F489167

General Info

Members Datasets Scaffolds Average Seq Length
1055 662 2110 279

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2871435913|2871441915
Length 336
Sequence PRKDILKKFRGMIDKGVPIVGGGAGTGLSAKAEEAGGIDLIIIYNSGRYRMAGRGSAAGLLAYGNANEIVKEMAYEVLPVVRHTPVLAGVNGTDPFVIMPLLLAELKTMGFSGVQNFPTIGLFDGSMRQSFEETGMGFGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVDMIAEAHKLDLLTTPYVFNPDEARAMTKAGADIVVAHMGVTTGGSIGATSAKSLDDCVVEIDAIANAARSVRKDVILLCHGGPISMPDDARYILSHAKGLHGFYGASSMERLPAEAAIARQTADFKSVTLGGQK

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
94 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
112 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
113 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
205 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
283 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
323 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
324 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
325 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
329 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
330 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
335 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
336 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
337 2506520008 Serratia plymuthica AS12 Isolate Unclassified
338 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
339 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
340 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
341 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
342 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
343 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
344 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
345 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
346 2512875024
347 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
348 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
349 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
350 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
351 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
352 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
353 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
354 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
355 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
356 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
357 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
358 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
359 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
360 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
361 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
362 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
363 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
364 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
365 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
366 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
367 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
368 2643221629 Devosia sp. Root105 Isolate Unclassified
369 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
370 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
371 2643221662 Devosia sp. Root413D1 Isolate Unclassified
372 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
373 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
374 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
375 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
376 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
377 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
378 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
379 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
380 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
381 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
382 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
383 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
384 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
385 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
386 2791355260 Rhizobium sp. L9 Isolate Nodule
387 2791355265 Rhizobium sp. H4 Isolate Nodule
388 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
389 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
390 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
391 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
392 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
393 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
394 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
395 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
396 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
397 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
398 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
399 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
400 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
401 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
402 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
403 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
404 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
405 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
406 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
407 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
408 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
409 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
410 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
411 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
412 2851182111 Bosea sp. Tri-44 Isolate Nodule
413 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
414 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
415 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
416 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
417 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
418 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
419 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
420 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
421 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
422 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
423 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
424 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
425 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
426 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
427 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
428 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
429 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
430 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
431 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
432 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
433 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
434 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
435 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
436 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
437 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
438 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
439 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
440 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
441 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
442 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
443 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
444 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
445 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
446 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
447 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
448 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
449 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
450 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
451 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
452 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
453 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
454 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
455 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
456 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
457 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
458 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
459 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
460 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
461 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
462 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
463 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
464 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
465 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
466 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
467 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
468 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
469 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
470 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
471 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
472 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
473 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
474 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
475 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
476 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
477 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
478 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
479 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
480 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
481 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
482 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
483 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
484 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
485 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
486 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
487 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
488 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
489 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
490 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
491 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
492 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
493 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
494 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
495 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
496 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
497 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
498 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
499 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
500 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
501 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
502 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
503 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
504 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
505 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
506 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
507 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
508 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
509 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
510 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
511 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
512 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
513 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
514 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
515 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
516 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
517 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
518 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
519 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
520 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
521 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
522 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
523 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
524 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
525 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
526 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
527 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
528 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
529 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
530 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
531 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
532 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
533 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
534 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
535 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
536 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
537 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
538 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
539 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
540 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
541 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
542 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
543 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
544 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
545 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
546 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
547 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
548 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
549 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
550 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
551 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
552 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
553 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
554 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
555 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
556 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
557 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
558 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
559 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
560 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
561 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
562 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
563 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
564 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
565 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
566 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
567 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
568 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
569 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
570 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
571 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
572 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
573 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
574 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
575 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
576 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
577 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
578 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
579 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
580 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
581 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
582 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
583 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
584 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
585 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
586 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
587 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
588 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
589 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
590 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
591 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
592 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
593 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
594 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
595 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
596 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
597 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
598 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
599 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
600 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
601 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
602 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
603 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
604 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
605 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
606 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
607 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
608 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
609 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
610 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
611 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
612 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
613 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
614 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
615 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
616 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
617 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
618 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
619 2996893221 Rhizobium sp. R635 Isolate Nodule
620 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
621 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
622 3004167301 Mesorhizobium loti 582 Isolate Unclassified
623 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
624 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
625 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
626 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
627 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
628 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
629 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
630 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
631 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
632 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
633 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
634 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
635 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
636 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
637 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
638 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
639 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
640 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
641 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
642 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
643 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
644 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
645 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
646 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
647 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
648 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
649 8005382845 Rhizobium sp. R634 Isolate Nodule
650 8005395548 Rhizobium sp. R339 Isolate Nodule
651 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
652 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
653 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
654 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
655 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
656 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
657 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
658 8024501048 Rhizobium sp. H4 Isolate Nodule
659 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
660 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
661 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
662 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.25
Metatranscriptomes 0
Isolates 31.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.69
Nodule 26.45
Rhizoplane 1.52
Rhizosphere 59.05
Stem 0
Stem Tuber 0.38
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10022936 3300001989 Bacteria 2211
2 JGI25159J45721_1000461 3300002987 Bacteria 18823
3 JGI25165J46597_1000034 3300003214 Bacteria 292458
4 rootH2_10130272 3300003320 Bacteria 1771
5 JGI25160J50197_1000248 3300003354 Bacteria 41777
6 JGI25160J50197_1002309 3300003354 Bacteria 8942
7 JGI25161J50226_1000183 3300003374 Bacteria 41777
8 Ga0055542_1001063 3300003762 Bacteria 16922
9 Ga0055529_1003010 3300003763 Bacteria 2960
10 Ga0055524_1000850 3300003775 Bacteria 20030
11 Ga0055528_1001807 3300003790 Bacteria 12257
12 Ga0055543_1000245 3300004625 Bacteria 41815
13 Ga0065165_1001012 3300005262 Bacteria 34230
14 Ga0070658_10147445 3300005327 Bacteria 1968
15 Ga0070658_10290359 3300005327 Bacteria 1393
16 Ga0070658_10332977 3300005327 Bacteria 1298
17 Ga0070676_10068798 3300005328 Bacteria 2120
18 Ga0070683_100200023 3300005329 Bacteria 1897
19 Ga0070690_100001510 3300005330 Bacteria 12195
20 Ga0070690_100148394 3300005330 Bacteria 1598
21 Ga0068869_100001072 3300005334 Bacteria 15972
22 Ga0068869_100091578 3300005334 Bacteria 2287
23 Ga0068869_100173041 3300005334 Bacteria 1688
24 Ga0068869_100287153 3300005334 Bacteria 1324
25 Ga0070666_10007488 3300005335 Bacteria 6729
26 Ga0068868_100058831 3300005338 Bacteria 3038
27 Ga0068868_100152931 3300005338 Bacteria 1901
28 Ga0068868_100211375 3300005338 Bacteria 1621
29 Ga0068868_100462246 3300005338 Bacteria 1105
30 Ga0068868_100484783 3300005338 Bacteria 1081
31 Ga0070660_100235649 3300005339 Bacteria 1490
32 Ga0070660_100332888 3300005339 Bacteria 1249
33 Ga0070689_100011792 3300005340 Bacteria 6271
34 Ga0070689_100165543 3300005340 Bacteria 1789
35 Ga0070661_100001089 3300005344 Bacteria 19198
36 Ga0070661_100077522 3300005344 Bacteria 2450
37 Ga0070661_100093694 3300005344 Bacteria 2225
38 Ga0070661_100183246 3300005344 Bacteria 1594
39 Ga0070692_10101388 3300005345 Bacteria 1578
40 Ga0070668_100105638 3300005347 Bacteria 2236
41 Ga0070668_100337545 3300005347 Bacteria 1272
42 Ga0070669_100030183 3300005353 Bacteria 3910
43 Ga0070669_100077937 3300005353 Bacteria 2463
44 Ga0070669_100099619 3300005353 Bacteria 2190
45 Ga0070675_100002305 3300005354 Bacteria 14175
46 Ga0070671_100086319 3300005355 Bacteria 2625
47 Ga0070671_100180420 3300005355 Bacteria 1787
48 Ga0070674_100017239 3300005356 Bacteria 4539
49 Ga0070674_100024016 3300005356 Bacteria 3954
50 Ga0070673_100164516 3300005364 Bacteria 1889
51 Ga0070659_100069612 3300005366 Bacteria 2793
52 Ga0070659_100083833 3300005366 Bacteria 2548
53 Ga0070667_100001504 3300005367 Bacteria 20851
54 Ga0070667_100047622 3300005367 Bacteria 3607
55 Ga0070667_100133328 3300005367 Bacteria 2170
56 Ga0070667_100163109 3300005367 Bacteria 1964
57 Ga0070667_100342299 3300005367 Bacteria 1353
58 Ga0070701_10021078 3300005438 Bacteria 3104
59 Ga0070705_100054268 3300005440 Bacteria 2350
60 Ga0070700_100102045 3300005441 Bacteria 1892
61 Ga0070694_100277084 3300005444 Bacteria 1277
62 Ga0070663_100120191 3300005455 Bacteria 1983
63 Ga0070678_100044742 3300005456 Bacteria 3163
64 Ga0070678_100103935 3300005456 Bacteria 2208
65 Ga0070678_100108089 3300005456 Bacteria 2171
66 Ga0070678_100401568 3300005456 Bacteria 1191
67 Ga0070662_100007515 3300005457 Bacteria 7069
68 Ga0070662_100023880 3300005457 Bacteria 4206
69 Ga0070681_10024387 3300005458 Bacteria 6088
70 Ga0068867_100015891 3300005459 Bacteria 5343
71 Ga0068867_100020391 3300005459 Bacteria 4723
72 Ga0068867_100165982 3300005459 Bacteria 1745
73 Ga0070685_10209442 3300005466 Bacteria 1272
74 Ga0070679_100225219 3300005530 Bacteria 1835
75 Ga0070684_100109601 3300005535 Bacteria 2474
76 Ga0068853_100006106 3300005539 Bacteria 9539
77 Ga0068853_100009175 3300005539 Bacteria 7968
78 Ga0068853_100027399 3300005539 Bacteria 4787
79 Ga0068853_100074345 3300005539 Bacteria 2965
80 Ga0070672_100067901 3300005543 Bacteria 2826
81 Ga0070672_100097962 3300005543 Bacteria 2374
82 Ga0070686_100012181 3300005544 Bacteria 4892
83 Ga0070686_100080814 3300005544 Bacteria 2151
84 Ga0070695_100366935 3300005545 Bacteria 1083
85 Ga0070665_100023505 3300005548 Bacteria 6205
86 Ga0070665_100031128 3300005548 Bacteria 5370
87 Ga0070665_100032562 3300005548 Bacteria 5246
88 Ga0070665_100063348 3300005548 Bacteria 3707
89 Ga0070665_100099653 3300005548 Bacteria 2910
90 Ga0070665_100197127 3300005548 Bacteria 2014
91 Ga0070665_100237090 3300005548 Bacteria 1825
92 Ga0070665_100477974 3300005548 Bacteria 1257
93 Ga0070664_100065451 3300005564 Bacteria 3101
94 Ga0070664_100528939 3300005564 Bacteria 1089
95 Ga0068857_100031257 3300005577 Bacteria 4704
96 Ga0068857_100032013 3300005577 Bacteria 4648
97 Ga0068854_100049679 3300005578 Bacteria 2997
98 Ga0068854_100152807 3300005578 Bacteria 1781
99 Ga0068854_100193943 3300005578 Bacteria 1593
100 Ga0068856_100034379 3300005614 Bacteria 4964
101 Ga0068856_100034534 3300005614 Bacteria 4953
102 Ga0068856_100198757 3300005614 Bacteria 2019
103 Ga0068852_100007354 3300005616 Bacteria 8035
104 Ga0068852_100205312 3300005616 Bacteria 1866
105 Ga0068852_100349477 3300005616 Bacteria 1443
106 Ga0068852_100505746 3300005616 Bacteria 1204
107 Ga0068859_100006383 3300005617 Bacteria 11961
108 Ga0068859_100028370 3300005617 Bacteria 5611
109 Ga0068859_100032249 3300005617 Bacteria 5262
110 Ga0068859_100041599 3300005617 Bacteria 4616
111 Ga0068859_100204119 3300005617 Bacteria 2061
112 Ga0068864_100028037 3300005618 Bacteria 4758
113 Ga0068864_100036087 3300005618 Bacteria 4212
114 Ga0068864_100048815 3300005618 Bacteria 3639
115 Ga0068864_100061768 3300005618 Bacteria 3245
116 Ga0068864_100125087 3300005618 Bacteria 2303
117 Ga0068866_10011237 3300005718 Bacteria 3866
118 Ga0068866_10075384 3300005718 Bacteria 1796
119 Ga0068861_100002678 3300005719 Bacteria 11666
120 Ga0068861_100018125 3300005719 Bacteria 5008
121 Ga0068851_10000365 3300005834 Bacteria 20408
122 Ga0068870_10124723 3300005840 Bacteria 1488
123 Ga0068863_100006580 3300005841 Bacteria 11405
124 Ga0068863_100080476 3300005841 Bacteria 3085
125 Ga0068863_100096878 3300005841 Bacteria 2801
126 Ga0068858_100004441 3300005842 Bacteria 13757
127 Ga0068858_100028194 3300005842 Bacteria 5217
128 Ga0068858_100035188 3300005842 Bacteria 4645
129 Ga0068858_100231277 3300005842 Bacteria 1753
130 Ga0068858_100478235 3300005842 Bacteria 1202
131 Ga0068860_100004331 3300005843 Bacteria 14508
132 Ga0068860_100022924 3300005843 Bacteria 6037
133 Ga0068862_100033418 3300005844 Bacteria 4348
134 Ga0068862_100043996 3300005844 Bacteria 3808
135 Ga0068862_100064488 3300005844 Bacteria 3153
136 Ga0068862_100121394 3300005844 Bacteria 2304
137 Ga0068862_100375484 3300005844 Bacteria 1325
138 Ga0081455_10080898 3300005937 Bacteria 2662
139 Ga0081455_10146886 3300005937 Bacteria 1823
140 Ga0081538_10004363 3300005981 Bacteria 13069
141 Ga0081540_1096763 3300005983 Bacteria 1283
142 Ga0081539_10002732 3300005985 Bacteria 23848
143 Ga0081539_10005538 3300005985 Bacteria 12799
144 Ga0081539_10006723 3300005985 Bacteria 10828
145 Ga0075365_10002114 3300006038 Bacteria 9514
146 Ga0075365_10044625 3300006038 Bacteria 2906
147 Ga0075365_10145851 3300006038 Bacteria 1644
148 Ga0075365_10271373 3300006038 Bacteria 1193
149 Ga0075368_10028307 3300006042 Bacteria 2165
150 Ga0075368_10062340 3300006042 Bacteria 1495
151 Ga0075368_10125673 3300006042 Bacteria 1064
152 Ga0075363_100163877 3300006048 Bacteria 1260
153 Ga0075362_10048050 3300006177 Bacteria 1903
154 Ga0075367_10111633 3300006178 Bacteria 1678
155 Ga0075367_10122285 3300006178 Bacteria 1604
156 Ga0075367_10125863 3300006178 Bacteria 1582
157 Ga0075369_10131423 3300006186 Bacteria 1138
158 Ga0097621_100028453 3300006237 Bacteria 4404
159 Ga0097621_100035235 3300006237 Bacteria 3998
160 Ga0097621_100040781 3300006237 Bacteria 3734
161 Ga0097621_100048996 3300006237 Bacteria 3430
162 Ga0075370_10002495 3300006353 Bacteria 8542
163 Ga0075370_10022024 3300006353 Bacteria 3495
164 Ga0075370_10181913 3300006353 Bacteria 1237
165 Ga0068871_100002664 3300006358 Bacteria 12194
166 Ga0068871_100042592 3300006358 Bacteria 3645
167 Ga0068871_100114905 3300006358 Bacteria 2268
168 Ga0068871_100373297 3300006358 Bacteria 1265
169 Ga0068865_100687602 3300006881 Bacteria 873
170 Ga0097620_100006383 3300006931 Bacteria 11961
171 Ga0097620_100028370 3300006931 Bacteria 5611
172 Ga0097620_100032249 3300006931 Bacteria 5262
173 Ga0097620_100041599 3300006931 Bacteria 4616
174 Ga0097620_100204114 3300006931 Bacteria 2061
175 Ga0099794_10058192 3300007265 Bacteria 1873
176 Ga0105251_10023093 3300009011 Bacteria 3217
177 Ga0105244_10000008 3300009036 Bacteria 302297
178 Ga0105244_10044571 3300009036 Bacteria 2285
179 Ga0105240_10033261 3300009093 Bacteria 6665
180 Ga0105240_10066593 3300009093 Bacteria 4467
181 Ga0105240_10356120 3300009093 Bacteria 1659
182 Ga0105240_10398424 3300009093 Bacteria 1551
183 Ga0105240_10679558 3300009093 Bacteria 1126
184 Ga0105245_10036163 3300009098 Bacteria 4386
185 Ga0105245_10138735 3300009098 Bacteria 2288
186 Ga0105245_10225969 3300009098 Bacteria 1808
187 Ga0105245_10319392 3300009098 Bacteria 1529
188 Ga0105245_10458339 3300009098 Bacteria 1285
189 Ga0105247_10008662 3300009101 Bacteria 6199
190 Ga0114129_10414989 3300009147 Bacteria 1772
191 Ga0114129_10454489 3300009147 Bacteria 1679
192 Ga0114129_10773577 3300009147 Bacteria 1227
193 Ga0105243_10091923 3300009148 Bacteria 2500
194 Ga0105243_10361206 3300009148 Bacteria 1337
195 Ga0105241_10036083 3300009174 Bacteria 3720
196 Ga0105241_10157185 3300009174 Bacteria 1865
197 Ga0105242_10208879 3300009176 Bacteria 1738
198 Ga0105248_10041378 3300009177 Bacteria 5166
199 Ga0105248_10061180 3300009177 Bacteria 4227
200 Ga0105248_10088563 3300009177 Bacteria 3484
201 Ga0105248_10364460 3300009177 Bacteria 1627
202 Ga0105248_10447472 3300009177 Bacteria 1455
203 Ga0105248_10689781 3300009177 Bacteria 1152
204 Ga0105237_10000397 3300009545 Bacteria 61927
205 Ga0105237_10009247 3300009545 Bacteria 10567
206 Ga0105237_10019781 3300009545 Bacteria 6951
207 Ga0105237_10054607 3300009545 Bacteria 4003
208 Ga0105238_10001007 3300009551 Bacteria 28742
209 Ga0105238_10038235 3300009551 Bacteria 4874
210 Ga0105238_10105265 3300009551 Bacteria 2803
211 Ga0105238_10158573 3300009551 Bacteria 2238
212 Ga0105238_10314728 3300009551 Bacteria 1551
213 Ga0105238_10405995 3300009551 Bacteria 1356
214 Ga0105249_10028900 3300009553 Bacteria 5004
215 Ga0105249_10161350 3300009553 Bacteria 2167
216 Ga0105249_10388482 3300009553 Bacteria 1423
217 Ga0123341_1000002 3300009765 Bacteria 191257
218 Ga0123342_1030249 3300009766 Bacteria 2736
219 Ga0105239_10014766 3300010375 Bacteria 8662
220 Ga0105239_10050615 3300010375 Bacteria 4556
221 Ga0105239_10161991 3300010375 Bacteria 2500
222 Ga0105239_10572027 3300010375 Bacteria 1288
223 Ga0157373_10107585 3300013100 Bacteria 1960
224 Ga0157370_10009932 3300013104 Bacteria 10080
225 Ga0157370_10075580 3300013104 Bacteria 3175
226 Ga0157369_10082358 3300013105 Bacteria 3443
227 Ga0157369_10188646 3300013105 Bacteria 2167
228 Ga0157374_10025942 3300013296 Bacteria 5268
229 Ga0157374_10033943 3300013296 Bacteria 4658
230 Ga0157374_10167215 3300013296 Bacteria 2144
231 Ga0157378_10045061 3300013297 Bacteria 3918
232 Ga0157378_10136529 3300013297 Bacteria 2274
233 Ga0163162_10024703 3300013306 Bacteria 5935
234 Ga0163162_10045548 3300013306 Bacteria 4395
235 Ga0163162_10057983 3300013306 Bacteria 3900
236 Ga0163162_10423131 3300013306 Bacteria 1464
237 Ga0163162_10739421 3300013306 Bacteria 1103
238 Ga0157372_10011373 3300013307 Bacteria 9468
239 Ga0157372_10708737 3300013307 Bacteria 1171
240 Ga0157375_10008005 3300013308 Bacteria 9255
241 Ga0157375_10023236 3300013308 Bacteria 5717
242 Ga0157375_10356582 3300013308 Bacteria 1628
243 Ga0163163_10261173 3300014325 Bacteria 1783
244 Ga0157380_10014846 3300014326 Bacteria 5706
245 Ga0157380_10069262 3300014326 Bacteria 2846
246 Ga0157380_10240615 3300014326 Bacteria 1631
247 Ga0157380_10359558 3300014326 Bacteria 1365
248 Ga0182008_10036580 3300014497 Bacteria 2456
249 Ga0157377_10040065 3300014745 Bacteria 2593
250 Ga0157379_10032980 3300014968 Bacteria 4618
251 Ga0157379_10048368 3300014968 Bacteria 3796
252 Ga0157379_10079481 3300014968 Bacteria 2936
253 Ga0157379_10110685 3300014968 Bacteria 2466
254 Ga0157379_10146008 3300014968 Bacteria 2133
255 Ga0157379_10172661 3300014968 Bacteria 1951
256 Ga0157379_10188227 3300014968 Bacteria 1865
257 Ga0157376_10017989 3300014969 Bacteria 5407
258 Ga0157376_10300346 3300014969 Bacteria 1520
259 Ga0157376_10415360 3300014969 Bacteria 1304
260 Ga0163161_10000375 3300017792 Bacteria 37352
261 Ga0163161_10015393 3300017792 Bacteria 5332
262 Ga0163161_10046661 3300017792 Bacteria 3126
263 Ga0163161_10473372 3300017792 Bacteria 1016
264 Ga0214544_1000010 3300021320 Bacteria 270164
265 Ga0214542_1000023 3300021321 Bacteria 191557
266 Ga0214543_1000019 3300021327 Bacteria 267908
267 Ga0214543_1000132 3300021327 Bacteria 102506
268 Ga0213872_10025047 3300021361 Bacteria 2744
269 Ga0213872_10065659 3300021361 Bacteria 1638
270 Ga0213876_10007178 3300021384 Bacteria 6072
271 Ga0209026_1000100 3300025250 Bacteria 156131
272 Ga0209148_1000069 3300025254 Bacteria 334444
273 Ga0209148_1003960 3300025254 Bacteria 3806
274 Ga0209759_1000549 3300025256 Bacteria 38630
275 Ga0209233_1000028 3300025261 Bacteria 642062
276 Ga0209455_1000135 3300025272 Bacteria 148007
277 Ga0209130_1000098 3300025284 Bacteria 142506
278 Ga0207426_1000069 3300025302 Bacteria 334513
279 Ga0207656_10033061 3300025321 Bacteria 2152
280 Ga0207656_10093293 3300025321 Bacteria 1369
281 Ga0207655_1000083 3300025728 Bacteria 213295
282 Ga0207642_10003301 3300025899 Bacteria 5072
283 Ga0207642_10017892 3300025899 Bacteria 2707
284 Ga0207642_10079957 3300025899 Bacteria 1584
285 Ga0207642_10306952 3300025899 Bacteria 922
286 Ga0207710_10020079 3300025900 Bacteria 2854
287 Ga0207688_10048621 3300025901 Bacteria 2370
288 Ga0207680_10008233 3300025903 Bacteria 5111
289 Ga0207680_10037305 3300025903 Bacteria 2805
290 Ga0207645_10014615 3300025907 Bacteria 5247
291 Ga0207645_10063671 3300025907 Bacteria 2356
292 Ga0207645_10080212 3300025907 Bacteria 2092
293 Ga0207645_10111210 3300025907 Bacteria 1773
294 Ga0207645_10150484 3300025907 Bacteria 1519
295 Ga0207643_10037483 3300025908 Bacteria 2721
296 Ga0207705_10193299 3300025909 Bacteria 1540
297 Ga0207707_10013657 3300025912 Bacteria 7081
298 Ga0207695_10038212 3300025913 Bacteria 5171
299 Ga0207695_10076226 3300025913 Bacteria 3410
300 Ga0207695_10096031 3300025913 Bacteria 2966
301 Ga0207695_10253863 3300025913 Bacteria 1657
302 Ga0207671_10001048 3300025914 Bacteria 33586
303 Ga0207671_10011147 3300025914 Bacteria 7344
304 Ga0207671_10048066 3300025914 Bacteria 3158
305 Ga0207671_10107859 3300025914 Bacteria 2116
306 Ga0207671_10206365 3300025914 Bacteria 1536
307 Ga0207660_10152323 3300025917 Bacteria 1777
308 Ga0207662_10091224 3300025918 Bacteria 1874
309 Ga0207657_10126788 3300025919 Bacteria 2096
310 Ga0207649_10016189 3300025920 Bacteria 4200
311 Ga0207649_10046174 3300025920 Bacteria 2674
312 Ga0207649_10092468 3300025920 Bacteria 1983
313 Ga0207652_10209720 3300025921 Bacteria 1754
314 Ga0207681_10002332 3300025923 Bacteria 12077
315 Ga0207681_10153866 3300025923 Bacteria 1726
316 Ga0207694_10000939 3300025924 Bacteria 25682
317 Ga0207694_10024125 3300025924 Bacteria 4618
318 Ga0207694_10041236 3300025924 Bacteria 3556
319 Ga0207650_10003921 3300025925 Bacteria 10179
320 Ga0207650_10329831 3300025925 Bacteria 1251
321 Ga0207659_10002102 3300025926 Bacteria 11796
322 Ga0207659_10004947 3300025926 Bacteria 8080
323 Ga0207659_10112987 3300025926 Bacteria 2068
324 Ga0207644_10000391 3300025931 Bacteria 28488
325 Ga0207644_10148455 3300025931 Bacteria 1812
326 Ga0207706_10012440 3300025933 Bacteria 7753
327 Ga0207706_10117616 3300025933 Bacteria 2338
328 Ga0207686_10061306 3300025934 Bacteria 2384
329 Ga0207686_10129417 3300025934 Bacteria 1729
330 Ga0207709_10040090 3300025935 Bacteria 2802
331 Ga0207709_10331959 3300025935 Bacteria 1142
332 Ga0207670_10363940 3300025936 Bacteria 1148
333 Ga0207669_10230800 3300025937 Bacteria 1365
334 Ga0207704_10002411 3300025938 Bacteria 8409
335 Ga0207704_10003969 3300025938 Bacteria 6732
336 Ga0207704_10156931 3300025938 Bacteria 1614
337 Ga0207704_10253923 3300025938 Bacteria 1322
338 Ga0207691_10106812 3300025940 Bacteria 2493
339 Ga0207691_10416751 3300025940 Bacteria 1145
340 Ga0207711_10075706 3300025941 Bacteria 2930
341 Ga0207711_10135078 3300025941 Bacteria 2215
342 Ga0207711_10259726 3300025941 Bacteria 1596
343 Ga0207711_10293817 3300025941 Bacteria 1498
344 Ga0207689_10001138 3300025942 Bacteria 25663
345 Ga0207689_10001210 3300025942 Bacteria 24834
346 Ga0207689_10025123 3300025942 Bacteria 4993
347 Ga0207689_10046936 3300025942 Bacteria 3568
348 Ga0207689_10068759 3300025942 Bacteria 2910
349 Ga0207679_10115679 3300025945 Bacteria 2125
350 Ga0207679_10406468 3300025945 Bacteria 1199
351 Ga0207667_10070326 3300025949 Bacteria 3642
352 Ga0207667_10168889 3300025949 Bacteria 2248
353 Ga0207667_10703046 3300025949 Bacteria 1013
354 Ga0207712_10014157 3300025961 Bacteria 5121
355 Ga0207712_10149895 3300025961 Bacteria 1800
356 Ga0207668_10081767 3300025972 Bacteria 2344
357 Ga0207658_10014043 3300025986 Bacteria 5481
358 Ga0207658_10041836 3300025986 Bacteria 3320
359 Ga0207658_10060711 3300025986 Bacteria 2822
360 Ga0207677_10002667 3300026023 Bacteria 9401
361 Ga0207677_10050917 3300026023 Bacteria 2804
362 Ga0207677_10057425 3300026023 Bacteria 2672
363 Ga0207703_10009260 3300026035 Bacteria 7744
364 Ga0207703_10021839 3300026035 Bacteria 5011
365 Ga0207703_10184954 3300026035 Bacteria 1841
366 Ga0207703_10186380 3300026035 Bacteria 1835
367 Ga0207703_10415708 3300026035 Bacteria 1250
368 Ga0207639_10007355 3300026041 Bacteria 7504
369 Ga0207639_10024149 3300026041 Bacteria 4395
370 Ga0207639_10043661 3300026041 Bacteria 3367
371 Ga0207639_10083123 3300026041 Bacteria 2541
372 Ga0207639_10188821 3300026041 Bacteria 1758
373 Ga0207639_10694793 3300026041 Bacteria 943
374 Ga0207678_10028557 3300026067 Bacteria 4869
375 Ga0207678_10043551 3300026067 Bacteria 3884
376 Ga0207678_10322066 3300026067 Bacteria 1330
377 Ga0207708_10007488 3300026075 Bacteria 8069
378 Ga0207708_10077668 3300026075 Bacteria 2548
379 Ga0207708_10101084 3300026075 Bacteria 2232
380 Ga0207708_10551199 3300026075 Bacteria 972
381 Ga0207641_10003042 3300026088 Bacteria 15111
382 Ga0207641_10064788 3300026088 Bacteria 3124
383 Ga0207641_10106666 3300026088 Bacteria 2477
384 Ga0207641_10171221 3300026088 Bacteria 1982
385 Ga0207648_10002672 3300026089 Bacteria 18989
386 Ga0207648_10020858 3300026089 Bacteria 5900
387 Ga0207648_10023482 3300026089 Bacteria 5523
388 Ga0207648_10082941 3300026089 Bacteria 2796
389 Ga0207648_10115887 3300026089 Bacteria 2355
390 Ga0207648_10651299 3300026089 Bacteria 974
391 Ga0207676_10020763 3300026095 Bacteria 4809
392 Ga0207676_10103059 3300026095 Bacteria 2370
393 Ga0207676_10214101 3300026095 Bacteria 1711
394 Ga0207674_10021614 3300026116 Bacteria 6927
395 Ga0207674_10028028 3300026116 Bacteria 5951
396 Ga0207674_10041929 3300026116 Bacteria 4730
397 Ga0207674_10042765 3300026116 Bacteria 4676
398 Ga0207674_10043491 3300026116 Bacteria 4631
399 Ga0207675_100006819 3300026118 Bacteria 10814
400 Ga0207675_100013077 3300026118 Bacteria 7747
401 Ga0207675_100013316 3300026118 Bacteria 7676
402 Ga0207675_100027523 3300026118 Bacteria 5295
403 Ga0207683_10066240 3300026121 Bacteria 3185
404 Ga0207683_10087595 3300026121 Bacteria 2769
405 Ga0207698_10012540 3300026142 Bacteria 5553
406 Ga0207698_10110387 3300026142 Bacteria 2304
407 Ga0207428_10088859 3300027907 Bacteria 2402
408 Ga0268266_10000257 3300028379 Bacteria 89384
409 Ga0268266_10033856 3300028379 Bacteria 4342
410 Ga0268266_10067552 3300028379 Bacteria 3094
411 Ga0268266_10099515 3300028379 Bacteria 2560
412 Ga0268266_10123949 3300028379 Bacteria 2303
413 Ga0268266_10181019 3300028379 Bacteria 1919
414 Ga0268265_10101967 3300028380 Bacteria 2320
415 Ga0268265_10119785 3300028380 Bacteria 2166
416 Ga0268265_10136798 3300028380 Bacteria 2045
417 Ga0268265_10165509 3300028380 Bacteria 1884
418 Ga0268265_10241758 3300028380 Bacteria 1593
419 Ga0268264_10001001 3300028381 Bacteria 28672
420 Ga0268264_10003066 3300028381 Bacteria 14474
421 Ga0268264_10023023 3300028381 Bacteria 5083
422 Ga0268264_10081093 3300028381 Bacteria 2772
423 Ga0268264_10198848 3300028381 Bacteria 1832
424 Ga0307515_10001956 3300028794 Bacteria 45627
425 Ga0265332_10070180 3300031238 Bacteria 1493
426 Ga0265325_10012043 3300031241 Bacteria 4955
427 Ga0265340_10103457 3300031247 Bacteria 1322
428 Ga0265339_10215540 3300031249 Bacteria 941
429 Ga0265331_10021115 3300031250 Bacteria 3336
430 Ga0265331_10092429 3300031250 Bacteria 1397
431 Ga0265316_10448039 3300031344 Bacteria 926
432 Ga0307513_10154305 3300031456 Bacteria 2199
433 Ga0307408_100184963 3300031548 Bacteria 1674
434 Ga0265313_10066804 3300031595 Bacteria 1665
435 Ga0265314_10036505 3300031711 Bacteria 3571
436 Ga0265314_10207403 3300031711 Bacteria 1153
437 Ga0307405_10055754 3300031731 Bacteria 2475
438 Ga0307413_10154821 3300031824 Bacteria 1602
439 Ga0307413_10391905 3300031824 Bacteria 1085
440 Ga0307406_10165481 3300031901 Bacteria 1595
441 Ga0307406_10182726 3300031901 Bacteria 1528
442 Ga0307406_10212650 3300031901 Bacteria 1432
443 Ga0307407_10135268 3300031903 Bacteria 1583
444 Ga0307412_10364108 3300031911 Bacteria 1165
445 Ga0307409_100071106 3300031995 Bacteria 2765
446 Ga0307409_100435895 3300031995 Bacteria 1261
447 Ga0307416_100011529 3300032002 Bacteria 5903
448 Ga0307416_100025422 3300032002 Bacteria 4340
449 Ga0307411_10175938 3300032005 Bacteria 1619
450 Ga0307415_100112335 3300032126 Bacteria 2024
451 Ga0307415_100271516 3300032126 Bacteria 1389
452 Ga0373962_0019366 3300035242 Bacteria 1780
453 Ga0373931_0030437 3300035691 Bacteria 2778
454 Ga0395899_0084472 3300037312 Bacteria 2308
455 Ga0395900_0014410 3300037418 Bacteria 8069
456 Ga0395900_0117317 3300037418 Bacteria 2731
457 Ga0395898_0250599 3300037466 Bacteria 1689
458 Ga0395905_0015692 3300037471 Bacteria 7196
459 Ga0395905_0133797 3300037471 Bacteria 2332
460 Ga0395905_0252820 3300037471 Bacteria 1646
461 Ga0395905_0344751 3300037471 Bacteria 1381
462 Ga0395901_0047074 3300038443 Bacteria 4479
463 Ga0395901_0076932 3300038443 Bacteria 3482
464 Ga0395901_0151688 3300038443 Bacteria 2435
465 Ga0436365_0551841 3300039437 Bacteria 1251
466 Ga0436365_1295259 3300039437 Bacteria 8569
467 Ga0436361_0060394 3300039447 Bacteria 4673
468 Ga0436361_0845671 3300039447 Bacteria 3085
469 Ga0439438_000021 3300041405 Bacteria 109330
470 Ga0439447_002674 3300041407 Bacteria 6453
471 Ga0439465_0035766 3300041413 Bacteria 1593
472 Ga0451841_0277328 3300041498 Bacteria 1627
473 Ga0451843_1665491 3300041509 Bacteria 1372
474 Ga0451855_1135979 3300041511 Bacteria 1792
475 Ga0451853_1535672 3300041512 Bacteria 1966
476 Ga0451853_3126826 3300041512 Bacteria 2691
477 Ga0439445_0079000 3300042004 Bacteria 918
478 Ga0439432_020645 3300042006 Bacteria 2187
479 Ga0439450_033059 3300042008 Bacteria 1171
480 Ga0450908_012082 3300042184 Bacteria 1571
481 Ga0439435_0050826 3300042436 Bacteria 1186
482 Ga0439464_0006733 3300042439 Bacteria 2996
483 Ga0466972_0029385 3300044658 Bacteria 2706
484 Ga0451576_0064685 3300045051 Bacteria 3809
485 Ga0466958_0157855 3300045836 Bacteria 1432
486 Ga0466967_0306169 3300045976 Bacteria 1530
487 Ga0495627_001317 3300046453 Bacteria 15130
488 Ga0495591_002496 3300046458 Bacteria 10186
489 Ga0495629_0199720 3300046459 Bacteria 1383
490 Ga0495638_0042235 3300046460 Bacteria 2881
491 Ga0495638_0215387 3300046460 Bacteria 1076
492 Ga0495650_0000008 3300046471 Bacteria 688246
493 Ga0495650_0013567 3300046471 Bacteria 4299
494 Ga0495650_0062159 3300046471 Bacteria 1493
495 Ga0495580_0016298 3300046472 Bacteria 5580
496 Ga0495605_0019290 3300046474 Bacteria 3647
497 Ga0495605_0031401 3300046474 Bacteria 2713
498 Ga0495584_0022473 3300046491 Bacteria 3200
499 Ga0495596_0112964 3300046500 Bacteria 1055
500 Ga0495607_0009540 3300046501 Bacteria 6560
501 Ga0495607_0148138 3300046501 Bacteria 1204
502 Ga0495606_0001619 3300046507 Bacteria 29382
503 Ga0495610_0018917 3300046512 Bacteria 3872
504 Ga0495616_0013102 3300046513 Bacteria 4688
505 Ga0495620_0016163 3300046515 Bacteria 3754
506 Ga0495628_0532409 3300046516 Bacteria 845
507 Ga0495631_0056290 3300046518 Bacteria 1712
508 Ga0495631_0078236 3300046518 Bacteria 1428
509 Ga0495632_0024918 3300046519 Bacteria 3171
510 Ga0495637_0078976 3300046520 Bacteria 1315
511 Ga0495643_0128851 3300046522 Bacteria 1272
512 Ga0495644_0025575 3300046523 Bacteria 2240
513 Ga0495648_0007216 3300046524 Bacteria 8929
514 Ga0495648_0014184 3300046524 Bacteria 5846
515 Ga0495648_0031408 3300046524 Bacteria 3497
516 Ga0495654_0076200 3300046530 Bacteria 1581
517 Ga0495621_0047296 3300046539 Bacteria 1529
518 Ga0495597_0013170 3300046542 Bacteria 3969
519 Ga0495597_0091737 3300046542 Bacteria 1289
520 Ga0495656_0000137 3300046615 Bacteria 27177
521 Ga0495656_0012841 3300046615 Bacteria 3102
522 Ga0495668_0036681 3300046616 Bacteria 2746
523 Ga0495668_0044095 3300046616 Bacteria 2479
524 Ga0495625_0005544 3300046660 Bacteria 11461
525 Ga0495625_0021804 3300046660 Bacteria 4921
526 Ga0495625_0145329 3300046660 Bacteria 1597
527 Ga0495625_0247566 3300046660 Bacteria 1158
528 Ga0495624_0097942 3300046690 Bacteria 1807
529 Ga0495671_0009568 3300046692 Bacteria 5409
530 Ga0495649_0003827 3300046694 Bacteria 9962
531 Ga0495649_0051331 3300046694 Bacteria 2237
532 Ga0495589_0016275 3300046794 Bacteria 3823
533 Ga0495660_0000019 3300046810 Bacteria 311047
534 Ga0495660_0053584 3300046810 Bacteria 2189
535 Ga0495672_0000003 3300047320 Bacteria 728845
536 Ga0495676_0041260 3300047321 Bacteria 3800
537 Ga0495680_0199987 3300047322 Bacteria 1434
538 Ga0495683_0060105 3300047323 Bacteria 1884
539 Ga0495687_000315 3300047443 Bacteria 62841
540 Ga0495687_004781 3300047443 Bacteria 8944
541 Ga0495673_0000011 3300047469 Bacteria 674140
542 Ga0495681_0046366 3300047470 Bacteria 2073
543 Ga0495686_0024783 3300047472 Bacteria 3937
544 Ga0495686_0025877 3300047472 Bacteria 3843
545 Ga0495686_0052543 3300047472 Bacteria 2555
546 Ga0495686_0058797 3300047472 Bacteria 2395
547 Ga0495593_0034342 3300047673 Bacteria 2759
548 Ga0495602_0349358 3300048088 Bacteria 1068
549 Ga0495615_0019143 3300048090 Bacteria 1517
550 Ga0495615_0031301 3300048090 Bacteria 1275
551 Ga0496102_0031944 3300048905 Bacteria 4727
552 Ga0496105_0431673 3300048908 Bacteria 1042
553 Ga0496106_0015363 3300048909 Bacteria 5666
554 Ga0496107_0057456 3300048910 Bacteria 2812
555 Ga0496108_0083530 3300048911 Bacteria 2709
556 Ga0496108_0137129 3300048911 Bacteria 2106
557 Ga0496108_0559098 3300048911 Bacteria 998
558 Ga0496109_0275367 3300048912 Bacteria 1586
559 Ga0496110_0008710 3300048913 Bacteria 8172
560 Ga0496111_0082657 3300048914 Bacteria 2346
561 Ga0496112_0001731 3300048915 Bacteria 17084
562 Ga0496112_0690544 3300048915 Bacteria 949
563 Ga0496113_0165586 3300048916 Bacteria 1749
564 Ga0496114_0280180 3300048917 Bacteria 1470
565 Ga0496116_0000076 3300048919 Bacteria 229670
566 Ga0496119_0000044 3300048922 Bacteria 191820
567 Ga0496119_0001021 3300048922 Bacteria 35860
568 Ga0496119_0010974 3300048922 Bacteria 7562
569 Ga0496120_0000044 3300048923 Bacteria 192292
570 Ga0496120_0000073 3300048923 Bacteria 164280
571 Ga0496120_0002155 3300048923 Bacteria 20986
572 Ga0496120_0020849 3300048923 Bacteria 4153
573 Ga0496121_0154062 3300048924 Bacteria 1688
574 Ga0496121_0167571 3300048924 Bacteria 1599
575 Ga0496124_0392689 3300048927 Bacteria 966
576 Ga0496125_0066554 3300048928 Bacteria 2846
577 Ga0496126_0046351 3300048929 Bacteria 3988
578 Ga0496126_0152871 3300048929 Bacteria 1977
579 Ga0495678_000479 3300049459 Bacteria 39762
580 Ga0495682_0000006 3300049460 Bacteria 316373
581 Ga0501031_0026318 3300049568 Bacteria 3793
582 Ga0501031_0058101 3300049568 Bacteria 2520
583 Ga0501032_0000018 3300049569 Bacteria 156275
584 Ga0501032_0012010 3300049569 Bacteria 6200
585 Ga0501032_0016409 3300049569 Bacteria 5209
586 Ga0501032_0145442 3300049569 Bacteria 1560
587 Ga0501033_0000032 3300049570 Bacteria 156304
588 Ga0501033_0010055 3300049570 Bacteria 7263
589 Ga0501033_0022431 3300049570 Bacteria 4762
590 Ga0501033_0048959 3300049570 Bacteria 3138
591 Ga0501034_0000103 3300049571 Bacteria 156304
592 Ga0501034_0000444 3300049571 Bacteria 68426
593 Ga0501034_0013483 3300049571 Bacteria 8413
594 Ga0501034_0026618 3300049571 Bacteria 5888
595 Ga0501034_0043168 3300049571 Bacteria 4564
596 Ga0501034_0050527 3300049571 Bacteria 4193
597 Ga0501034_0051840 3300049571 Bacteria 4136
598 Ga0501034_0053228 3300049571 Bacteria 4077
599 Ga0501034_0085368 3300049571 Bacteria 3158
600 Ga0501034_0176639 3300049571 Bacteria 2101
601 Ga0501034_0177927 3300049571 Bacteria 2093
602 Ga0501034_0201026 3300049571 Bacteria 1951
603 Ga0501034_0371386 3300049571 Bacteria 1356
604 Ga0501034_0584761 3300049571 Bacteria 1023
605 Ga0501036_0000012 3300049572 Bacteria 156304
606 Ga0501036_0021735 3300049572 Bacteria 5393
607 Ga0501036_0357484 3300049572 Bacteria 1219
608 Ga0501037_0000018 3300049573 Bacteria 156304
609 Ga0501037_0070785 3300049573 Bacteria 2537
610 Ga0501037_0361101 3300049573 Bacteria 1001
611 Ga0501038_0000017 3300049574 Bacteria 156304
612 Ga0501038_0035575 3300049574 Bacteria 4371
613 Ga0501039_0000024 3300049575 Bacteria 156304
614 Ga0501039_0085075 3300049575 Bacteria 2463
615 Ga0501039_0095117 3300049575 Bacteria 2322
616 Ga0501040_0040528 3300049576 Bacteria 3169
617 Ga0501043_0004332 3300049579 Bacteria 11551
618 Ga0501043_0035219 3300049579 Bacteria 3938
619 Ga0501043_0040158 3300049579 Bacteria 3678
620 Ga0501043_0047170 3300049579 Bacteria 3387
621 Ga0501043_0126877 3300049579 Bacteria 2001
622 Ga0501043_0210059 3300049579 Bacteria 1509
623 Ga0501046_0020293 3300049580 Bacteria 5498
624 Ga0501047_0004558 3300049581 Bacteria 13028
625 Ga0501047_0008752 3300049581 Bacteria 9553
626 Ga0501047_0075346 3300049581 Bacteria 3247
627 Ga0501047_0084654 3300049581 Bacteria 3047
628 Ga0501047_0086899 3300049581 Bacteria 3004
629 Ga0501047_0134003 3300049581 Bacteria 2357
630 Ga0501047_0242319 3300049581 Bacteria 1653
631 Ga0501047_0289007 3300049581 Bacteria 1483
632 Ga0501067_0017674 3300049583 Bacteria 3948
633 Ga0501068_0000614 3300049584 Bacteria 18139
634 Ga0501068_0026011 3300049584 Bacteria 3445
635 Ga0501069_0010352 3300049585 Bacteria 4935
636 Ga0501069_0013466 3300049585 Bacteria 4361
637 Ga0501069_0043505 3300049585 Bacteria 2486
638 Ga0501070_0007753 3300049586 Bacteria 9100
639 Ga0501070_0026001 3300049586 Bacteria 4911
640 Ga0501070_0093477 3300049586 Bacteria 2488
641 Ga0501070_0145407 3300049586 Bacteria 1957
642 Ga0501070_0364503 3300049586 Bacteria 1172
643 Ga0501071_0014047 3300049587 Bacteria 5472
644 Ga0501072_0274843 3300049588 Bacteria 1340
645 Ga0501073_0000143 3300049589 Bacteria 47217
646 Ga0501073_0016948 3300049589 Bacteria 5276
647 Ga0501073_0025527 3300049589 Bacteria 4236
648 Ga0501073_0031477 3300049589 Bacteria 3785
649 Ga0501073_0087298 3300049589 Bacteria 2169
650 Ga0501073_0090803 3300049589 Bacteria 2123
651 Ga0501073_0099760 3300049589 Bacteria 2016
652 Ga0501073_0144825 3300049589 Bacteria 1646
653 Ga0501073_0248679 3300049589 Bacteria 1227
654 Ga0501074_0031683 3300049590 Bacteria 3830
655 Ga0501074_0043632 3300049590 Bacteria 3246
656 Ga0501074_0185745 3300049590 Bacteria 1482
657 Ga0501076_0069235 3300049592 Bacteria 2820
658 Ga0501077_0004814 3300049593 Bacteria 8204
659 Ga0501079_0172456 3300049741 Bacteria 1687
660 Ga0501080_0000955 3300049742 Bacteria 23659
661 Ga0501080_0016628 3300049742 Bacteria 6796
662 Ga0501080_0035296 3300049742 Bacteria 4667
663 Ga0501080_0290864 3300049742 Bacteria 1483
664 Ga0501080_0311304 3300049742 Bacteria 1427
665 Ga0501080_0408157 3300049742 Bacteria 1221
666 Ga0501080_0691419 3300049742 Bacteria 900
667 Ga0501083_0008455 3300049744 Bacteria 7274
668 Ga0501083_0044759 3300049744 Bacteria 2996
669 Ga0501083_0064134 3300049744 Bacteria 2448
670 Ga0501083_0080260 3300049744 Bacteria 2163
671 Ga0501035_0000040 3300049822 Bacteria 156262
672 Ga0501035_0005942 3300049822 Bacteria 11492
673 Ga0501035_0010917 3300049822 Bacteria 8410
674 Ga0501035_0013756 3300049822 Bacteria 7469
675 Ga0501035_0031169 3300049822 Bacteria 4856
676 Ga0501035_0047332 3300049822 Bacteria 3861
677 Ga0501035_0108123 3300049822 Bacteria 2438
678 Ga0501035_0155127 3300049822 Bacteria 1985
679 Ga0501044_0000040 3300049823 Bacteria 156304
680 Ga0501044_0007916 3300049823 Bacteria 11685
681 Ga0501044_0013108 3300049823 Bacteria 8975
682 Ga0501044_0059837 3300049823 Bacteria 3902
683 Ga0501044_0061348 3300049823 Bacteria 3846
684 Ga0501044_0064588 3300049823 Bacteria 3736
685 Ga0501044_0395455 3300049823 Bacteria 1295
686 nmdc:mga03683_114917_c1 3300050489 Bacteria 1193
687 nmdc:mga03683_57021_c1 3300050489 Bacteria 1643
688 nmdc:mga0yw44_177287_c1 3300050492 Bacteria 1401
689 nmdc:mga0yw44_315155_c1 3300050492 Bacteria 1050
690 nmdc:mga0yw44_82007_c1 3300050492 Bacteria 2023
691 nmdc:mga0k408_45484_c1 3300050493 Bacteria 2533
692 nmdc:mga0k408_68018_c1 3300050493 Bacteria 2077
693 nmdc:mga06z11_257117_c1 3300050494 Bacteria 1030
694 nmdc:mga06z11_308338_c1 3300050494 Bacteria 942
695 nmdc:mga04h51_79090_c1 3300050495 Bacteria 1163
696 nmdc:mga07m45_17151_c1 3300050496 Bacteria 3884
697 nmdc:mga07m45_378_c1 3300050496 Bacteria 18230
698 nmdc:mga05p37_346908_c1 3300050507 Bacteria 1749
699 nmdc:mga06r32_15012_c1 3300050510 Bacteria 7030
700 nmdc:mga06r32_212448_c1 3300050510 Bacteria 1922
701 nmdc:mga08y16_430057_c1 3300050511 Bacteria 1348
702 nmdc:mga0sz30_116209_c1 3300050516 Bacteria 1174
703 nmdc:mga0sz30_41876_c1 3300050516 Bacteria 1926
704 Ga0495619_0314681 3300053085 Bacteria 1084
705 Ga0500643_022254 3300053087 Bacteria 2043
706 Ga0500555_021183 3300053103 Bacteria 1871
707 Ga0500562_055410 3300053108 Bacteria 1063
708 Ga0500621_000004 3300053126 Bacteria 485792
709 Ga0500568_0000010 3300053139 Bacteria 249043
710 Ga0500568_0017450 3300053139 Bacteria 3169
711 Ga0500616_0055079 3300053153 Bacteria 2081
712 Ga0500616_0145217 3300053153 Bacteria 1104
713 Ga0500620_000598 3300053155 Bacteria 6198
714 Ga0500622_0000734 3300053156 Bacteria 28647
715 Ga0500622_0045878 3300053156 Bacteria 2261
716 Ga0500627_0161288 3300053158 Bacteria 1011
717 Ga0500645_002075 3300053730 Bacteria 9285
718 Ga0501084_0086241 3300054114 Bacteria 2636
719 Ga0501082_0017173 3300060353 Bacteria 6234
720 Ga0501082_0442417 3300060353 Bacteria 1135
721 2871441915 2871435913 Bacteria 6880295
722 2503199714 2503198000 Bacteria 6884444
723 2506580941 2506520007 Bacteria 5442880
724 2506586080 2506520008 Bacteria 5443009
725 2509116655 2508501123 Bacteria 6283661
726 2509142467 2508501127 Bacteria 7037543
727 2509372055 2509276018 Bacteria 6910194
728 2509394643 2509276022 Bacteria 6200534
729 2510136115 2510065019 Bacteria 6903379
730 2510318778 2510065059 Bacteria 6847884
731 2510892882 2510461076 Bacteria 8618824
732 2512932870 2512875016 Bacteria 6529530
733 2512960891 2512875024 Bacteria 7195110
734 2513568416 2513237084 Bacteria 7231967
735 2513571888 2513237084 Bacteria 7231967
736 2513608981 2513237090 Bacteria 7096802
737 2513630727 2513237093 Bacteria 7545552
738 2513711921 2513237103 Bacteria 7647401
739 2514018250 2513237162 Bacteria 7468464
740 2514036663 2513237164 Bacteria 7563725
741 2514417286 2513237305 Bacteria 7293571
742 2514585981 2513237351 Bacteria 6968952
743 2515108958 2515075009 Bacteria 7288508
744 2515633037 2515154113 Bacteria 7807172
745 2515640242 2515154114 Bacteria 7848616
746 2515656323 2515154116 Bacteria 7552979
747 2515853372 2515154155 Bacteria 7985436
748 2517040899 2516653077 Bacteria 7555578
749 2517098499 2517093000 Bacteria 7412387
750 2588518926 2588253730 Bacteria 6881675
751 2597811080 2597489875 Bacteria 7010078
752 2599939860 2599185301 Bacteria 6161860
753 2616297886 2615840624 Bacteria 6557588
754 2643987609 2643221595 Bacteria 6565519
755 2644157870 2643221627 Bacteria 6761570
756 2644169376 2643221629 Bacteria 5850260
757 2644169825 2643221629 Bacteria 5850260
758 2644195208 2643221634 Bacteria 6705461
759 2644241132 2643221643 Bacteria 5749658
760 2644350461 2643221662 Bacteria 5851492
761 2644350773 2643221662 Bacteria 5851492
762 2656276776 2654587920 Bacteria 5475511
763 2688596966 2687453392 Bacteria 6880454
764 2689447492 2687453601 Bacteria 5546041
765 2694630225 2693429783 Bacteria 7019804
766 2694634305 2693429784 Bacteria 7241525
767 2723574116 2721755686 Bacteria 7343952
768 2725949384 2724679232 Bacteria 7646494
769 2739612373 2739367655 Bacteria 4051151
770 2765464463 2765235802 Bacteria 5618596
771 2766064607 2765235942 Bacteria 7445910
772 2776267091 2775506902 Bacteria 6208009
773 2776283434 2775506904 Bacteria 5954060
774 2792748281 2791355123 Bacteria 8049106
775 2793315014 2791355259 Bacteria 7254731
776 2793322548 2791355260 Bacteria 6598818
777 2793356265 2791355265 Bacteria 6539969
778 2838024757 2838022645 Bacteria 6494267
779 2838046870 2838042994 Bacteria 6046894
780 2838668896 2838668709 Bacteria 6671819
781 2838701444 2838701080 Bacteria 6669771
782 2839997337 2839993093 Bacteria 5512535
783 2840765801 2840764183 Bacteria 6358399
784 2841737462 2841734538 Bacteria 6784580
785 2842113798 2842110456 Bacteria 7656360
786 2842146491 2842146304 Bacteria 5957337
787 2842194118 2842192696 Bacteria 6147454
788 2842200138 2842198810 Bacteria 6608673
789 2842209930 2842205361 Bacteria 6340321
790 2842219644 2842217011 Bacteria 7497767
791 2842251279 2842250916 Bacteria 6579627
792 2842283384 2842278818 Bacteria 6340002
793 2842288119 2842285085 Bacteria 6011953
794 2842405385 2842402390 Bacteria 6681310
795 2842411858 2842409023 Bacteria 6687331
796 2842418615 2842415677 Bacteria 6596907
797 2842494805 2842489311 Bacteria 6620893
798 2842500841 2842495871 Bacteria 6820686
799 2844012307 2844009547 Bacteria 6728125
800 2847674706 2847670302 Bacteria 6165597
801 2847690815 2847686936 Bacteria 6278406
802 2851186195 2851182111 Bacteria 6047226
803 2854917309 2854916844 Bacteria 5725939
804 2855196576 2855195626 Bacteria 4927512
805 2856317408 2856314179 Bacteria 6477897
806 2856328731 2856328259 Bacteria 6528202
807 2856338338 2856334872 Bacteria 7037011
808 2856349200 2856342000 Bacteria 7176905
809 2856355334 2856349417 Bacteria 6230045
810 2856366857 2856364286 Bacteria 6939991
811 2857352255 2857349434 Bacteria 7926032
812 2857370918 2857367948 Bacteria 6965560
813 2857523132 2857516855 Bacteria 7787325
814 2869168561 2869162929 Bacteria 6399702
815 2869175169 2869169390 Bacteria 6659796
816 2869241877 2869234852 Bacteria 6654993
817 2869249189 2869242130 Bacteria 6609239
818 2869249922 2869249662 Bacteria 6868783
819 2869262911 2869256925 Bacteria 6981691
820 2869276239 2869271264 Bacteria 6908218
821 2869285653 2869278585 Bacteria 7077053
822 2869287731 2869285874 Bacteria 6901219
823 2871284461 2871282230 Bacteria 4917173
824 2871435679 2871429161 Bacteria 6547891
825 2871445479 2871444079 Bacteria 6423508
826 2871452877 2871451962 Bacteria 7336357
827 2871460251 2871459585 Bacteria 6866887
828 2871473272 2871466892 Bacteria 6923287
829 2871480887 2871474448 Bacteria 6806570
830 2871496544 2871495908 Bacteria 6935695
831 2874105293 2874102143 Bacteria 6342645
832 2874115110 2874109183 Bacteria 6517025
833 2874119248 2874116593 Bacteria 6674494
834 2874132901 2874131515 Bacteria 6820270
835 2874142009 2874139085 Bacteria 7021506
836 2874151362 2874146452 Bacteria 7533118
837 2874158996 2874155637 Bacteria 6724144
838 2874163034 2874162495 Bacteria 6174670
839 2874175073 2874168670 Bacteria 8062617
840 2876364880 2876363079 Bacteria 6544991
841 2876377286 2876369609 Bacteria 6807521
842 2876387077 2876386047 Bacteria 6698674
843 2876397708 2876392853 Bacteria 6660880
844 2876405592 2876399893 Bacteria 6927900
845 2876413852 2876406927 Bacteria 6191900
846 2876417415 2876413966 Bacteria 6831344
847 2878038446 2878035449 Bacteria 6555736
848 2878733083 2878730984 Bacteria 6380721
849 2878744807 2878738818 Bacteria 7136951
850 2878749242 2878745973 Bacteria 6867388
851 2878757562 2878753008 Bacteria 6922523
852 2878760772 2878760144 Bacteria 6823465
853 2878767603 2878767105 Bacteria 6898628
854 2878784098 2878781027 Bacteria 6834456
855 2878794336 2878788777 Bacteria 6567085
856 2881149590 2881147464 Bacteria 7779814
857 2881160771 2881155292 Bacteria 6461656
858 2881166469 2881161766 Bacteria 7127907
859 2881849486 2881845957 Bacteria 6611900
860 2881860505 2881853255 Bacteria 6698367
861 2881863131 2881861095 Bacteria 7128710
862 2882639383 2882632389 Bacteria 8154593
863 2882918380 2882912400 Bacteria 6801539
864 2885307950 2885305155 Bacteria 7348390
865 2885313128 2885312484 Bacteria 6415165
866 2885319415 2885318864 Bacteria 6729568
867 2885326734 2885326080 Bacteria 7134805
868 2885340995 2885334103 Bacteria 7216818
869 2885356108 2885350715 Bacteria 6787678
870 2888354698 2888350351 Bacteria 7372807
871 2889016313 2889010040 Bacteria 6749192
872 2889018664 2889016732 Bacteria 6700763
873 2889794442 2889790730 Bacteria 5689708
874 2889914953 2889914905 Bacteria 5702301
875 2894026861 2894023352 Bacteria 5167372
876 2900053985 2900051742 Bacteria 4985156
877 2900054458 2900051742 Bacteria 4985156
878 2903498706 2903492973 Bacteria 13473544
879 2903501292 2903492973 Bacteria 13473544
880 2903522384 2903521522 Bacteria 6525694
881 2903528763 2903528002 Bacteria 6586099
882 2903541338 2903540706 Bacteria 7062119
883 2904542417 2904541872 Bacteria 8915136
884 2904664359 2904659560 Bacteria 6685615
885 2906310280 2906308376 Bacteria 6841989
886 2906324345 2906321335 Bacteria 6579571
887 2906333159 2906328253 Bacteria 6585166
888 2906355226 2906354277 Bacteria 6991324
889 2906365978 2906363423 Bacteria 6856682
890 2906375160 2906370794 Bacteria 6881062
891 2906384876 2906378014 Bacteria 6911440
892 2906387086 2906386501 Bacteria 5977019
893 2906394381 2906393657 Bacteria 6790866
894 2906407986 2906401398 Bacteria 6693206
895 2906414051 2906408224 Bacteria 6162342
896 2906417473 2906414383 Bacteria 6580790
897 2913301660 2913295892 Bacteria 6333755
898 2919173906 2919171160 Bacteria 6499771
899 2922138325 2922130491 Bacteria 7173936
900 2922153686 2922151315 Bacteria 6902399
901 2922159040 2922158528 Bacteria 6573167
902 2922172652 2922172374 Bacteria 6167644
903 2922179550 2922178524 Bacteria 6025201
904 2922188375 2922185730 Bacteria 7113964
905 2924712192 2924710171 Bacteria 6752351
906 2924730220 2924726620 Bacteria 6271473
907 2924733918 2924733363 Bacteria 7574837
908 2924743665 2924741084 Bacteria 6661321
909 2924749216 2924748358 Bacteria 6154725
910 2924767248 2924762789 Bacteria 6561353
911 2924782838 2924776078 Bacteria 7492003
912 2924786857 2924784321 Bacteria 7416538
913 2929167669 2929160207 Bacteria 9075316
914 2933589566 2933586486 Bacteria 7667493
915 2936373589 2936367885 Bacteria 7324495
916 2936374699 2936367885 Bacteria 7324495
917 2936375866 2936375103 Bacteria 6652732
918 2937817104 2937813078 Bacteria 7783518
919 2937822548 2937822353 Bacteria 7290551
920 2937840302 2937836603 Bacteria 6811263
921 2937847024 2937843397 Bacteria 5256375
922 2937852483 2937848649 Bacteria 6983481
923 2937883621 2937877337 Bacteria 7246526
924 2937892977 2937891427 Bacteria 6357007
925 2937977570 2937972304 Bacteria 7532020
926 2937995194 2937994558 Bacteria 7036190
927 2938016112 2938014810 Bacteria 6700592
928 2958041668 2958034702 Bacteria 6989922
929 2958047950 2958041894 Bacteria 13082850
930 2958070661 2958064165 Bacteria 7158582
931 2958071511 2958071322 Bacteria 6815895
932 2958090789 2958084443 Bacteria 7312792
933 2958093536 2958092219 Bacteria 6861151
934 2958102442 2958100919 Bacteria 6800575
935 2958113401 2958108152 Bacteria 6681128
936 2958120911 2958115193 Bacteria 6923548
937 2958128981 2958122699 Bacteria 7280457
938 2958132133 2958130278 Bacteria 6897202
939 2958138031 2958137437 Bacteria 6050276
940 2958164490 2958158011 Bacteria 6058449
941 2958165541 2958165035 Bacteria 6906348
942 2958174260 2958172287 Bacteria 6716688
943 2958181947 2958179912 Bacteria 6874908
944 2961079791 2961077736 Bacteria 7079850
945 2961119358 2961114664 Bacteria 6680456
946 2961132269 2961127735 Bacteria 7196641
947 2961139723 2961136820 Bacteria 6775228
948 2961164000 2961163497 Bacteria 6901077
949 2961175111 2961170736 Bacteria 7072258
950 2961188401 2961183825 Bacteria 6688536
951 2963646336 2963644680 Bacteria 6530403
952 2965018934 2965018300 Bacteria 6883036
953 2965027035 2965025482 Bacteria 6532201
954 2965040200 2965032056 Bacteria 6887443
955 2965046269 2965040258 Bacteria 6855979
956 2965062847 2965062239 Bacteria 7412989
957 2965090430 2965089291 Bacteria 6866420
958 2965117065 2965110997 Bacteria 6693150
959 2965125245 2965119406 Bacteria 6956431
960 2967999888 2967996073 Bacteria 6787468
961 2968008247 2968003550 Bacteria 6929263
962 2968020461 2968016561 Bacteria 7022047
963 2968087138 2968083720 Bacteria 7351627
964 2968091312 2968091066 Bacteria 6052692
965 2968103140 2968097103 Bacteria 6107094
966 2968115613 2968110612 Bacteria 6814636
967 2968118986 2968117919 Bacteria 6536078
968 2968128930 2968128360 Bacteria 6270294
969 2968143472 2968138860 Bacteria 6605449
970 2968172403 2968171901 Bacteria 6894245
971 2970473758 2970469710 Bacteria 6969209
972 2970490429 2970489779 Bacteria 6517260
973 2970507699 2970503327 Bacteria 7099517
974 2970516849 2970510686 Bacteria 7006402
975 2970527094 2970524798 Bacteria 6840927
976 2970534772 2970532167 Bacteria 6553173
977 2970544535 2970540015 Bacteria 6977556
978 2970548273 2970547951 Bacteria 6931819
979 2970555625 2970554993 Bacteria 6814252
980 2970600269 2970593180 Bacteria 7073582
981 2970620167 2970619444 Bacteria 6986144
982 2977826719 2977821940 Bacteria 6906439
983 2977832939 2977828996 Bacteria 7007971
984 2977847395 2977843712 Bacteria 6753583
985 2977854159 2977851361 Bacteria 6694324
986 2977861730 2977858184 Bacteria 6215359
987 2977871925 2977864932 Bacteria 7534097
988 2977873983 2977872689 Bacteria 7270173
989 2977921921 2977915119 Bacteria 6829656
990 2977925277 2977922695 Bacteria 6956781
991 2977940645 2977935797 Bacteria 6252826
992 2977945674 2977942078 Bacteria 7570577
993 2977964757 2977957713 Bacteria 6877875
994 2977973944 2977971508 Bacteria 7472917
995 2977991287 2977986579 Bacteria 6581278
996 2979715663 2979710463 Bacteria 6785254
997 2979745632 2979742915 Bacteria 7301278
998 2979771260 2979764755 Bacteria 6610066
999 2979782194 2979779861 Bacteria 6219781
1000 2979793979 2979793036 Bacteria 6808957
1001 2979812883 2979808191 Bacteria 7179355
1002 2987639439 2987636660 Bacteria 8088555
1003 2987648062 2987645492 Bacteria 6117018
1004 2987653914 2987652177 Bacteria 6969023
1005 2987660008 2987659509 Bacteria 6966464
1006 2987673446 2987666974 Bacteria 6509233
1007 2996316552 2996310559 Bacteria 6357320
1008 2996341633 2996336353 Bacteria 5511628
1009 2996342788 2996341866 Bacteria 6643098
1010 2996352919 2996348954 Bacteria 7239054
1011 2996393295 2996386984 Bacteria 6978667
1012 2996895732 2996893221 Bacteria 5823108
1013 3000139312 3000135777 Bacteria 6891109
1014 3003931263 3003930520 Bacteria 5667563
1015 3004167353 3004167301 Bacteria 8330599
1016 3004189056 3004188549 Bacteria 6952365
1017 3004204317 3004203850 Bacteria 7307914
1018 3004217771 3004211236 Bacteria 7417683
1019 3004221181 3004218560 Bacteria 7421728
1020 3004232810 3004232784 Bacteria 6662140
1021 3004243378 3004239961 Bacteria 6892290
1022 3004269930 3004268573 Bacteria 7043476
1023 3004279601 3004275668 Bacteria 7114440
1024 3004290610 3004289098 Bacteria 6135450
1025 3004336058 3004334049 Bacteria 8449246
1026 639645356 639633055 Bacteria 7751309
1027 649871524 649633066 Bacteria 6690028
1028 8004301844 8004300914 Bacteria 6132239
1029 8004314683 8004312739 Bacteria 7444653
1030 8004379135 8004374579 Bacteria 6898112
1031 8004389516 8004387939 Bacteria 7049250
1032 8004402195 8004395343 Bacteria 6620908
1033 8004451787 8004445564 Bacteria 6322258
1034 8004637406 8004633249 Bacteria 6723080
1035 8004644028 8004640170 Bacteria 6723001
1036 8004712337 8004703790 Bacteria 8006957
1037 8004717914 8004714634 Bacteria 6776161
1038 8004734035 8004727605 Bacteria 6643904
1039 8005290826 8005289223 Bacteria 6634003
1040 8005301296 8005301065 Bacteria 6614431
1041 8005380540 8005376324 Bacteria 6590079
1042 8005384501 8005382845 Bacteria 6732062
1043 8005397813 8005395548 Bacteria 6806915
1044 8005467551 8005460587 Bacteria 7157962
1045 8005559466 8005556819 Bacteria 6908598
1046 8005566487 8005563573 Bacteria 7153261
1047 8005688889 8005688590 Bacteria 6610080
1048 8018132315 8018127388 Bacteria 7351159
1049 8018163761 8018163183 Bacteria 7277977
1050 8024481423 8024479707 Bacteria 6954785
1051 8024501837 8024501048 Bacteria 6427847
1052 8054560632 8054558443 Bacteria 5204801
1053 8054568395 8054563764 Bacteria 5592885
1054 8055619183 8055617313 Bacteria 7548464
1055 8057881284 8057874678 Bacteria 7494653
1056 JGI24739J22299_10022936
1057 JGI25159J45721_1000461
1058 JGI25165J46597_1000034
1059 rootH2_10130272
1060 JGI25160J50197_1000248
1061 JGI25160J50197_1002309
1062 JGI25161J50226_1000183
1063 Ga0055542_1001063
1064 Ga0055529_1003010
1065 Ga0055524_1000850
1066 Ga0055528_1001807
1067 Ga0055543_1000245
1068 Ga0065165_1001012
1069 Ga0070658_10147445
1070 Ga0070658_10290359
1071 Ga0070658_10332977
1072 Ga0070676_10068798
1073 Ga0070683_100200023
1074 Ga0070690_100001510
1075 Ga0070690_100148394
1076 Ga0068869_100001072
1077 Ga0068869_100091578
1078 Ga0068869_100173041
1079 Ga0068869_100287153
1080 Ga0070666_10007488
1081 Ga0068868_100058831
1082 Ga0068868_100152931
1083 Ga0068868_100211375
1084 Ga0068868_100462246
1085 Ga0068868_100484783
1086 Ga0070660_100235649
1087 Ga0070660_100332888
1088 Ga0070689_100011792
1089 Ga0070689_100165543
1090 Ga0070661_100001089
1091 Ga0070661_100077522
1092 Ga0070661_100093694
1093 Ga0070661_100183246
1094 Ga0070692_10101388
1095 Ga0070668_100105638
1096 Ga0070668_100337545
1097 Ga0070669_100030183
1098 Ga0070669_100077937
1099 Ga0070669_100099619
1100 Ga0070675_100002305
1101 Ga0070671_100086319
1102 Ga0070671_100180420
1103 Ga0070674_100017239
1104 Ga0070674_100024016
1105 Ga0070673_100164516
1106 Ga0070659_100069612
1107 Ga0070659_100083833
1108 Ga0070667_100001504
1109 Ga0070667_100047622
1110 Ga0070667_100133328
1111 Ga0070667_100163109
1112 Ga0070667_100342299
1113 Ga0070701_10021078
1114 Ga0070705_100054268
1115 Ga0070700_100102045
1116 Ga0070694_100277084
1117 Ga0070663_100120191
1118 Ga0070678_100044742
1119 Ga0070678_100103935
1120 Ga0070678_100108089
1121 Ga0070678_100401568
1122 Ga0070662_100007515
1123 Ga0070662_100023880
1124 Ga0070681_10024387
1125 Ga0068867_100015891
1126 Ga0068867_100020391
1127 Ga0068867_100165982
1128 Ga0070685_10209442
1129 Ga0070679_100225219
1130 Ga0070684_100109601
1131 Ga0068853_100006106
1132 Ga0068853_100009175
1133 Ga0068853_100027399
1134 Ga0068853_100074345
1135 Ga0070672_100067901
1136 Ga0070672_100097962
1137 Ga0070686_100012181
1138 Ga0070686_100080814
1139 Ga0070695_100366935
1140 Ga0070665_100023505
1141 Ga0070665_100031128
1142 Ga0070665_100032562
1143 Ga0070665_100063348
1144 Ga0070665_100099653
1145 Ga0070665_100197127
1146 Ga0070665_100237090
1147 Ga0070665_100477974
1148 Ga0070664_100065451
1149 Ga0070664_100528939
1150 Ga0068857_100031257
1151 Ga0068857_100032013
1152 Ga0068854_100049679
1153 Ga0068854_100152807
1154 Ga0068854_100193943
1155 Ga0068856_100034379
1156 Ga0068856_100034534
1157 Ga0068856_100198757
1158 Ga0068852_100007354
1159 Ga0068852_100205312
1160 Ga0068852_100349477
1161 Ga0068852_100505746
1162 Ga0068859_100006383
1163 Ga0068859_100028370
1164 Ga0068859_100032249
1165 Ga0068859_100041599
1166 Ga0068859_100204119
1167 Ga0068864_100028037
1168 Ga0068864_100036087
1169 Ga0068864_100048815
1170 Ga0068864_100061768
1171 Ga0068864_100125087
1172 Ga0068866_10011237
1173 Ga0068866_10075384
1174 Ga0068861_100002678
1175 Ga0068861_100018125
1176 Ga0068851_10000365
1177 Ga0068870_10124723
1178 Ga0068863_100006580
1179 Ga0068863_100080476
1180 Ga0068863_100096878
1181 Ga0068858_100004441
1182 Ga0068858_100028194
1183 Ga0068858_100035188
1184 Ga0068858_100231277
1185 Ga0068858_100478235
1186 Ga0068860_100004331
1187 Ga0068860_100022924
1188 Ga0068862_100033418
1189 Ga0068862_100043996
1190 Ga0068862_100064488
1191 Ga0068862_100121394
1192 Ga0068862_100375484
1193 Ga0081455_10080898
1194 Ga0081455_10146886
1195 Ga0081538_10004363
1196 Ga0081540_1096763
1197 Ga0081539_10002732
1198 Ga0081539_10005538
1199 Ga0081539_10006723
1200 Ga0075365_10002114
1201 Ga0075365_10044625
1202 Ga0075365_10145851
1203 Ga0075365_10271373
1204 Ga0075368_10028307
1205 Ga0075368_10062340
1206 Ga0075368_10125673
1207 Ga0075363_100163877
1208 Ga0075362_10048050
1209 Ga0075367_10111633
1210 Ga0075367_10122285
1211 Ga0075367_10125863
1212 Ga0075369_10131423
1213 Ga0097621_100028453
1214 Ga0097621_100035235
1215 Ga0097621_100040781
1216 Ga0097621_100048996
1217 Ga0075370_10002495
1218 Ga0075370_10022024
1219 Ga0075370_10181913
1220 Ga0068871_100002664
1221 Ga0068871_100042592
1222 Ga0068871_100114905
1223 Ga0068871_100373297
1224 Ga0068865_100687602
1225 Ga0097620_100006383
1226 Ga0097620_100028370
1227 Ga0097620_100032249
1228 Ga0097620_100041599
1229 Ga0097620_100204114
1230 Ga0099794_10058192
1231 Ga0105251_10023093
1232 Ga0105244_10000008
1233 Ga0105244_10044571
1234 Ga0105240_10033261
1235 Ga0105240_10066593
1236 Ga0105240_10356120
1237 Ga0105240_10398424
1238 Ga0105240_10679558
1239 Ga0105245_10036163
1240 Ga0105245_10138735
1241 Ga0105245_10225969
1242 Ga0105245_10319392
1243 Ga0105245_10458339
1244 Ga0105247_10008662
1245 Ga0114129_10414989
1246 Ga0114129_10454489
1247 Ga0114129_10773577
1248 Ga0105243_10091923
1249 Ga0105243_10361206
1250 Ga0105241_10036083
1251 Ga0105241_10157185
1252 Ga0105242_10208879
1253 Ga0105248_10041378
1254 Ga0105248_10061180
1255 Ga0105248_10088563
1256 Ga0105248_10364460
1257 Ga0105248_10447472
1258 Ga0105248_10689781
1259 Ga0105237_10000397
1260 Ga0105237_10009247
1261 Ga0105237_10019781
1262 Ga0105237_10054607
1263 Ga0105238_10001007
1264 Ga0105238_10038235
1265 Ga0105238_10105265
1266 Ga0105238_10158573
1267 Ga0105238_10314728
1268 Ga0105238_10405995
1269 Ga0105249_10028900
1270 Ga0105249_10161350
1271 Ga0105249_10388482
1272 Ga0123341_1000002
1273 Ga0123342_1030249
1274 Ga0105239_10014766
1275 Ga0105239_10050615
1276 Ga0105239_10161991
1277 Ga0105239_10572027
1278 Ga0157373_10107585
1279 Ga0157370_10009932
1280 Ga0157370_10075580
1281 Ga0157369_10082358
1282 Ga0157369_10188646
1283 Ga0157374_10025942
1284 Ga0157374_10033943
1285 Ga0157374_10167215
1286 Ga0157378_10045061
1287 Ga0157378_10136529
1288 Ga0163162_10024703
1289 Ga0163162_10045548
1290 Ga0163162_10057983
1291 Ga0163162_10423131
1292 Ga0163162_10739421
1293 Ga0157372_10011373
1294 Ga0157372_10708737
1295 Ga0157375_10008005
1296 Ga0157375_10023236
1297 Ga0157375_10356582
1298 Ga0163163_10261173
1299 Ga0157380_10014846
1300 Ga0157380_10069262
1301 Ga0157380_10240615
1302 Ga0157380_10359558
1303 Ga0182008_10036580
1304 Ga0157377_10040065
1305 Ga0157379_10032980
1306 Ga0157379_10048368
1307 Ga0157379_10079481
1308 Ga0157379_10110685
1309 Ga0157379_10146008
1310 Ga0157379_10172661
1311 Ga0157379_10188227
1312 Ga0157376_10017989
1313 Ga0157376_10300346
1314 Ga0157376_10415360
1315 Ga0163161_10000375
1316 Ga0163161_10015393
1317 Ga0163161_10046661
1318 Ga0163161_10473372
1319 Ga0214544_1000010
1320 Ga0214542_1000023
1321 Ga0214543_1000019
1322 Ga0214543_1000132
1323 Ga0213872_10025047
1324 Ga0213872_10065659
1325 Ga0213876_10007178
1326 Ga0209026_1000100
1327 Ga0209148_1000069
1328 Ga0209148_1003960
1329 Ga0209759_1000549
1330 Ga0209233_1000028
1331 Ga0209455_1000135
1332 Ga0209130_1000098
1333 Ga0207426_1000069
1334 Ga0207656_10033061
1335 Ga0207656_10093293
1336 Ga0207655_1000083
1337 Ga0207642_10003301
1338 Ga0207642_10017892
1339 Ga0207642_10079957
1340 Ga0207642_10306952
1341 Ga0207710_10020079
1342 Ga0207688_10048621
1343 Ga0207680_10008233
1344 Ga0207680_10037305
1345 Ga0207645_10014615
1346 Ga0207645_10063671
1347 Ga0207645_10080212
1348 Ga0207645_10111210
1349 Ga0207645_10150484
1350 Ga0207643_10037483
1351 Ga0207705_10193299
1352 Ga0207707_10013657
1353 Ga0207695_10038212
1354 Ga0207695_10076226
1355 Ga0207695_10096031
1356 Ga0207695_10253863
1357 Ga0207671_10001048
1358 Ga0207671_10011147
1359 Ga0207671_10048066
1360 Ga0207671_10107859
1361 Ga0207671_10206365
1362 Ga0207660_10152323
1363 Ga0207662_10091224
1364 Ga0207657_10126788
1365 Ga0207649_10016189
1366 Ga0207649_10046174
1367 Ga0207649_10092468
1368 Ga0207652_10209720
1369 Ga0207681_10002332
1370 Ga0207681_10153866
1371 Ga0207694_10000939
1372 Ga0207694_10024125
1373 Ga0207694_10041236
1374 Ga0207650_10003921
1375 Ga0207650_10329831
1376 Ga0207659_10002102
1377 Ga0207659_10004947
1378 Ga0207659_10112987
1379 Ga0207644_10000391
1380 Ga0207644_10148455
1381 Ga0207706_10012440
1382 Ga0207706_10117616
1383 Ga0207686_10061306
1384 Ga0207686_10129417
1385 Ga0207709_10040090
1386 Ga0207709_10331959
1387 Ga0207670_10363940
1388 Ga0207669_10230800
1389 Ga0207704_10002411
1390 Ga0207704_10003969
1391 Ga0207704_10156931
1392 Ga0207704_10253923
1393 Ga0207691_10106812
1394 Ga0207691_10416751
1395 Ga0207711_10075706
1396 Ga0207711_10135078
1397 Ga0207711_10259726
1398 Ga0207711_10293817
1399 Ga0207689_10001138
1400 Ga0207689_10001210
1401 Ga0207689_10025123
1402 Ga0207689_10046936
1403 Ga0207689_10068759
1404 Ga0207679_10115679
1405 Ga0207679_10406468
1406 Ga0207667_10070326
1407 Ga0207667_10168889
1408 Ga0207667_10703046
1409 Ga0207712_10014157
1410 Ga0207712_10149895
1411 Ga0207668_10081767
1412 Ga0207658_10014043
1413 Ga0207658_10041836
1414 Ga0207658_10060711
1415 Ga0207677_10002667
1416 Ga0207677_10050917
1417 Ga0207677_10057425
1418 Ga0207703_10009260
1419 Ga0207703_10021839
1420 Ga0207703_10184954
1421 Ga0207703_10186380
1422 Ga0207703_10415708
1423 Ga0207639_10007355
1424 Ga0207639_10024149
1425 Ga0207639_10043661
1426 Ga0207639_10083123
1427 Ga0207639_10188821
1428 Ga0207639_10694793
1429 Ga0207678_10028557
1430 Ga0207678_10043551
1431 Ga0207678_10322066
1432 Ga0207708_10007488
1433 Ga0207708_10077668
1434 Ga0207708_10101084
1435 Ga0207708_10551199
1436 Ga0207641_10003042
1437 Ga0207641_10064788
1438 Ga0207641_10106666
1439 Ga0207641_10171221
1440 Ga0207648_10002672
1441 Ga0207648_10020858
1442 Ga0207648_10023482
1443 Ga0207648_10082941
1444 Ga0207648_10115887
1445 Ga0207648_10651299
1446 Ga0207676_10020763
1447 Ga0207676_10103059
1448 Ga0207676_10214101
1449 Ga0207674_10021614
1450 Ga0207674_10028028
1451 Ga0207674_10041929
1452 Ga0207674_10042765
1453 Ga0207674_10043491
1454 Ga0207675_100006819
1455 Ga0207675_100013077
1456 Ga0207675_100013316
1457 Ga0207675_100027523
1458 Ga0207683_10066240
1459 Ga0207683_10087595
1460 Ga0207698_10012540
1461 Ga0207698_10110387
1462 Ga0207428_10088859
1463 Ga0268266_10000257
1464 Ga0268266_10033856
1465 Ga0268266_10067552
1466 Ga0268266_10099515
1467 Ga0268266_10123949
1468 Ga0268266_10181019
1469 Ga0268265_10101967
1470 Ga0268265_10119785
1471 Ga0268265_10136798
1472 Ga0268265_10165509
1473 Ga0268265_10241758
1474 Ga0268264_10001001
1475 Ga0268264_10003066
1476 Ga0268264_10023023
1477 Ga0268264_10081093
1478 Ga0268264_10198848
1479 Ga0307515_10001956
1480 Ga0265332_10070180
1481 Ga0265325_10012043
1482 Ga0265340_10103457
1483 Ga0265339_10215540
1484 Ga0265331_10021115
1485 Ga0265331_10092429
1486 Ga0265316_10448039
1487 Ga0307513_10154305
1488 Ga0307408_100184963
1489 Ga0265313_10066804
1490 Ga0265314_10036505
1491 Ga0265314_10207403
1492 Ga0307405_10055754
1493 Ga0307413_10154821
1494 Ga0307413_10391905
1495 Ga0307406_10165481
1496 Ga0307406_10182726
1497 Ga0307406_10212650
1498 Ga0307407_10135268
1499 Ga0307412_10364108
1500 Ga0307409_100071106
1501 Ga0307409_100435895
1502 Ga0307416_100011529
1503 Ga0307416_100025422
1504 Ga0307411_10175938
1505 Ga0307415_100112335
1506 Ga0307415_100271516
1507 Ga0373962_0019366
1508 Ga0373931_0030437
1509 Ga0395899_0084472
1510 Ga0395900_0014410
1511 Ga0395900_0117317
1512 Ga0395898_0250599
1513 Ga0395905_0015692
1514 Ga0395905_0133797
1515 Ga0395905_0252820
1516 Ga0395905_0344751
1517 Ga0395901_0047074
1518 Ga0395901_0076932
1519 Ga0395901_0151688
1520 Ga0436365_0551841
1521 Ga0436365_1295259
1522 Ga0436361_0060394
1523 Ga0436361_0845671
1524 Ga0439438_000021
1525 Ga0439447_002674
1526 Ga0439465_0035766
1527 Ga0451841_0277328
1528 Ga0451843_1665491
1529 Ga0451855_1135979
1530 Ga0451853_1535672
1531 Ga0451853_3126826
1532 Ga0439445_0079000
1533 Ga0439432_020645
1534 Ga0439450_033059
1535 Ga0450908_012082
1536 Ga0439435_0050826
1537 Ga0439464_0006733
1538 Ga0466972_0029385
1539 Ga0451576_0064685
1540 Ga0466958_0157855
1541 Ga0466967_0306169
1542 Ga0495627_001317
1543 Ga0495591_002496
1544 Ga0495629_0199720
1545 Ga0495638_0042235
1546 Ga0495638_0215387
1547 Ga0495650_0000008
1548 Ga0495650_0013567
1549 Ga0495650_0062159
1550 Ga0495580_0016298
1551 Ga0495605_0019290
1552 Ga0495605_0031401
1553 Ga0495584_0022473
1554 Ga0495596_0112964
1555 Ga0495607_0009540
1556 Ga0495607_0148138
1557 Ga0495606_0001619
1558 Ga0495610_0018917
1559 Ga0495616_0013102
1560 Ga0495620_0016163
1561 Ga0495628_0532409
1562 Ga0495631_0056290
1563 Ga0495631_0078236
1564 Ga0495632_0024918
1565 Ga0495637_0078976
1566 Ga0495643_0128851
1567 Ga0495644_0025575
1568 Ga0495648_0007216
1569 Ga0495648_0014184
1570 Ga0495648_0031408
1571 Ga0495654_0076200
1572 Ga0495621_0047296
1573 Ga0495597_0013170
1574 Ga0495597_0091737
1575 Ga0495656_0000137
1576 Ga0495656_0012841
1577 Ga0495668_0036681
1578 Ga0495668_0044095
1579 Ga0495625_0005544
1580 Ga0495625_0021804
1581 Ga0495625_0145329
1582 Ga0495625_0247566
1583 Ga0495624_0097942
1584 Ga0495671_0009568
1585 Ga0495649_0003827
1586 Ga0495649_0051331
1587 Ga0495589_0016275
1588 Ga0495660_0000019
1589 Ga0495660_0053584
1590 Ga0495672_0000003
1591 Ga0495676_0041260
1592 Ga0495680_0199987
1593 Ga0495683_0060105
1594 Ga0495687_000315
1595 Ga0495687_004781
1596 Ga0495673_0000011
1597 Ga0495681_0046366
1598 Ga0495686_0024783
1599 Ga0495686_0025877
1600 Ga0495686_0052543
1601 Ga0495686_0058797
1602 Ga0495593_0034342
1603 Ga0495602_0349358
1604 Ga0495615_0019143
1605 Ga0495615_0031301
1606 Ga0496102_0031944
1607 Ga0496105_0431673
1608 Ga0496106_0015363
1609 Ga0496107_0057456
1610 Ga0496108_0083530
1611 Ga0496108_0137129
1612 Ga0496108_0559098
1613 Ga0496109_0275367
1614 Ga0496110_0008710
1615 Ga0496111_0082657
1616 Ga0496112_0001731
1617 Ga0496112_0690544
1618 Ga0496113_0165586
1619 Ga0496114_0280180
1620 Ga0496116_0000076
1621 Ga0496119_0000044
1622 Ga0496119_0001021
1623 Ga0496119_0010974
1624 Ga0496120_0000044
1625 Ga0496120_0000073
1626 Ga0496120_0002155
1627 Ga0496120_0020849
1628 Ga0496121_0154062
1629 Ga0496121_0167571
1630 Ga0496124_0392689
1631 Ga0496125_0066554
1632 Ga0496126_0046351
1633 Ga0496126_0152871
1634 Ga0495678_000479
1635 Ga0495682_0000006
1636 Ga0501031_0026318
1637 Ga0501031_0058101
1638 Ga0501032_0000018
1639 Ga0501032_0012010
1640 Ga0501032_0016409
1641 Ga0501032_0145442
1642 Ga0501033_0000032
1643 Ga0501033_0010055
1644 Ga0501033_0022431
1645 Ga0501033_0048959
1646 Ga0501034_0000103
1647 Ga0501034_0000444
1648 Ga0501034_0013483
1649 Ga0501034_0026618
1650 Ga0501034_0043168
1651 Ga0501034_0050527
1652 Ga0501034_0051840
1653 Ga0501034_0053228
1654 Ga0501034_0085368
1655 Ga0501034_0176639
1656 Ga0501034_0177927
1657 Ga0501034_0201026
1658 Ga0501034_0371386
1659 Ga0501034_0584761
1660 Ga0501036_0000012
1661 Ga0501036_0021735
1662 Ga0501036_0357484
1663 Ga0501037_0000018
1664 Ga0501037_0070785
1665 Ga0501037_0361101
1666 Ga0501038_0000017
1667 Ga0501038_0035575
1668 Ga0501039_0000024
1669 Ga0501039_0085075
1670 Ga0501039_0095117
1671 Ga0501040_0040528
1672 Ga0501043_0004332
1673 Ga0501043_0035219
1674 Ga0501043_0040158
1675 Ga0501043_0047170
1676 Ga0501043_0126877
1677 Ga0501043_0210059
1678 Ga0501046_0020293
1679 Ga0501047_0004558
1680 Ga0501047_0008752
1681 Ga0501047_0075346
1682 Ga0501047_0084654
1683 Ga0501047_0086899
1684 Ga0501047_0134003
1685 Ga0501047_0242319
1686 Ga0501047_0289007
1687 Ga0501067_0017674
1688 Ga0501068_0000614
1689 Ga0501068_0026011
1690 Ga0501069_0010352
1691 Ga0501069_0013466
1692 Ga0501069_0043505
1693 Ga0501070_0007753
1694 Ga0501070_0026001
1695 Ga0501070_0093477
1696 Ga0501070_0145407
1697 Ga0501070_0364503
1698 Ga0501071_0014047
1699 Ga0501072_0274843
1700 Ga0501073_0000143
1701 Ga0501073_0016948
1702 Ga0501073_0025527
1703 Ga0501073_0031477
1704 Ga0501073_0087298
1705 Ga0501073_0090803
1706 Ga0501073_0099760
1707 Ga0501073_0144825
1708 Ga0501073_0248679
1709 Ga0501074_0031683
1710 Ga0501074_0043632
1711 Ga0501074_0185745
1712 Ga0501076_0069235
1713 Ga0501077_0004814
1714 Ga0501079_0172456
1715 Ga0501080_0000955
1716 Ga0501080_0016628
1717 Ga0501080_0035296
1718 Ga0501080_0290864
1719 Ga0501080_0311304
1720 Ga0501080_0408157
1721 Ga0501080_0691419
1722 Ga0501083_0008455
1723 Ga0501083_0044759
1724 Ga0501083_0064134
1725 Ga0501083_0080260
1726 Ga0501035_0000040
1727 Ga0501035_0005942
1728 Ga0501035_0010917
1729 Ga0501035_0013756
1730 Ga0501035_0031169
1731 Ga0501035_0047332
1732 Ga0501035_0108123
1733 Ga0501035_0155127
1734 Ga0501044_0000040
1735 Ga0501044_0007916
1736 Ga0501044_0013108
1737 Ga0501044_0059837
1738 Ga0501044_0061348
1739 Ga0501044_0064588
1740 Ga0501044_0395455
1741 nmdc:mga03683_114917_c1
1742 nmdc:mga03683_57021_c1
1743 nmdc:mga0yw44_177287_c1
1744 nmdc:mga0yw44_315155_c1
1745 nmdc:mga0yw44_82007_c1
1746 nmdc:mga0k408_45484_c1
1747 nmdc:mga0k408_68018_c1
1748 nmdc:mga06z11_257117_c1
1749 nmdc:mga06z11_308338_c1
1750 nmdc:mga04h51_79090_c1
1751 nmdc:mga07m45_17151_c1
1752 nmdc:mga07m45_378_c1
1753 nmdc:mga05p37_346908_c1
1754 nmdc:mga06r32_15012_c1
1755 nmdc:mga06r32_212448_c1
1756 nmdc:mga08y16_430057_c1
1757 nmdc:mga0sz30_116209_c1
1758 nmdc:mga0sz30_41876_c1
1759 Ga0495619_0314681
1760 Ga0500643_022254
1761 Ga0500555_021183
1762 Ga0500562_055410
1763 Ga0500621_000004
1764 Ga0500568_0000010
1765 Ga0500568_0017450
1766 Ga0500616_0055079
1767 Ga0500616_0145217
1768 Ga0500620_000598
1769 Ga0500622_0000734
1770 Ga0500622_0045878
1771 Ga0500627_0161288
1772 Ga0500645_002075
1773 Ga0501084_0086241
1774 Ga0501082_0017173
1775 Ga0501082_0442417
1776 2871441915
1777 2503199714
1778 2506580941
1779 2506586080
1780 2509116655
1781 2509142467
1782 2509372055
1783 2509394643
1784 2510136115
1785 2510318778
1786 2510892882
1787 2512932870
1788 2512960891
1789 2513568416
1790 2513571888
1791 2513608981
1792 2513630727
1793 2513711921
1794 2514018250
1795 2514036663
1796 2514417286
1797 2514585981
1798 2515108958
1799 2515633037
1800 2515640242
1801 2515656323
1802 2515853372
1803 2517040899
1804 2517098499
1805 2588518926
1806 2597811080
1807 2599939860
1808 2616297886
1809 2643987609
1810 2644157870
1811 2644169376
1812 2644169825
1813 2644195208
1814 2644241132
1815 2644350461
1816 2644350773
1817 2656276776
1818 2688596966
1819 2689447492
1820 2694630225
1821 2694634305
1822 2723574116
1823 2725949384
1824 2739612373
1825 2765464463
1826 2766064607
1827 2776267091
1828 2776283434
1829 2792748281
1830 2793315014
1831 2793322548
1832 2793356265
1833 2838024757
1834 2838046870
1835 2838668896
1836 2838701444
1837 2839997337
1838 2840765801
1839 2841737462
1840 2842113798
1841 2842146491
1842 2842194118
1843 2842200138
1844 2842209930
1845 2842219644
1846 2842251279
1847 2842283384
1848 2842288119
1849 2842405385
1850 2842411858
1851 2842418615
1852 2842494805
1853 2842500841
1854 2844012307
1855 2847674706
1856 2847690815
1857 2851186195
1858 2854917309
1859 2855196576
1860 2856317408
1861 2856328731
1862 2856338338
1863 2856349200
1864 2856355334
1865 2856366857
1866 2857352255
1867 2857370918
1868 2857523132
1869 2869168561
1870 2869175169
1871 2869241877
1872 2869249189
1873 2869249922
1874 2869262911
1875 2869276239
1876 2869285653
1877 2869287731
1878 2871284461
1879 2871435679
1880 2871445479
1881 2871452877
1882 2871460251
1883 2871473272
1884 2871480887
1885 2871496544
1886 2874105293
1887 2874115110
1888 2874119248
1889 2874132901
1890 2874142009
1891 2874151362
1892 2874158996
1893 2874163034
1894 2874175073
1895 2876364880
1896 2876377286
1897 2876387077
1898 2876397708
1899 2876405592
1900 2876413852
1901 2876417415
1902 2878038446
1903 2878733083
1904 2878744807
1905 2878749242
1906 2878757562
1907 2878760772
1908 2878767603
1909 2878784098
1910 2878794336
1911 2881149590
1912 2881160771
1913 2881166469
1914 2881849486
1915 2881860505
1916 2881863131
1917 2882639383
1918 2882918380
1919 2885307950
1920 2885313128
1921 2885319415
1922 2885326734
1923 2885340995
1924 2885356108
1925 2888354698
1926 2889016313
1927 2889018664
1928 2889794442
1929 2889914953
1930 2894026861
1931 2900053985
1932 2900054458
1933 2903498706
1934 2903501292
1935 2903522384
1936 2903528763
1937 2903541338
1938 2904542417
1939 2904664359
1940 2906310280
1941 2906324345
1942 2906333159
1943 2906355226
1944 2906365978
1945 2906375160
1946 2906384876
1947 2906387086
1948 2906394381
1949 2906407986
1950 2906414051
1951 2906417473
1952 2913301660
1953 2919173906
1954 2922138325
1955 2922153686
1956 2922159040
1957 2922172652
1958 2922179550
1959 2922188375
1960 2924712192
1961 2924730220
1962 2924733918
1963 2924743665
1964 2924749216
1965 2924767248
1966 2924782838
1967 2924786857
1968 2929167669
1969 2933589566
1970 2936373589
1971 2936374699
1972 2936375866
1973 2937817104
1974 2937822548
1975 2937840302
1976 2937847024
1977 2937852483
1978 2937883621
1979 2937892977
1980 2937977570
1981 2937995194
1982 2938016112
1983 2958041668
1984 2958047950
1985 2958070661
1986 2958071511
1987 2958090789
1988 2958093536
1989 2958102442
1990 2958113401
1991 2958120911
1992 2958128981
1993 2958132133
1994 2958138031
1995 2958164490
1996 2958165541
1997 2958174260
1998 2958181947
1999 2961079791
2000 2961119358
2001 2961132269
2002 2961139723
2003 2961164000
2004 2961175111
2005 2961188401
2006 2963646336
2007 2965018934
2008 2965027035
2009 2965040200
2010 2965046269
2011 2965062847
2012 2965090430
2013 2965117065
2014 2965125245
2015 2967999888
2016 2968008247
2017 2968020461
2018 2968087138
2019 2968091312
2020 2968103140
2021 2968115613
2022 2968118986
2023 2968128930
2024 2968143472
2025 2968172403
2026 2970473758
2027 2970490429
2028 2970507699
2029 2970516849
2030 2970527094
2031 2970534772
2032 2970544535
2033 2970548273
2034 2970555625
2035 2970600269
2036 2970620167
2037 2977826719
2038 2977832939
2039 2977847395
2040 2977854159
2041 2977861730
2042 2977871925
2043 2977873983
2044 2977921921
2045 2977925277
2046 2977940645
2047 2977945674
2048 2977964757
2049 2977973944
2050 2977991287
2051 2979715663
2052 2979745632
2053 2979771260
2054 2979782194
2055 2979793979
2056 2979812883
2057 2987639439
2058 2987648062
2059 2987653914
2060 2987660008
2061 2987673446
2062 2996316552
2063 2996341633
2064 2996342788
2065 2996352919
2066 2996393295
2067 2996895732
2068 3000139312
2069 3003931263
2070 3004167353
2071 3004189056
2072 3004204317
2073 3004217771
2074 3004221181
2075 3004232810
2076 3004243378
2077 3004269930
2078 3004279601
2079 3004290610
2080 3004336058
2081 639645356
2082 649871524
2083 8004301844
2084 8004314683
2085 8004379135
2086 8004389516
2087 8004402195
2088 8004451787
2089 8004637406
2090 8004644028
2091 8004712337
2092 8004717914
2093 8004734035
2094 8005290826
2095 8005301296
2096 8005380540
2097 8005384501
2098 8005397813
2099 8005467551
2100 8005559466
2101 8005566487
2102 8005688889
2103 8018132315
2104 8018163761
2105 8024481423
2106 8024501837
2107 8054560632
2108 8054568395
2109 8055619183
2110 8057881284

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09370

PEP_hydrolase

Phosphoenolpyruvate hydrolase-like

194

330

0.98

PF09370

PEP_hydrolase

Phosphoenolpyruvate hydrolase-like

4

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p10-assembly1.cif.gz_E crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9357 4 277
2p10-assembly1.cif.gz_D crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9346 4 277
2p10-assembly1.cif.gz_E crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9295 4 277
2p10-assembly1.cif.gz_F crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9292 4 277
2p10-assembly1.cif.gz_D crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9244 4 277
ID Description Score Start End Superfamily
af_A0A1D6FD56_1_198_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9354 55 252 3.20.20.70
2p10E01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9341 4 252 3.20.20.70
af_A0A1D6FD56_1_198_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9308 55 252 3.20.20.70
af_A0A1D6MLW1_1_166_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9293 57 218 3.20.20.70
2p10E01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9263 4 252 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A527VN36-F1-model_v4 Phosphoenolpyruvate hydrolase family protein 0.9969 156 240 GO:0016787
AF-A0A5K0XTA2-F1-model_v4 TIM-barrel domain-containing protein 0.9899 145 227 GO:0003824
AF-A0A530ATE5-F1-model_v4 deleted 0.9859 75 279
AF-A0A528AZZ8-F1-model_v4 Phosphoenolpyruvate hydrolase family protein 0.9844 110 245 GO:0016787
AF-L8GJP6-F1-model_v4 Transcriptional regulator, putative 0.9836 130 276 GO:0003824

Map