bacteria 6427
973 Ga0501259_004572 3300049688 Bacteria 2199
974 Ga0501261_000479 3300049690 Bacteria 5113
975 Ga0501219_000944 3300049703 Bacteria 3507
976 Ga0501221_000519 3300049704 Bacteria 6099
977 Ga0501225_0001014 3300049705 Bacteria 8815
978 Ga0501225_0002100 3300049705 Bacteria 6196
979 Ga0501225_0111651 3300049705 Bacteria 806
980 Ga0501234_000632 3300049707 Bacteria 5424
981 Ga0501234_007549 3300049707 Bacteria 1701
982 Ga0501245_010223 3300049708 Bacteria 1354
983 Ga0501079_0064510 3300049741 Bacteria 2825
984 Ga0501079_0191309 3300049741 Bacteria 1597
985 Ga0501080_0077292 3300049742 Bacteria 3095
986 Ga0501080_0314414 3300049742 Bacteria 1419
987 Ga0501083_0086403 3300049744 Bacteria 2074
988 Ga0501083_0148600 3300049744 Bacteria 1534
989 Ga0501241_018032 3300049758 Bacteria 1292
990 Ga0501264_004095 3300049761 Bacteria 1321
991 Ga0501266_013482 3300049763 Bacteria 1064
992 Ga0501267_002942 3300049764 Bacteria 1529
993 Ga0501268_006384 3300049765 Bacteria 1728
994 Ga0501279_009957 3300049775 Bacteria 1277
995 Ga0501282_005688 3300049778 Bacteria 1335
996 Ga0501035_0001789 3300049822 Bacteria 21715
997 Ga0501035_0019698 3300049822 Bacteria 6200
998 Ga0501035_0065820 3300049822 Bacteria 3217
999 Ga0501035_0075123 3300049822 Bacteria 2989
1000 Ga0501035_0531458 3300049822 Unclassified 965
1001 Ga0501044_0004121 3300049823 Bacteria 16310
1002 Ga0501044_0012046 3300049823 Bacteria 9365
1003 Ga0501044_0026210 3300049823 Bacteria 6174
1004 Ga0501044_0039575 3300049823 Bacteria 4917
1005 Ga0501044_0273289 3300049823 Bacteria 1625
1006 Ga0501044_0369310 3300049823 Bacteria 1351
1007 Ga0501204_004697 3300049850 Bacteria 1478
1008 Ga0501212_004479 3300049851 Bacteria 1806
1009 Ga0501284_00006 3300050005 Bacteria 153628
1010 nmdc:mga0k408_101998_c1 3300050493 Bacteria 1692
1011 nmdc:mga0k408_105792_c1 3300050493 Bacteria 1662
1012 nmdc:mga0k408_176430_c1 3300050493 Bacteria 1274
1013 nmdc:mga0k408_18195_c1 3300050493 Bacteria 3921
1014 nmdc:mga0k408_3671_c2 3300050493 Bacteria 1797
1015 nmdc:mga0k408_54565_c2 3300050493 Bacteria 1079
1016 nmdc:mga05p37_48940_c1 3300050507 Bacteria 5198
1017 nmdc:mga05p37_53739_c1 3300050507 Bacteria 4954
1018 nmdc:mga0qj67_84982_c1 3300050509 Bacteria 2538
1019 nmdc:mga06r32_131083_c1 3300050510 Bacteria 2479
1020 nmdc:mga06r32_23249_c1 3300050510 Bacteria 5733
1021 nmdc:mga08y16_39378_c1 3300050511 Bacteria 4960
1022 nmdc:mga08y16_423395_c1 3300050511 Unclassified 1361
1023 nmdc:mga08y16_470754_c1 3300050511 Bacteria 1279
1024 nmdc:mga08y16_820311_c1 3300050511 Bacteria 922
1025 nmdc:mga08y16_880207_c1 3300050511 Bacteria 883
1026 Ga0495619_0044008 3300053085 Bacteria 2929
1027 Ga0500578_0011031 3300053086 Bacteria 5839
1028 Ga0500583_0000009 3300053092 Bacteria 160749
1029 Ga0500583_0000258 3300053092 Bacteria 18965
1030 Ga0500651_0000232 3300053093 Bacteria 34617
1031 Ga0500641_0091345 3300053096 Unclassified 1300
1032 Ga0500555_024159 3300053103 Bacteria 1742
1033 Ga0500642_0043895 3300053130 Bacteria 1944
1034 Ga0500642_0135173 3300053130 Bacteria 1156
1035 Ga0500652_018206 3300053131 Bacteria 2589
1036 Ga0500652_086308 3300053131 Bacteria 1309
1037 Ga0500559_0024426 3300053136 Bacteria 2572
1038 Ga0500568_0000895 3300053139 Bacteria 20694
1039 Ga0500589_001419 3300053147 Bacteria 7110
1040 Ga0500604_0010575 3300053151 Bacteria 2470
1041 Ga0500616_0176839 3300053153 Bacteria 964
1042 Ga0500622_0000615 3300053156 Bacteria 32225
1043 Ga0500622_0058994 3300053156 Bacteria 1960
1044 Ga0500639_037414 3300053163 Bacteria 2557
1045 Ga0500611_000005 3300053727 Bacteria 228837
1046 Ga0500645_034780 3300053730 Bacteria 1504
1047 Ga0501084_0018691 3300054114 Bacteria 5770
1048 Ga0501084_0183587 3300054114 Bacteria 1766
1049 Ga0500661_001332 3300055283 Bacteria 4609
1050 Ga0587068_011416 3300059641 Bacteria 1340
1051 Ga0501082_0070209 3300060353 Bacteria 3016
1052 2738725990 2738541278 Bacteria 9755573
1053 2819590467 2818991444 Bacteria 6968812
1054 2914759804 2914759650 Bacteria 4701441
1055 2929158632 2929154850 Bacteria 6753285
1056 Ga0501080_0676784
1057 MRS1b_contig_8282875
1058 MBSR1b_contig_807238
1059 JGI24744J21845_10019960
1060 JGI24033J26618_1007474
1061 JGI24751J29686_10000409
1062 JGI25406J46586_10000143
1063 JGI25406J46586_10048452
1064 rootH1_10024197
1065 rootH2_10100492
1066 rootL2_10216868
1067 rootL2_10230147
1068 rootH1_10014938
1069 rootH1_10073697
1070 rootH1_10104989
1071 JGI25160J50197_1001273
1072 Ga0065714_10090598
1073 Ga0065704_10091559
1074 Ga0065704_10149944
1075 Ga0065712_10114193
1076 Ga0065715_10008112
1077 Ga0065715_10189048
1078 Ga0065715_10381257
1079 Ga0070658_10117258
1080 Ga0070658_10145098
1081 Ga0070676_10000238
1082 Ga0070676_10155426
1083 Ga0070676_10173976
1084 Ga0070676_10293962
1085 Ga0070676_10341912
1086 Ga0070683_100008594
1087 Ga0070683_100243220
1088 Ga0070683_100469055
1089 Ga0070690_100018274
1090 Ga0070690_100019279
1091 Ga0070690_100206683
1092 Ga0070670_100021331
1093 Ga0070670_100042070
1094 Ga0070670_100066171
1095 Ga0070670_100088043
1096 Ga0070670_100092922
1097 Ga0070670_100257530
1098 Ga0070670_100541003
1099 Ga0070670_100633829
1100 Ga0070677_10011093
1101 Ga0070677_10076810
1102 Ga0068869_100005951
1103 Ga0068869_100010616
1104 Ga0068869_100011228
1105 Ga0068869_100011620
1106 Ga0068869_100017491
1107 Ga0068869_100029659
1108 Ga0068869_100081983
1109 Ga0068869_100158273
1110 Ga0068869_100318764
1111 Ga0070666_10000019
1112 Ga0070666_10000966
1113 Ga0070666_10004456
1114 Ga0070666_10103137
1115 Ga0070666_10173240
1116 Ga0070666_10232849
1117 Ga0070680_100000930
1118 Ga0070680_100034567
1119 Ga0070680_100127533
1120 Ga0070682_100000423
1121 Ga0070682_100001176
1122 Ga0070682_100079043
1123 Ga0070682_100091788
1124 Ga0070682_100259407
1125 Ga0068868_100002525
1126 Ga0068868_100004277
1127 Ga0068868_100004975
1128 Ga0068868_100019194
1129 Ga0068868_100042310
1130 Ga0068868_100062700
1131 Ga0068868_100063169
1132 Ga0068868_100144041
1133 Ga0070660_100046558
1134 Ga0070660_100122274
1135 Ga0070660_100331338
1136 Ga0070660_100533699
1137 Ga0070689_100023578
1138 Ga0070689_100141821
1139 Ga0070689_100188755
1140 Ga0070687_100013338
1141 Ga0070687_100080022
1142 Ga0070661_100026648
1143 Ga0070661_100596269
1144 Ga0070692_10255945
1145 Ga0070668_100000981
1146 Ga0070668_100016663
1147 Ga0070668_100037453
1148 Ga0070668_100140486
1149 Ga0070668_100159587
1150 Ga0070668_100235022
1151 Ga0070668_100294963
1152 Ga0070669_100000826
1153 Ga0070669_100023785
1154 Ga0070669_100096692
1155 Ga0070669_100206721
1156 Ga0070675_100011529
1157 Ga0070675_100012707
1158 Ga0070675_100069637
1159 Ga0070675_100076970
1160 Ga0070675_100281514
1161 Ga0070675_100560982
1162 Ga0070671_100032220
1163 Ga0070671_100054717
1164 Ga0070671_100224205
1165 Ga0070671_100267854
1166 Ga0070671_100641687
1167 Ga0070674_100136372
1168 Ga0070674_100477639
1169 Ga0070673_100001854
1170 Ga0070673_100008764
1171 Ga0070673_100012202
1172 Ga0070673_100036038
1173 Ga0070673_100079878
1174 Ga0070673_100112347
1175 Ga0070673_100130947
1176 Ga0070673_100138587
1177 Ga0070673_100219197
1178 Ga0070673_100770808
1179 Ga0070688_100001299
1180 Ga0070688_100002166
1181 Ga0070688_100073887
1182 Ga0070688_100253364
1183 Ga0070659_100032456
1184 Ga0070667_100001589
1185 Ga0070667_100011530
1186 Ga0070667_100012973
1187 Ga0070667_100014864
1188 Ga0070667_100022490
1189 Ga0070667_100226056
1190 Ga0070667_100242036
1191 Ga0070667_100257172
1192 Ga0070667_100355701
1193 Ga0070667_100406789
1194 Ga0070700_100148522
1195 Ga0070694_100512318
1196 Ga0070663_100138358
1197 Ga0070663_100263995
1198 Ga0070663_100452975
1199 Ga0070678_100003466
1200 Ga0070678_100325856
1201 Ga0070678_100478616
1202 Ga0070662_100001906
1203 Ga0070662_100002104
1204 Ga0070662_100038623
1205 Ga0070662_100237271
1206 Ga0070662_100993694
1207 Ga0070681_10033798
1208 Ga0070681_10078658
1209 Ga0070681_10247465
1210 Ga0070681_10389345
1211 Ga0068867_100004334
1212 Ga0068867_100011177
1213 Ga0068867_100015145
1214 Ga0068867_100028178
1215 Ga0068867_100028654
1216 Ga0068867_100054313
1217 Ga0068867_100064586
1218 Ga0068867_100108848
1219 Ga0068867_100114652
1220 Ga0068867_100117163
1221 Ga0068867_100258067
1222 Ga0068867_100338431
1223 Ga0068867_100725156
1224 Ga0070685_10031812
1225 Ga0070685_10128264
1226 Ga0070706_100444877
1227 Ga0070707_100148980
1228 Ga0070698_100001267
1229 Ga0070698_100019395
1230 Ga0070698_100054424
1231 Ga0070698_100066940
1232 Ga0070698_100664676
1233 Ga0070699_100055087
1234 Ga0070679_100054082
1235 Ga0070679_100062849
1236 Ga0070679_100104850
1237 Ga0070684_100005645
1238 Ga0070697_100334894
1239 Ga0068853_100009326
1240 Ga0068853_100085771
1241 Ga0068853_100089920
1242 Ga0068853_100165384
1243 Ga0068853_100176568
1244 Ga0068853_100346450
1245 Ga0068853_100494491
1246 Ga0070672_100001555
1247 Ga0070672_100011979
1248 Ga0070672_100058606
1249 Ga0070672_100112553
1250 Ga0070672_100238544
1251 Ga0070672_100388203
1252 Ga0070672_100539695
1253 Ga0070686_100017757
1254 Ga0070686_100145797
1255 Ga0070686_100213621
1256 Ga0070686_100475980
1257 Ga0070686_100477280
1258 Ga0070693_100071864
1259 Ga0070693_100092842
1260 Ga0070665_100002381
1261 Ga0070665_100018175
1262 Ga0070665_100418798
1263 Ga0070665_100687807
1264 Ga0068855_100005983
1265 Ga0068855_100039366
1266 Ga0068855_100083430
1267 Ga0068855_100253182
1268 Ga0070664_100061322
1269 Ga0070664_100064495
1270 Ga0070664_100074517
1271 Ga0070664_100109408
1272 Ga0070664_100533505
1273 Ga0070664_100573254
1274 Ga0070664_100651503
1275 Ga0068857_100023123
1276 Ga0068857_100174400
1277 Ga0068857_100597673
1278 Ga0068857_100653403
1279 Ga0068854_100037680
1280 Ga0068854_100189763
1281 Ga0068854_100611099
1282 Ga0068856_100007851
1283 Ga0070702_100066427
1284 Ga0070702_100113874
1285 Ga0068852_100031375
1286 Ga0068852_100053358
1287 Ga0068852_100102496
1288 Ga0068852_100135178
1289 Ga0068859_100000013
1290 Ga0068859_100010041
1291 Ga0068859_100019858
1292 Ga0068859_100019894
1293 Ga0068859_100029635
1294 Ga0068859_100029925
1295 Ga0068859_100038541
1296 Ga0068859_100054597
1297 Ga0068859_100058980
1298 Ga0068859_100090332
1299 Ga0068859_100131419
1300 Ga0068859_100139162
1301 Ga0068859_100284061
1302 Ga0068859_100382405
1303 Ga0068859_100632298
1304 Ga0068864_100000357
1305 Ga0068864_100001339
1306 Ga0068864_100011141
1307 Ga0068864_100029348
1308 Ga0068864_100045286
1309 Ga0068864_100450642
1310 Ga0068864_100498590
1311 Ga0068866_10003544
1312 Ga0068866_10079890
1313 Ga0068866_10217405
1314 Ga0068861_100009344
1315 Ga0068861_100014355
1316 Ga0068861_100045063
1317 Ga0068861_100110453
1318 Ga0068861_100141357
1319 Ga0068861_100279769
1320 Ga0068861_100361218
1321 Ga0068861_100372015
1322 Ga0068851_10000433
1323 Ga0068851_10025715
1324 Ga0068851_10252166
1325 Ga0068851_10255719
1326 Ga0068870_10001616
1327 Ga0068870_10088732
1328 Ga0068870_10436643
1329 Ga0068863_100001616
1330 Ga0068863_100002217
1331 Ga0068863_100026605
1332 Ga0068863_100067788
1333 Ga0068863_100110030
1334 Ga0068863_100275815
1335 Ga0068863_100299336
1336 Ga0068863_100312215
1337 Ga0068863_100352403
1338 Ga0068863_100626159
1339 Ga0068863_100931683
1340 Ga0068858_100006851
1341 Ga0068858_100013114
1342 Ga0068858_100102257
1343 Ga0068858_100122844
1344 Ga0068858_100126686
1345 Ga0068858_100789562
1346 Ga0068860_100000948
1347 Ga0068860_100002928
1348 Ga0068860_100008208
1349 Ga0068860_100011092
1350 Ga0068860_100012904
1351 Ga0068860_100019036
1352 Ga0068860_100037012
1353 Ga0068860_100151572
1354 Ga0068860_100163293
1355 Ga0068860_100174243
1356 Ga0068860_100188881
1357 Ga0068860_100283172
1358 Ga0068860_100582336
1359 Ga0068860_100616993
1360 Ga0068862_100005077
1361 Ga0068862_100040502
1362 Ga0068862_100110877
1363 Ga0068862_100111578
1364 Ga0068862_100167921
1365 Ga0068862_100452332
1366 Ga0068862_100920125
1367 Ga0081539_10000402
1368 Ga0081539_10026620
1369 Ga0075366_10005580
1370 Ga0075366_10010004
1371 Ga0075366_10083828
1372 Ga0075366_10244292
1373 Ga0075366_10264951
1374 Ga0097621_100000960
1375 Ga0097621_100003944
1376 Ga0097621_100017259
1377 Ga0097621_100040578
1378 Ga0097621_100104803
1379 Ga0097621_100110271
1380 Ga0075370_10147888
1381 Ga0075370_10204252
1382 Ga0068871_100000582
1383 Ga0068871_100001510
1384 Ga0068871_100001981
1385 Ga0068871_100076476
1386 Ga0068871_100116632
1387 Ga0068871_100348634
1388 Ga0068871_100353048
1389 Ga0068871_100439543
1390 Ga0068871_100564957
1391 Ga0068871_100649722
1392 Ga0075428_100041147
1393 Ga0075430_100005897
1394 Ga0075431_100020982
1395 Ga0075431_100317946
1396 Ga0075429_100030293
1397 Ga0075429_100157104
1398 Ga0068865_100005767
1399 Ga0068865_100018860
1400 Ga0068865_100162117
1401 Ga0097620_100000013
1402 Ga0097620_100010041
1403 Ga0097620_100019858
1404 Ga0097620_100019895
1405 Ga0097620_100029634
1406 Ga0097620_100029926
1407 Ga0097620_100038543
1408 Ga0097620_100054597
1409 Ga0097620_100058980
1410 Ga0097620_100090336
1411 Ga0097620_100131425
1412 Ga0097620_100139165
1413 Ga0097620_100284040
1414 Ga0097620_100382392
1415 Ga0097620_100632282
1416 Ga0105240_10001908
1417 Ga0111539_10028550
1418 Ga0111539_10047620
1419 Ga0111539_10114039
1420 Ga0111539_10129092
1421 Ga0111539_11278505
1422 Ga0105245_10051281
1423 Ga0105245_10068267
1424 Ga0105247_10000906
1425 Ga0105247_10011607
1426 Ga0114129_10033187
1427 Ga0105243_10070257
1428 Ga0105243_10073565
1429 Ga0105241_10000858
1430 Ga0105241_10005708
1431 Ga0105241_10008625
1432 Ga0105241_10097998
1433 Ga0105241_10200902
1434 Ga0105241_10323049
1435 Ga0105241_10437512
1436 Ga0105241_10619090
1437 Ga0105242_10010225
1438 Ga0105242_10029115
1439 Ga0105242_10042800
1440 Ga0105242_10066209
1441 Ga0105242_10164073
1442 Ga0105242_10276328
1443 Ga0105242_10331238
1444 Ga0105242_10419863
1445 Ga0105242_10537505
1446 Ga0105242_10835750
1447 Ga0105248_10074758
1448 Ga0105248_10085106
1449 Ga0105237_10012709
1450 Ga0105237_10026673
1451 Ga0105237_10038845
1452 Ga0105249_10000349
1453 Ga0105249_10001507
1454 Ga0105249_10001918
1455 Ga0105249_10006005
1456 Ga0105249_10011132
1457 Ga0105249_10032555
1458 Ga0105249_10052361
1459 Ga0105249_10077670
1460 Ga0105249_10109955
1461 Ga0105249_10228135
1462 Ga0105249_10240861
1463 Ga0105239_10001102
1464 Ga0105239_10049269
1465 Ga0105239_10582044
1466 Ga0105239_10726381
1467 Ga0105246_10012996
1468 Ga0105246_10204976
1469 Ga0157373_10082601
1470 Ga0157373_10190016
1471 Ga0157371_10028376
1472 Ga0157371_10049104
1473 Ga0157371_10677130
1474 Ga0157370_10001507
1475 Ga0157370_10004859
1476 Ga0157370_10294963
1477 Ga0157369_10040230
1478 Ga0157374_10002251
1479 Ga0157374_10002286
1480 Ga0157374_10031984
1481 Ga0157374_10053553
1482 Ga0157374_10141538
1483 Ga0157374_10249292
1484 Ga0157374_10705627
1485 Ga0157374_10983454
1486 Ga0157378_10011546
1487 Ga0157378_10013523
1488 Ga0157378_10015823
1489 Ga0157378_10017243
1490 Ga0157378_10018450
1491 Ga0157378_10020057
1492 Ga0157378_10029140
1493 Ga0157378_10051030
1494 Ga0157378_10073011
1495 Ga0157378_10594185
1496 Ga0157378_10670193
1497 Ga0157378_10763422
1498 Ga0157378_10872330
1499 Ga0163162_10001002
1500 Ga0163162_10001863
1501 Ga0163162_10012341
1502 Ga0163162_10026158
1503 Ga0163162_10054538
1504 Ga0163162_10153151
1505 Ga0163162_10172942
1506 Ga0163162_10359976
1507 Ga0163162_10368078
1508 Ga0157372_10053387
1509 Ga0157372_10107240
1510 Ga0157372_10130502
1511 Ga0157372_10156597
1512 Ga0157372_11165304
1513 Ga0157372_11372333
1514 Ga0157375_10000186
1515 Ga0157375_10000827
1516 Ga0157375_10035495
1517 Ga0157375_10051538
1518 Ga0157375_10133808
1519 Ga0157375_10152272
1520 Ga0157375_10211732
1521 Ga0157375_10227395
1522 Ga0157375_10282570
1523 Ga0157375_10403786
1524 Ga0157375_10503547
1525 Ga0157375_10624499
1526 Ga0163163_10001753
1527 Ga0163163_10066412
1528 Ga0163163_10140861
1529 Ga0163163_10276699
1530 Ga0163163_10352991
1531 Ga0163163_10621308
1532 Ga0157380_10000650
1533 Ga0157380_10003052
1534 Ga0157380_10025482
1535 Ga0157380_10371768
1536 Ga0157380_10444385
1537 Ga0157380_10521547
1538 Ga0157377_10000426
1539 Ga0157377_10021575
1540 Ga0157377_10026874
1541 Ga0157377_10066059
1542 Ga0157377_10083855
1543 Ga0157379_10000976
1544 Ga0157379_10015986
1545 Ga0157379_10016659
1546 Ga0157379_10037296
1547 Ga0157379_10180962
1548 Ga0157379_10429861
1549 Ga0157376_10000650
1550 Ga0157376_10008988
1551 Ga0157376_10061038
1552 Ga0157376_10124854
1553 Ga0157376_10206340
1554 Ga0157376_10543233
1555 Ga0163161_10004470
1556 Ga0163161_10025267
1557 Ga0163161_10031410
1558 Ga0163161_10039345
1559 Ga0163161_10044628
1560 Ga0163161_10409513
1561 Ga0213876_10012974
1562 Ga0207426_1000230
1563 Ga0207697_10114295
1564 Ga0207656_10001978
1565 Ga0207656_10011320
1566 Ga0207656_10034210
1567 Ga0207656_10261089
1568 Ga0207682_10021187
1569 Ga0207682_10025688
1570 Ga0207682_10031701
1571 Ga0207642_10006779
1572 Ga0207710_10000417
1573 Ga0207710_10103541
1574 Ga0207688_10120088
1575 Ga0207680_10000673
1576 Ga0207680_10105322
1577 Ga0207680_10204976
1578 Ga0207680_10233803
1579 Ga0207680_10234123
1580 Ga0207680_10536183
1581 Ga0207647_10041916
1582 Ga0207685_10128385
1583 Ga0207645_10000684
1584 Ga0207645_10001198
1585 Ga0207645_10015549
1586 Ga0207645_10046954
1587 Ga0207645_10065076
1588 Ga0207645_10082001
1589 Ga0207645_10103782
1590 Ga0207645_10157573
1591 Ga0207645_10307144
1592 Ga0207643_10010782
1593 Ga0207643_10021449
1594 Ga0207643_10304794
1595 Ga0207705_10010195
1596 Ga0207654_10000569
1597 Ga0207654_10002605
1598 Ga0207654_10224234
1599 Ga0207654_10304868
1600 Ga0207654_10315026
1601 Ga0207707_10000299
1602 Ga0207707_10385436
1603 Ga0207707_10386624
1604 Ga0207707_10477052
1605 Ga0207695_10014544
1606 Ga0207671_10007851
1607 Ga0207671_10018917
1608 Ga0207671_10020567
1609 Ga0207660_10004975
1610 Ga0207660_10021310
1611 Ga0207662_10000535
1612 Ga0207657_10028682
1613 Ga0207657_10088416
1614 Ga0207657_10113696
1615 Ga0207657_10419254
1616 Ga0207649_10087229
1617 Ga0207652_10013799
1618 Ga0207652_10033484
1619 Ga0207652_10222080
1620 Ga0207646_10798337
1621 Ga0207681_10085979
1622 Ga0207681_10097085
1623 Ga0207681_10129501
1624 Ga0207681_10225019
1625 Ga0207681_10270733
1626 Ga0207681_10355544
1627 Ga0207650_10086314
1628 Ga0207650_10095012
1629 Ga0207650_10099351
1630 Ga0207650_10114342
1631 Ga0207650_10150942
1632 Ga0207650_10271446
1633 Ga0207650_10413451
1634 Ga0207659_10009317
1635 Ga0207659_10014000
1636 Ga0207659_10014978
1637 Ga0207659_10050875
1638 Ga0207659_10055643
1639 Ga0207659_10193585
1640 Ga0207687_10283307
1641 Ga0207644_10033752
1642 Ga0207644_10198384
1643 Ga0207644_10208113
1644 Ga0207644_10548283
1645 Ga0207644_10614149
1646 Ga0207644_10782563
1647 Ga0207690_10000343
1648 Ga0207690_10017765
1649 Ga0207690_10084309
1650 Ga0207690_10256772
1651 Ga0207706_10005121
1652 Ga0207706_10008686
1653 Ga0207706_10027788
1654 Ga0207706_10028286
1655 Ga0207706_10111430
1656 Ga0207706_10340490
1657 Ga0207706_10817573
1658 Ga0207686_10001802
1659 Ga0207686_10045206
1660 Ga0207686_10147386
1661 Ga0207686_10705821
1662 Ga0207709_10061250
1663 Ga0207670_10136932
1664 Ga0207670_10713195
1665 Ga0207669_10055077
1666 Ga0207669_10093896
1667 Ga0207669_10385712
1668 Ga0207704_10037101
1669 Ga0207704_10037235
1670 Ga0207704_10093507
1671 Ga0207704_10280838
1672 Ga0207704_10620461
1673 Ga0207665_10454282
1674 Ga0207691_10000076
1675 Ga0207691_10003310
1676 Ga0207691_10026563
1677 Ga0207691_10040327
1678 Ga0207691_10072636
1679 Ga0207691_10079309
1680 Ga0207691_10089212
1681 Ga0207691_10099507
1682 Ga0207691_10669181
1683 Ga0207711_10109221
1684 Ga0207711_10255166
1685 Ga0207689_10001148
1686 Ga0207689_10002202
1687 Ga0207689_10004010
1688 Ga0207689_10015942
1689 Ga0207689_10017269
1690 Ga0207689_10035934
1691 Ga0207689_10156204
1692 Ga0207689_10161836
1693 Ga0207689_10167365
1694 Ga0207689_10192959
1695 Ga0207689_10196534
1696 Ga0207689_10393235
1697 Ga0207661_10373642
1698 Ga0207661_10478636
1699 Ga0207661_10806530
1700 Ga0207679_10002585
1701 Ga0207679_10117752
1702 Ga0207679_10557287
1703 Ga0207679_10626190
1704 Ga0207679_10792209
1705 Ga0207667_10075896
1706 Ga0207667_10086421
1707 Ga0207667_10108676
1708 Ga0207667_10147491
1709 Ga0207651_10001378
1710 Ga0207651_10032539
1711 Ga0207651_10109564
1712 Ga0207651_10122701
1713 Ga0207651_10131231
1714 Ga0207651_10172666
1715 Ga0207651_10205281
1716 Ga0207651_10232658
1717 Ga0207651_10302024
1718 Ga0207712_10003179
1719 Ga0207712_10004545
1720 Ga0207712_10008002
1721 Ga0207712_10011029
1722 Ga0207712_10063039
1723 Ga0207712_10067357
1724 Ga0207712_10205388
1725 Ga0207668_10009407
1726 Ga0207668_10290495
1727 Ga0207668_10396971
1728 Ga0207668_10522606
1729 Ga0207640_10043487
1730 Ga0207658_10003801
1731 Ga0207658_10017334
1732 Ga0207658_10025533
1733 Ga0207658_10028133
1734 Ga0207658_10058676
1735 Ga0207658_10211973
1736 Ga0207658_10543960
1737 Ga0207677_10002528
1738 Ga0207677_10044505
1739 Ga0207677_10054223
1740 Ga0207677_10100519
1741 Ga0207677_10125779
1742 Ga0207677_10173022
1743 Ga0207677_10279216
1744 Ga0207703_10002545
1745 Ga0207703_10003606
1746 Ga0207703_10339693
1747 Ga0207639_10002738
1748 Ga0207639_10009982
1749 Ga0207639_10065405
1750 Ga0207639_10086953
1751 Ga0207639_10608182
1752 Ga0207678_10063575
1753 Ga0207678_10170807
1754 Ga0207708_10016926
1755 Ga0207708_10077631
1756 Ga0207708_10517588
1757 Ga0207708_10527723
1758 Ga0207641_10000184
1759 Ga0207641_10003089
1760 Ga0207641_10004182
1761 Ga0207641_10046443
1762 Ga0207641_10073835
1763 Ga0207641_10311829
1764 Ga0207641_10368053
1765 Ga0207641_10519400
1766 Ga0207648_10000488
1767 Ga0207648_10006518
1768 Ga0207648_10016043
1769 Ga0207648_10024406
1770 Ga0207648_10030559
1771 Ga0207648_10034010
1772 Ga0207648_10046889
1773 Ga0207648_10079248
1774 Ga0207648_10087305
1775 Ga0207648_10830143
1776 Ga0207676_10003388
1777 Ga0207676_10011316
1778 Ga0207676_10030308
1779 Ga0207676_10049366
1780 Ga0207676_10069682
1781 Ga0207676_10436645
1782 Ga0207676_10549461
1783 Ga0207674_10008650
1784 Ga0207674_10027729
1785 Ga0207674_10036746
1786 Ga0207674_10076348
1787 Ga0207674_10105672
1788 Ga0207674_10277979
1789 Ga0207674_10456867
1790 Ga0207674_10555679
1791 Ga0207674_10901502
1792 Ga0207675_100003643
1793 Ga0207675_100007531
1794 Ga0207675_100060176
1795 Ga0207675_100063971
1796 Ga0207675_100097749
1797 Ga0207675_100238776
1798 Ga0207675_100243594
1799 Ga0207675_100330999
1800 Ga0207675_100596880
1801 Ga0207675_100607235
1802 Ga0207683_10002620
1803 Ga0207683_10026193
1804 Ga0207683_10026625
1805 Ga0207683_10047263
1806 Ga0207683_10085974
1807 Ga0207683_10093250
1808 Ga0207683_10278135
1809 Ga0207698_10097916
1810 Ga0207698_10404643
1811 Ga0207698_10422490
1812 Ga0207698_10423485
1813 Ga0207698_10762707
1814 Ga0207698_10769692
1815 Ga0207428_10013560
1816 Ga0207428_10044663
1817 Ga0268266_10003446
1818 Ga0268266_10545767
1819 Ga0268265_10019847
1820 Ga0268265_10046626
1821 Ga0268265_10095069
1822 Ga0268265_10096767
1823 Ga0268265_10266513
1824 Ga0268265_10332197
1825 Ga0268264_10002907
1826 Ga0268264_10007740
1827 Ga0268264_10012563
1828 Ga0268264_10023693
1829 Ga0268264_10025491
1830 Ga0268264_10046502
1831 Ga0268264_10068267
1832 Ga0268264_10097640
1833 Ga0268264_10113047
1834 Ga0268264_10139237
1835 Ga0268264_10171535
1836 Ga0268264_10301685
1837 Ga0268264_10491116
1838 Ga0307515_10000455
1839 Ga0316177_1064545
1840 Ga0265327_10000013
1841 Ga0265327_10000254
1842 Ga0265327_10032002
1843 Ga0265327_10062068
1844 Ga0307513_10124861
1845 Ga0307513_10463790
1846 Ga0307509_10043969
1847 Ga0307509_10535933
1848 Ga0265313_10029162
1849 Ga0307508_10000603
1850 Ga0307406_10013998
1851 Ga0307416_100157791
1852 Ga0307416_100467654
1853 Ga0307414_10150774
1854 Ga0307414_10427274
1855 Ga0307415_100129468
1856 Ga0307415_100182501
1857 Ga0373933_0013556
1858 Ga0373933_0057220
1859 Ga0373937_0000626
1860 Ga0373937_0034742
1861 Ga0373937_0154718
1862 Ga0395899_0015685
1863 Ga0395900_0047839
1864 Ga0395900_0125735
1865 Ga0395898_0015536
1866 Ga0395901_0003272
1867 Ga0436365_0298838
1868 Ga0436365_1778757
1869 Ga0436365_1889540
1870 Ga0439436_0000413
1871 Ga0451807_2402910
1872 Ga0439441_014677
1873 Ga0439449_0016026
1874 Ga0439449_0017796
1875 Ga0439457_003832
1876 Ga0439457_014419
1877 Ga0439462_0042841
1878 Ga0450897_007222
1879 Ga0450897_007938
1880 Ga0450894_014063
1881 Ga0450898_030723
1882 Ga0450899_009011
1883 Ga0439446_0024266
1884 Ga0450893_0021987
1885 Ga0451577_0020044
1886 Ga0451577_0302370
1887 Ga0451577_0538842
1888 Ga0466969_0004123
1889 Ga0466972_0000016
1890 Ga0466972_0000104
1891 Ga0466965_0189992
1892 Ga0466966_0000193
1893 Ga0466961_0211192
1894 Ga0453684_0021387
1895 Ga0453684_0038554
1896 Ga0453684_0148150
1897 Ga0453684_0734438
1898 Ga0453684_0748184
1899 Ga0466968_0010449
1900 Ga0466970_0043550
1901 Ga0466957_0001943
1902 Ga0466957_0110513
1903 Ga0466960_0054762
1904 Ga0466959_0002486
1905 Ga0451576_0133276
1906 Ga0495592_0041592
1907 Ga0495603_0170933
1908 Ga0495638_0023753
1909 Ga0495650_0029888
1910 Ga0495618_0121311
1911 Ga0495628_0032333
1912 Ga0495630_0018495
1913 Ga0495668_0000242
1914 Ga0495668_0006585
1915 Ga0495634_0131032
1916 Ga0495635_0042972
1917 Ga0495670_0010331
1918 Ga0495674_0188469
1919 Ga0495672_0005013
1920 Ga0495672_0020050
1921 Ga0495680_0128059
1922 Ga0495684_0291467
1923 Ga0495686_0011185
1924 Ga0496100_0693337
1925 Ga0496101_0224250
1926 Ga0496104_0339198
1927 Ga0496105_0207097
1928 Ga0496109_0014633
1929 Ga0496109_0288820
1930 Ga0496110_0065694
1931 Ga0496110_0231067
1932 Ga0496112_0328164
1933 Ga0501306_016337
1934 Ga0501306_031780
1935 Ga0501306_033411
1936 Ga0501308_001539
1937 Ga0501308_012590
1938 Ga0501305_030069
1939 Ga0501290_002235
1940 Ga0501292_000995
1941 Ga0501298_000530
1942 Ga0501299_001303
1943 Ga0501303_015565
1944 Ga0501312_002971
1945 Ga0501312_024910
1946 Ga0501312_036890
1947 Ga0501314_009319
1948 Ga0501316_024174
1949 Ga0501324_016328
1950 Ga0501337_006885
1951 Ga0501031_0328658
1952 Ga0501031_0363715
1953 Ga0501032_0004313
1954 Ga0501032_0045286
1955 Ga0501032_0098945
1956 Ga0501032_0201334
1957 Ga0501033_0006858
1958 Ga0501033_0094311
1959 Ga0501033_0214437
1960 Ga0501034_0000002
1961 Ga0501034_0008447
1962 Ga0501034_0012890
1963 Ga0501034_0022986
1964 Ga0501034_0031289
1965 Ga0501034_0039862
1966 Ga0501034_0097671
1967 Ga0501034_0098127
1968 Ga0501034_0106927
1969 Ga0501036_0041557
1970 Ga0501037_0020352
1971 Ga0501037_0036949
1972 Ga0501037_0042976
1973 Ga0501037_0175444
1974 Ga0501038_0005400
1975 Ga0501038_0039893
1976 Ga0501038_0062216
1977 Ga0501038_0100211
1978 Ga0501038_0478766
1979 Ga0501039_0008583
1980 Ga0501039_0039599
1981 Ga0501043_0004656
1982 Ga0501043_0013445
1983 Ga0501043_0059217
1984 Ga0501043_0160558
1985 Ga0501046_0003336
1986 Ga0501046_0026201
1987 Ga0501047_0002513
1988 Ga0501047_0088741
1989 Ga0501047_0160319
1990 Ga0501047_0167032
1991 Ga0501047_0199458
1992 Ga0501048_0390018
1993 Ga0501069_0080213
1994 Ga0501070_0006730
1995 Ga0501070_0103596
1996 Ga0501070_0396254
1997 Ga0501072_0013863
1998 Ga0501072_0526879
1999 Ga0501073_0001665
2000 Ga0501073_0093194
2001 Ga0501074_0102143
2002 Ga0501198_000711
2003 Ga0501198_011403
2004 Ga0501201_000337
2005 Ga0501202_005557
2006 Ga0501206_007100
2007 Ga0501207_001019
2008 Ga0501216_001931
2009 Ga0501217_000623
2010 Ga0501217_008287
2011 Ga0501222_009960
2012 Ga0501223_000612
2013 Ga0501227_013552
2014 Ga0501228_005443
2015 Ga0501233_036779
2016 Ga0501235_001816
2017 Ga0501235_023363
2018 Ga0501236_008339
2019 Ga0501240_000563
2020 Ga0501242_002993
2021 Ga0501242_009611
2022 Ga0501243_000175
2023 Ga0501251_001086
2024 Ga0501252_000056
2025 Ga0501253_004251
2026 Ga0501257_030121
2027 Ga0501259_000471
2028 Ga0501259_004572
2029 Ga0501261_000479
2030 Ga0501219_000944
2031 Ga0501221_000519
2032 Ga0501225_0001014
2033 Ga0501225_0002100
2034 Ga0501225_0111651
2035 Ga0501234_000632
2036 Ga0501234_007549
2037 Ga0501245_010223
2038 Ga0501079_0064510
2039 Ga0501079_0191309
2040 Ga0501080_0077292
2041 Ga0501080_0314414
2042 Ga0501083_0086403
2043 Ga0501083_0148600
2044 Ga0501241_018032
2045 Ga0501264_004095
2046 Ga0501266_013482
2047 Ga0501267_002942
2048 Ga0501268_006384
2049 Ga0501279_009957
2050 Ga0501282_005688
2051 Ga0501035_0001789
2052 Ga0501035_0019698
2053 Ga0501035_0065820
2054 Ga0501035_0075123
2055 Ga0501035_0531458
2056 Ga0501044_0004121
2057 Ga0501044_0012046
2058 Ga0501044_0026210
2059 Ga0501044_0039575
2060 Ga0501044_0273289
2061 Ga0501044_0369310
2062 Ga0501204_004697
2063 Ga0501212_004479
2064 Ga0501284_00006
2065 nmdc:mga0k408_101998_c1
2066 nmdc:mga0k408_105792_c1
2067 nmdc:mga0k408_176430_c1
2068 nmdc:mga0k408_18195_c1
2069 nmdc:mga0k408_3671_c2
2070 nmdc:mga0k408_54565_c2
2071 nmdc:mga05p37_48940_c1
2072 nmdc:mga05p37_53739_c1
2073 nmdc:mga0qj67_84982_c1
2074 nmdc:mga06r32_131083_c1
2075 nmdc:mga06r32_23249_c1
2076 nmdc:mga08y16_39378_c1
2077 nmdc:mga08y16_423395_c1
2078 nmdc:mga08y16_470754_c1
2079 nmdc:mga08y16_820311_c1
2080 nmdc:mga08y16_880207_c1
2081 Ga0495619_0044008
2082 Ga0500578_0011031
2083 Ga0500583_0000009
2084 Ga0500583_0000258
2085 Ga0500651_0000232
2086 Ga0500641_0091345
2087 Ga0500555_024159
2088 Ga0500642_0043895
2089 Ga0500642_0135173
2090 Ga0500652_018206
2091 Ga0500652_086308
2092 Ga0500559_0024426
2093 Ga0500568_0000895
2094 Ga0500589_001419
2095 Ga0500604_0010575
2096 Ga0500616_0176839
2097 Ga0500622_0000615
2098 Ga0500622_0058994
2099 Ga0500639_037414
2100 Ga0500611_000005
2101 Ga0500645_034780
2102 Ga0501084_0018691
2103 Ga0501084_0183587
2104 Ga0500661_001332
2105 Ga0587068_011416
2106 Ga0501082_0070209
2107 2738725990
2108 2819590467
2109 2914759804
2110 2929158632

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

43

216

0.98

Map