F489166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 349 | 2110 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0676784|Ga0501080_0676784_35_703 |
| Length | 222 |
| Sequence | MDFGKEFEKYAVKHRGISSNTIHGYKQHSITNLTPYIIEERPLNVASMDVFSRLMMDRIIFLGEPVDDYVANIVTAQLLFLDSTDRTRDIQMYINSPGGSVYTMQFVSPDVSTICTGIAASMAAILMCAGVKGKRSALKHSRIMLHQPFGSIGGQATDIEITAKEIRKIKHELYSIIAHHTEKDIEKVEADCDRDFWMNADESKAYGVVDEVLITNPRKDKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 201 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 202 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 205 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 206 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 207 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 208 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 209 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 210 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 211 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 252 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 253 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 254 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 255 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 256 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 279 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 282 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 283 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 284 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 285 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 286 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 289 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 295 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 298 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 299 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 300 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 301 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 302 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 303 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 309 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 310 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 311 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 312 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 313 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 314 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 318 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 319 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 327 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 328 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 329 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 333 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 336 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 339 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 340 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 341 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 342 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 344 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 347 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 348 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 349 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.29 |
| Metatranscriptomes | 1.33 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.41 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 93.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501080_0676784 | 3300049742 | Bacteria | 911 |
| 2 | MRS1b_contig_8282875 | 2162886011 | Unclassified | 932 |
| 3 | MBSR1b_contig_807238 | 2162886012 | Unclassified | 1712 |
| 4 | JGI24744J21845_10019960 | 3300002077 | Bacteria | 1324 |
| 5 | JGI24033J26618_1007474 | 3300002155 | Unclassified | 1242 |
| 6 | JGI24751J29686_10000409 | 3300002459 | Bacteria | 13652 |
| 7 | JGI25406J46586_10000143 | 3300003203 | Bacteria | 31027 |
| 8 | JGI25406J46586_10048452 | 3300003203 | Bacteria | 1440 |
| 9 | rootH1_10024197 | 3300003316 | Bacteria | 5578 |
| 10 | rootH2_10100492 | 3300003320 | Bacteria | 10831 |
| 11 | rootL2_10216868 | 3300003322 | Bacteria | 2894 |
| 12 | rootL2_10230147 | 3300003322 | Bacteria | 1702 |
| 13 | rootH1_10014938 | 3300003323 | Bacteria | 2580 |
| 14 | rootH1_10073697 | 3300003323 | Bacteria | 2436 |
| 15 | rootH1_10104989 | 3300003323 | Bacteria | 1054 |
| 16 | JGI25160J50197_1001273 | 3300003354 | Bacteria | 12786 |
| 17 | Ga0065714_10090598 | 3300005288 | Bacteria | 1938 |
| 18 | Ga0065704_10091559 | 3300005289 | Bacteria | 2703 |
| 19 | Ga0065704_10149944 | 3300005289 | Unclassified | 1438 |
| 20 | Ga0065712_10114193 | 3300005290 | Unclassified | 1750 |
| 21 | Ga0065715_10008112 | 3300005293 | Bacteria | 3225 |
| 22 | Ga0065715_10189048 | 3300005293 | Unclassified | 1426 |
| 23 | Ga0065715_10381257 | 3300005293 | Bacteria | 907 |
| 24 | Ga0070658_10117258 | 3300005327 | Bacteria | 2210 |
| 25 | Ga0070658_10145098 | 3300005327 | Bacteria | 1984 |
| 26 | Ga0070676_10000238 | 3300005328 | Bacteria | 23718 |
| 27 | Ga0070676_10155426 | 3300005328 | Bacteria | 1468 |
| 28 | Ga0070676_10173976 | 3300005328 | Bacteria | 1395 |
| 29 | Ga0070676_10293962 | 3300005328 | Unclassified | 1099 |
| 30 | Ga0070676_10341912 | 3300005328 | Bacteria | 1026 |
| 31 | Ga0070683_100008594 | 3300005329 | Bacteria | 8678 |
| 32 | Ga0070683_100243220 | 3300005329 | Bacteria | 1712 |
| 33 | Ga0070683_100469055 | 3300005329 | Bacteria | 1202 |
| 34 | Ga0070690_100018274 | 3300005330 | Bacteria | 4232 |
| 35 | Ga0070690_100019279 | 3300005330 | Bacteria | 4136 |
| 36 | Ga0070690_100206683 | 3300005330 | Unclassified | 1369 |
| 37 | Ga0070670_100021331 | 3300005331 | Bacteria | 5572 |
| 38 | Ga0070670_100042070 | 3300005331 | Bacteria | 3927 |
| 39 | Ga0070670_100066171 | 3300005331 | Unclassified | 3100 |
| 40 | Ga0070670_100088043 | 3300005331 | Bacteria | 2669 |
| 41 | Ga0070670_100092922 | 3300005331 | Unclassified | 2594 |
| 42 | Ga0070670_100257530 | 3300005331 | Bacteria | 1521 |
| 43 | Ga0070670_100541003 | 3300005331 | Bacteria | 1038 |
| 44 | Ga0070670_100633829 | 3300005331 | Bacteria | 958 |
| 45 | Ga0070677_10011093 | 3300005333 | Bacteria | 3098 |
| 46 | Ga0070677_10076810 | 3300005333 | Bacteria | 1419 |
| 47 | Ga0068869_100005951 | 3300005334 | Bacteria | 7710 |
| 48 | Ga0068869_100010616 | 3300005334 | Bacteria | 6012 |
| 49 | Ga0068869_100011228 | 3300005334 | Bacteria | 5868 |
| 50 | Ga0068869_100011620 | 3300005334 | Bacteria | 5782 |
| 51 | Ga0068869_100017491 | 3300005334 | Bacteria | 4861 |
| 52 | Ga0068869_100029659 | 3300005334 | Bacteria | 3835 |
| 53 | Ga0068869_100081983 | 3300005334 | Bacteria | 2410 |
| 54 | Ga0068869_100158273 | 3300005334 | Bacteria | 1762 |
| 55 | Ga0068869_100318764 | 3300005334 | Unclassified | 1260 |
| 56 | Ga0070666_10000019 | 3300005335 | Bacteria | 185877 |
| 57 | Ga0070666_10000966 | 3300005335 | Bacteria | 17531 |
| 58 | Ga0070666_10004456 | 3300005335 | Bacteria | 8528 |
| 59 | Ga0070666_10103137 | 3300005335 | Bacteria | 1968 |
| 60 | Ga0070666_10173240 | 3300005335 | Bacteria | 1512 |
| 61 | Ga0070666_10232849 | 3300005335 | Bacteria | 1301 |
| 62 | Ga0070680_100000930 | 3300005336 | Bacteria | 20720 |
| 63 | Ga0070680_100034567 | 3300005336 | Bacteria | 4075 |
| 64 | Ga0070680_100127533 | 3300005336 | Bacteria | 2126 |
| 65 | Ga0070682_100000423 | 3300005337 | Bacteria | 27350 |
| 66 | Ga0070682_100001176 | 3300005337 | Bacteria | 14932 |
| 67 | Ga0070682_100079043 | 3300005337 | Bacteria | 2123 |
| 68 | Ga0070682_100091788 | 3300005337 | Bacteria | 1988 |
| 69 | Ga0070682_100259407 | 3300005337 | Unclassified | 1257 |
| 70 | Ga0068868_100002525 | 3300005338 | Bacteria | 12711 |
| 71 | Ga0068868_100004277 | 3300005338 | Bacteria | 9996 |
| 72 | Ga0068868_100004975 | 3300005338 | Bacteria | 9332 |
| 73 | Ga0068868_100019194 | 3300005338 | Bacteria | 5122 |
| 74 | Ga0068868_100042310 | 3300005338 | Bacteria | 3555 |
| 75 | Ga0068868_100062700 | 3300005338 | Bacteria | 2947 |
| 76 | Ga0068868_100063169 | 3300005338 | Bacteria | 2937 |
| 77 | Ga0068868_100144041 | 3300005338 | Bacteria | 1958 |
| 78 | Ga0070660_100046558 | 3300005339 | Bacteria | 3324 |
| 79 | Ga0070660_100122274 | 3300005339 | Unclassified | 2078 |
| 80 | Ga0070660_100331338 | 3300005339 | Bacteria | 1252 |
| 81 | Ga0070660_100533699 | 3300005339 | Bacteria | 978 |
| 82 | Ga0070689_100023578 | 3300005340 | Bacteria | 4607 |
| 83 | Ga0070689_100141821 | 3300005340 | Bacteria | 1933 |
| 84 | Ga0070689_100188755 | 3300005340 | Bacteria | 1677 |
| 85 | Ga0070687_100013338 | 3300005343 | Bacteria | 3660 |
| 86 | Ga0070687_100080022 | 3300005343 | Bacteria | 1780 |
| 87 | Ga0070661_100026648 | 3300005344 | Bacteria | 4158 |
| 88 | Ga0070661_100596269 | 3300005344 | Bacteria | 893 |
| 89 | Ga0070692_10255945 | 3300005345 | Bacteria | 1050 |
| 90 | Ga0070668_100000981 | 3300005347 | Bacteria | 19999 |
| 91 | Ga0070668_100016663 | 3300005347 | Bacteria | 5493 |
| 92 | Ga0070668_100037453 | 3300005347 | Bacteria | 3704 |
| 93 | Ga0070668_100140486 | 3300005347 | Bacteria | 1946 |
| 94 | Ga0070668_100159587 | 3300005347 | Unclassified | 1829 |
| 95 | Ga0070668_100235022 | 3300005347 | Bacteria | 1517 |
| 96 | Ga0070668_100294963 | 3300005347 | Bacteria | 1358 |
| 97 | Ga0070669_100000826 | 3300005353 | Bacteria | 22540 |
| 98 | Ga0070669_100023785 | 3300005353 | Bacteria | 4390 |
| 99 | Ga0070669_100096692 | 3300005353 | Unclassified | 2222 |
| 100 | Ga0070669_100206721 | 3300005353 | Unclassified | 1547 |
| 101 | Ga0070675_100011529 | 3300005354 | Bacteria | 6924 |
| 102 | Ga0070675_100012707 | 3300005354 | Bacteria | 6603 |
| 103 | Ga0070675_100069637 | 3300005354 | Bacteria | 2915 |
| 104 | Ga0070675_100076970 | 3300005354 | Bacteria | 2776 |
| 105 | Ga0070675_100281514 | 3300005354 | Bacteria | 1461 |
| 106 | Ga0070675_100560982 | 3300005354 | Bacteria | 1033 |
| 107 | Ga0070671_100032220 | 3300005355 | Bacteria | 4334 |
| 108 | Ga0070671_100054717 | 3300005355 | Bacteria | 3318 |
| 109 | Ga0070671_100224205 | 3300005355 | Bacteria | 1595 |
| 110 | Ga0070671_100267854 | 3300005355 | Unclassified | 1452 |
| 111 | Ga0070671_100641687 | 3300005355 | Bacteria | 919 |
| 112 | Ga0070674_100136372 | 3300005356 | Bacteria | 1836 |
| 113 | Ga0070674_100477639 | 3300005356 | Bacteria | 1034 |
| 114 | Ga0070673_100001854 | 3300005364 | Bacteria | 12646 |
| 115 | Ga0070673_100008764 | 3300005364 | Bacteria | 6751 |
| 116 | Ga0070673_100012202 | 3300005364 | Bacteria | 5891 |
| 117 | Ga0070673_100036038 | 3300005364 | Bacteria | 3757 |
| 118 | Ga0070673_100079878 | 3300005364 | Bacteria | 2649 |
| 119 | Ga0070673_100112347 | 3300005364 | Bacteria | 2261 |
| 120 | Ga0070673_100130947 | 3300005364 | Bacteria | 2104 |
| 121 | Ga0070673_100138587 | 3300005364 | Bacteria | 2050 |
| 122 | Ga0070673_100219197 | 3300005364 | Unclassified | 1646 |
| 123 | Ga0070673_100770808 | 3300005364 | Bacteria | 887 |
| 124 | Ga0070688_100001299 | 3300005365 | Bacteria | 12452 |
| 125 | Ga0070688_100002166 | 3300005365 | Bacteria | 9903 |
| 126 | Ga0070688_100073887 | 3300005365 | Bacteria | 2188 |
| 127 | Ga0070688_100253364 | 3300005365 | Unclassified | 1254 |
| 128 | Ga0070659_100032456 | 3300005366 | Bacteria | 4050 |
| 129 | Ga0070667_100001589 | 3300005367 | Bacteria | 20342 |
| 130 | Ga0070667_100011530 | 3300005367 | Bacteria | 7307 |
| 131 | Ga0070667_100012973 | 3300005367 | Bacteria | 6892 |
| 132 | Ga0070667_100014864 | 3300005367 | Bacteria | 6430 |
| 133 | Ga0070667_100022490 | 3300005367 | Bacteria | 5228 |
| 134 | Ga0070667_100226056 | 3300005367 | Bacteria | 1667 |
| 135 | Ga0070667_100242036 | 3300005367 | Bacteria | 1611 |
| 136 | Ga0070667_100257172 | 3300005367 | Bacteria | 1562 |
| 137 | Ga0070667_100355701 | 3300005367 | Bacteria | 1326 |
| 138 | Ga0070667_100406789 | 3300005367 | Unclassified | 1239 |
| 139 | Ga0070700_100148522 | 3300005441 | Bacteria | 1601 |
| 140 | Ga0070694_100512318 | 3300005444 | Bacteria | 956 |
| 141 | Ga0070663_100138358 | 3300005455 | Bacteria | 1856 |
| 142 | Ga0070663_100263995 | 3300005455 | Unclassified | 1366 |
| 143 | Ga0070663_100452975 | 3300005455 | Unclassified | 1058 |
| 144 | Ga0070678_100003466 | 3300005456 | Bacteria | 8795 |
| 145 | Ga0070678_100325856 | 3300005456 | Bacteria | 1313 |
| 146 | Ga0070678_100478616 | 3300005456 | Bacteria | 1095 |
| 147 | Ga0070662_100001906 | 3300005457 | Bacteria | 12809 |
| 148 | Ga0070662_100002104 | 3300005457 | Bacteria | 12210 |
| 149 | Ga0070662_100038623 | 3300005457 | Bacteria | 3392 |
| 150 | Ga0070662_100237271 | 3300005457 | Bacteria | 1461 |
| 151 | Ga0070662_100993694 | 3300005457 | Bacteria | 718 |
| 152 | Ga0070681_10033798 | 3300005458 | Bacteria | 5133 |
| 153 | Ga0070681_10078658 | 3300005458 | Bacteria | 3254 |
| 154 | Ga0070681_10247465 | 3300005458 | Bacteria | 1696 |
| 155 | Ga0070681_10389345 | 3300005458 | Bacteria | 1305 |
| 156 | Ga0068867_100004334 | 3300005459 | Bacteria | 9990 |
| 157 | Ga0068867_100011177 | 3300005459 | Bacteria | 6334 |
| 158 | Ga0068867_100015145 | 3300005459 | Bacteria | 5468 |
| 159 | Ga0068867_100028178 | 3300005459 | Bacteria | 4042 |
| 160 | Ga0068867_100028654 | 3300005459 | Bacteria | 4010 |
| 161 | Ga0068867_100054313 | 3300005459 | Bacteria | 2959 |
| 162 | Ga0068867_100064586 | 3300005459 | Bacteria | 2722 |
| 163 | Ga0068867_100108848 | 3300005459 | Bacteria | 2126 |
| 164 | Ga0068867_100114652 | 3300005459 | Bacteria | 2075 |
| 165 | Ga0068867_100117163 | 3300005459 | Bacteria | 2054 |
| 166 | Ga0068867_100258067 | 3300005459 | Unclassified | 1420 |
| 167 | Ga0068867_100338431 | 3300005459 | Bacteria | 1252 |
| 168 | Ga0068867_100725156 | 3300005459 | Bacteria | 879 |
| 169 | Ga0070685_10031812 | 3300005466 | Bacteria | 2950 |
| 170 | Ga0070685_10128264 | 3300005466 | Bacteria | 1583 |
| 171 | Ga0070706_100444877 | 3300005467 | Bacteria | 1206 |
| 172 | Ga0070707_100148980 | 3300005468 | Bacteria | 2278 |
| 173 | Ga0070698_100001267 | 3300005471 | Bacteria | 28207 |
| 174 | Ga0070698_100019395 | 3300005471 | Bacteria | 7140 |
| 175 | Ga0070698_100054424 | 3300005471 | Bacteria | 4062 |
| 176 | Ga0070698_100066940 | 3300005471 | Bacteria | 3613 |
| 177 | Ga0070698_100664676 | 3300005471 | Unclassified | 983 |
| 178 | Ga0070699_100055087 | 3300005518 | Unclassified | 3444 |
| 179 | Ga0070679_100054082 | 3300005530 | Bacteria | 3996 |
| 180 | Ga0070679_100062849 | 3300005530 | Bacteria | 3701 |
| 181 | Ga0070679_100104850 | 3300005530 | Bacteria | 2813 |
| 182 | Ga0070684_100005645 | 3300005535 | Bacteria | 9611 |
| 183 | Ga0070697_100334894 | 3300005536 | Bacteria | 1305 |
| 184 | Ga0068853_100009326 | 3300005539 | Bacteria | 7912 |
| 185 | Ga0068853_100085771 | 3300005539 | Bacteria | 2761 |
| 186 | Ga0068853_100089920 | 3300005539 | Bacteria | 2698 |
| 187 | Ga0068853_100165384 | 3300005539 | Bacteria | 1999 |
| 188 | Ga0068853_100176568 | 3300005539 | Bacteria | 1935 |
| 189 | Ga0068853_100346450 | 3300005539 | Bacteria | 1381 |
| 190 | Ga0068853_100494491 | 3300005539 | Bacteria | 1154 |
| 191 | Ga0070672_100001555 | 3300005543 | Bacteria | 14218 |
| 192 | Ga0070672_100011979 | 3300005543 | Bacteria | 6064 |
| 193 | Ga0070672_100058606 | 3300005543 | Bacteria | 3027 |
| 194 | Ga0070672_100112553 | 3300005543 | Bacteria | 2220 |
| 195 | Ga0070672_100238544 | 3300005543 | Bacteria | 1529 |
| 196 | Ga0070672_100388203 | 3300005543 | Bacteria | 1195 |
| 197 | Ga0070672_100539695 | 3300005543 | Bacteria | 1012 |
| 198 | Ga0070686_100017757 | 3300005544 | Bacteria | 4163 |
| 199 | Ga0070686_100145797 | 3300005544 | Bacteria | 1653 |
| 200 | Ga0070686_100213621 | 3300005544 | Unclassified | 1390 |
| 201 | Ga0070686_100475980 | 3300005544 | Unclassified | 965 |
| 202 | Ga0070686_100477280 | 3300005544 | Bacteria | 963 |
| 203 | Ga0070693_100071864 | 3300005547 | Bacteria | 2040 |
| 204 | Ga0070693_100092842 | 3300005547 | Bacteria | 1823 |
| 205 | Ga0070665_100002381 | 3300005548 | Bacteria | 20760 |
| 206 | Ga0070665_100018175 | 3300005548 | Bacteria | 7052 |
| 207 | Ga0070665_100418798 | 3300005548 | Bacteria | 1348 |
| 208 | Ga0070665_100687807 | 3300005548 | Bacteria | 1036 |
| 209 | Ga0068855_100005983 | 3300005563 | Bacteria | 14842 |
| 210 | Ga0068855_100039366 | 3300005563 | Bacteria | 5612 |
| 211 | Ga0068855_100083430 | 3300005563 | Bacteria | 3702 |
| 212 | Ga0068855_100253182 | 3300005563 | Bacteria | 1964 |
| 213 | Ga0070664_100061322 | 3300005564 | Bacteria | 3205 |
| 214 | Ga0070664_100064495 | 3300005564 | Bacteria | 3124 |
| 215 | Ga0070664_100074517 | 3300005564 | Bacteria | 2913 |
| 216 | Ga0070664_100109408 | 3300005564 | Bacteria | 2410 |
| 217 | Ga0070664_100533505 | 3300005564 | Unclassified | 1084 |
| 218 | Ga0070664_100573254 | 3300005564 | Bacteria | 1045 |
| 219 | Ga0070664_100651503 | 3300005564 | Bacteria | 979 |
| 220 | Ga0068857_100023123 | 3300005577 | Bacteria | 5467 |
| 221 | Ga0068857_100174400 | 3300005577 | Bacteria | 1955 |
| 222 | Ga0068857_100597673 | 3300005577 | Bacteria | 1043 |
| 223 | Ga0068857_100653403 | 3300005577 | Bacteria | 997 |
| 224 | Ga0068854_100037680 | 3300005578 | Bacteria | 3395 |
| 225 | Ga0068854_100189763 | 3300005578 | Bacteria | 1610 |
| 226 | Ga0068854_100611099 | 3300005578 | Unclassified | 932 |
| 227 | Ga0068856_100007851 | 3300005614 | Bacteria | 10420 |
| 228 | Ga0070702_100066427 | 3300005615 | Bacteria | 2115 |
| 229 | Ga0070702_100113874 | 3300005615 | Bacteria | 1682 |
| 230 | Ga0068852_100031375 | 3300005616 | Bacteria | 4384 |
| 231 | Ga0068852_100053358 | 3300005616 | Bacteria | 3480 |
| 232 | Ga0068852_100102496 | 3300005616 | Unclassified | 2586 |
| 233 | Ga0068852_100135178 | 3300005616 | Bacteria | 2276 |
| 234 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 235 | Ga0068859_100010041 | 3300005617 | Bacteria | 9549 |
| 236 | Ga0068859_100019858 | 3300005617 | Bacteria | 6745 |
| 237 | Ga0068859_100019894 | 3300005617 | Bacteria | 6738 |
| 238 | Ga0068859_100029635 | 3300005617 | Bacteria | 5492 |
| 239 | Ga0068859_100029925 | 3300005617 | Bacteria | 5462 |
| 240 | Ga0068859_100038541 | 3300005617 | Bacteria | 4794 |
| 241 | Ga0068859_100054597 | 3300005617 | Bacteria | 4018 |
| 242 | Ga0068859_100058980 | 3300005617 | Bacteria | 3867 |
| 243 | Ga0068859_100090332 | 3300005617 | Bacteria | 3114 |
| 244 | Ga0068859_100131419 | 3300005617 | Bacteria | 2575 |
| 245 | Ga0068859_100139162 | 3300005617 | Bacteria | 2501 |
| 246 | Ga0068859_100284061 | 3300005617 | Bacteria | 1748 |
| 247 | Ga0068859_100382405 | 3300005617 | Bacteria | 1503 |
| 248 | Ga0068859_100632298 | 3300005617 | Bacteria | 1163 |
| 249 | Ga0068864_100000357 | 3300005618 | Bacteria | 40219 |
| 250 | Ga0068864_100001339 | 3300005618 | Bacteria | 20471 |
| 251 | Ga0068864_100011141 | 3300005618 | Bacteria | 7432 |
| 252 | Ga0068864_100029348 | 3300005618 | Bacteria | 4657 |
| 253 | Ga0068864_100045286 | 3300005618 | Bacteria | 3774 |
| 254 | Ga0068864_100450642 | 3300005618 | Bacteria | 1230 |
| 255 | Ga0068864_100498590 | 3300005618 | Bacteria | 1171 |
| 256 | Ga0068866_10003544 | 3300005718 | Bacteria | 6393 |
| 257 | Ga0068866_10079890 | 3300005718 | Bacteria | 1753 |
| 258 | Ga0068866_10217405 | 3300005718 | Bacteria | 1151 |
| 259 | Ga0068861_100009344 | 3300005719 | Bacteria | 6767 |
| 260 | Ga0068861_100014355 | 3300005719 | Bacteria | 5558 |
| 261 | Ga0068861_100045063 | 3300005719 | Bacteria | 3319 |
| 262 | Ga0068861_100110453 | 3300005719 | Unclassified | 2202 |
| 263 | Ga0068861_100141357 | 3300005719 | Bacteria | 1965 |
| 264 | Ga0068861_100279769 | 3300005719 | Bacteria | 1436 |
| 265 | Ga0068861_100361218 | 3300005719 | Bacteria | 1277 |
| 266 | Ga0068861_100372015 | 3300005719 | Bacteria | 1260 |
| 267 | Ga0068851_10000433 | 3300005834 | Bacteria | 18684 |
| 268 | Ga0068851_10025715 | 3300005834 | Bacteria | 2889 |
| 269 | Ga0068851_10252166 | 3300005834 | Bacteria | 1001 |
| 270 | Ga0068851_10255719 | 3300005834 | Bacteria | 995 |
| 271 | Ga0068870_10001616 | 3300005840 | Bacteria | 9177 |
| 272 | Ga0068870_10088732 | 3300005840 | Bacteria | 1724 |
| 273 | Ga0068870_10436643 | 3300005840 | Bacteria | 860 |
| 274 | Ga0068863_100001616 | 3300005841 | Bacteria | 22269 |
| 275 | Ga0068863_100002217 | 3300005841 | Bacteria | 19295 |
| 276 | Ga0068863_100026605 | 3300005841 | Bacteria | 5517 |
| 277 | Ga0068863_100067788 | 3300005841 | Bacteria | 3375 |
| 278 | Ga0068863_100110030 | 3300005841 | Bacteria | 2623 |
| 279 | Ga0068863_100275815 | 3300005841 | Bacteria | 1628 |
| 280 | Ga0068863_100299336 | 3300005841 | Bacteria | 1560 |
| 281 | Ga0068863_100312215 | 3300005841 | Bacteria | 1526 |
| 282 | Ga0068863_100352403 | 3300005841 | Bacteria | 1433 |
| 283 | Ga0068863_100626159 | 3300005841 | Bacteria | 1066 |
| 284 | Ga0068863_100931683 | 3300005841 | Bacteria | 870 |
| 285 | Ga0068858_100006851 | 3300005842 | Bacteria | 11076 |
| 286 | Ga0068858_100013114 | 3300005842 | Bacteria | 7815 |
| 287 | Ga0068858_100102257 | 3300005842 | Bacteria | 2673 |
| 288 | Ga0068858_100122844 | 3300005842 | Bacteria | 2430 |
| 289 | Ga0068858_100126686 | 3300005842 | Bacteria | 2392 |
| 290 | Ga0068858_100789562 | 3300005842 | Unclassified | 926 |
| 291 | Ga0068860_100000948 | 3300005843 | Bacteria | 32094 |
| 292 | Ga0068860_100002928 | 3300005843 | Bacteria | 17676 |
| 293 | Ga0068860_100008208 | 3300005843 | Bacteria | 10394 |
| 294 | Ga0068860_100011092 | 3300005843 | Bacteria | 8885 |
| 295 | Ga0068860_100012904 | 3300005843 | Bacteria | 8209 |
| 296 | Ga0068860_100019036 | 3300005843 | Bacteria | 6668 |
| 297 | Ga0068860_100037012 | 3300005843 | Bacteria | 4672 |
| 298 | Ga0068860_100151572 | 3300005843 | Bacteria | 2233 |
| 299 | Ga0068860_100163293 | 3300005843 | Bacteria | 2149 |
| 300 | Ga0068860_100174243 | 3300005843 | Bacteria | 2079 |
| 301 | Ga0068860_100188881 | 3300005843 | Bacteria | 1993 |
| 302 | Ga0068860_100283172 | 3300005843 | Bacteria | 1621 |
| 303 | Ga0068860_100582336 | 3300005843 | Unclassified | 1123 |
| 304 | Ga0068860_100616993 | 3300005843 | Unclassified | 1091 |
| 305 | Ga0068862_100005077 | 3300005844 | Bacteria | 11082 |
| 306 | Ga0068862_100040502 | 3300005844 | Bacteria | 3960 |
| 307 | Ga0068862_100110877 | 3300005844 | Bacteria | 2408 |
| 308 | Ga0068862_100111578 | 3300005844 | Bacteria | 2401 |
| 309 | Ga0068862_100167921 | 3300005844 | Unclassified | 1963 |
| 310 | Ga0068862_100452332 | 3300005844 | Bacteria | 1211 |
| 311 | Ga0068862_100920125 | 3300005844 | Bacteria | 861 |
| 312 | Ga0081539_10000402 | 3300005985 | Bacteria | 92866 |
| 313 | Ga0081539_10026620 | 3300005985 | Bacteria | 3684 |
| 314 | Ga0075366_10005580 | 3300006195 | Bacteria | 6821 |
| 315 | Ga0075366_10010004 | 3300006195 | Bacteria | 5313 |
| 316 | Ga0075366_10083828 | 3300006195 | Bacteria | 1905 |
| 317 | Ga0075366_10244292 | 3300006195 | Bacteria | 1094 |
| 318 | Ga0075366_10264951 | 3300006195 | Bacteria | 1049 |
| 319 | Ga0097621_100000960 | 3300006237 | Bacteria | 20226 |
| 320 | Ga0097621_100003944 | 3300006237 | Bacteria | 10276 |
| 321 | Ga0097621_100017259 | 3300006237 | Bacteria | 5477 |
| 322 | Ga0097621_100040578 | 3300006237 | Bacteria | 3742 |
| 323 | Ga0097621_100104803 | 3300006237 | Bacteria | 2383 |
| 324 | Ga0097621_100110271 | 3300006237 | Bacteria | 2325 |
| 325 | Ga0075370_10147888 | 3300006353 | Bacteria | 1376 |
| 326 | Ga0075370_10204252 | 3300006353 | Bacteria | 1166 |
| 327 | Ga0068871_100000582 | 3300006358 | Bacteria | 25067 |
| 328 | Ga0068871_100001510 | 3300006358 | Bacteria | 15596 |
| 329 | Ga0068871_100001981 | 3300006358 | Bacteria | 13880 |
| 330 | Ga0068871_100076476 | 3300006358 | Bacteria | 2765 |
| 331 | Ga0068871_100116632 | 3300006358 | Bacteria | 2251 |
| 332 | Ga0068871_100348634 | 3300006358 | Unclassified | 1309 |
| 333 | Ga0068871_100353048 | 3300006358 | Bacteria | 1301 |
| 334 | Ga0068871_100439543 | 3300006358 | Bacteria | 1168 |
| 335 | Ga0068871_100564957 | 3300006358 | Bacteria | 1032 |
| 336 | Ga0068871_100649722 | 3300006358 | Bacteria | 963 |
| 337 | Ga0075428_100041147 | 3300006844 | Bacteria | 5083 |
| 338 | Ga0075430_100005897 | 3300006846 | Bacteria | 10344 |
| 339 | Ga0075431_100020982 | 3300006847 | Bacteria | 6676 |
| 340 | Ga0075431_100317946 | 3300006847 | Bacteria | 1570 |
| 341 | Ga0075429_100030293 | 3300006880 | Bacteria | 4700 |
| 342 | Ga0075429_100157104 | 3300006880 | Bacteria | 1991 |
| 343 | Ga0068865_100005767 | 3300006881 | Bacteria | 7527 |
| 344 | Ga0068865_100018860 | 3300006881 | Bacteria | 4459 |
| 345 | Ga0068865_100162117 | 3300006881 | Bacteria | 1707 |
| 346 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 347 | Ga0097620_100010041 | 3300006931 | Bacteria | 9549 |
| 348 | Ga0097620_100019858 | 3300006931 | Bacteria | 6745 |
| 349 | Ga0097620_100019895 | 3300006931 | Bacteria | 6738 |
| 350 | Ga0097620_100029634 | 3300006931 | Bacteria | 5492 |
| 351 | Ga0097620_100029926 | 3300006931 | Bacteria | 5462 |
| 352 | Ga0097620_100038543 | 3300006931 | Bacteria | 4794 |
| 353 | Ga0097620_100054597 | 3300006931 | Bacteria | 4018 |
| 354 | Ga0097620_100058980 | 3300006931 | Bacteria | 3867 |
| 355 | Ga0097620_100090336 | 3300006931 | Bacteria | 3114 |
| 356 | Ga0097620_100131425 | 3300006931 | Bacteria | 2575 |
| 357 | Ga0097620_100139165 | 3300006931 | Bacteria | 2501 |
| 358 | Ga0097620_100284040 | 3300006931 | Bacteria | 1748 |
| 359 | Ga0097620_100382392 | 3300006931 | Bacteria | 1503 |
| 360 | Ga0097620_100632282 | 3300006931 | Bacteria | 1163 |
| 361 | Ga0105240_10001908 | 3300009093 | Bacteria | 34614 |
| 362 | Ga0111539_10028550 | 3300009094 | Bacteria | 6805 |
| 363 | Ga0111539_10047620 | 3300009094 | Bacteria | 5123 |
| 364 | Ga0111539_10114039 | 3300009094 | Bacteria | 3170 |
| 365 | Ga0111539_10129092 | 3300009094 | Bacteria | 2960 |
| 366 | Ga0111539_11278505 | 3300009094 | Unclassified | 852 |
| 367 | Ga0105245_10051281 | 3300009098 | Bacteria | 3699 |
| 368 | Ga0105245_10068267 | 3300009098 | Bacteria | 3221 |
| 369 | Ga0105247_10000906 | 3300009101 | Bacteria | 22300 |
| 370 | Ga0105247_10011607 | 3300009101 | Bacteria | 5307 |
| 371 | Ga0114129_10033187 | 3300009147 | Bacteria | 7295 |
| 372 | Ga0105243_10070257 | 3300009148 | Bacteria | 2827 |
| 373 | Ga0105243_10073565 | 3300009148 | Bacteria | 2769 |
| 374 | Ga0105241_10000858 | 3300009174 | Bacteria | 23051 |
| 375 | Ga0105241_10005708 | 3300009174 | Bacteria | 9185 |
| 376 | Ga0105241_10008625 | 3300009174 | Bacteria | 7491 |
| 377 | Ga0105241_10097998 | 3300009174 | Bacteria | 2326 |
| 378 | Ga0105241_10200902 | 3300009174 | Bacteria | 1665 |
| 379 | Ga0105241_10323049 | 3300009174 | Bacteria | 1332 |
| 380 | Ga0105241_10437512 | 3300009174 | Bacteria | 1154 |
| 381 | Ga0105241_10619090 | 3300009174 | Bacteria | 980 |
| 382 | Ga0105242_10010225 | 3300009176 | Bacteria | 7194 |
| 383 | Ga0105242_10029115 | 3300009176 | Bacteria | 4402 |
| 384 | Ga0105242_10042800 | 3300009176 | Bacteria | 3660 |
| 385 | Ga0105242_10066209 | 3300009176 | Bacteria | 2983 |
| 386 | Ga0105242_10164073 | 3300009176 | Bacteria | 1947 |
| 387 | Ga0105242_10276328 | 3300009176 | Bacteria | 1524 |
| 388 | Ga0105242_10331238 | 3300009176 | Bacteria | 1400 |
| 389 | Ga0105242_10419863 | 3300009176 | Bacteria | 1253 |
| 390 | Ga0105242_10537505 | 3300009176 | Bacteria | 1118 |
| 391 | Ga0105242_10835750 | 3300009176 | Unclassified | 915 |
| 392 | Ga0105248_10074758 | 3300009177 | Bacteria | 3808 |
| 393 | Ga0105248_10085106 | 3300009177 | Bacteria | 3558 |
| 394 | Ga0105237_10012709 | 3300009545 | Bacteria | 8858 |
| 395 | Ga0105237_10026673 | 3300009545 | Bacteria | 5904 |
| 396 | Ga0105237_10038845 | 3300009545 | Bacteria | 4807 |
| 397 | Ga0105249_10000349 | 3300009553 | Bacteria | 46353 |
| 398 | Ga0105249_10001507 | 3300009553 | Bacteria | 20425 |
| 399 | Ga0105249_10001918 | 3300009553 | Bacteria | 18040 |
| 400 | Ga0105249_10006005 | 3300009553 | Bacteria | 10522 |
| 401 | Ga0105249_10011132 | 3300009553 | Bacteria | 7902 |
| 402 | Ga0105249_10032555 | 3300009553 | Bacteria | 4717 |
| 403 | Ga0105249_10052361 | 3300009553 | Bacteria | 3727 |
| 404 | Ga0105249_10077670 | 3300009553 | Bacteria | 3079 |
| 405 | Ga0105249_10109955 | 3300009553 | Bacteria | 2604 |
| 406 | Ga0105249_10228135 | 3300009553 | Bacteria | 1836 |
| 407 | Ga0105249_10240861 | 3300009553 | Unclassified | 1788 |
| 408 | Ga0105239_10001102 | 3300010375 | Bacteria | 37330 |
| 409 | Ga0105239_10049269 | 3300010375 | Bacteria | 4619 |
| 410 | Ga0105239_10582044 | 3300010375 | Bacteria | 1276 |
| 411 | Ga0105239_10726381 | 3300010375 | Bacteria | 1136 |
| 412 | Ga0105246_10012996 | 3300011119 | Bacteria | 5210 |
| 413 | Ga0105246_10204976 | 3300011119 | Bacteria | 1536 |
| 414 | Ga0157373_10082601 | 3300013100 | Bacteria | 2265 |
| 415 | Ga0157373_10190016 | 3300013100 | Bacteria | 1447 |
| 416 | Ga0157371_10028376 | 3300013102 | Bacteria | 4053 |
| 417 | Ga0157371_10049104 | 3300013102 | Bacteria | 2998 |
| 418 | Ga0157371_10677130 | 3300013102 | Bacteria | 771 |
| 419 | Ga0157370_10001507 | 3300013104 | Bacteria | 28750 |
| 420 | Ga0157370_10004859 | 3300013104 | Bacteria | 15261 |
| 421 | Ga0157370_10294963 | 3300013104 | Bacteria | 1497 |
| 422 | Ga0157369_10040230 | 3300013105 | Bacteria | 5104 |
| 423 | Ga0157374_10002251 | 3300013296 | Bacteria | 16254 |
| 424 | Ga0157374_10002286 | 3300013296 | Bacteria | 16120 |
| 425 | Ga0157374_10031984 | 3300013296 | Bacteria | 4787 |
| 426 | Ga0157374_10053553 | 3300013296 | Bacteria | 3762 |
| 427 | Ga0157374_10141538 | 3300013296 | Bacteria | 2335 |
| 428 | Ga0157374_10249292 | 3300013296 | Bacteria | 1747 |
| 429 | Ga0157374_10705627 | 3300013296 | Unclassified | 1022 |
| 430 | Ga0157374_10983454 | 3300013296 | Bacteria | 863 |
| 431 | Ga0157378_10011546 | 3300013297 | Bacteria | 7734 |
| 432 | Ga0157378_10013523 | 3300013297 | Bacteria | 7138 |
| 433 | Ga0157378_10015823 | 3300013297 | Bacteria | 6605 |
| 434 | Ga0157378_10017243 | 3300013297 | Bacteria | 6333 |
| 435 | Ga0157378_10018450 | 3300013297 | Bacteria | 6128 |
| 436 | Ga0157378_10020057 | 3300013297 | Bacteria | 5879 |
| 437 | Ga0157378_10029140 | 3300013297 | Bacteria | 4873 |
| 438 | Ga0157378_10051030 | 3300013297 | Bacteria | 3681 |
| 439 | Ga0157378_10073011 | 3300013297 | Bacteria | 3084 |
| 440 | Ga0157378_10594185 | 3300013297 | Unclassified | 1117 |
| 441 | Ga0157378_10670193 | 3300013297 | Bacteria | 1054 |
| 442 | Ga0157378_10763422 | 3300013297 | Bacteria | 990 |
| 443 | Ga0157378_10872330 | 3300013297 | Bacteria | 929 |
| 444 | Ga0163162_10001002 | 3300013306 | Bacteria | 26238 |
| 445 | Ga0163162_10001863 | 3300013306 | Bacteria | 19846 |
| 446 | Ga0163162_10012341 | 3300013306 | Bacteria | 8343 |
| 447 | Ga0163162_10026158 | 3300013306 | Bacteria | 5767 |
| 448 | Ga0163162_10054538 | 3300013306 | Bacteria | 4021 |
| 449 | Ga0163162_10153151 | 3300013306 | Unclassified | 2424 |
| 450 | Ga0163162_10172942 | 3300013306 | Bacteria | 2285 |
| 451 | Ga0163162_10359976 | 3300013306 | Bacteria | 1588 |
| 452 | Ga0163162_10368078 | 3300013306 | Bacteria | 1570 |
| 453 | Ga0157372_10053387 | 3300013307 | Bacteria | 4505 |
| 454 | Ga0157372_10107240 | 3300013307 | Bacteria | 3196 |
| 455 | Ga0157372_10130502 | 3300013307 | Unclassified | 2891 |
| 456 | Ga0157372_10156597 | 3300013307 | Bacteria | 2632 |
| 457 | Ga0157372_11165304 | 3300013307 | Bacteria | 891 |
| 458 | Ga0157372_11372333 | 3300013307 | Bacteria | 815 |
| 459 | Ga0157375_10000186 | 3300013308 | Bacteria | 58217 |
| 460 | Ga0157375_10000827 | 3300013308 | Bacteria | 27101 |
| 461 | Ga0157375_10035495 | 3300013308 | Bacteria | 4760 |
| 462 | Ga0157375_10051538 | 3300013308 | Bacteria | 4042 |
| 463 | Ga0157375_10133808 | 3300013308 | Bacteria | 2601 |
| 464 | Ga0157375_10152272 | 3300013308 | Bacteria | 2449 |
| 465 | Ga0157375_10211732 | 3300013308 | Unclassified | 2096 |
| 466 | Ga0157375_10227395 | 3300013308 | Bacteria | 2024 |
| 467 | Ga0157375_10282570 | 3300013308 | Bacteria | 1823 |
| 468 | Ga0157375_10403786 | 3300013308 | Bacteria | 1533 |
| 469 | Ga0157375_10503547 | 3300013308 | Bacteria | 1375 |
| 470 | Ga0157375_10624499 | 3300013308 | Bacteria | 1235 |
| 471 | Ga0163163_10001753 | 3300014325 | Bacteria | 18282 |
| 472 | Ga0163163_10066412 | 3300014325 | Bacteria | 3583 |
| 473 | Ga0163163_10140861 | 3300014325 | Unclassified | 2454 |
| 474 | Ga0163163_10276699 | 3300014325 | Bacteria | 1730 |
| 475 | Ga0163163_10352991 | 3300014325 | Bacteria | 1527 |
| 476 | Ga0163163_10621308 | 3300014325 | Bacteria | 1144 |
| 477 | Ga0157380_10000650 | 3300014326 | Bacteria | 21489 |
| 478 | Ga0157380_10003052 | 3300014326 | Bacteria | 11413 |
| 479 | Ga0157380_10025482 | 3300014326 | Bacteria | 4485 |
| 480 | Ga0157380_10371768 | 3300014326 | Bacteria | 1346 |
| 481 | Ga0157380_10444385 | 3300014326 | Bacteria | 1243 |
| 482 | Ga0157380_10521547 | 3300014326 | Bacteria | 1159 |
| 483 | Ga0157377_10000426 | 3300014745 | Bacteria | 18260 |
| 484 | Ga0157377_10021575 | 3300014745 | Bacteria | 3389 |
| 485 | Ga0157377_10026874 | 3300014745 | Bacteria | 3084 |
| 486 | Ga0157377_10066059 | 3300014745 | Unclassified | 2079 |
| 487 | Ga0157377_10083855 | 3300014745 | Bacteria | 1868 |
| 488 | Ga0157379_10000976 | 3300014968 | Bacteria | 23195 |
| 489 | Ga0157379_10015986 | 3300014968 | Bacteria | 6597 |
| 490 | Ga0157379_10016659 | 3300014968 | Bacteria | 6464 |
| 491 | Ga0157379_10037296 | 3300014968 | Bacteria | 4334 |
| 492 | Ga0157379_10180962 | 3300014968 | Bacteria | 1904 |
| 493 | Ga0157379_10429861 | 3300014968 | Unclassified | 1217 |
| 494 | Ga0157376_10000650 | 3300014969 | Bacteria | 22495 |
| 495 | Ga0157376_10008988 | 3300014969 | Bacteria | 7235 |
| 496 | Ga0157376_10061038 | 3300014969 | Bacteria | 3168 |
| 497 | Ga0157376_10124854 | 3300014969 | Unclassified | 2287 |
| 498 | Ga0157376_10206340 | 3300014969 | Unclassified | 1811 |
| 499 | Ga0157376_10543233 | 3300014969 | Bacteria | 1149 |
| 500 | Ga0163161_10004470 | 3300017792 | Bacteria | 9736 |
| 501 | Ga0163161_10025267 | 3300017792 | Bacteria | 4203 |
| 502 | Ga0163161_10031410 | 3300017792 | Bacteria | 3784 |
| 503 | Ga0163161_10039345 | 3300017792 | Bacteria | 3394 |
| 504 | Ga0163161_10044628 | 3300017792 | Bacteria | 3194 |
| 505 | Ga0163161_10409513 | 3300017792 | Unclassified | 1089 |
| 506 | Ga0213876_10012974 | 3300021384 | Bacteria | 4429 |
| 507 | Ga0207426_1000230 | 3300025302 | Bacteria | 128357 |
| 508 | Ga0207697_10114295 | 3300025315 | Bacteria | 1157 |
| 509 | Ga0207656_10001978 | 3300025321 | Bacteria | 6827 |
| 510 | Ga0207656_10011320 | 3300025321 | Bacteria | 3368 |
| 511 | Ga0207656_10034210 | 3300025321 | Bacteria | 2121 |
| 512 | Ga0207656_10261089 | 3300025321 | Bacteria | 851 |
| 513 | Ga0207682_10021187 | 3300025893 | Bacteria | 2556 |
| 514 | Ga0207682_10025688 | 3300025893 | Bacteria | 2336 |
| 515 | Ga0207682_10031701 | 3300025893 | Unclassified | 2123 |
| 516 | Ga0207642_10006779 | 3300025899 | Bacteria | 3830 |
| 517 | Ga0207710_10000417 | 3300025900 | Bacteria | 28186 |
| 518 | Ga0207710_10103541 | 3300025900 | Bacteria | 1345 |
| 519 | Ga0207688_10120088 | 3300025901 | Bacteria | 1533 |
| 520 | Ga0207680_10000673 | 3300025903 | Bacteria | 16133 |
| 521 | Ga0207680_10105322 | 3300025903 | Bacteria | 1819 |
| 522 | Ga0207680_10204976 | 3300025903 | Bacteria | 1346 |
| 523 | Ga0207680_10233803 | 3300025903 | Bacteria | 1264 |
| 524 | Ga0207680_10234123 | 3300025903 | Bacteria | 1263 |
| 525 | Ga0207680_10536183 | 3300025903 | Bacteria | 835 |
| 526 | Ga0207647_10041916 | 3300025904 | Bacteria | 2874 |
| 527 | Ga0207685_10128385 | 3300025905 | Bacteria | 1122 |
| 528 | Ga0207645_10000684 | 3300025907 | Bacteria | 28112 |
| 529 | Ga0207645_10001198 | 3300025907 | Bacteria | 21394 |
| 530 | Ga0207645_10015549 | 3300025907 | Bacteria | 5054 |
| 531 | Ga0207645_10046954 | 3300025907 | Bacteria | 2758 |
| 532 | Ga0207645_10065076 | 3300025907 | Bacteria | 2330 |
| 533 | Ga0207645_10082001 | 3300025907 | Bacteria | 2068 |
| 534 | Ga0207645_10103782 | 3300025907 | Bacteria | 1836 |
| 535 | Ga0207645_10157573 | 3300025907 | Bacteria | 1484 |
| 536 | Ga0207645_10307144 | 3300025907 | Bacteria | 1057 |
| 537 | Ga0207643_10010782 | 3300025908 | Bacteria | 4928 |
| 538 | Ga0207643_10021449 | 3300025908 | Bacteria | 3549 |
| 539 | Ga0207643_10304794 | 3300025908 | Unclassified | 992 |
| 540 | Ga0207705_10010195 | 3300025909 | Bacteria | 6835 |
| 541 | Ga0207654_10000569 | 3300025911 | Bacteria | 20920 |
| 542 | Ga0207654_10002605 | 3300025911 | Bacteria | 9148 |
| 543 | Ga0207654_10224234 | 3300025911 | Bacteria | 1248 |
| 544 | Ga0207654_10304868 | 3300025911 | Bacteria | 1084 |
| 545 | Ga0207654_10315026 | 3300025911 | Bacteria | 1068 |
| 546 | Ga0207707_10000299 | 3300025912 | Bacteria | 52083 |
| 547 | Ga0207707_10385436 | 3300025912 | Bacteria | 1204 |
| 548 | Ga0207707_10386624 | 3300025912 | Bacteria | 1202 |
| 549 | Ga0207707_10477052 | 3300025912 | Bacteria | 1066 |
| 550 | Ga0207695_10014544 | 3300025913 | Bacteria | 9312 |
| 551 | Ga0207671_10007851 | 3300025914 | Bacteria | 9169 |
| 552 | Ga0207671_10018917 | 3300025914 | Bacteria | 5277 |
| 553 | Ga0207671_10020567 | 3300025914 | Bacteria | 5022 |
| 554 | Ga0207660_10004975 | 3300025917 | Bacteria | 8664 |
| 555 | Ga0207660_10021310 | 3300025917 | Bacteria | 4358 |
| 556 | Ga0207662_10000535 | 3300025918 | Bacteria | 16868 |
| 557 | Ga0207657_10028682 | 3300025919 | Bacteria | 5073 |
| 558 | Ga0207657_10088416 | 3300025919 | Unclassified | 2590 |
| 559 | Ga0207657_10113696 | 3300025919 | Unclassified | 2233 |
| 560 | Ga0207657_10419254 | 3300025919 | Unclassified | 1052 |
| 561 | Ga0207649_10087229 | 3300025920 | Bacteria | 2035 |
| 562 | Ga0207652_10013799 | 3300025921 | Bacteria | 6535 |
| 563 | Ga0207652_10033484 | 3300025921 | Bacteria | 4327 |
| 564 | Ga0207652_10222080 | 3300025921 | Bacteria | 1702 |
| 565 | Ga0207646_10798337 | 3300025922 | Bacteria | 841 |
| 566 | Ga0207681_10085979 | 3300025923 | Unclassified | 2233 |
| 567 | Ga0207681_10097085 | 3300025923 | Bacteria | 2117 |
| 568 | Ga0207681_10129501 | 3300025923 | Unclassified | 1863 |
| 569 | Ga0207681_10225019 | 3300025923 | Bacteria | 1453 |
| 570 | Ga0207681_10270733 | 3300025923 | Unclassified | 1333 |
| 571 | Ga0207681_10355544 | 3300025923 | Bacteria | 1173 |
| 572 | Ga0207650_10086314 | 3300025925 | Bacteria | 2389 |
| 573 | Ga0207650_10095012 | 3300025925 | Unclassified | 2285 |
| 574 | Ga0207650_10099351 | 3300025925 | Unclassified | 2237 |
| 575 | Ga0207650_10114342 | 3300025925 | Bacteria | 2093 |
| 576 | Ga0207650_10150942 | 3300025925 | Bacteria | 1834 |
| 577 | Ga0207650_10271446 | 3300025925 | Bacteria | 1378 |
| 578 | Ga0207650_10413451 | 3300025925 | Bacteria | 1118 |
| 579 | Ga0207659_10009317 | 3300025926 | Bacteria | 6130 |
| 580 | Ga0207659_10014000 | 3300025926 | Bacteria | 5161 |
| 581 | Ga0207659_10014978 | 3300025926 | Bacteria | 5014 |
| 582 | Ga0207659_10050875 | 3300025926 | Bacteria | 2945 |
| 583 | Ga0207659_10055643 | 3300025926 | Bacteria | 2831 |
| 584 | Ga0207659_10193585 | 3300025926 | Unclassified | 1619 |
| 585 | Ga0207687_10283307 | 3300025927 | Bacteria | 1329 |
| 586 | Ga0207644_10033752 | 3300025931 | Bacteria | 3579 |
| 587 | Ga0207644_10198384 | 3300025931 | Unclassified | 1582 |
| 588 | Ga0207644_10208113 | 3300025931 | Bacteria | 1546 |
| 589 | Ga0207644_10548283 | 3300025931 | Bacteria | 957 |
| 590 | Ga0207644_10614149 | 3300025931 | Bacteria | 903 |
| 591 | Ga0207644_10782563 | 3300025931 | Bacteria | 798 |
| 592 | Ga0207690_10000343 | 3300025932 | Bacteria | 31195 |
| 593 | Ga0207690_10017765 | 3300025932 | Bacteria | 4351 |
| 594 | Ga0207690_10084309 | 3300025932 | Bacteria | 2227 |
| 595 | Ga0207690_10256772 | 3300025932 | Unclassified | 1352 |
| 596 | Ga0207706_10005121 | 3300025933 | Bacteria | 12232 |
| 597 | Ga0207706_10008686 | 3300025933 | Bacteria | 9357 |
| 598 | Ga0207706_10027788 | 3300025933 | Bacteria | 5056 |
| 599 | Ga0207706_10028286 | 3300025933 | Bacteria | 5007 |
| 600 | Ga0207706_10111430 | 3300025933 | Bacteria | 2407 |
| 601 | Ga0207706_10340490 | 3300025933 | Bacteria | 1305 |
| 602 | Ga0207706_10817573 | 3300025933 | Bacteria | 791 |
| 603 | Ga0207686_10001802 | 3300025934 | Bacteria | 11908 |
| 604 | Ga0207686_10045206 | 3300025934 | Bacteria | 2708 |
| 605 | Ga0207686_10147386 | 3300025934 | Bacteria | 1634 |
| 606 | Ga0207686_10705821 | 3300025934 | Bacteria | 802 |
| 607 | Ga0207709_10061250 | 3300025935 | Bacteria | 2351 |
| 608 | Ga0207670_10136932 | 3300025936 | Bacteria | 1801 |
| 609 | Ga0207670_10713195 | 3300025936 | Bacteria | 831 |
| 610 | Ga0207669_10055077 | 3300025937 | Bacteria | 2406 |
| 611 | Ga0207669_10093896 | 3300025937 | Unclassified | 1961 |
| 612 | Ga0207669_10385712 | 3300025937 | Bacteria | 1093 |
| 613 | Ga0207704_10037101 | 3300025938 | Bacteria | 2812 |
| 614 | Ga0207704_10037235 | 3300025938 | Bacteria | 2809 |
| 615 | Ga0207704_10093507 | 3300025938 | Bacteria | 1982 |
| 616 | Ga0207704_10280838 | 3300025938 | Bacteria | 1266 |
| 617 | Ga0207704_10620461 | 3300025938 | Unclassified | 887 |
| 618 | Ga0207665_10454282 | 3300025939 | Bacteria | 984 |
| 619 | Ga0207691_10000076 | 3300025940 | Bacteria | 83005 |
| 620 | Ga0207691_10003310 | 3300025940 | Bacteria | 15699 |
| 621 | Ga0207691_10026563 | 3300025940 | Bacteria | 5432 |
| 622 | Ga0207691_10040327 | 3300025940 | Bacteria | 4315 |
| 623 | Ga0207691_10072636 | 3300025940 | Bacteria | 3103 |
| 624 | Ga0207691_10079309 | 3300025940 | Bacteria | 2955 |
| 625 | Ga0207691_10089212 | 3300025940 | Bacteria | 2765 |
| 626 | Ga0207691_10099507 | 3300025940 | Bacteria | 2596 |
| 627 | Ga0207691_10669181 | 3300025940 | Bacteria | 876 |
| 628 | Ga0207711_10109221 | 3300025941 | Bacteria | 2458 |
| 629 | Ga0207711_10255166 | 3300025941 | Unclassified | 1611 |
| 630 | Ga0207689_10001148 | 3300025942 | Bacteria | 25510 |
| 631 | Ga0207689_10002202 | 3300025942 | Bacteria | 18273 |
| 632 | Ga0207689_10004010 | 3300025942 | Bacteria | 13393 |
| 633 | Ga0207689_10015942 | 3300025942 | Bacteria | 6361 |
| 634 | Ga0207689_10017269 | 3300025942 | Bacteria | 6108 |
| 635 | Ga0207689_10035934 | 3300025942 | Bacteria | 4113 |
| 636 | Ga0207689_10156204 | 3300025942 | Bacteria | 1880 |
| 637 | Ga0207689_10161836 | 3300025942 | Bacteria | 1844 |
| 638 | Ga0207689_10167365 | 3300025942 | Bacteria | 1811 |
| 639 | Ga0207689_10192959 | 3300025942 | Bacteria | 1681 |
| 640 | Ga0207689_10196534 | 3300025942 | Unclassified | 1665 |
| 641 | Ga0207689_10393235 | 3300025942 | Bacteria | 1155 |
| 642 | Ga0207661_10373642 | 3300025944 | Bacteria | 1289 |
| 643 | Ga0207661_10478636 | 3300025944 | Bacteria | 1136 |
| 644 | Ga0207661_10806530 | 3300025944 | Unclassified | 864 |
| 645 | Ga0207679_10002585 | 3300025945 | Bacteria | 11158 |
| 646 | Ga0207679_10117752 | 3300025945 | Bacteria | 2109 |
| 647 | Ga0207679_10557287 | 3300025945 | Bacteria | 1029 |
| 648 | Ga0207679_10626190 | 3300025945 | Bacteria | 971 |
| 649 | Ga0207679_10792209 | 3300025945 | Bacteria | 864 |
| 650 | Ga0207667_10075896 | 3300025949 | Bacteria | 3489 |
| 651 | Ga0207667_10086421 | 3300025949 | Bacteria | 3245 |
| 652 | Ga0207667_10108676 | 3300025949 | Bacteria | 2861 |
| 653 | Ga0207667_10147491 | 3300025949 | Bacteria | 2422 |
| 654 | Ga0207651_10001378 | 3300025960 | Bacteria | 11009 |
| 655 | Ga0207651_10032539 | 3300025960 | Bacteria | 3351 |
| 656 | Ga0207651_10109564 | 3300025960 | Bacteria | 2069 |
| 657 | Ga0207651_10122701 | 3300025960 | Bacteria | 1973 |
| 658 | Ga0207651_10131231 | 3300025960 | Unclassified | 1918 |
| 659 | Ga0207651_10172666 | 3300025960 | Bacteria | 1706 |
| 660 | Ga0207651_10205281 | 3300025960 | Bacteria | 1582 |
| 661 | Ga0207651_10232658 | 3300025960 | Bacteria | 1497 |
| 662 | Ga0207651_10302024 | 3300025960 | Bacteria | 1331 |
| 663 | Ga0207712_10003179 | 3300025961 | Bacteria | 10455 |
| 664 | Ga0207712_10004545 | 3300025961 | Bacteria | 8758 |
| 665 | Ga0207712_10008002 | 3300025961 | Bacteria | 6684 |
| 666 | Ga0207712_10011029 | 3300025961 | Bacteria | 5754 |
| 667 | Ga0207712_10063039 | 3300025961 | Bacteria | 2637 |
| 668 | Ga0207712_10067357 | 3300025961 | Bacteria | 2562 |
| 669 | Ga0207712_10205388 | 3300025961 | Bacteria | 1565 |
| 670 | Ga0207668_10009407 | 3300025972 | Bacteria | 5856 |
| 671 | Ga0207668_10290495 | 3300025972 | Bacteria | 1345 |
| 672 | Ga0207668_10396971 | 3300025972 | Bacteria | 1165 |
| 673 | Ga0207668_10522606 | 3300025972 | Bacteria | 1024 |
| 674 | Ga0207640_10043487 | 3300025981 | Bacteria | 2872 |
| 675 | Ga0207658_10003801 | 3300025986 | Bacteria | 10632 |
| 676 | Ga0207658_10017334 | 3300025986 | Bacteria | 4961 |
| 677 | Ga0207658_10025533 | 3300025986 | Bacteria | 4137 |
| 678 | Ga0207658_10028133 | 3300025986 | Bacteria | 3957 |
| 679 | Ga0207658_10058676 | 3300025986 | Bacteria | 2865 |
| 680 | Ga0207658_10211973 | 3300025986 | Unclassified | 1624 |
| 681 | Ga0207658_10543960 | 3300025986 | Unclassified | 1038 |
| 682 | Ga0207677_10002528 | 3300026023 | Bacteria | 9587 |
| 683 | Ga0207677_10044505 | 3300026023 | Bacteria | 2958 |
| 684 | Ga0207677_10054223 | 3300026023 | Bacteria | 2734 |
| 685 | Ga0207677_10100519 | 3300026023 | Bacteria | 2127 |
| 686 | Ga0207677_10125779 | 3300026023 | Bacteria | 1937 |
| 687 | Ga0207677_10173022 | 3300026023 | Bacteria | 1691 |
| 688 | Ga0207677_10279216 | 3300026023 | Bacteria | 1370 |
| 689 | Ga0207703_10002545 | 3300026035 | Bacteria | 15745 |
| 690 | Ga0207703_10003606 | 3300026035 | Bacteria | 12919 |
| 691 | Ga0207703_10339693 | 3300026035 | Unclassified | 1380 |
| 692 | Ga0207639_10002738 | 3300026041 | Bacteria | 11827 |
| 693 | Ga0207639_10009982 | 3300026041 | Bacteria | 6563 |
| 694 | Ga0207639_10065405 | 3300026041 | Bacteria | 2823 |
| 695 | Ga0207639_10086953 | 3300026041 | Bacteria | 2490 |
| 696 | Ga0207639_10608182 | 3300026041 | Bacteria | 1008 |
| 697 | Ga0207678_10063575 | 3300026067 | Bacteria | 3172 |
| 698 | Ga0207678_10170807 | 3300026067 | Bacteria | 1856 |
| 699 | Ga0207708_10016926 | 3300026075 | Bacteria | 5489 |
| 700 | Ga0207708_10077631 | 3300026075 | Bacteria | 2549 |
| 701 | Ga0207708_10517588 | 3300026075 | Unclassified | 1002 |
| 702 | Ga0207708_10527723 | 3300026075 | Bacteria | 993 |
| 703 | Ga0207641_10000184 | 3300026088 | Bacteria | 86994 |
| 704 | Ga0207641_10003089 | 3300026088 | Bacteria | 14998 |
| 705 | Ga0207641_10004182 | 3300026088 | Bacteria | 12574 |
| 706 | Ga0207641_10046443 | 3300026088 | Bacteria | 3660 |
| 707 | Ga0207641_10073835 | 3300026088 | Bacteria | 2940 |
| 708 | Ga0207641_10311829 | 3300026088 | Bacteria | 1489 |
| 709 | Ga0207641_10368053 | 3300026088 | Bacteria | 1374 |
| 710 | Ga0207641_10519400 | 3300026088 | Bacteria | 1158 |
| 711 | Ga0207648_10000488 | 3300026089 | Bacteria | 44152 |
| 712 | Ga0207648_10006518 | 3300026089 | Bacteria | 11585 |
| 713 | Ga0207648_10016043 | 3300026089 | Bacteria | 6862 |
| 714 | Ga0207648_10024406 | 3300026089 | Bacteria | 5398 |
| 715 | Ga0207648_10030559 | 3300026089 | Bacteria | 4768 |
| 716 | Ga0207648_10034010 | 3300026089 | Bacteria | 4495 |
| 717 | Ga0207648_10046889 | 3300026089 | Bacteria | 3788 |
| 718 | Ga0207648_10079248 | 3300026089 | Bacteria | 2865 |
| 719 | Ga0207648_10087305 | 3300026089 | Bacteria | 2722 |
| 720 | Ga0207648_10830143 | 3300026089 | Unclassified | 861 |
| 721 | Ga0207676_10003388 | 3300026095 | Bacteria | 11264 |
| 722 | Ga0207676_10011316 | 3300026095 | Bacteria | 6377 |
| 723 | Ga0207676_10030308 | 3300026095 | Bacteria | 4059 |
| 724 | Ga0207676_10049366 | 3300026095 | Bacteria | 3273 |
| 725 | Ga0207676_10069682 | 3300026095 | Bacteria | 2817 |
| 726 | Ga0207676_10436645 | 3300026095 | Bacteria | 1231 |
| 727 | Ga0207676_10549461 | 3300026095 | Unclassified | 1103 |
| 728 | Ga0207674_10008650 | 3300026116 | Bacteria | 11727 |
| 729 | Ga0207674_10027729 | 3300026116 | Bacteria | 5986 |
| 730 | Ga0207674_10036746 | 3300026116 | Bacteria | 5099 |
| 731 | Ga0207674_10076348 | 3300026116 | Bacteria | 3358 |
| 732 | Ga0207674_10105672 | 3300026116 | Unclassified | 2793 |
| 733 | Ga0207674_10277979 | 3300026116 | Unclassified | 1622 |
| 734 | Ga0207674_10456867 | 3300026116 | Bacteria | 1234 |
| 735 | Ga0207674_10555679 | 3300026116 | Bacteria | 1109 |
| 736 | Ga0207674_10901502 | 3300026116 | Bacteria | 852 |
| 737 | Ga0207675_100003643 | 3300026118 | Bacteria | 15015 |
| 738 | Ga0207675_100007531 | 3300026118 | Bacteria | 10285 |
| 739 | Ga0207675_100060176 | 3300026118 | Bacteria | 3546 |
| 740 | Ga0207675_100063971 | 3300026118 | Bacteria | 3437 |
| 741 | Ga0207675_100097749 | 3300026118 | Bacteria | 2765 |
| 742 | Ga0207675_100238776 | 3300026118 | Bacteria | 1756 |
| 743 | Ga0207675_100243594 | 3300026118 | Bacteria | 1738 |
| 744 | Ga0207675_100330999 | 3300026118 | Bacteria | 1489 |
| 745 | Ga0207675_100596880 | 3300026118 | Bacteria | 1107 |
| 746 | Ga0207675_100607235 | 3300026118 | Bacteria | 1097 |
| 747 | Ga0207683_10002620 | 3300026121 | Bacteria | 15710 |
| 748 | Ga0207683_10026193 | 3300026121 | Bacteria | 5033 |
| 749 | Ga0207683_10026625 | 3300026121 | Bacteria | 4993 |
| 750 | Ga0207683_10047263 | 3300026121 | Bacteria | 3769 |
| 751 | Ga0207683_10085974 | 3300026121 | Bacteria | 2796 |
| 752 | Ga0207683_10093250 | 3300026121 | Bacteria | 2683 |
| 753 | Ga0207683_10278135 | 3300026121 | Bacteria | 1530 |
| 754 | Ga0207698_10097916 | 3300026142 | Bacteria | 2422 |
| 755 | Ga0207698_10404643 | 3300026142 | Bacteria | 1305 |
| 756 | Ga0207698_10422490 | 3300026142 | Bacteria | 1279 |
| 757 | Ga0207698_10423485 | 3300026142 | Bacteria | 1278 |
| 758 | Ga0207698_10762707 | 3300026142 | Unclassified | 967 |
| 759 | Ga0207698_10769692 | 3300026142 | Bacteria | 963 |
| 760 | Ga0207428_10013560 | 3300027907 | Bacteria | 7113 |
| 761 | Ga0207428_10044663 | 3300027907 | Bacteria | 3573 |
| 762 | Ga0268266_10003446 | 3300028379 | Bacteria | 15772 |
| 763 | Ga0268266_10545767 | 3300028379 | Bacteria | 1110 |
| 764 | Ga0268265_10019847 | 3300028380 | Bacteria | 4681 |
| 765 | Ga0268265_10046626 | 3300028380 | Bacteria | 3241 |
| 766 | Ga0268265_10095069 | 3300028380 | Bacteria | 2392 |
| 767 | Ga0268265_10096767 | 3300028380 | Bacteria | 2373 |
| 768 | Ga0268265_10266513 | 3300028380 | Unclassified | 1526 |
| 769 | Ga0268265_10332197 | 3300028380 | Bacteria | 1381 |
| 770 | Ga0268264_10002907 | 3300028381 | Bacteria | 14884 |
| 771 | Ga0268264_10007740 | 3300028381 | Bacteria | 8946 |
| 772 | Ga0268264_10012563 | 3300028381 | Bacteria | 6974 |
| 773 | Ga0268264_10023693 | 3300028381 | Bacteria | 5005 |
| 774 | Ga0268264_10025491 | 3300028381 | Bacteria | 4831 |
| 775 | Ga0268264_10046502 | 3300028381 | Bacteria | 3604 |
| 776 | Ga0268264_10068267 | 3300028381 | Bacteria | 3004 |
| 777 | Ga0268264_10097640 | 3300028381 | Bacteria | 2547 |
| 778 | Ga0268264_10113047 | 3300028381 | Bacteria | 2382 |
| 779 | Ga0268264_10139237 | 3300028381 | Bacteria | 2162 |
| 780 | Ga0268264_10171535 | 3300028381 | Bacteria | 1962 |
| 781 | Ga0268264_10301685 | 3300028381 | Bacteria | 1508 |
| 782 | Ga0268264_10491116 | 3300028381 | Bacteria | 1196 |
| 783 | Ga0307515_10000455 | 3300028794 | Bacteria | 97670 |
| 784 | Ga0316177_1064545 | 3300030731 | Bacteria | 1232 |
| 785 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 786 | Ga0265327_10000254 | 3300031251 | Bacteria | 106076 |
| 787 | Ga0265327_10032002 | 3300031251 | Bacteria | 2950 |
| 788 | Ga0265327_10062068 | 3300031251 | Bacteria | 1904 |
| 789 | Ga0307513_10124861 | 3300031456 | Bacteria | 2532 |
| 790 | Ga0307513_10463790 | 3300031456 | Bacteria | 989 |
| 791 | Ga0307509_10043969 | 3300031507 | Bacteria | 4828 |
| 792 | Ga0307509_10535933 | 3300031507 | Bacteria | 850 |
| 793 | Ga0265313_10029162 | 3300031595 | Bacteria | 2858 |
| 794 | Ga0307508_10000603 | 3300031616 | Bacteria | 43051 |
| 795 | Ga0307406_10013998 | 3300031901 | Bacteria | 4607 |
| 796 | Ga0307416_100157791 | 3300032002 | Bacteria | 2092 |
| 797 | Ga0307416_100467654 | 3300032002 | Bacteria | 1318 |
| 798 | Ga0307414_10150774 | 3300032004 | Bacteria | 1834 |
| 799 | Ga0307414_10427274 | 3300032004 | Bacteria | 1157 |
| 800 | Ga0307415_100129468 | 3300032126 | Bacteria | 1908 |
| 801 | Ga0307415_100182501 | 3300032126 | Bacteria | 1648 |
| 802 | Ga0373933_0013556 | 3300035724 | Bacteria | 4520 |
| 803 | Ga0373933_0057220 | 3300035724 | Unclassified | 2343 |
| 804 | Ga0373937_0000626 | 3300036401 | Bacteria | 31047 |
| 805 | Ga0373937_0034742 | 3300036401 | Bacteria | 4585 |
| 806 | Ga0373937_0154718 | 3300036401 | Bacteria | 2149 |
| 807 | Ga0395899_0015685 | 3300037312 | Bacteria | 5777 |
| 808 | Ga0395900_0047839 | 3300037418 | Bacteria | 4405 |
| 809 | Ga0395900_0125735 | 3300037418 | Bacteria | 2630 |
| 810 | Ga0395898_0015536 | 3300037466 | Bacteria | 7807 |
| 811 | Ga0395901_0003272 | 3300038443 | Bacteria | 16313 |
| 812 | Ga0436365_0298838 | 3300039437 | Bacteria | 7530 |
| 813 | Ga0436365_1778757 | 3300039437 | Bacteria | 6021 |
| 814 | Ga0436365_1889540 | 3300039437 | Bacteria | 1650 |
| 815 | Ga0439436_0000413 | 3300041404 | Bacteria | 10744 |
| 816 | Ga0451807_2402910 | 3300041486 | Bacteria | 1021 |
| 817 | Ga0439441_014677 | 3300042001 | Unclassified | 1377 |
| 818 | Ga0439449_0016026 | 3300042007 | Bacteria | 2818 |
| 819 | Ga0439449_0017796 | 3300042007 | Bacteria | 2668 |
| 820 | Ga0439457_003832 | 3300042014 | Bacteria | 4030 |
| 821 | Ga0439457_014419 | 3300042014 | Bacteria | 1769 |
| 822 | Ga0439462_0042841 | 3300042015 | Bacteria | 1209 |
| 823 | Ga0450897_007222 | 3300042128 | Bacteria | 1010 |
| 824 | Ga0450897_007938 | 3300042128 | Bacteria | 978 |
| 825 | Ga0450894_014063 | 3300042131 | Bacteria | 1054 |
| 826 | Ga0450898_030723 | 3300042134 | Bacteria | 985 |
| 827 | Ga0450899_009011 | 3300042135 | Bacteria | 1096 |
| 828 | Ga0439446_0024266 | 3300042156 | Bacteria | 1730 |
| 829 | Ga0450893_0021987 | 3300042532 | Bacteria | 1103 |
| 830 | Ga0451577_0020044 | 3300042876 | Bacteria | 6141 |
| 831 | Ga0451577_0302370 | 3300042876 | Bacteria | 1450 |
| 832 | Ga0451577_0538842 | 3300042876 | Unclassified | 1060 |
| 833 | Ga0466969_0004123 | 3300044656 | Bacteria | 7712 |
| 834 | Ga0466972_0000016 | 3300044658 | Bacteria | 208802 |
| 835 | Ga0466972_0000104 | 3300044658 | Bacteria | 73886 |
| 836 | Ga0466965_0189992 | 3300044683 | Bacteria | 1086 |
| 837 | Ga0466966_0000193 | 3300044684 | Bacteria | 40730 |
| 838 | Ga0466961_0211192 | 3300044693 | Bacteria | 1198 |
| 839 | Ga0453684_0021387 | 3300044712 | Bacteria | 9667 |
| 840 | Ga0453684_0038554 | 3300044712 | Bacteria | 6529 |
| 841 | Ga0453684_0148150 | 3300044712 | Bacteria | 2793 |
| 842 | Ga0453684_0734438 | 3300044712 | Bacteria | 1070 |
| 843 | Ga0453684_0748184 | 3300044712 | Bacteria | 1058 |
| 844 | Ga0466968_0010449 | 3300044735 | Bacteria | 3600 |
| 845 | Ga0466970_0043550 | 3300044765 | Bacteria | 2388 |
| 846 | Ga0466957_0001943 | 3300044842 | Bacteria | 10977 |
| 847 | Ga0466957_0110513 | 3300044842 | Bacteria | 1742 |
| 848 | Ga0466960_0054762 | 3300044901 | Bacteria | 1938 |
| 849 | Ga0466959_0002486 | 3300045049 | Bacteria | 11803 |
| 850 | Ga0451576_0133276 | 3300045051 | Bacteria | 2590 |
| 851 | Ga0495592_0041592 | 3300046454 | Bacteria | 3445 |
| 852 | Ga0495603_0170933 | 3300046455 | Bacteria | 1259 |
| 853 | Ga0495638_0023753 | 3300046460 | Bacteria | 4005 |
| 854 | Ga0495650_0029888 | 3300046471 | Bacteria | 2476 |
| 855 | Ga0495618_0121311 | 3300046514 | Bacteria | 1674 |
| 856 | Ga0495628_0032333 | 3300046516 | Bacteria | 4224 |
| 857 | Ga0495630_0018495 | 3300046517 | Bacteria | 5119 |
| 858 | Ga0495668_0000242 | 3300046616 | Bacteria | 78022 |
| 859 | Ga0495668_0006585 | 3300046616 | Bacteria | 7580 |
| 860 | Ga0495634_0131032 | 3300046642 | Bacteria | 1598 |
| 861 | Ga0495635_0042972 | 3300046663 | Bacteria | 3120 |
| 862 | Ga0495670_0010331 | 3300046691 | Bacteria | 4586 |
| 863 | Ga0495674_0188469 | 3300047319 | Unclassified | 1715 |
| 864 | Ga0495672_0005013 | 3300047320 | Bacteria | 10598 |
| 865 | Ga0495672_0020050 | 3300047320 | Bacteria | 4392 |
| 866 | Ga0495680_0128059 | 3300047322 | Bacteria | 1868 |
| 867 | Ga0495684_0291467 | 3300047471 | Bacteria | 1174 |
| 868 | Ga0495686_0011185 | 3300047472 | Bacteria | 6332 |
| 869 | Ga0496100_0693337 | 3300048903 | Bacteria | 795 |
| 870 | Ga0496101_0224250 | 3300048904 | Unclassified | 1459 |
| 871 | Ga0496104_0339198 | 3300048907 | Unclassified | 1416 |
| 872 | Ga0496105_0207097 | 3300048908 | Bacteria | 1600 |
| 873 | Ga0496109_0014633 | 3300048912 | Bacteria | 6826 |
| 874 | Ga0496109_0288820 | 3300048912 | Bacteria | 1546 |
| 875 | Ga0496110_0065694 | 3300048913 | Bacteria | 3208 |
| 876 | Ga0496110_0231067 | 3300048913 | Bacteria | 1682 |
| 877 | Ga0496112_0328164 | 3300048915 | Bacteria | 1474 |
| 878 | Ga0501306_016337 | 3300049127 | Bacteria | 996 |
| 879 | Ga0501306_031780 | 3300049127 | Bacteria | 788 |
| 880 | Ga0501306_033411 | 3300049127 | Bacteria | 773 |
| 881 | Ga0501308_001539 | 3300049128 | Bacteria | 1869 |
| 882 | Ga0501308_012590 | 3300049128 | Bacteria | 968 |
| 883 | Ga0501305_030069 | 3300049161 | Bacteria | 843 |
| 884 | Ga0501290_002235 | 3300049513 | Bacteria | 2515 |
| 885 | Ga0501292_000995 | 3300049515 | Bacteria | 3442 |
| 886 | Ga0501298_000530 | 3300049521 | Bacteria | 5175 |
| 887 | Ga0501299_001303 | 3300049522 | Bacteria | 3168 |
| 888 | Ga0501303_015565 | 3300049526 | Bacteria | 762 |
| 889 | Ga0501312_002971 | 3300049528 | Bacteria | 1881 |
| 890 | Ga0501312_024910 | 3300049528 | Bacteria | 909 |
| 891 | Ga0501312_036890 | 3300049528 | Bacteria | 786 |
| 892 | Ga0501314_009319 | 3300049530 | Bacteria | 899 |
| 893 | Ga0501316_024174 | 3300049532 | Bacteria | 784 |
| 894 | Ga0501324_016328 | 3300049540 | Bacteria | 728 |
| 895 | Ga0501337_006885 | 3300049553 | Bacteria | 784 |
| 896 | Ga0501031_0328658 | 3300049568 | Bacteria | 990 |
| 897 | Ga0501031_0363715 | 3300049568 | Bacteria | 936 |
| 898 | Ga0501032_0004313 | 3300049569 | Bacteria | 10742 |
| 899 | Ga0501032_0045286 | 3300049569 | Bacteria | 2976 |
| 900 | Ga0501032_0098945 | 3300049569 | Bacteria | 1932 |
| 901 | Ga0501032_0201334 | 3300049569 | Unclassified | 1299 |
| 902 | Ga0501033_0006858 | 3300049570 | Bacteria | 8892 |
| 903 | Ga0501033_0094311 | 3300049570 | Bacteria | 2189 |
| 904 | Ga0501033_0214437 | 3300049570 | Bacteria | 1372 |
| 905 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 906 | Ga0501034_0008447 | 3300049571 | Bacteria | 10876 |
| 907 | Ga0501034_0012890 | 3300049571 | Bacteria | 8623 |
| 908 | Ga0501034_0022986 | 3300049571 | Bacteria | 6353 |
| 909 | Ga0501034_0031289 | 3300049571 | Bacteria | 5405 |
| 910 | Ga0501034_0039862 | 3300049571 | Bacteria | 4757 |
| 911 | Ga0501034_0097671 | 3300049571 | Bacteria | 2933 |
| 912 | Ga0501034_0098127 | 3300049571 | Bacteria | 2925 |
| 913 | Ga0501034_0106927 | 3300049571 | Bacteria | 2790 |
| 914 | Ga0501036_0041557 | 3300049572 | Bacteria | 3889 |
| 915 | Ga0501037_0020352 | 3300049573 | Bacteria | 4899 |
| 916 | Ga0501037_0036949 | 3300049573 | Bacteria | 3599 |
| 917 | Ga0501037_0042976 | 3300049573 | Bacteria | 3321 |
| 918 | Ga0501037_0175444 | 3300049573 | Unclassified | 1522 |
| 919 | Ga0501038_0005400 | 3300049574 | Bacteria | 11880 |
| 920 | Ga0501038_0039893 | 3300049574 | Bacteria | 4104 |
| 921 | Ga0501038_0062216 | 3300049574 | Bacteria | 3189 |
| 922 | Ga0501038_0100211 | 3300049574 | Bacteria | 2414 |
| 923 | Ga0501038_0478766 | 3300049574 | Bacteria | 954 |
| 924 | Ga0501039_0008583 | 3300049575 | Bacteria | 7792 |
| 925 | Ga0501039_0039599 | 3300049575 | Bacteria | 3640 |
| 926 | Ga0501043_0004656 | 3300049579 | Bacteria | 11119 |
| 927 | Ga0501043_0013445 | 3300049579 | Bacteria | 6401 |
| 928 | Ga0501043_0059217 | 3300049579 | Bacteria | 3006 |
| 929 | Ga0501043_0160558 | 3300049579 | Bacteria | 1756 |
| 930 | Ga0501046_0003336 | 3300049580 | Bacteria | 14755 |
| 931 | Ga0501046_0026201 | 3300049580 | Bacteria | 4763 |
| 932 | Ga0501047_0002513 | 3300049581 | Bacteria | 17487 |
| 933 | Ga0501047_0088741 | 3300049581 | Bacteria | 2969 |
| 934 | Ga0501047_0160319 | 3300049581 | Bacteria | 2121 |
| 935 | Ga0501047_0167032 | 3300049581 | Bacteria | 2071 |
| 936 | Ga0501047_0199458 | 3300049581 | Bacteria | 1862 |
| 937 | Ga0501048_0390018 | 3300049582 | Bacteria | 995 |
| 938 | Ga0501069_0080213 | 3300049585 | Bacteria | 1838 |
| 939 | Ga0501070_0006730 | 3300049586 | Bacteria | 9787 |
| 940 | Ga0501070_0103596 | 3300049586 | Bacteria | 2353 |
| 941 | Ga0501070_0396254 | 3300049586 | Unclassified | 1117 |
| 942 | Ga0501072_0013863 | 3300049588 | Bacteria | 6176 |
| 943 | Ga0501072_0526879 | 3300049588 | Bacteria | 934 |
| 944 | Ga0501073_0001665 | 3300049589 | Bacteria | 16470 |
| 945 | Ga0501073_0093194 | 3300049589 | Bacteria | 2093 |
| 946 | Ga0501074_0102143 | 3300049590 | Bacteria | 2052 |
| 947 | Ga0501198_000711 | 3300049649 | Bacteria | 4137 |
| 948 | Ga0501198_011403 | 3300049649 | Bacteria | 1326 |
| 949 | Ga0501201_000337 | 3300049651 | Bacteria | 4292 |
| 950 | Ga0501202_005557 | 3300049652 | Bacteria | 2233 |
| 951 | Ga0501206_007100 | 3300049653 | Bacteria | 1465 |
| 952 | Ga0501207_001019 | 3300049654 | Bacteria | 3409 |
| 953 | Ga0501216_001931 | 3300049660 | Bacteria | 2876 |
| 954 | Ga0501217_000623 | 3300049661 | Bacteria | 5967 |
| 955 | Ga0501217_008287 | 3300049661 | Bacteria | 2242 |
| 956 | Ga0501222_009960 | 3300049662 | Bacteria | 1255 |
| 957 | Ga0501223_000612 | 3300049663 | Bacteria | 8570 |
| 958 | Ga0501227_013552 | 3300049665 | Bacteria | 1798 |
| 959 | Ga0501228_005443 | 3300049666 | Bacteria | 1129 |
| 960 | Ga0501233_036779 | 3300049668 | Bacteria | 1134 |
| 961 | Ga0501235_001816 | 3300049669 | Bacteria | 4582 |
| 962 | Ga0501235_023363 | 3300049669 | Bacteria | 1378 |
| 963 | Ga0501236_008339 | 3300049670 | Bacteria | 1315 |
| 964 | Ga0501240_000563 | 3300049673 | Bacteria | 3098 |
| 965 | Ga0501242_002993 | 3300049674 | Bacteria | 1805 |
| 966 | Ga0501242_009611 | 3300049674 | Bacteria | 1146 |
| 967 | Ga0501243_000175 | 3300049675 | Bacteria | 7506 |
| 968 | Ga0501251_001086 | 3300049681 | Bacteria | 2501 |
| 969 | Ga0501252_000056 | 3300049682 | Bacteria | 5790 |
| 970 | Ga0501253_004251 | 3300049683 | Bacteria | 1792 |
| 971 | Ga0501257_030121 | 3300049686 | Bacteria | 1305 |
| 972 | Ga0501259_000471 | 3300049688 | Bacteria | 6427 |
| 973 | Ga0501259_004572 | 3300049688 | Bacteria | 2199 |
| 974 | Ga0501261_000479 | 3300049690 | Bacteria | 5113 |
| 975 | Ga0501219_000944 | 3300049703 | Bacteria | 3507 |
| 976 | Ga0501221_000519 | 3300049704 | Bacteria | 6099 |
| 977 | Ga0501225_0001014 | 3300049705 | Bacteria | 8815 |
| 978 | Ga0501225_0002100 | 3300049705 | Bacteria | 6196 |
| 979 | Ga0501225_0111651 | 3300049705 | Bacteria | 806 |
| 980 | Ga0501234_000632 | 3300049707 | Bacteria | 5424 |
| 981 | Ga0501234_007549 | 3300049707 | Bacteria | 1701 |
| 982 | Ga0501245_010223 | 3300049708 | Bacteria | 1354 |
| 983 | Ga0501079_0064510 | 3300049741 | Bacteria | 2825 |
| 984 | Ga0501079_0191309 | 3300049741 | Bacteria | 1597 |
| 985 | Ga0501080_0077292 | 3300049742 | Bacteria | 3095 |
| 986 | Ga0501080_0314414 | 3300049742 | Bacteria | 1419 |
| 987 | Ga0501083_0086403 | 3300049744 | Bacteria | 2074 |
| 988 | Ga0501083_0148600 | 3300049744 | Bacteria | 1534 |
| 989 | Ga0501241_018032 | 3300049758 | Bacteria | 1292 |
| 990 | Ga0501264_004095 | 3300049761 | Bacteria | 1321 |
| 991 | Ga0501266_013482 | 3300049763 | Bacteria | 1064 |
| 992 | Ga0501267_002942 | 3300049764 | Bacteria | 1529 |
| 993 | Ga0501268_006384 | 3300049765 | Bacteria | 1728 |
| 994 | Ga0501279_009957 | 3300049775 | Bacteria | 1277 |
| 995 | Ga0501282_005688 | 3300049778 | Bacteria | 1335 |
| 996 | Ga0501035_0001789 | 3300049822 | Bacteria | 21715 |
| 997 | Ga0501035_0019698 | 3300049822 | Bacteria | 6200 |
| 998 | Ga0501035_0065820 | 3300049822 | Bacteria | 3217 |
| 999 | Ga0501035_0075123 | 3300049822 | Bacteria | 2989 |
| 1000 | Ga0501035_0531458 | 3300049822 | Unclassified | 965 |
| 1001 | Ga0501044_0004121 | 3300049823 | Bacteria | 16310 |
| 1002 | Ga0501044_0012046 | 3300049823 | Bacteria | 9365 |
| 1003 | Ga0501044_0026210 | 3300049823 | Bacteria | 6174 |
| 1004 | Ga0501044_0039575 | 3300049823 | Bacteria | 4917 |
| 1005 | Ga0501044_0273289 | 3300049823 | Bacteria | 1625 |
| 1006 | Ga0501044_0369310 | 3300049823 | Bacteria | 1351 |
| 1007 | Ga0501204_004697 | 3300049850 | Bacteria | 1478 |
| 1008 | Ga0501212_004479 | 3300049851 | Bacteria | 1806 |
| 1009 | Ga0501284_00006 | 3300050005 | Bacteria | 153628 |
| 1010 | nmdc:mga0k408_101998_c1 | 3300050493 | Bacteria | 1692 |
| 1011 | nmdc:mga0k408_105792_c1 | 3300050493 | Bacteria | 1662 |
| 1012 | nmdc:mga0k408_176430_c1 | 3300050493 | Bacteria | 1274 |
| 1013 | nmdc:mga0k408_18195_c1 | 3300050493 | Bacteria | 3921 |
| 1014 | nmdc:mga0k408_3671_c2 | 3300050493 | Bacteria | 1797 |
| 1015 | nmdc:mga0k408_54565_c2 | 3300050493 | Bacteria | 1079 |
| 1016 | nmdc:mga05p37_48940_c1 | 3300050507 | Bacteria | 5198 |
| 1017 | nmdc:mga05p37_53739_c1 | 3300050507 | Bacteria | 4954 |
| 1018 | nmdc:mga0qj67_84982_c1 | 3300050509 | Bacteria | 2538 |
| 1019 | nmdc:mga06r32_131083_c1 | 3300050510 | Bacteria | 2479 |
| 1020 | nmdc:mga06r32_23249_c1 | 3300050510 | Bacteria | 5733 |
| 1021 | nmdc:mga08y16_39378_c1 | 3300050511 | Bacteria | 4960 |
| 1022 | nmdc:mga08y16_423395_c1 | 3300050511 | Unclassified | 1361 |
| 1023 | nmdc:mga08y16_470754_c1 | 3300050511 | Bacteria | 1279 |
| 1024 | nmdc:mga08y16_820311_c1 | 3300050511 | Bacteria | 922 |
| 1025 | nmdc:mga08y16_880207_c1 | 3300050511 | Bacteria | 883 |
| 1026 | Ga0495619_0044008 | 3300053085 | Bacteria | 2929 |
| 1027 | Ga0500578_0011031 | 3300053086 | Bacteria | 5839 |
| 1028 | Ga0500583_0000009 | 3300053092 | Bacteria | 160749 |
| 1029 | Ga0500583_0000258 | 3300053092 | Bacteria | 18965 |
| 1030 | Ga0500651_0000232 | 3300053093 | Bacteria | 34617 |
| 1031 | Ga0500641_0091345 | 3300053096 | Unclassified | 1300 |
| 1032 | Ga0500555_024159 | 3300053103 | Bacteria | 1742 |
| 1033 | Ga0500642_0043895 | 3300053130 | Bacteria | 1944 |
| 1034 | Ga0500642_0135173 | 3300053130 | Bacteria | 1156 |
| 1035 | Ga0500652_018206 | 3300053131 | Bacteria | 2589 |
| 1036 | Ga0500652_086308 | 3300053131 | Bacteria | 1309 |
| 1037 | Ga0500559_0024426 | 3300053136 | Bacteria | 2572 |
| 1038 | Ga0500568_0000895 | 3300053139 | Bacteria | 20694 |
| 1039 | Ga0500589_001419 | 3300053147 | Bacteria | 7110 |
| 1040 | Ga0500604_0010575 | 3300053151 | Bacteria | 2470 |
| 1041 | Ga0500616_0176839 | 3300053153 | Bacteria | 964 |
| 1042 | Ga0500622_0000615 | 3300053156 | Bacteria | 32225 |
| 1043 | Ga0500622_0058994 | 3300053156 | Bacteria | 1960 |
| 1044 | Ga0500639_037414 | 3300053163 | Bacteria | 2557 |
| 1045 | Ga0500611_000005 | 3300053727 | Bacteria | 228837 |
| 1046 | Ga0500645_034780 | 3300053730 | Bacteria | 1504 |
| 1047 | Ga0501084_0018691 | 3300054114 | Bacteria | 5770 |
| 1048 | Ga0501084_0183587 | 3300054114 | Bacteria | 1766 |
| 1049 | Ga0500661_001332 | 3300055283 | Bacteria | 4609 |
| 1050 | Ga0587068_011416 | 3300059641 | Bacteria | 1340 |
| 1051 | Ga0501082_0070209 | 3300060353 | Bacteria | 3016 |
| 1052 | 2738725990 | 2738541278 | Bacteria | 9755573 |
| 1053 | 2819590467 | 2818991444 | Bacteria | 6968812 |
| 1054 | 2914759804 | 2914759650 | Bacteria | 4701441 |
| 1055 | 2929158632 | 2929154850 | Bacteria | 6753285 |
| 1056 | Ga0501080_0676784 | |||
| 1057 | MRS1b_contig_8282875 | |||
| 1058 | MBSR1b_contig_807238 | |||
| 1059 | JGI24744J21845_10019960 | |||
| 1060 | JGI24033J26618_1007474 | |||
| 1061 | JGI24751J29686_10000409 | |||
| 1062 | JGI25406J46586_10000143 | |||
| 1063 | JGI25406J46586_10048452 | |||
| 1064 | rootH1_10024197 | |||
| 1065 | rootH2_10100492 | |||
| 1066 | rootL2_10216868 | |||
| 1067 | rootL2_10230147 | |||
| 1068 | rootH1_10014938 | |||
| 1069 | rootH1_10073697 | |||
| 1070 | rootH1_10104989 | |||
| 1071 | JGI25160J50197_1001273 | |||
| 1072 | Ga0065714_10090598 | |||
| 1073 | Ga0065704_10091559 | |||
| 1074 | Ga0065704_10149944 | |||
| 1075 | Ga0065712_10114193 | |||
| 1076 | Ga0065715_10008112 | |||
| 1077 | Ga0065715_10189048 | |||
| 1078 | Ga0065715_10381257 | |||
| 1079 | Ga0070658_10117258 | |||
| 1080 | Ga0070658_10145098 | |||
| 1081 | Ga0070676_10000238 | |||
| 1082 | Ga0070676_10155426 | |||
| 1083 | Ga0070676_10173976 | |||
| 1084 | Ga0070676_10293962 | |||
| 1085 | Ga0070676_10341912 | |||
| 1086 | Ga0070683_100008594 | |||
| 1087 | Ga0070683_100243220 | |||
| 1088 | Ga0070683_100469055 | |||
| 1089 | Ga0070690_100018274 | |||
| 1090 | Ga0070690_100019279 | |||
| 1091 | Ga0070690_100206683 | |||
| 1092 | Ga0070670_100021331 | |||
| 1093 | Ga0070670_100042070 | |||
| 1094 | Ga0070670_100066171 | |||
| 1095 | Ga0070670_100088043 | |||
| 1096 | Ga0070670_100092922 | |||
| 1097 | Ga0070670_100257530 | |||
| 1098 | Ga0070670_100541003 | |||
| 1099 | Ga0070670_100633829 | |||
| 1100 | Ga0070677_10011093 | |||
| 1101 | Ga0070677_10076810 | |||
| 1102 | Ga0068869_100005951 | |||
| 1103 | Ga0068869_100010616 | |||
| 1104 | Ga0068869_100011228 | |||
| 1105 | Ga0068869_100011620 | |||
| 1106 | Ga0068869_100017491 | |||
| 1107 | Ga0068869_100029659 | |||
| 1108 | Ga0068869_100081983 | |||
| 1109 | Ga0068869_100158273 | |||
| 1110 | Ga0068869_100318764 | |||
| 1111 | Ga0070666_10000019 | |||
| 1112 | Ga0070666_10000966 | |||
| 1113 | Ga0070666_10004456 | |||
| 1114 | Ga0070666_10103137 | |||
| 1115 | Ga0070666_10173240 | |||
| 1116 | Ga0070666_10232849 | |||
| 1117 | Ga0070680_100000930 | |||
| 1118 | Ga0070680_100034567 | |||
| 1119 | Ga0070680_100127533 | |||
| 1120 | Ga0070682_100000423 | |||
| 1121 | Ga0070682_100001176 | |||
| 1122 | Ga0070682_100079043 | |||
| 1123 | Ga0070682_100091788 | |||
| 1124 | Ga0070682_100259407 | |||
| 1125 | Ga0068868_100002525 | |||
| 1126 | Ga0068868_100004277 | |||
| 1127 | Ga0068868_100004975 | |||
| 1128 | Ga0068868_100019194 | |||
| 1129 | Ga0068868_100042310 | |||
| 1130 | Ga0068868_100062700 | |||
| 1131 | Ga0068868_100063169 | |||
| 1132 | Ga0068868_100144041 | |||
| 1133 | Ga0070660_100046558 | |||
| 1134 | Ga0070660_100122274 | |||
| 1135 | Ga0070660_100331338 | |||
| 1136 | Ga0070660_100533699 | |||
| 1137 | Ga0070689_100023578 | |||
| 1138 | Ga0070689_100141821 | |||
| 1139 | Ga0070689_100188755 | |||
| 1140 | Ga0070687_100013338 | |||
| 1141 | Ga0070687_100080022 | |||
| 1142 | Ga0070661_100026648 | |||
| 1143 | Ga0070661_100596269 | |||
| 1144 | Ga0070692_10255945 | |||
| 1145 | Ga0070668_100000981 | |||
| 1146 | Ga0070668_100016663 | |||
| 1147 | Ga0070668_100037453 | |||
| 1148 | Ga0070668_100140486 | |||
| 1149 | Ga0070668_100159587 | |||
| 1150 | Ga0070668_100235022 | |||
| 1151 | Ga0070668_100294963 | |||
| 1152 | Ga0070669_100000826 | |||
| 1153 | Ga0070669_100023785 | |||
| 1154 | Ga0070669_100096692 | |||
| 1155 | Ga0070669_100206721 | |||
| 1156 | Ga0070675_100011529 | |||
| 1157 | Ga0070675_100012707 | |||
| 1158 | Ga0070675_100069637 | |||
| 1159 | Ga0070675_100076970 | |||
| 1160 | Ga0070675_100281514 | |||
| 1161 | Ga0070675_100560982 | |||
| 1162 | Ga0070671_100032220 | |||
| 1163 | Ga0070671_100054717 | |||
| 1164 | Ga0070671_100224205 | |||
| 1165 | Ga0070671_100267854 | |||
| 1166 | Ga0070671_100641687 | |||
| 1167 | Ga0070674_100136372 | |||
| 1168 | Ga0070674_100477639 | |||
| 1169 | Ga0070673_100001854 | |||
| 1170 | Ga0070673_100008764 | |||
| 1171 | Ga0070673_100012202 | |||
| 1172 | Ga0070673_100036038 | |||
| 1173 | Ga0070673_100079878 | |||
| 1174 | Ga0070673_100112347 | |||
| 1175 | Ga0070673_100130947 | |||
| 1176 | Ga0070673_100138587 | |||
| 1177 | Ga0070673_100219197 | |||
| 1178 | Ga0070673_100770808 | |||
| 1179 | Ga0070688_100001299 | |||
| 1180 | Ga0070688_100002166 | |||
| 1181 | Ga0070688_100073887 | |||
| 1182 | Ga0070688_100253364 | |||
| 1183 | Ga0070659_100032456 | |||
| 1184 | Ga0070667_100001589 | |||
| 1185 | Ga0070667_100011530 | |||
| 1186 | Ga0070667_100012973 | |||
| 1187 | Ga0070667_100014864 | |||
| 1188 | Ga0070667_100022490 | |||
| 1189 | Ga0070667_100226056 | |||
| 1190 | Ga0070667_100242036 | |||
| 1191 | Ga0070667_100257172 | |||
| 1192 | Ga0070667_100355701 | |||
| 1193 | Ga0070667_100406789 | |||
| 1194 | Ga0070700_100148522 | |||
| 1195 | Ga0070694_100512318 | |||
| 1196 | Ga0070663_100138358 | |||
| 1197 | Ga0070663_100263995 | |||
| 1198 | Ga0070663_100452975 | |||
| 1199 | Ga0070678_100003466 | |||
| 1200 | Ga0070678_100325856 | |||
| 1201 | Ga0070678_100478616 | |||
| 1202 | Ga0070662_100001906 | |||
| 1203 | Ga0070662_100002104 | |||
| 1204 | Ga0070662_100038623 | |||
| 1205 | Ga0070662_100237271 | |||
| 1206 | Ga0070662_100993694 | |||
| 1207 | Ga0070681_10033798 | |||
| 1208 | Ga0070681_10078658 | |||
| 1209 | Ga0070681_10247465 | |||
| 1210 | Ga0070681_10389345 | |||
| 1211 | Ga0068867_100004334 | |||
| 1212 | Ga0068867_100011177 | |||
| 1213 | Ga0068867_100015145 | |||
| 1214 | Ga0068867_100028178 | |||
| 1215 | Ga0068867_100028654 | |||
| 1216 | Ga0068867_100054313 | |||
| 1217 | Ga0068867_100064586 | |||
| 1218 | Ga0068867_100108848 | |||
| 1219 | Ga0068867_100114652 | |||
| 1220 | Ga0068867_100117163 | |||
| 1221 | Ga0068867_100258067 | |||
| 1222 | Ga0068867_100338431 | |||
| 1223 | Ga0068867_100725156 | |||
| 1224 | Ga0070685_10031812 | |||
| 1225 | Ga0070685_10128264 | |||
| 1226 | Ga0070706_100444877 | |||
| 1227 | Ga0070707_100148980 | |||
| 1228 | Ga0070698_100001267 | |||
| 1229 | Ga0070698_100019395 | |||
| 1230 | Ga0070698_100054424 | |||
| 1231 | Ga0070698_100066940 | |||
| 1232 | Ga0070698_100664676 | |||
| 1233 | Ga0070699_100055087 | |||
| 1234 | Ga0070679_100054082 | |||
| 1235 | Ga0070679_100062849 | |||
| 1236 | Ga0070679_100104850 | |||
| 1237 | Ga0070684_100005645 | |||
| 1238 | Ga0070697_100334894 | |||
| 1239 | Ga0068853_100009326 | |||
| 1240 | Ga0068853_100085771 | |||
| 1241 | Ga0068853_100089920 | |||
| 1242 | Ga0068853_100165384 | |||
| 1243 | Ga0068853_100176568 | |||
| 1244 | Ga0068853_100346450 | |||
| 1245 | Ga0068853_100494491 | |||
| 1246 | Ga0070672_100001555 | |||
| 1247 | Ga0070672_100011979 | |||
| 1248 | Ga0070672_100058606 | |||
| 1249 | Ga0070672_100112553 | |||
| 1250 | Ga0070672_100238544 | |||
| 1251 | Ga0070672_100388203 | |||
| 1252 | Ga0070672_100539695 | |||
| 1253 | Ga0070686_100017757 | |||
| 1254 | Ga0070686_100145797 | |||
| 1255 | Ga0070686_100213621 | |||
| 1256 | Ga0070686_100475980 | |||
| 1257 | Ga0070686_100477280 | |||
| 1258 | Ga0070693_100071864 | |||
| 1259 | Ga0070693_100092842 | |||
| 1260 | Ga0070665_100002381 | |||
| 1261 | Ga0070665_100018175 | |||
| 1262 | Ga0070665_100418798 | |||
| 1263 | Ga0070665_100687807 | |||
| 1264 | Ga0068855_100005983 | |||
| 1265 | Ga0068855_100039366 | |||
| 1266 | Ga0068855_100083430 | |||
| 1267 | Ga0068855_100253182 | |||
| 1268 | Ga0070664_100061322 | |||
| 1269 | Ga0070664_100064495 | |||
| 1270 | Ga0070664_100074517 | |||
| 1271 | Ga0070664_100109408 | |||
| 1272 | Ga0070664_100533505 | |||
| 1273 | Ga0070664_100573254 | |||
| 1274 | Ga0070664_100651503 | |||
| 1275 | Ga0068857_100023123 | |||
| 1276 | Ga0068857_100174400 | |||
| 1277 | Ga0068857_100597673 | |||
| 1278 | Ga0068857_100653403 | |||
| 1279 | Ga0068854_100037680 | |||
| 1280 | Ga0068854_100189763 | |||
| 1281 | Ga0068854_100611099 | |||
| 1282 | Ga0068856_100007851 | |||
| 1283 | Ga0070702_100066427 | |||
| 1284 | Ga0070702_100113874 | |||
| 1285 | Ga0068852_100031375 | |||
| 1286 | Ga0068852_100053358 | |||
| 1287 | Ga0068852_100102496 | |||
| 1288 | Ga0068852_100135178 | |||
| 1289 | Ga0068859_100000013 | |||
| 1290 | Ga0068859_100010041 | |||
| 1291 | Ga0068859_100019858 | |||
| 1292 | Ga0068859_100019894 | |||
| 1293 | Ga0068859_100029635 | |||
| 1294 | Ga0068859_100029925 | |||
| 1295 | Ga0068859_100038541 | |||
| 1296 | Ga0068859_100054597 | |||
| 1297 | Ga0068859_100058980 | |||
| 1298 | Ga0068859_100090332 | |||
| 1299 | Ga0068859_100131419 | |||
| 1300 | Ga0068859_100139162 | |||
| 1301 | Ga0068859_100284061 | |||
| 1302 | Ga0068859_100382405 | |||
| 1303 | Ga0068859_100632298 | |||
| 1304 | Ga0068864_100000357 | |||
| 1305 | Ga0068864_100001339 | |||
| 1306 | Ga0068864_100011141 | |||
| 1307 | Ga0068864_100029348 | |||
| 1308 | Ga0068864_100045286 | |||
| 1309 | Ga0068864_100450642 | |||
| 1310 | Ga0068864_100498590 | |||
| 1311 | Ga0068866_10003544 | |||
| 1312 | Ga0068866_10079890 | |||
| 1313 | Ga0068866_10217405 | |||
| 1314 | Ga0068861_100009344 | |||
| 1315 | Ga0068861_100014355 | |||
| 1316 | Ga0068861_100045063 | |||
| 1317 | Ga0068861_100110453 | |||
| 1318 | Ga0068861_100141357 | |||
| 1319 | Ga0068861_100279769 | |||
| 1320 | Ga0068861_100361218 | |||
| 1321 | Ga0068861_100372015 | |||
| 1322 | Ga0068851_10000433 | |||
| 1323 | Ga0068851_10025715 | |||
| 1324 | Ga0068851_10252166 | |||
| 1325 | Ga0068851_10255719 | |||
| 1326 | Ga0068870_10001616 | |||
| 1327 | Ga0068870_10088732 | |||
| 1328 | Ga0068870_10436643 | |||
| 1329 | Ga0068863_100001616 | |||
| 1330 | Ga0068863_100002217 | |||
| 1331 | Ga0068863_100026605 | |||
| 1332 | Ga0068863_100067788 | |||
| 1333 | Ga0068863_100110030 | |||
| 1334 | Ga0068863_100275815 | |||
| 1335 | Ga0068863_100299336 | |||
| 1336 | Ga0068863_100312215 | |||
| 1337 | Ga0068863_100352403 | |||
| 1338 | Ga0068863_100626159 | |||
| 1339 | Ga0068863_100931683 | |||
| 1340 | Ga0068858_100006851 | |||
| 1341 | Ga0068858_100013114 | |||
| 1342 | Ga0068858_100102257 | |||
| 1343 | Ga0068858_100122844 | |||
| 1344 | Ga0068858_100126686 | |||
| 1345 | Ga0068858_100789562 | |||
| 1346 | Ga0068860_100000948 | |||
| 1347 | Ga0068860_100002928 | |||
| 1348 | Ga0068860_100008208 | |||
| 1349 | Ga0068860_100011092 | |||
| 1350 | Ga0068860_100012904 | |||
| 1351 | Ga0068860_100019036 | |||
| 1352 | Ga0068860_100037012 | |||
| 1353 | Ga0068860_100151572 | |||
| 1354 | Ga0068860_100163293 | |||
| 1355 | Ga0068860_100174243 | |||
| 1356 | Ga0068860_100188881 | |||
| 1357 | Ga0068860_100283172 | |||
| 1358 | Ga0068860_100582336 | |||
| 1359 | Ga0068860_100616993 | |||
| 1360 | Ga0068862_100005077 | |||
| 1361 | Ga0068862_100040502 | |||
| 1362 | Ga0068862_100110877 | |||
| 1363 | Ga0068862_100111578 | |||
| 1364 | Ga0068862_100167921 | |||
| 1365 | Ga0068862_100452332 | |||
| 1366 | Ga0068862_100920125 | |||
| 1367 | Ga0081539_10000402 | |||
| 1368 | Ga0081539_10026620 | |||
| 1369 | Ga0075366_10005580 | |||
| 1370 | Ga0075366_10010004 | |||
| 1371 | Ga0075366_10083828 | |||
| 1372 | Ga0075366_10244292 | |||
| 1373 | Ga0075366_10264951 | |||
| 1374 | Ga0097621_100000960 | |||
| 1375 | Ga0097621_100003944 | |||
| 1376 | Ga0097621_100017259 | |||
| 1377 | Ga0097621_100040578 | |||
| 1378 | Ga0097621_100104803 | |||
| 1379 | Ga0097621_100110271 | |||
| 1380 | Ga0075370_10147888 | |||
| 1381 | Ga0075370_10204252 | |||
| 1382 | Ga0068871_100000582 | |||
| 1383 | Ga0068871_100001510 | |||
| 1384 | Ga0068871_100001981 | |||
| 1385 | Ga0068871_100076476 | |||
| 1386 | Ga0068871_100116632 | |||
| 1387 | Ga0068871_100348634 | |||
| 1388 | Ga0068871_100353048 | |||
| 1389 | Ga0068871_100439543 | |||
| 1390 | Ga0068871_100564957 | |||
| 1391 | Ga0068871_100649722 | |||
| 1392 | Ga0075428_100041147 | |||
| 1393 | Ga0075430_100005897 | |||
| 1394 | Ga0075431_100020982 | |||
| 1395 | Ga0075431_100317946 | |||
| 1396 | Ga0075429_100030293 | |||
| 1397 | Ga0075429_100157104 | |||
| 1398 | Ga0068865_100005767 | |||
| 1399 | Ga0068865_100018860 | |||
| 1400 | Ga0068865_100162117 | |||
| 1401 | Ga0097620_100000013 | |||
| 1402 | Ga0097620_100010041 | |||
| 1403 | Ga0097620_100019858 | |||
| 1404 | Ga0097620_100019895 | |||
| 1405 | Ga0097620_100029634 | |||
| 1406 | Ga0097620_100029926 | |||
| 1407 | Ga0097620_100038543 | |||
| 1408 | Ga0097620_100054597 | |||
| 1409 | Ga0097620_100058980 | |||
| 1410 | Ga0097620_100090336 | |||
| 1411 | Ga0097620_100131425 | |||
| 1412 | Ga0097620_100139165 | |||
| 1413 | Ga0097620_100284040 | |||
| 1414 | Ga0097620_100382392 | |||
| 1415 | Ga0097620_100632282 | |||
| 1416 | Ga0105240_10001908 | |||
| 1417 | Ga0111539_10028550 | |||
| 1418 | Ga0111539_10047620 | |||
| 1419 | Ga0111539_10114039 | |||
| 1420 | Ga0111539_10129092 | |||
| 1421 | Ga0111539_11278505 | |||
| 1422 | Ga0105245_10051281 | |||
| 1423 | Ga0105245_10068267 | |||
| 1424 | Ga0105247_10000906 | |||
| 1425 | Ga0105247_10011607 | |||
| 1426 | Ga0114129_10033187 | |||
| 1427 | Ga0105243_10070257 | |||
| 1428 | Ga0105243_10073565 | |||
| 1429 | Ga0105241_10000858 | |||
| 1430 | Ga0105241_10005708 | |||
| 1431 | Ga0105241_10008625 | |||
| 1432 | Ga0105241_10097998 | |||
| 1433 | Ga0105241_10200902 | |||
| 1434 | Ga0105241_10323049 | |||
| 1435 | Ga0105241_10437512 | |||
| 1436 | Ga0105241_10619090 | |||
| 1437 | Ga0105242_10010225 | |||
| 1438 | Ga0105242_10029115 | |||
| 1439 | Ga0105242_10042800 | |||
| 1440 | Ga0105242_10066209 | |||
| 1441 | Ga0105242_10164073 | |||
| 1442 | Ga0105242_10276328 | |||
| 1443 | Ga0105242_10331238 | |||
| 1444 | Ga0105242_10419863 | |||
| 1445 | Ga0105242_10537505 | |||
| 1446 | Ga0105242_10835750 | |||
| 1447 | Ga0105248_10074758 | |||
| 1448 | Ga0105248_10085106 | |||
| 1449 | Ga0105237_10012709 | |||
| 1450 | Ga0105237_10026673 | |||
| 1451 | Ga0105237_10038845 | |||
| 1452 | Ga0105249_10000349 | |||
| 1453 | Ga0105249_10001507 | |||
| 1454 | Ga0105249_10001918 | |||
| 1455 | Ga0105249_10006005 | |||
| 1456 | Ga0105249_10011132 | |||
| 1457 | Ga0105249_10032555 | |||
| 1458 | Ga0105249_10052361 | |||
| 1459 | Ga0105249_10077670 | |||
| 1460 | Ga0105249_10109955 | |||
| 1461 | Ga0105249_10228135 | |||
| 1462 | Ga0105249_10240861 | |||
| 1463 | Ga0105239_10001102 | |||
| 1464 | Ga0105239_10049269 | |||
| 1465 | Ga0105239_10582044 | |||
| 1466 | Ga0105239_10726381 | |||
| 1467 | Ga0105246_10012996 | |||
| 1468 | Ga0105246_10204976 | |||
| 1469 | Ga0157373_10082601 | |||
| 1470 | Ga0157373_10190016 | |||
| 1471 | Ga0157371_10028376 | |||
| 1472 | Ga0157371_10049104 | |||
| 1473 | Ga0157371_10677130 | |||
| 1474 | Ga0157370_10001507 | |||
| 1475 | Ga0157370_10004859 | |||
| 1476 | Ga0157370_10294963 | |||
| 1477 | Ga0157369_10040230 | |||
| 1478 | Ga0157374_10002251 | |||
| 1479 | Ga0157374_10002286 | |||
| 1480 | Ga0157374_10031984 | |||
| 1481 | Ga0157374_10053553 | |||
| 1482 | Ga0157374_10141538 | |||
| 1483 | Ga0157374_10249292 | |||
| 1484 | Ga0157374_10705627 | |||
| 1485 | Ga0157374_10983454 | |||
| 1486 | Ga0157378_10011546 | |||
| 1487 | Ga0157378_10013523 | |||
| 1488 | Ga0157378_10015823 | |||
| 1489 | Ga0157378_10017243 | |||
| 1490 | Ga0157378_10018450 | |||
| 1491 | Ga0157378_10020057 | |||
| 1492 | Ga0157378_10029140 | |||
| 1493 | Ga0157378_10051030 | |||
| 1494 | Ga0157378_10073011 | |||
| 1495 | Ga0157378_10594185 | |||
| 1496 | Ga0157378_10670193 | |||
| 1497 | Ga0157378_10763422 | |||
| 1498 | Ga0157378_10872330 | |||
| 1499 | Ga0163162_10001002 | |||
| 1500 | Ga0163162_10001863 | |||
| 1501 | Ga0163162_10012341 | |||
| 1502 | Ga0163162_10026158 | |||
| 1503 | Ga0163162_10054538 | |||
| 1504 | Ga0163162_10153151 | |||
| 1505 | Ga0163162_10172942 | |||
| 1506 | Ga0163162_10359976 | |||
| 1507 | Ga0163162_10368078 | |||
| 1508 | Ga0157372_10053387 | |||
| 1509 | Ga0157372_10107240 | |||
| 1510 | Ga0157372_10130502 | |||
| 1511 | Ga0157372_10156597 | |||
| 1512 | Ga0157372_11165304 | |||
| 1513 | Ga0157372_11372333 | |||
| 1514 | Ga0157375_10000186 | |||
| 1515 | Ga0157375_10000827 | |||
| 1516 | Ga0157375_10035495 | |||
| 1517 | Ga0157375_10051538 | |||
| 1518 | Ga0157375_10133808 | |||
| 1519 | Ga0157375_10152272 | |||
| 1520 | Ga0157375_10211732 | |||
| 1521 | Ga0157375_10227395 | |||
| 1522 | Ga0157375_10282570 | |||
| 1523 | Ga0157375_10403786 | |||
| 1524 | Ga0157375_10503547 | |||
| 1525 | Ga0157375_10624499 | |||
| 1526 | Ga0163163_10001753 | |||
| 1527 | Ga0163163_10066412 | |||
| 1528 | Ga0163163_10140861 | |||
| 1529 | Ga0163163_10276699 | |||
| 1530 | Ga0163163_10352991 | |||
| 1531 | Ga0163163_10621308 | |||
| 1532 | Ga0157380_10000650 | |||
| 1533 | Ga0157380_10003052 | |||
| 1534 | Ga0157380_10025482 | |||
| 1535 | Ga0157380_10371768 | |||
| 1536 | Ga0157380_10444385 | |||
| 1537 | Ga0157380_10521547 | |||
| 1538 | Ga0157377_10000426 | |||
| 1539 | Ga0157377_10021575 | |||
| 1540 | Ga0157377_10026874 | |||
| 1541 | Ga0157377_10066059 | |||
| 1542 | Ga0157377_10083855 | |||
| 1543 | Ga0157379_10000976 | |||
| 1544 | Ga0157379_10015986 | |||
| 1545 | Ga0157379_10016659 | |||
| 1546 | Ga0157379_10037296 | |||
| 1547 | Ga0157379_10180962 | |||
| 1548 | Ga0157379_10429861 | |||
| 1549 | Ga0157376_10000650 | |||
| 1550 | Ga0157376_10008988 | |||
| 1551 | Ga0157376_10061038 | |||
| 1552 | Ga0157376_10124854 | |||
| 1553 | Ga0157376_10206340 | |||
| 1554 | Ga0157376_10543233 | |||
| 1555 | Ga0163161_10004470 | |||
| 1556 | Ga0163161_10025267 | |||
| 1557 | Ga0163161_10031410 | |||
| 1558 | Ga0163161_10039345 | |||
| 1559 | Ga0163161_10044628 | |||
| 1560 | Ga0163161_10409513 | |||
| 1561 | Ga0213876_10012974 | |||
| 1562 | Ga0207426_1000230 | |||
| 1563 | Ga0207697_10114295 | |||
| 1564 | Ga0207656_10001978 | |||
| 1565 | Ga0207656_10011320 | |||
| 1566 | Ga0207656_10034210 | |||
| 1567 | Ga0207656_10261089 | |||
| 1568 | Ga0207682_10021187 | |||
| 1569 | Ga0207682_10025688 | |||
| 1570 | Ga0207682_10031701 | |||
| 1571 | Ga0207642_10006779 | |||
| 1572 | Ga0207710_10000417 | |||
| 1573 | Ga0207710_10103541 | |||
| 1574 | Ga0207688_10120088 | |||
| 1575 | Ga0207680_10000673 | |||
| 1576 | Ga0207680_10105322 | |||
| 1577 | Ga0207680_10204976 | |||
| 1578 | Ga0207680_10233803 | |||
| 1579 | Ga0207680_10234123 | |||
| 1580 | Ga0207680_10536183 | |||
| 1581 | Ga0207647_10041916 | |||
| 1582 | Ga0207685_10128385 | |||
| 1583 | Ga0207645_10000684 | |||
| 1584 | Ga0207645_10001198 | |||
| 1585 | Ga0207645_10015549 | |||
| 1586 | Ga0207645_10046954 | |||
| 1587 | Ga0207645_10065076 | |||
| 1588 | Ga0207645_10082001 | |||
| 1589 | Ga0207645_10103782 | |||
| 1590 | Ga0207645_10157573 | |||
| 1591 | Ga0207645_10307144 | |||
| 1592 | Ga0207643_10010782 | |||
| 1593 | Ga0207643_10021449 | |||
| 1594 | Ga0207643_10304794 | |||
| 1595 | Ga0207705_10010195 | |||
| 1596 | Ga0207654_10000569 | |||
| 1597 | Ga0207654_10002605 | |||
| 1598 | Ga0207654_10224234 | |||
| 1599 | Ga0207654_10304868 | |||
| 1600 | Ga0207654_10315026 | |||
| 1601 | Ga0207707_10000299 | |||
| 1602 | Ga0207707_10385436 | |||
| 1603 | Ga0207707_10386624 | |||
| 1604 | Ga0207707_10477052 | |||
| 1605 | Ga0207695_10014544 | |||
| 1606 | Ga0207671_10007851 | |||
| 1607 | Ga0207671_10018917 | |||
| 1608 | Ga0207671_10020567 | |||
| 1609 | Ga0207660_10004975 | |||
| 1610 | Ga0207660_10021310 | |||
| 1611 | Ga0207662_10000535 | |||
| 1612 | Ga0207657_10028682 | |||
| 1613 | Ga0207657_10088416 | |||
| 1614 | Ga0207657_10113696 | |||
| 1615 | Ga0207657_10419254 | |||
| 1616 | Ga0207649_10087229 | |||
| 1617 | Ga0207652_10013799 | |||
| 1618 | Ga0207652_10033484 | |||
| 1619 | Ga0207652_10222080 | |||
| 1620 | Ga0207646_10798337 | |||
| 1621 | Ga0207681_10085979 | |||
| 1622 | Ga0207681_10097085 | |||
| 1623 | Ga0207681_10129501 | |||
| 1624 | Ga0207681_10225019 | |||
| 1625 | Ga0207681_10270733 | |||
| 1626 | Ga0207681_10355544 | |||
| 1627 | Ga0207650_10086314 | |||
| 1628 | Ga0207650_10095012 | |||
| 1629 | Ga0207650_10099351 | |||
| 1630 | Ga0207650_10114342 | |||
| 1631 | Ga0207650_10150942 | |||
| 1632 | Ga0207650_10271446 | |||
| 1633 | Ga0207650_10413451 | |||
| 1634 | Ga0207659_10009317 | |||
| 1635 | Ga0207659_10014000 | |||
| 1636 | Ga0207659_10014978 | |||
| 1637 | Ga0207659_10050875 | |||
| 1638 | Ga0207659_10055643 | |||
| 1639 | Ga0207659_10193585 | |||
| 1640 | Ga0207687_10283307 | |||
| 1641 | Ga0207644_10033752 | |||
| 1642 | Ga0207644_10198384 | |||
| 1643 | Ga0207644_10208113 | |||
| 1644 | Ga0207644_10548283 | |||
| 1645 | Ga0207644_10614149 | |||
| 1646 | Ga0207644_10782563 | |||
| 1647 | Ga0207690_10000343 | |||
| 1648 | Ga0207690_10017765 | |||
| 1649 | Ga0207690_10084309 | |||
| 1650 | Ga0207690_10256772 | |||
| 1651 | Ga0207706_10005121 | |||
| 1652 | Ga0207706_10008686 | |||
| 1653 | Ga0207706_10027788 | |||
| 1654 | Ga0207706_10028286 | |||
| 1655 | Ga0207706_10111430 | |||
| 1656 | Ga0207706_10340490 | |||
| 1657 | Ga0207706_10817573 | |||
| 1658 | Ga0207686_10001802 | |||
| 1659 | Ga0207686_10045206 | |||
| 1660 | Ga0207686_10147386 | |||
| 1661 | Ga0207686_10705821 | |||
| 1662 | Ga0207709_10061250 | |||
| 1663 | Ga0207670_10136932 | |||
| 1664 | Ga0207670_10713195 | |||
| 1665 | Ga0207669_10055077 | |||
| 1666 | Ga0207669_10093896 | |||
| 1667 | Ga0207669_10385712 | |||
| 1668 | Ga0207704_10037101 | |||
| 1669 | Ga0207704_10037235 | |||
| 1670 | Ga0207704_10093507 | |||
| 1671 | Ga0207704_10280838 | |||
| 1672 | Ga0207704_10620461 | |||
| 1673 | Ga0207665_10454282 | |||
| 1674 | Ga0207691_10000076 | |||
| 1675 | Ga0207691_10003310 | |||
| 1676 | Ga0207691_10026563 | |||
| 1677 | Ga0207691_10040327 | |||
| 1678 | Ga0207691_10072636 | |||
| 1679 | Ga0207691_10079309 | |||
| 1680 | Ga0207691_10089212 | |||
| 1681 | Ga0207691_10099507 | |||
| 1682 | Ga0207691_10669181 | |||
| 1683 | Ga0207711_10109221 | |||
| 1684 | Ga0207711_10255166 | |||
| 1685 | Ga0207689_10001148 | |||
| 1686 | Ga0207689_10002202 | |||
| 1687 | Ga0207689_10004010 | |||
| 1688 | Ga0207689_10015942 | |||
| 1689 | Ga0207689_10017269 | |||
| 1690 | Ga0207689_10035934 | |||
| 1691 | Ga0207689_10156204 | |||
| 1692 | Ga0207689_10161836 | |||
| 1693 | Ga0207689_10167365 | |||
| 1694 | Ga0207689_10192959 | |||
| 1695 | Ga0207689_10196534 | |||
| 1696 | Ga0207689_10393235 | |||
| 1697 | Ga0207661_10373642 | |||
| 1698 | Ga0207661_10478636 | |||
| 1699 | Ga0207661_10806530 | |||
| 1700 | Ga0207679_10002585 | |||
| 1701 | Ga0207679_10117752 | |||
| 1702 | Ga0207679_10557287 | |||
| 1703 | Ga0207679_10626190 | |||
| 1704 | Ga0207679_10792209 | |||
| 1705 | Ga0207667_10075896 | |||
| 1706 | Ga0207667_10086421 | |||
| 1707 | Ga0207667_10108676 | |||
| 1708 | Ga0207667_10147491 | |||
| 1709 | Ga0207651_10001378 | |||
| 1710 | Ga0207651_10032539 | |||
| 1711 | Ga0207651_10109564 | |||
| 1712 | Ga0207651_10122701 | |||
| 1713 | Ga0207651_10131231 | |||
| 1714 | Ga0207651_10172666 | |||
| 1715 | Ga0207651_10205281 | |||
| 1716 | Ga0207651_10232658 | |||
| 1717 | Ga0207651_10302024 | |||
| 1718 | Ga0207712_10003179 | |||
| 1719 | Ga0207712_10004545 | |||
| 1720 | Ga0207712_10008002 | |||
| 1721 | Ga0207712_10011029 | |||
| 1722 | Ga0207712_10063039 | |||
| 1723 | Ga0207712_10067357 | |||
| 1724 | Ga0207712_10205388 | |||
| 1725 | Ga0207668_10009407 | |||
| 1726 | Ga0207668_10290495 | |||
| 1727 | Ga0207668_10396971 | |||
| 1728 | Ga0207668_10522606 | |||
| 1729 | Ga0207640_10043487 | |||
| 1730 | Ga0207658_10003801 | |||
| 1731 | Ga0207658_10017334 | |||
| 1732 | Ga0207658_10025533 | |||
| 1733 | Ga0207658_10028133 | |||
| 1734 | Ga0207658_10058676 | |||
| 1735 | Ga0207658_10211973 | |||
| 1736 | Ga0207658_10543960 | |||
| 1737 | Ga0207677_10002528 | |||
| 1738 | Ga0207677_10044505 | |||
| 1739 | Ga0207677_10054223 | |||
| 1740 | Ga0207677_10100519 | |||
| 1741 | Ga0207677_10125779 | |||
| 1742 | Ga0207677_10173022 | |||
| 1743 | Ga0207677_10279216 | |||
| 1744 | Ga0207703_10002545 | |||
| 1745 | Ga0207703_10003606 | |||
| 1746 | Ga0207703_10339693 | |||
| 1747 | Ga0207639_10002738 | |||
| 1748 | Ga0207639_10009982 | |||
| 1749 | Ga0207639_10065405 | |||
| 1750 | Ga0207639_10086953 | |||
| 1751 | Ga0207639_10608182 | |||
| 1752 | Ga0207678_10063575 | |||
| 1753 | Ga0207678_10170807 | |||
| 1754 | Ga0207708_10016926 | |||
| 1755 | Ga0207708_10077631 | |||
| 1756 | Ga0207708_10517588 | |||
| 1757 | Ga0207708_10527723 | |||
| 1758 | Ga0207641_10000184 | |||
| 1759 | Ga0207641_10003089 | |||
| 1760 | Ga0207641_10004182 | |||
| 1761 | Ga0207641_10046443 | |||
| 1762 | Ga0207641_10073835 | |||
| 1763 | Ga0207641_10311829 | |||
| 1764 | Ga0207641_10368053 | |||
| 1765 | Ga0207641_10519400 | |||
| 1766 | Ga0207648_10000488 | |||
| 1767 | Ga0207648_10006518 | |||
| 1768 | Ga0207648_10016043 | |||
| 1769 | Ga0207648_10024406 | |||
| 1770 | Ga0207648_10030559 | |||
| 1771 | Ga0207648_10034010 | |||
| 1772 | Ga0207648_10046889 | |||
| 1773 | Ga0207648_10079248 | |||
| 1774 | Ga0207648_10087305 | |||
| 1775 | Ga0207648_10830143 | |||
| 1776 | Ga0207676_10003388 | |||
| 1777 | Ga0207676_10011316 | |||
| 1778 | Ga0207676_10030308 | |||
| 1779 | Ga0207676_10049366 | |||
| 1780 | Ga0207676_10069682 | |||
| 1781 | Ga0207676_10436645 | |||
| 1782 | Ga0207676_10549461 | |||
| 1783 | Ga0207674_10008650 | |||
| 1784 | Ga0207674_10027729 | |||
| 1785 | Ga0207674_10036746 | |||
| 1786 | Ga0207674_10076348 | |||
| 1787 | Ga0207674_10105672 | |||
| 1788 | Ga0207674_10277979 | |||
| 1789 | Ga0207674_10456867 | |||
| 1790 | Ga0207674_10555679 | |||
| 1791 | Ga0207674_10901502 | |||
| 1792 | Ga0207675_100003643 | |||
| 1793 | Ga0207675_100007531 | |||
| 1794 | Ga0207675_100060176 | |||
| 1795 | Ga0207675_100063971 | |||
| 1796 | Ga0207675_100097749 | |||
| 1797 | Ga0207675_100238776 | |||
| 1798 | Ga0207675_100243594 | |||
| 1799 | Ga0207675_100330999 | |||
| 1800 | Ga0207675_100596880 | |||
| 1801 | Ga0207675_100607235 | |||
| 1802 | Ga0207683_10002620 | |||
| 1803 | Ga0207683_10026193 | |||
| 1804 | Ga0207683_10026625 | |||
| 1805 | Ga0207683_10047263 | |||
| 1806 | Ga0207683_10085974 | |||
| 1807 | Ga0207683_10093250 | |||
| 1808 | Ga0207683_10278135 | |||
| 1809 | Ga0207698_10097916 | |||
| 1810 | Ga0207698_10404643 | |||
| 1811 | Ga0207698_10422490 | |||
| 1812 | Ga0207698_10423485 | |||
| 1813 | Ga0207698_10762707 | |||
| 1814 | Ga0207698_10769692 | |||
| 1815 | Ga0207428_10013560 | |||
| 1816 | Ga0207428_10044663 | |||
| 1817 | Ga0268266_10003446 | |||
| 1818 | Ga0268266_10545767 | |||
| 1819 | Ga0268265_10019847 | |||
| 1820 | Ga0268265_10046626 | |||
| 1821 | Ga0268265_10095069 | |||
| 1822 | Ga0268265_10096767 | |||
| 1823 | Ga0268265_10266513 | |||
| 1824 | Ga0268265_10332197 | |||
| 1825 | Ga0268264_10002907 | |||
| 1826 | Ga0268264_10007740 | |||
| 1827 | Ga0268264_10012563 | |||
| 1828 | Ga0268264_10023693 | |||
| 1829 | Ga0268264_10025491 | |||
| 1830 | Ga0268264_10046502 | |||
| 1831 | Ga0268264_10068267 | |||
| 1832 | Ga0268264_10097640 | |||
| 1833 | Ga0268264_10113047 | |||
| 1834 | Ga0268264_10139237 | |||
| 1835 | Ga0268264_10171535 | |||
| 1836 | Ga0268264_10301685 | |||
| 1837 | Ga0268264_10491116 | |||
| 1838 | Ga0307515_10000455 | |||
| 1839 | Ga0316177_1064545 | |||
| 1840 | Ga0265327_10000013 | |||
| 1841 | Ga0265327_10000254 | |||
| 1842 | Ga0265327_10032002 | |||
| 1843 | Ga0265327_10062068 | |||
| 1844 | Ga0307513_10124861 | |||
| 1845 | Ga0307513_10463790 | |||
| 1846 | Ga0307509_10043969 | |||
| 1847 | Ga0307509_10535933 | |||
| 1848 | Ga0265313_10029162 | |||
| 1849 | Ga0307508_10000603 | |||
| 1850 | Ga0307406_10013998 | |||
| 1851 | Ga0307416_100157791 | |||
| 1852 | Ga0307416_100467654 | |||
| 1853 | Ga0307414_10150774 | |||
| 1854 | Ga0307414_10427274 | |||
| 1855 | Ga0307415_100129468 | |||
| 1856 | Ga0307415_100182501 | |||
| 1857 | Ga0373933_0013556 | |||
| 1858 | Ga0373933_0057220 | |||
| 1859 | Ga0373937_0000626 | |||
| 1860 | Ga0373937_0034742 | |||
| 1861 | Ga0373937_0154718 | |||
| 1862 | Ga0395899_0015685 | |||
| 1863 | Ga0395900_0047839 | |||
| 1864 | Ga0395900_0125735 | |||
| 1865 | Ga0395898_0015536 | |||
| 1866 | Ga0395901_0003272 | |||
| 1867 | Ga0436365_0298838 | |||
| 1868 | Ga0436365_1778757 | |||
| 1869 | Ga0436365_1889540 | |||
| 1870 | Ga0439436_0000413 | |||
| 1871 | Ga0451807_2402910 | |||
| 1872 | Ga0439441_014677 | |||
| 1873 | Ga0439449_0016026 | |||
| 1874 | Ga0439449_0017796 | |||
| 1875 | Ga0439457_003832 | |||
| 1876 | Ga0439457_014419 | |||
| 1877 | Ga0439462_0042841 | |||
| 1878 | Ga0450897_007222 | |||
| 1879 | Ga0450897_007938 | |||
| 1880 | Ga0450894_014063 | |||
| 1881 | Ga0450898_030723 | |||
| 1882 | Ga0450899_009011 | |||
| 1883 | Ga0439446_0024266 | |||
| 1884 | Ga0450893_0021987 | |||
| 1885 | Ga0451577_0020044 | |||
| 1886 | Ga0451577_0302370 | |||
| 1887 | Ga0451577_0538842 | |||
| 1888 | Ga0466969_0004123 | |||
| 1889 | Ga0466972_0000016 | |||
| 1890 | Ga0466972_0000104 | |||
| 1891 | Ga0466965_0189992 | |||
| 1892 | Ga0466966_0000193 | |||
| 1893 | Ga0466961_0211192 | |||
| 1894 | Ga0453684_0021387 | |||
| 1895 | Ga0453684_0038554 | |||
| 1896 | Ga0453684_0148150 | |||
| 1897 | Ga0453684_0734438 | |||
| 1898 | Ga0453684_0748184 | |||
| 1899 | Ga0466968_0010449 | |||
| 1900 | Ga0466970_0043550 | |||
| 1901 | Ga0466957_0001943 | |||
| 1902 | Ga0466957_0110513 | |||
| 1903 | Ga0466960_0054762 | |||
| 1904 | Ga0466959_0002486 | |||
| 1905 | Ga0451576_0133276 | |||
| 1906 | Ga0495592_0041592 | |||
| 1907 | Ga0495603_0170933 | |||
| 1908 | Ga0495638_0023753 | |||
| 1909 | Ga0495650_0029888 | |||
| 1910 | Ga0495618_0121311 | |||
| 1911 | Ga0495628_0032333 | |||
| 1912 | Ga0495630_0018495 | |||
| 1913 | Ga0495668_0000242 | |||
| 1914 | Ga0495668_0006585 | |||
| 1915 | Ga0495634_0131032 | |||
| 1916 | Ga0495635_0042972 | |||
| 1917 | Ga0495670_0010331 | |||
| 1918 | Ga0495674_0188469 | |||
| 1919 | Ga0495672_0005013 | |||
| 1920 | Ga0495672_0020050 | |||
| 1921 | Ga0495680_0128059 | |||
| 1922 | Ga0495684_0291467 | |||
| 1923 | Ga0495686_0011185 | |||
| 1924 | Ga0496100_0693337 | |||
| 1925 | Ga0496101_0224250 | |||
| 1926 | Ga0496104_0339198 | |||
| 1927 | Ga0496105_0207097 | |||
| 1928 | Ga0496109_0014633 | |||
| 1929 | Ga0496109_0288820 | |||
| 1930 | Ga0496110_0065694 | |||
| 1931 | Ga0496110_0231067 | |||
| 1932 | Ga0496112_0328164 | |||
| 1933 | Ga0501306_016337 | |||
| 1934 | Ga0501306_031780 | |||
| 1935 | Ga0501306_033411 | |||
| 1936 | Ga0501308_001539 | |||
| 1937 | Ga0501308_012590 | |||
| 1938 | Ga0501305_030069 | |||
| 1939 | Ga0501290_002235 | |||
| 1940 | Ga0501292_000995 | |||
| 1941 | Ga0501298_000530 | |||
| 1942 | Ga0501299_001303 | |||
| 1943 | Ga0501303_015565 | |||
| 1944 | Ga0501312_002971 | |||
| 1945 | Ga0501312_024910 | |||
| 1946 | Ga0501312_036890 | |||
| 1947 | Ga0501314_009319 | |||
| 1948 | Ga0501316_024174 | |||
| 1949 | Ga0501324_016328 | |||
| 1950 | Ga0501337_006885 | |||
| 1951 | Ga0501031_0328658 | |||
| 1952 | Ga0501031_0363715 | |||
| 1953 | Ga0501032_0004313 | |||
| 1954 | Ga0501032_0045286 | |||
| 1955 | Ga0501032_0098945 | |||
| 1956 | Ga0501032_0201334 | |||
| 1957 | Ga0501033_0006858 | |||
| 1958 | Ga0501033_0094311 | |||
| 1959 | Ga0501033_0214437 | |||
| 1960 | Ga0501034_0000002 | |||
| 1961 | Ga0501034_0008447 | |||
| 1962 | Ga0501034_0012890 | |||
| 1963 | Ga0501034_0022986 | |||
| 1964 | Ga0501034_0031289 | |||
| 1965 | Ga0501034_0039862 | |||
| 1966 | Ga0501034_0097671 | |||
| 1967 | Ga0501034_0098127 | |||
| 1968 | Ga0501034_0106927 | |||
| 1969 | Ga0501036_0041557 | |||
| 1970 | Ga0501037_0020352 | |||
| 1971 | Ga0501037_0036949 | |||
| 1972 | Ga0501037_0042976 | |||
| 1973 | Ga0501037_0175444 | |||
| 1974 | Ga0501038_0005400 | |||
| 1975 | Ga0501038_0039893 | |||
| 1976 | Ga0501038_0062216 | |||
| 1977 | Ga0501038_0100211 | |||
| 1978 | Ga0501038_0478766 | |||
| 1979 | Ga0501039_0008583 | |||
| 1980 | Ga0501039_0039599 | |||
| 1981 | Ga0501043_0004656 | |||
| 1982 | Ga0501043_0013445 | |||
| 1983 | Ga0501043_0059217 | |||
| 1984 | Ga0501043_0160558 | |||
| 1985 | Ga0501046_0003336 | |||
| 1986 | Ga0501046_0026201 | |||
| 1987 | Ga0501047_0002513 | |||
| 1988 | Ga0501047_0088741 | |||
| 1989 | Ga0501047_0160319 | |||
| 1990 | Ga0501047_0167032 | |||
| 1991 | Ga0501047_0199458 | |||
| 1992 | Ga0501048_0390018 | |||
| 1993 | Ga0501069_0080213 | |||
| 1994 | Ga0501070_0006730 | |||
| 1995 | Ga0501070_0103596 | |||
| 1996 | Ga0501070_0396254 | |||
| 1997 | Ga0501072_0013863 | |||
| 1998 | Ga0501072_0526879 | |||
| 1999 | Ga0501073_0001665 | |||
| 2000 | Ga0501073_0093194 | |||
| 2001 | Ga0501074_0102143 | |||
| 2002 | Ga0501198_000711 | |||
| 2003 | Ga0501198_011403 | |||
| 2004 | Ga0501201_000337 | |||
| 2005 | Ga0501202_005557 | |||
| 2006 | Ga0501206_007100 | |||
| 2007 | Ga0501207_001019 | |||
| 2008 | Ga0501216_001931 | |||
| 2009 | Ga0501217_000623 | |||
| 2010 | Ga0501217_008287 | |||
| 2011 | Ga0501222_009960 | |||
| 2012 | Ga0501223_000612 | |||
| 2013 | Ga0501227_013552 | |||
| 2014 | Ga0501228_005443 | |||
| 2015 | Ga0501233_036779 | |||
| 2016 | Ga0501235_001816 | |||
| 2017 | Ga0501235_023363 | |||
| 2018 | Ga0501236_008339 | |||
| 2019 | Ga0501240_000563 | |||
| 2020 | Ga0501242_002993 | |||
| 2021 | Ga0501242_009611 | |||
| 2022 | Ga0501243_000175 | |||
| 2023 | Ga0501251_001086 | |||
| 2024 | Ga0501252_000056 | |||
| 2025 | Ga0501253_004251 | |||
| 2026 | Ga0501257_030121 | |||
| 2027 | Ga0501259_000471 | |||
| 2028 | Ga0501259_004572 | |||
| 2029 | Ga0501261_000479 | |||
| 2030 | Ga0501219_000944 | |||
| 2031 | Ga0501221_000519 | |||
| 2032 | Ga0501225_0001014 | |||
| 2033 | Ga0501225_0002100 | |||
| 2034 | Ga0501225_0111651 | |||
| 2035 | Ga0501234_000632 | |||
| 2036 | Ga0501234_007549 | |||
| 2037 | Ga0501245_010223 | |||
| 2038 | Ga0501079_0064510 | |||
| 2039 | Ga0501079_0191309 | |||
| 2040 | Ga0501080_0077292 | |||
| 2041 | Ga0501080_0314414 | |||
| 2042 | Ga0501083_0086403 | |||
| 2043 | Ga0501083_0148600 | |||
| 2044 | Ga0501241_018032 | |||
| 2045 | Ga0501264_004095 | |||
| 2046 | Ga0501266_013482 | |||
| 2047 | Ga0501267_002942 | |||
| 2048 | Ga0501268_006384 | |||
| 2049 | Ga0501279_009957 | |||
| 2050 | Ga0501282_005688 | |||
| 2051 | Ga0501035_0001789 | |||
| 2052 | Ga0501035_0019698 | |||
| 2053 | Ga0501035_0065820 | |||
| 2054 | Ga0501035_0075123 | |||
| 2055 | Ga0501035_0531458 | |||
| 2056 | Ga0501044_0004121 | |||
| 2057 | Ga0501044_0012046 | |||
| 2058 | Ga0501044_0026210 | |||
| 2059 | Ga0501044_0039575 | |||
| 2060 | Ga0501044_0273289 | |||
| 2061 | Ga0501044_0369310 | |||
| 2062 | Ga0501204_004697 | |||
| 2063 | Ga0501212_004479 | |||
| 2064 | Ga0501284_00006 | |||
| 2065 | nmdc:mga0k408_101998_c1 | |||
| 2066 | nmdc:mga0k408_105792_c1 | |||
| 2067 | nmdc:mga0k408_176430_c1 | |||
| 2068 | nmdc:mga0k408_18195_c1 | |||
| 2069 | nmdc:mga0k408_3671_c2 | |||
| 2070 | nmdc:mga0k408_54565_c2 | |||
| 2071 | nmdc:mga05p37_48940_c1 | |||
| 2072 | nmdc:mga05p37_53739_c1 | |||
| 2073 | nmdc:mga0qj67_84982_c1 | |||
| 2074 | nmdc:mga06r32_131083_c1 | |||
| 2075 | nmdc:mga06r32_23249_c1 | |||
| 2076 | nmdc:mga08y16_39378_c1 | |||
| 2077 | nmdc:mga08y16_423395_c1 | |||
| 2078 | nmdc:mga08y16_470754_c1 | |||
| 2079 | nmdc:mga08y16_820311_c1 | |||
| 2080 | nmdc:mga08y16_880207_c1 | |||
| 2081 | Ga0495619_0044008 | |||
| 2082 | Ga0500578_0011031 | |||
| 2083 | Ga0500583_0000009 | |||
| 2084 | Ga0500583_0000258 | |||
| 2085 | Ga0500651_0000232 | |||
| 2086 | Ga0500641_0091345 | |||
| 2087 | Ga0500555_024159 | |||
| 2088 | Ga0500642_0043895 | |||
| 2089 | Ga0500642_0135173 | |||
| 2090 | Ga0500652_018206 | |||
| 2091 | Ga0500652_086308 | |||
| 2092 | Ga0500559_0024426 | |||
| 2093 | Ga0500568_0000895 | |||
| 2094 | Ga0500589_001419 | |||
| 2095 | Ga0500604_0010575 | |||
| 2096 | Ga0500616_0176839 | |||
| 2097 | Ga0500622_0000615 | |||
| 2098 | Ga0500622_0058994 | |||
| 2099 | Ga0500639_037414 | |||
| 2100 | Ga0500611_000005 | |||
| 2101 | Ga0500645_034780 | |||
| 2102 | Ga0501084_0018691 | |||
| 2103 | Ga0501084_0183587 | |||
| 2104 | Ga0500661_001332 | |||
| 2105 | Ga0587068_011416 | |||
| 2106 | Ga0501082_0070209 | |||
| 2107 | 2738725990 | |||
| 2108 | 2819590467 | |||
| 2109 | 2914759804 | |||
| 2110 | 2929158632 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy