F489167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 662 | 2110 | 279 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2871435913|2871441915 |
| Length | 336 |
| Sequence | PRKDILKKFRGMIDKGVPIVGGGAGTGLSAKAEEAGGIDLIIIYNSGRYRMAGRGSAAGLLAYGNANEIVKEMAYEVLPVVRHTPVLAGVNGTDPFVIMPLLLAELKTMGFSGVQNFPTIGLFDGSMRQSFEETGMGFGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVDMIAEAHKLDLLTTPYVFNPDEARAMTKAGADIVVAHMGVTTGGSIGATSAKSLDDCVVEIDAIANAARSVRKDVILLCHGGPISMPDDARYILSHAKGLHGFYGASSMERLPAEAAIARQTADFKSVTLGGQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 94 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 112 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 113 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 204 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 205 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 206 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 207 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 208 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 209 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 210 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 211 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 212 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 213 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 214 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 215 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 216 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 277 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 325 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 329 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 330 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 335 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 336 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 337 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 338 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 339 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 340 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 341 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 342 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 343 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 344 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 345 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 346 | 2512875024 | |||
| 347 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 348 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 349 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 350 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 351 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 352 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 353 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 354 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 355 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 356 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 357 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 358 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 359 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 360 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 361 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 362 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 363 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 364 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 365 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 366 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 367 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 368 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 369 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 370 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 371 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 372 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 373 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 374 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 375 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 376 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 377 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 378 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 379 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 380 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 381 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 382 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 383 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 384 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 385 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 386 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 387 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 388 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 389 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 390 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 391 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 392 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 393 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 394 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 395 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 396 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 397 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 398 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 399 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 400 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 401 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 402 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 403 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 404 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 405 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 406 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 407 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 408 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 409 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 410 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 411 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 412 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 413 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 414 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 415 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 416 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 417 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 418 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 419 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 420 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 421 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 422 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 423 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 424 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 425 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 426 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 427 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 428 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 429 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 430 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 431 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 432 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 433 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 434 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 435 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 436 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 437 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 438 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 439 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 440 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 441 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 442 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 443 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 444 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 445 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 446 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 447 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 448 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 449 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 450 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 451 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 452 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 453 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 454 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 455 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 456 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 457 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 458 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 459 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 460 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 461 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 462 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 463 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 464 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 465 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 466 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 467 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 468 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 469 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 470 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 471 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 472 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 473 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 474 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 475 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 476 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 477 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 478 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 479 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 480 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 481 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 482 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 483 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 484 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 485 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 486 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 487 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 488 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 489 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 490 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 491 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 492 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 493 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 494 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 495 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 496 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 497 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 498 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 499 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 500 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 501 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 502 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 503 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 504 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 505 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 506 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 507 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 508 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 509 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 510 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 511 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 512 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 513 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 514 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 515 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 516 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 517 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 518 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 519 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 520 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 521 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 522 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 523 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 524 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 525 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 526 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 527 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 528 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 529 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 530 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 531 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 532 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 533 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 534 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 535 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 536 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 537 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 538 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 539 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 540 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 541 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 542 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 543 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 544 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 545 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 546 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 547 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 548 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 549 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 550 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 551 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 552 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 553 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 554 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 555 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 556 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 557 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 558 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 559 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 560 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 561 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 562 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 563 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 564 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 565 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 566 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 567 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 568 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 569 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 570 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 571 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 572 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 573 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 574 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 575 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 576 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 577 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 578 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 579 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 580 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 581 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 582 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 583 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 584 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 585 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 586 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 587 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 588 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 589 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 590 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 591 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 592 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 593 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 594 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 595 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 596 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 597 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 598 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 599 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 600 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 601 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 602 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 603 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 604 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 605 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 606 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 607 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 608 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 609 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 610 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 611 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 612 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 613 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 614 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 615 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 616 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 617 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 618 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 619 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 620 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 621 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 622 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 623 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 624 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 625 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 626 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 627 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 628 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 629 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 630 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 631 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 632 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 633 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 634 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 635 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 636 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 637 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 638 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 639 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 640 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 641 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 642 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 643 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 644 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 645 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 646 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 647 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 648 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 649 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 650 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 651 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 652 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 653 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 654 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 655 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 656 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 657 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 658 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 659 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 660 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 661 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 662 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.25 |
| Metatranscriptomes | 0 |
| Isolates | 31.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.69 |
| Nodule | 26.45 |
| Rhizoplane | 1.52 |
| Rhizosphere | 59.05 |
| Stem | 0 |
| Stem Tuber | 0.38 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10022936 | 3300001989 | Bacteria | 2211 |
| 2 | JGI25159J45721_1000461 | 3300002987 | Bacteria | 18823 |
| 3 | JGI25165J46597_1000034 | 3300003214 | Bacteria | 292458 |
| 4 | rootH2_10130272 | 3300003320 | Bacteria | 1771 |
| 5 | JGI25160J50197_1000248 | 3300003354 | Bacteria | 41777 |
| 6 | JGI25160J50197_1002309 | 3300003354 | Bacteria | 8942 |
| 7 | JGI25161J50226_1000183 | 3300003374 | Bacteria | 41777 |
| 8 | Ga0055542_1001063 | 3300003762 | Bacteria | 16922 |
| 9 | Ga0055529_1003010 | 3300003763 | Bacteria | 2960 |
| 10 | Ga0055524_1000850 | 3300003775 | Bacteria | 20030 |
| 11 | Ga0055528_1001807 | 3300003790 | Bacteria | 12257 |
| 12 | Ga0055543_1000245 | 3300004625 | Bacteria | 41815 |
| 13 | Ga0065165_1001012 | 3300005262 | Bacteria | 34230 |
| 14 | Ga0070658_10147445 | 3300005327 | Bacteria | 1968 |
| 15 | Ga0070658_10290359 | 3300005327 | Bacteria | 1393 |
| 16 | Ga0070658_10332977 | 3300005327 | Bacteria | 1298 |
| 17 | Ga0070676_10068798 | 3300005328 | Bacteria | 2120 |
| 18 | Ga0070683_100200023 | 3300005329 | Bacteria | 1897 |
| 19 | Ga0070690_100001510 | 3300005330 | Bacteria | 12195 |
| 20 | Ga0070690_100148394 | 3300005330 | Bacteria | 1598 |
| 21 | Ga0068869_100001072 | 3300005334 | Bacteria | 15972 |
| 22 | Ga0068869_100091578 | 3300005334 | Bacteria | 2287 |
| 23 | Ga0068869_100173041 | 3300005334 | Bacteria | 1688 |
| 24 | Ga0068869_100287153 | 3300005334 | Bacteria | 1324 |
| 25 | Ga0070666_10007488 | 3300005335 | Bacteria | 6729 |
| 26 | Ga0068868_100058831 | 3300005338 | Bacteria | 3038 |
| 27 | Ga0068868_100152931 | 3300005338 | Bacteria | 1901 |
| 28 | Ga0068868_100211375 | 3300005338 | Bacteria | 1621 |
| 29 | Ga0068868_100462246 | 3300005338 | Bacteria | 1105 |
| 30 | Ga0068868_100484783 | 3300005338 | Bacteria | 1081 |
| 31 | Ga0070660_100235649 | 3300005339 | Bacteria | 1490 |
| 32 | Ga0070660_100332888 | 3300005339 | Bacteria | 1249 |
| 33 | Ga0070689_100011792 | 3300005340 | Bacteria | 6271 |
| 34 | Ga0070689_100165543 | 3300005340 | Bacteria | 1789 |
| 35 | Ga0070661_100001089 | 3300005344 | Bacteria | 19198 |
| 36 | Ga0070661_100077522 | 3300005344 | Bacteria | 2450 |
| 37 | Ga0070661_100093694 | 3300005344 | Bacteria | 2225 |
| 38 | Ga0070661_100183246 | 3300005344 | Bacteria | 1594 |
| 39 | Ga0070692_10101388 | 3300005345 | Bacteria | 1578 |
| 40 | Ga0070668_100105638 | 3300005347 | Bacteria | 2236 |
| 41 | Ga0070668_100337545 | 3300005347 | Bacteria | 1272 |
| 42 | Ga0070669_100030183 | 3300005353 | Bacteria | 3910 |
| 43 | Ga0070669_100077937 | 3300005353 | Bacteria | 2463 |
| 44 | Ga0070669_100099619 | 3300005353 | Bacteria | 2190 |
| 45 | Ga0070675_100002305 | 3300005354 | Bacteria | 14175 |
| 46 | Ga0070671_100086319 | 3300005355 | Bacteria | 2625 |
| 47 | Ga0070671_100180420 | 3300005355 | Bacteria | 1787 |
| 48 | Ga0070674_100017239 | 3300005356 | Bacteria | 4539 |
| 49 | Ga0070674_100024016 | 3300005356 | Bacteria | 3954 |
| 50 | Ga0070673_100164516 | 3300005364 | Bacteria | 1889 |
| 51 | Ga0070659_100069612 | 3300005366 | Bacteria | 2793 |
| 52 | Ga0070659_100083833 | 3300005366 | Bacteria | 2548 |
| 53 | Ga0070667_100001504 | 3300005367 | Bacteria | 20851 |
| 54 | Ga0070667_100047622 | 3300005367 | Bacteria | 3607 |
| 55 | Ga0070667_100133328 | 3300005367 | Bacteria | 2170 |
| 56 | Ga0070667_100163109 | 3300005367 | Bacteria | 1964 |
| 57 | Ga0070667_100342299 | 3300005367 | Bacteria | 1353 |
| 58 | Ga0070701_10021078 | 3300005438 | Bacteria | 3104 |
| 59 | Ga0070705_100054268 | 3300005440 | Bacteria | 2350 |
| 60 | Ga0070700_100102045 | 3300005441 | Bacteria | 1892 |
| 61 | Ga0070694_100277084 | 3300005444 | Bacteria | 1277 |
| 62 | Ga0070663_100120191 | 3300005455 | Bacteria | 1983 |
| 63 | Ga0070678_100044742 | 3300005456 | Bacteria | 3163 |
| 64 | Ga0070678_100103935 | 3300005456 | Bacteria | 2208 |
| 65 | Ga0070678_100108089 | 3300005456 | Bacteria | 2171 |
| 66 | Ga0070678_100401568 | 3300005456 | Bacteria | 1191 |
| 67 | Ga0070662_100007515 | 3300005457 | Bacteria | 7069 |
| 68 | Ga0070662_100023880 | 3300005457 | Bacteria | 4206 |
| 69 | Ga0070681_10024387 | 3300005458 | Bacteria | 6088 |
| 70 | Ga0068867_100015891 | 3300005459 | Bacteria | 5343 |
| 71 | Ga0068867_100020391 | 3300005459 | Bacteria | 4723 |
| 72 | Ga0068867_100165982 | 3300005459 | Bacteria | 1745 |
| 73 | Ga0070685_10209442 | 3300005466 | Bacteria | 1272 |
| 74 | Ga0070679_100225219 | 3300005530 | Bacteria | 1835 |
| 75 | Ga0070684_100109601 | 3300005535 | Bacteria | 2474 |
| 76 | Ga0068853_100006106 | 3300005539 | Bacteria | 9539 |
| 77 | Ga0068853_100009175 | 3300005539 | Bacteria | 7968 |
| 78 | Ga0068853_100027399 | 3300005539 | Bacteria | 4787 |
| 79 | Ga0068853_100074345 | 3300005539 | Bacteria | 2965 |
| 80 | Ga0070672_100067901 | 3300005543 | Bacteria | 2826 |
| 81 | Ga0070672_100097962 | 3300005543 | Bacteria | 2374 |
| 82 | Ga0070686_100012181 | 3300005544 | Bacteria | 4892 |
| 83 | Ga0070686_100080814 | 3300005544 | Bacteria | 2151 |
| 84 | Ga0070695_100366935 | 3300005545 | Bacteria | 1083 |
| 85 | Ga0070665_100023505 | 3300005548 | Bacteria | 6205 |
| 86 | Ga0070665_100031128 | 3300005548 | Bacteria | 5370 |
| 87 | Ga0070665_100032562 | 3300005548 | Bacteria | 5246 |
| 88 | Ga0070665_100063348 | 3300005548 | Bacteria | 3707 |
| 89 | Ga0070665_100099653 | 3300005548 | Bacteria | 2910 |
| 90 | Ga0070665_100197127 | 3300005548 | Bacteria | 2014 |
| 91 | Ga0070665_100237090 | 3300005548 | Bacteria | 1825 |
| 92 | Ga0070665_100477974 | 3300005548 | Bacteria | 1257 |
| 93 | Ga0070664_100065451 | 3300005564 | Bacteria | 3101 |
| 94 | Ga0070664_100528939 | 3300005564 | Bacteria | 1089 |
| 95 | Ga0068857_100031257 | 3300005577 | Bacteria | 4704 |
| 96 | Ga0068857_100032013 | 3300005577 | Bacteria | 4648 |
| 97 | Ga0068854_100049679 | 3300005578 | Bacteria | 2997 |
| 98 | Ga0068854_100152807 | 3300005578 | Bacteria | 1781 |
| 99 | Ga0068854_100193943 | 3300005578 | Bacteria | 1593 |
| 100 | Ga0068856_100034379 | 3300005614 | Bacteria | 4964 |
| 101 | Ga0068856_100034534 | 3300005614 | Bacteria | 4953 |
| 102 | Ga0068856_100198757 | 3300005614 | Bacteria | 2019 |
| 103 | Ga0068852_100007354 | 3300005616 | Bacteria | 8035 |
| 104 | Ga0068852_100205312 | 3300005616 | Bacteria | 1866 |
| 105 | Ga0068852_100349477 | 3300005616 | Bacteria | 1443 |
| 106 | Ga0068852_100505746 | 3300005616 | Bacteria | 1204 |
| 107 | Ga0068859_100006383 | 3300005617 | Bacteria | 11961 |
| 108 | Ga0068859_100028370 | 3300005617 | Bacteria | 5611 |
| 109 | Ga0068859_100032249 | 3300005617 | Bacteria | 5262 |
| 110 | Ga0068859_100041599 | 3300005617 | Bacteria | 4616 |
| 111 | Ga0068859_100204119 | 3300005617 | Bacteria | 2061 |
| 112 | Ga0068864_100028037 | 3300005618 | Bacteria | 4758 |
| 113 | Ga0068864_100036087 | 3300005618 | Bacteria | 4212 |
| 114 | Ga0068864_100048815 | 3300005618 | Bacteria | 3639 |
| 115 | Ga0068864_100061768 | 3300005618 | Bacteria | 3245 |
| 116 | Ga0068864_100125087 | 3300005618 | Bacteria | 2303 |
| 117 | Ga0068866_10011237 | 3300005718 | Bacteria | 3866 |
| 118 | Ga0068866_10075384 | 3300005718 | Bacteria | 1796 |
| 119 | Ga0068861_100002678 | 3300005719 | Bacteria | 11666 |
| 120 | Ga0068861_100018125 | 3300005719 | Bacteria | 5008 |
| 121 | Ga0068851_10000365 | 3300005834 | Bacteria | 20408 |
| 122 | Ga0068870_10124723 | 3300005840 | Bacteria | 1488 |
| 123 | Ga0068863_100006580 | 3300005841 | Bacteria | 11405 |
| 124 | Ga0068863_100080476 | 3300005841 | Bacteria | 3085 |
| 125 | Ga0068863_100096878 | 3300005841 | Bacteria | 2801 |
| 126 | Ga0068858_100004441 | 3300005842 | Bacteria | 13757 |
| 127 | Ga0068858_100028194 | 3300005842 | Bacteria | 5217 |
| 128 | Ga0068858_100035188 | 3300005842 | Bacteria | 4645 |
| 129 | Ga0068858_100231277 | 3300005842 | Bacteria | 1753 |
| 130 | Ga0068858_100478235 | 3300005842 | Bacteria | 1202 |
| 131 | Ga0068860_100004331 | 3300005843 | Bacteria | 14508 |
| 132 | Ga0068860_100022924 | 3300005843 | Bacteria | 6037 |
| 133 | Ga0068862_100033418 | 3300005844 | Bacteria | 4348 |
| 134 | Ga0068862_100043996 | 3300005844 | Bacteria | 3808 |
| 135 | Ga0068862_100064488 | 3300005844 | Bacteria | 3153 |
| 136 | Ga0068862_100121394 | 3300005844 | Bacteria | 2304 |
| 137 | Ga0068862_100375484 | 3300005844 | Bacteria | 1325 |
| 138 | Ga0081455_10080898 | 3300005937 | Bacteria | 2662 |
| 139 | Ga0081455_10146886 | 3300005937 | Bacteria | 1823 |
| 140 | Ga0081538_10004363 | 3300005981 | Bacteria | 13069 |
| 141 | Ga0081540_1096763 | 3300005983 | Bacteria | 1283 |
| 142 | Ga0081539_10002732 | 3300005985 | Bacteria | 23848 |
| 143 | Ga0081539_10005538 | 3300005985 | Bacteria | 12799 |
| 144 | Ga0081539_10006723 | 3300005985 | Bacteria | 10828 |
| 145 | Ga0075365_10002114 | 3300006038 | Bacteria | 9514 |
| 146 | Ga0075365_10044625 | 3300006038 | Bacteria | 2906 |
| 147 | Ga0075365_10145851 | 3300006038 | Bacteria | 1644 |
| 148 | Ga0075365_10271373 | 3300006038 | Bacteria | 1193 |
| 149 | Ga0075368_10028307 | 3300006042 | Bacteria | 2165 |
| 150 | Ga0075368_10062340 | 3300006042 | Bacteria | 1495 |
| 151 | Ga0075368_10125673 | 3300006042 | Bacteria | 1064 |
| 152 | Ga0075363_100163877 | 3300006048 | Bacteria | 1260 |
| 153 | Ga0075362_10048050 | 3300006177 | Bacteria | 1903 |
| 154 | Ga0075367_10111633 | 3300006178 | Bacteria | 1678 |
| 155 | Ga0075367_10122285 | 3300006178 | Bacteria | 1604 |
| 156 | Ga0075367_10125863 | 3300006178 | Bacteria | 1582 |
| 157 | Ga0075369_10131423 | 3300006186 | Bacteria | 1138 |
| 158 | Ga0097621_100028453 | 3300006237 | Bacteria | 4404 |
| 159 | Ga0097621_100035235 | 3300006237 | Bacteria | 3998 |
| 160 | Ga0097621_100040781 | 3300006237 | Bacteria | 3734 |
| 161 | Ga0097621_100048996 | 3300006237 | Bacteria | 3430 |
| 162 | Ga0075370_10002495 | 3300006353 | Bacteria | 8542 |
| 163 | Ga0075370_10022024 | 3300006353 | Bacteria | 3495 |
| 164 | Ga0075370_10181913 | 3300006353 | Bacteria | 1237 |
| 165 | Ga0068871_100002664 | 3300006358 | Bacteria | 12194 |
| 166 | Ga0068871_100042592 | 3300006358 | Bacteria | 3645 |
| 167 | Ga0068871_100114905 | 3300006358 | Bacteria | 2268 |
| 168 | Ga0068871_100373297 | 3300006358 | Bacteria | 1265 |
| 169 | Ga0068865_100687602 | 3300006881 | Bacteria | 873 |
| 170 | Ga0097620_100006383 | 3300006931 | Bacteria | 11961 |
| 171 | Ga0097620_100028370 | 3300006931 | Bacteria | 5611 |
| 172 | Ga0097620_100032249 | 3300006931 | Bacteria | 5262 |
| 173 | Ga0097620_100041599 | 3300006931 | Bacteria | 4616 |
| 174 | Ga0097620_100204114 | 3300006931 | Bacteria | 2061 |
| 175 | Ga0099794_10058192 | 3300007265 | Bacteria | 1873 |
| 176 | Ga0105251_10023093 | 3300009011 | Bacteria | 3217 |
| 177 | Ga0105244_10000008 | 3300009036 | Bacteria | 302297 |
| 178 | Ga0105244_10044571 | 3300009036 | Bacteria | 2285 |
| 179 | Ga0105240_10033261 | 3300009093 | Bacteria | 6665 |
| 180 | Ga0105240_10066593 | 3300009093 | Bacteria | 4467 |
| 181 | Ga0105240_10356120 | 3300009093 | Bacteria | 1659 |
| 182 | Ga0105240_10398424 | 3300009093 | Bacteria | 1551 |
| 183 | Ga0105240_10679558 | 3300009093 | Bacteria | 1126 |
| 184 | Ga0105245_10036163 | 3300009098 | Bacteria | 4386 |
| 185 | Ga0105245_10138735 | 3300009098 | Bacteria | 2288 |
| 186 | Ga0105245_10225969 | 3300009098 | Bacteria | 1808 |
| 187 | Ga0105245_10319392 | 3300009098 | Bacteria | 1529 |
| 188 | Ga0105245_10458339 | 3300009098 | Bacteria | 1285 |
| 189 | Ga0105247_10008662 | 3300009101 | Bacteria | 6199 |
| 190 | Ga0114129_10414989 | 3300009147 | Bacteria | 1772 |
| 191 | Ga0114129_10454489 | 3300009147 | Bacteria | 1679 |
| 192 | Ga0114129_10773577 | 3300009147 | Bacteria | 1227 |
| 193 | Ga0105243_10091923 | 3300009148 | Bacteria | 2500 |
| 194 | Ga0105243_10361206 | 3300009148 | Bacteria | 1337 |
| 195 | Ga0105241_10036083 | 3300009174 | Bacteria | 3720 |
| 196 | Ga0105241_10157185 | 3300009174 | Bacteria | 1865 |
| 197 | Ga0105242_10208879 | 3300009176 | Bacteria | 1738 |
| 198 | Ga0105248_10041378 | 3300009177 | Bacteria | 5166 |
| 199 | Ga0105248_10061180 | 3300009177 | Bacteria | 4227 |
| 200 | Ga0105248_10088563 | 3300009177 | Bacteria | 3484 |
| 201 | Ga0105248_10364460 | 3300009177 | Bacteria | 1627 |
| 202 | Ga0105248_10447472 | 3300009177 | Bacteria | 1455 |
| 203 | Ga0105248_10689781 | 3300009177 | Bacteria | 1152 |
| 204 | Ga0105237_10000397 | 3300009545 | Bacteria | 61927 |
| 205 | Ga0105237_10009247 | 3300009545 | Bacteria | 10567 |
| 206 | Ga0105237_10019781 | 3300009545 | Bacteria | 6951 |
| 207 | Ga0105237_10054607 | 3300009545 | Bacteria | 4003 |
| 208 | Ga0105238_10001007 | 3300009551 | Bacteria | 28742 |
| 209 | Ga0105238_10038235 | 3300009551 | Bacteria | 4874 |
| 210 | Ga0105238_10105265 | 3300009551 | Bacteria | 2803 |
| 211 | Ga0105238_10158573 | 3300009551 | Bacteria | 2238 |
| 212 | Ga0105238_10314728 | 3300009551 | Bacteria | 1551 |
| 213 | Ga0105238_10405995 | 3300009551 | Bacteria | 1356 |
| 214 | Ga0105249_10028900 | 3300009553 | Bacteria | 5004 |
| 215 | Ga0105249_10161350 | 3300009553 | Bacteria | 2167 |
| 216 | Ga0105249_10388482 | 3300009553 | Bacteria | 1423 |
| 217 | Ga0123341_1000002 | 3300009765 | Bacteria | 191257 |
| 218 | Ga0123342_1030249 | 3300009766 | Bacteria | 2736 |
| 219 | Ga0105239_10014766 | 3300010375 | Bacteria | 8662 |
| 220 | Ga0105239_10050615 | 3300010375 | Bacteria | 4556 |
| 221 | Ga0105239_10161991 | 3300010375 | Bacteria | 2500 |
| 222 | Ga0105239_10572027 | 3300010375 | Bacteria | 1288 |
| 223 | Ga0157373_10107585 | 3300013100 | Bacteria | 1960 |
| 224 | Ga0157370_10009932 | 3300013104 | Bacteria | 10080 |
| 225 | Ga0157370_10075580 | 3300013104 | Bacteria | 3175 |
| 226 | Ga0157369_10082358 | 3300013105 | Bacteria | 3443 |
| 227 | Ga0157369_10188646 | 3300013105 | Bacteria | 2167 |
| 228 | Ga0157374_10025942 | 3300013296 | Bacteria | 5268 |
| 229 | Ga0157374_10033943 | 3300013296 | Bacteria | 4658 |
| 230 | Ga0157374_10167215 | 3300013296 | Bacteria | 2144 |
| 231 | Ga0157378_10045061 | 3300013297 | Bacteria | 3918 |
| 232 | Ga0157378_10136529 | 3300013297 | Bacteria | 2274 |
| 233 | Ga0163162_10024703 | 3300013306 | Bacteria | 5935 |
| 234 | Ga0163162_10045548 | 3300013306 | Bacteria | 4395 |
| 235 | Ga0163162_10057983 | 3300013306 | Bacteria | 3900 |
| 236 | Ga0163162_10423131 | 3300013306 | Bacteria | 1464 |
| 237 | Ga0163162_10739421 | 3300013306 | Bacteria | 1103 |
| 238 | Ga0157372_10011373 | 3300013307 | Bacteria | 9468 |
| 239 | Ga0157372_10708737 | 3300013307 | Bacteria | 1171 |
| 240 | Ga0157375_10008005 | 3300013308 | Bacteria | 9255 |
| 241 | Ga0157375_10023236 | 3300013308 | Bacteria | 5717 |
| 242 | Ga0157375_10356582 | 3300013308 | Bacteria | 1628 |
| 243 | Ga0163163_10261173 | 3300014325 | Bacteria | 1783 |
| 244 | Ga0157380_10014846 | 3300014326 | Bacteria | 5706 |
| 245 | Ga0157380_10069262 | 3300014326 | Bacteria | 2846 |
| 246 | Ga0157380_10240615 | 3300014326 | Bacteria | 1631 |
| 247 | Ga0157380_10359558 | 3300014326 | Bacteria | 1365 |
| 248 | Ga0182008_10036580 | 3300014497 | Bacteria | 2456 |
| 249 | Ga0157377_10040065 | 3300014745 | Bacteria | 2593 |
| 250 | Ga0157379_10032980 | 3300014968 | Bacteria | 4618 |
| 251 | Ga0157379_10048368 | 3300014968 | Bacteria | 3796 |
| 252 | Ga0157379_10079481 | 3300014968 | Bacteria | 2936 |
| 253 | Ga0157379_10110685 | 3300014968 | Bacteria | 2466 |
| 254 | Ga0157379_10146008 | 3300014968 | Bacteria | 2133 |
| 255 | Ga0157379_10172661 | 3300014968 | Bacteria | 1951 |
| 256 | Ga0157379_10188227 | 3300014968 | Bacteria | 1865 |
| 257 | Ga0157376_10017989 | 3300014969 | Bacteria | 5407 |
| 258 | Ga0157376_10300346 | 3300014969 | Bacteria | 1520 |
| 259 | Ga0157376_10415360 | 3300014969 | Bacteria | 1304 |
| 260 | Ga0163161_10000375 | 3300017792 | Bacteria | 37352 |
| 261 | Ga0163161_10015393 | 3300017792 | Bacteria | 5332 |
| 262 | Ga0163161_10046661 | 3300017792 | Bacteria | 3126 |
| 263 | Ga0163161_10473372 | 3300017792 | Bacteria | 1016 |
| 264 | Ga0214544_1000010 | 3300021320 | Bacteria | 270164 |
| 265 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 266 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 267 | Ga0214543_1000132 | 3300021327 | Bacteria | 102506 |
| 268 | Ga0213872_10025047 | 3300021361 | Bacteria | 2744 |
| 269 | Ga0213872_10065659 | 3300021361 | Bacteria | 1638 |
| 270 | Ga0213876_10007178 | 3300021384 | Bacteria | 6072 |
| 271 | Ga0209026_1000100 | 3300025250 | Bacteria | 156131 |
| 272 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 273 | Ga0209148_1003960 | 3300025254 | Bacteria | 3806 |
| 274 | Ga0209759_1000549 | 3300025256 | Bacteria | 38630 |
| 275 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 276 | Ga0209455_1000135 | 3300025272 | Bacteria | 148007 |
| 277 | Ga0209130_1000098 | 3300025284 | Bacteria | 142506 |
| 278 | Ga0207426_1000069 | 3300025302 | Bacteria | 334513 |
| 279 | Ga0207656_10033061 | 3300025321 | Bacteria | 2152 |
| 280 | Ga0207656_10093293 | 3300025321 | Bacteria | 1369 |
| 281 | Ga0207655_1000083 | 3300025728 | Bacteria | 213295 |
| 282 | Ga0207642_10003301 | 3300025899 | Bacteria | 5072 |
| 283 | Ga0207642_10017892 | 3300025899 | Bacteria | 2707 |
| 284 | Ga0207642_10079957 | 3300025899 | Bacteria | 1584 |
| 285 | Ga0207642_10306952 | 3300025899 | Bacteria | 922 |
| 286 | Ga0207710_10020079 | 3300025900 | Bacteria | 2854 |
| 287 | Ga0207688_10048621 | 3300025901 | Bacteria | 2370 |
| 288 | Ga0207680_10008233 | 3300025903 | Bacteria | 5111 |
| 289 | Ga0207680_10037305 | 3300025903 | Bacteria | 2805 |
| 290 | Ga0207645_10014615 | 3300025907 | Bacteria | 5247 |
| 291 | Ga0207645_10063671 | 3300025907 | Bacteria | 2356 |
| 292 | Ga0207645_10080212 | 3300025907 | Bacteria | 2092 |
| 293 | Ga0207645_10111210 | 3300025907 | Bacteria | 1773 |
| 294 | Ga0207645_10150484 | 3300025907 | Bacteria | 1519 |
| 295 | Ga0207643_10037483 | 3300025908 | Bacteria | 2721 |
| 296 | Ga0207705_10193299 | 3300025909 | Bacteria | 1540 |
| 297 | Ga0207707_10013657 | 3300025912 | Bacteria | 7081 |
| 298 | Ga0207695_10038212 | 3300025913 | Bacteria | 5171 |
| 299 | Ga0207695_10076226 | 3300025913 | Bacteria | 3410 |
| 300 | Ga0207695_10096031 | 3300025913 | Bacteria | 2966 |
| 301 | Ga0207695_10253863 | 3300025913 | Bacteria | 1657 |
| 302 | Ga0207671_10001048 | 3300025914 | Bacteria | 33586 |
| 303 | Ga0207671_10011147 | 3300025914 | Bacteria | 7344 |
| 304 | Ga0207671_10048066 | 3300025914 | Bacteria | 3158 |
| 305 | Ga0207671_10107859 | 3300025914 | Bacteria | 2116 |
| 306 | Ga0207671_10206365 | 3300025914 | Bacteria | 1536 |
| 307 | Ga0207660_10152323 | 3300025917 | Bacteria | 1777 |
| 308 | Ga0207662_10091224 | 3300025918 | Bacteria | 1874 |
| 309 | Ga0207657_10126788 | 3300025919 | Bacteria | 2096 |
| 310 | Ga0207649_10016189 | 3300025920 | Bacteria | 4200 |
| 311 | Ga0207649_10046174 | 3300025920 | Bacteria | 2674 |
| 312 | Ga0207649_10092468 | 3300025920 | Bacteria | 1983 |
| 313 | Ga0207652_10209720 | 3300025921 | Bacteria | 1754 |
| 314 | Ga0207681_10002332 | 3300025923 | Bacteria | 12077 |
| 315 | Ga0207681_10153866 | 3300025923 | Bacteria | 1726 |
| 316 | Ga0207694_10000939 | 3300025924 | Bacteria | 25682 |
| 317 | Ga0207694_10024125 | 3300025924 | Bacteria | 4618 |
| 318 | Ga0207694_10041236 | 3300025924 | Bacteria | 3556 |
| 319 | Ga0207650_10003921 | 3300025925 | Bacteria | 10179 |
| 320 | Ga0207650_10329831 | 3300025925 | Bacteria | 1251 |
| 321 | Ga0207659_10002102 | 3300025926 | Bacteria | 11796 |
| 322 | Ga0207659_10004947 | 3300025926 | Bacteria | 8080 |
| 323 | Ga0207659_10112987 | 3300025926 | Bacteria | 2068 |
| 324 | Ga0207644_10000391 | 3300025931 | Bacteria | 28488 |
| 325 | Ga0207644_10148455 | 3300025931 | Bacteria | 1812 |
| 326 | Ga0207706_10012440 | 3300025933 | Bacteria | 7753 |
| 327 | Ga0207706_10117616 | 3300025933 | Bacteria | 2338 |
| 328 | Ga0207686_10061306 | 3300025934 | Bacteria | 2384 |
| 329 | Ga0207686_10129417 | 3300025934 | Bacteria | 1729 |
| 330 | Ga0207709_10040090 | 3300025935 | Bacteria | 2802 |
| 331 | Ga0207709_10331959 | 3300025935 | Bacteria | 1142 |
| 332 | Ga0207670_10363940 | 3300025936 | Bacteria | 1148 |
| 333 | Ga0207669_10230800 | 3300025937 | Bacteria | 1365 |
| 334 | Ga0207704_10002411 | 3300025938 | Bacteria | 8409 |
| 335 | Ga0207704_10003969 | 3300025938 | Bacteria | 6732 |
| 336 | Ga0207704_10156931 | 3300025938 | Bacteria | 1614 |
| 337 | Ga0207704_10253923 | 3300025938 | Bacteria | 1322 |
| 338 | Ga0207691_10106812 | 3300025940 | Bacteria | 2493 |
| 339 | Ga0207691_10416751 | 3300025940 | Bacteria | 1145 |
| 340 | Ga0207711_10075706 | 3300025941 | Bacteria | 2930 |
| 341 | Ga0207711_10135078 | 3300025941 | Bacteria | 2215 |
| 342 | Ga0207711_10259726 | 3300025941 | Bacteria | 1596 |
| 343 | Ga0207711_10293817 | 3300025941 | Bacteria | 1498 |
| 344 | Ga0207689_10001138 | 3300025942 | Bacteria | 25663 |
| 345 | Ga0207689_10001210 | 3300025942 | Bacteria | 24834 |
| 346 | Ga0207689_10025123 | 3300025942 | Bacteria | 4993 |
| 347 | Ga0207689_10046936 | 3300025942 | Bacteria | 3568 |
| 348 | Ga0207689_10068759 | 3300025942 | Bacteria | 2910 |
| 349 | Ga0207679_10115679 | 3300025945 | Bacteria | 2125 |
| 350 | Ga0207679_10406468 | 3300025945 | Bacteria | 1199 |
| 351 | Ga0207667_10070326 | 3300025949 | Bacteria | 3642 |
| 352 | Ga0207667_10168889 | 3300025949 | Bacteria | 2248 |
| 353 | Ga0207667_10703046 | 3300025949 | Bacteria | 1013 |
| 354 | Ga0207712_10014157 | 3300025961 | Bacteria | 5121 |
| 355 | Ga0207712_10149895 | 3300025961 | Bacteria | 1800 |
| 356 | Ga0207668_10081767 | 3300025972 | Bacteria | 2344 |
| 357 | Ga0207658_10014043 | 3300025986 | Bacteria | 5481 |
| 358 | Ga0207658_10041836 | 3300025986 | Bacteria | 3320 |
| 359 | Ga0207658_10060711 | 3300025986 | Bacteria | 2822 |
| 360 | Ga0207677_10002667 | 3300026023 | Bacteria | 9401 |
| 361 | Ga0207677_10050917 | 3300026023 | Bacteria | 2804 |
| 362 | Ga0207677_10057425 | 3300026023 | Bacteria | 2672 |
| 363 | Ga0207703_10009260 | 3300026035 | Bacteria | 7744 |
| 364 | Ga0207703_10021839 | 3300026035 | Bacteria | 5011 |
| 365 | Ga0207703_10184954 | 3300026035 | Bacteria | 1841 |
| 366 | Ga0207703_10186380 | 3300026035 | Bacteria | 1835 |
| 367 | Ga0207703_10415708 | 3300026035 | Bacteria | 1250 |
| 368 | Ga0207639_10007355 | 3300026041 | Bacteria | 7504 |
| 369 | Ga0207639_10024149 | 3300026041 | Bacteria | 4395 |
| 370 | Ga0207639_10043661 | 3300026041 | Bacteria | 3367 |
| 371 | Ga0207639_10083123 | 3300026041 | Bacteria | 2541 |
| 372 | Ga0207639_10188821 | 3300026041 | Bacteria | 1758 |
| 373 | Ga0207639_10694793 | 3300026041 | Bacteria | 943 |
| 374 | Ga0207678_10028557 | 3300026067 | Bacteria | 4869 |
| 375 | Ga0207678_10043551 | 3300026067 | Bacteria | 3884 |
| 376 | Ga0207678_10322066 | 3300026067 | Bacteria | 1330 |
| 377 | Ga0207708_10007488 | 3300026075 | Bacteria | 8069 |
| 378 | Ga0207708_10077668 | 3300026075 | Bacteria | 2548 |
| 379 | Ga0207708_10101084 | 3300026075 | Bacteria | 2232 |
| 380 | Ga0207708_10551199 | 3300026075 | Bacteria | 972 |
| 381 | Ga0207641_10003042 | 3300026088 | Bacteria | 15111 |
| 382 | Ga0207641_10064788 | 3300026088 | Bacteria | 3124 |
| 383 | Ga0207641_10106666 | 3300026088 | Bacteria | 2477 |
| 384 | Ga0207641_10171221 | 3300026088 | Bacteria | 1982 |
| 385 | Ga0207648_10002672 | 3300026089 | Bacteria | 18989 |
| 386 | Ga0207648_10020858 | 3300026089 | Bacteria | 5900 |
| 387 | Ga0207648_10023482 | 3300026089 | Bacteria | 5523 |
| 388 | Ga0207648_10082941 | 3300026089 | Bacteria | 2796 |
| 389 | Ga0207648_10115887 | 3300026089 | Bacteria | 2355 |
| 390 | Ga0207648_10651299 | 3300026089 | Bacteria | 974 |
| 391 | Ga0207676_10020763 | 3300026095 | Bacteria | 4809 |
| 392 | Ga0207676_10103059 | 3300026095 | Bacteria | 2370 |
| 393 | Ga0207676_10214101 | 3300026095 | Bacteria | 1711 |
| 394 | Ga0207674_10021614 | 3300026116 | Bacteria | 6927 |
| 395 | Ga0207674_10028028 | 3300026116 | Bacteria | 5951 |
| 396 | Ga0207674_10041929 | 3300026116 | Bacteria | 4730 |
| 397 | Ga0207674_10042765 | 3300026116 | Bacteria | 4676 |
| 398 | Ga0207674_10043491 | 3300026116 | Bacteria | 4631 |
| 399 | Ga0207675_100006819 | 3300026118 | Bacteria | 10814 |
| 400 | Ga0207675_100013077 | 3300026118 | Bacteria | 7747 |
| 401 | Ga0207675_100013316 | 3300026118 | Bacteria | 7676 |
| 402 | Ga0207675_100027523 | 3300026118 | Bacteria | 5295 |
| 403 | Ga0207683_10066240 | 3300026121 | Bacteria | 3185 |
| 404 | Ga0207683_10087595 | 3300026121 | Bacteria | 2769 |
| 405 | Ga0207698_10012540 | 3300026142 | Bacteria | 5553 |
| 406 | Ga0207698_10110387 | 3300026142 | Bacteria | 2304 |
| 407 | Ga0207428_10088859 | 3300027907 | Bacteria | 2402 |
| 408 | Ga0268266_10000257 | 3300028379 | Bacteria | 89384 |
| 409 | Ga0268266_10033856 | 3300028379 | Bacteria | 4342 |
| 410 | Ga0268266_10067552 | 3300028379 | Bacteria | 3094 |
| 411 | Ga0268266_10099515 | 3300028379 | Bacteria | 2560 |
| 412 | Ga0268266_10123949 | 3300028379 | Bacteria | 2303 |
| 413 | Ga0268266_10181019 | 3300028379 | Bacteria | 1919 |
| 414 | Ga0268265_10101967 | 3300028380 | Bacteria | 2320 |
| 415 | Ga0268265_10119785 | 3300028380 | Bacteria | 2166 |
| 416 | Ga0268265_10136798 | 3300028380 | Bacteria | 2045 |
| 417 | Ga0268265_10165509 | 3300028380 | Bacteria | 1884 |
| 418 | Ga0268265_10241758 | 3300028380 | Bacteria | 1593 |
| 419 | Ga0268264_10001001 | 3300028381 | Bacteria | 28672 |
| 420 | Ga0268264_10003066 | 3300028381 | Bacteria | 14474 |
| 421 | Ga0268264_10023023 | 3300028381 | Bacteria | 5083 |
| 422 | Ga0268264_10081093 | 3300028381 | Bacteria | 2772 |
| 423 | Ga0268264_10198848 | 3300028381 | Bacteria | 1832 |
| 424 | Ga0307515_10001956 | 3300028794 | Bacteria | 45627 |
| 425 | Ga0265332_10070180 | 3300031238 | Bacteria | 1493 |
| 426 | Ga0265325_10012043 | 3300031241 | Bacteria | 4955 |
| 427 | Ga0265340_10103457 | 3300031247 | Bacteria | 1322 |
| 428 | Ga0265339_10215540 | 3300031249 | Bacteria | 941 |
| 429 | Ga0265331_10021115 | 3300031250 | Bacteria | 3336 |
| 430 | Ga0265331_10092429 | 3300031250 | Bacteria | 1397 |
| 431 | Ga0265316_10448039 | 3300031344 | Bacteria | 926 |
| 432 | Ga0307513_10154305 | 3300031456 | Bacteria | 2199 |
| 433 | Ga0307408_100184963 | 3300031548 | Bacteria | 1674 |
| 434 | Ga0265313_10066804 | 3300031595 | Bacteria | 1665 |
| 435 | Ga0265314_10036505 | 3300031711 | Bacteria | 3571 |
| 436 | Ga0265314_10207403 | 3300031711 | Bacteria | 1153 |
| 437 | Ga0307405_10055754 | 3300031731 | Bacteria | 2475 |
| 438 | Ga0307413_10154821 | 3300031824 | Bacteria | 1602 |
| 439 | Ga0307413_10391905 | 3300031824 | Bacteria | 1085 |
| 440 | Ga0307406_10165481 | 3300031901 | Bacteria | 1595 |
| 441 | Ga0307406_10182726 | 3300031901 | Bacteria | 1528 |
| 442 | Ga0307406_10212650 | 3300031901 | Bacteria | 1432 |
| 443 | Ga0307407_10135268 | 3300031903 | Bacteria | 1583 |
| 444 | Ga0307412_10364108 | 3300031911 | Bacteria | 1165 |
| 445 | Ga0307409_100071106 | 3300031995 | Bacteria | 2765 |
| 446 | Ga0307409_100435895 | 3300031995 | Bacteria | 1261 |
| 447 | Ga0307416_100011529 | 3300032002 | Bacteria | 5903 |
| 448 | Ga0307416_100025422 | 3300032002 | Bacteria | 4340 |
| 449 | Ga0307411_10175938 | 3300032005 | Bacteria | 1619 |
| 450 | Ga0307415_100112335 | 3300032126 | Bacteria | 2024 |
| 451 | Ga0307415_100271516 | 3300032126 | Bacteria | 1389 |
| 452 | Ga0373962_0019366 | 3300035242 | Bacteria | 1780 |
| 453 | Ga0373931_0030437 | 3300035691 | Bacteria | 2778 |
| 454 | Ga0395899_0084472 | 3300037312 | Bacteria | 2308 |
| 455 | Ga0395900_0014410 | 3300037418 | Bacteria | 8069 |
| 456 | Ga0395900_0117317 | 3300037418 | Bacteria | 2731 |
| 457 | Ga0395898_0250599 | 3300037466 | Bacteria | 1689 |
| 458 | Ga0395905_0015692 | 3300037471 | Bacteria | 7196 |
| 459 | Ga0395905_0133797 | 3300037471 | Bacteria | 2332 |
| 460 | Ga0395905_0252820 | 3300037471 | Bacteria | 1646 |
| 461 | Ga0395905_0344751 | 3300037471 | Bacteria | 1381 |
| 462 | Ga0395901_0047074 | 3300038443 | Bacteria | 4479 |
| 463 | Ga0395901_0076932 | 3300038443 | Bacteria | 3482 |
| 464 | Ga0395901_0151688 | 3300038443 | Bacteria | 2435 |
| 465 | Ga0436365_0551841 | 3300039437 | Bacteria | 1251 |
| 466 | Ga0436365_1295259 | 3300039437 | Bacteria | 8569 |
| 467 | Ga0436361_0060394 | 3300039447 | Bacteria | 4673 |
| 468 | Ga0436361_0845671 | 3300039447 | Bacteria | 3085 |
| 469 | Ga0439438_000021 | 3300041405 | Bacteria | 109330 |
| 470 | Ga0439447_002674 | 3300041407 | Bacteria | 6453 |
| 471 | Ga0439465_0035766 | 3300041413 | Bacteria | 1593 |
| 472 | Ga0451841_0277328 | 3300041498 | Bacteria | 1627 |
| 473 | Ga0451843_1665491 | 3300041509 | Bacteria | 1372 |
| 474 | Ga0451855_1135979 | 3300041511 | Bacteria | 1792 |
| 475 | Ga0451853_1535672 | 3300041512 | Bacteria | 1966 |
| 476 | Ga0451853_3126826 | 3300041512 | Bacteria | 2691 |
| 477 | Ga0439445_0079000 | 3300042004 | Bacteria | 918 |
| 478 | Ga0439432_020645 | 3300042006 | Bacteria | 2187 |
| 479 | Ga0439450_033059 | 3300042008 | Bacteria | 1171 |
| 480 | Ga0450908_012082 | 3300042184 | Bacteria | 1571 |
| 481 | Ga0439435_0050826 | 3300042436 | Bacteria | 1186 |
| 482 | Ga0439464_0006733 | 3300042439 | Bacteria | 2996 |
| 483 | Ga0466972_0029385 | 3300044658 | Bacteria | 2706 |
| 484 | Ga0451576_0064685 | 3300045051 | Bacteria | 3809 |
| 485 | Ga0466958_0157855 | 3300045836 | Bacteria | 1432 |
| 486 | Ga0466967_0306169 | 3300045976 | Bacteria | 1530 |
| 487 | Ga0495627_001317 | 3300046453 | Bacteria | 15130 |
| 488 | Ga0495591_002496 | 3300046458 | Bacteria | 10186 |
| 489 | Ga0495629_0199720 | 3300046459 | Bacteria | 1383 |
| 490 | Ga0495638_0042235 | 3300046460 | Bacteria | 2881 |
| 491 | Ga0495638_0215387 | 3300046460 | Bacteria | 1076 |
| 492 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 493 | Ga0495650_0013567 | 3300046471 | Bacteria | 4299 |
| 494 | Ga0495650_0062159 | 3300046471 | Bacteria | 1493 |
| 495 | Ga0495580_0016298 | 3300046472 | Bacteria | 5580 |
| 496 | Ga0495605_0019290 | 3300046474 | Bacteria | 3647 |
| 497 | Ga0495605_0031401 | 3300046474 | Bacteria | 2713 |
| 498 | Ga0495584_0022473 | 3300046491 | Bacteria | 3200 |
| 499 | Ga0495596_0112964 | 3300046500 | Bacteria | 1055 |
| 500 | Ga0495607_0009540 | 3300046501 | Bacteria | 6560 |
| 501 | Ga0495607_0148138 | 3300046501 | Bacteria | 1204 |
| 502 | Ga0495606_0001619 | 3300046507 | Bacteria | 29382 |
| 503 | Ga0495610_0018917 | 3300046512 | Bacteria | 3872 |
| 504 | Ga0495616_0013102 | 3300046513 | Bacteria | 4688 |
| 505 | Ga0495620_0016163 | 3300046515 | Bacteria | 3754 |
| 506 | Ga0495628_0532409 | 3300046516 | Bacteria | 845 |
| 507 | Ga0495631_0056290 | 3300046518 | Bacteria | 1712 |
| 508 | Ga0495631_0078236 | 3300046518 | Bacteria | 1428 |
| 509 | Ga0495632_0024918 | 3300046519 | Bacteria | 3171 |
| 510 | Ga0495637_0078976 | 3300046520 | Bacteria | 1315 |
| 511 | Ga0495643_0128851 | 3300046522 | Bacteria | 1272 |
| 512 | Ga0495644_0025575 | 3300046523 | Bacteria | 2240 |
| 513 | Ga0495648_0007216 | 3300046524 | Bacteria | 8929 |
| 514 | Ga0495648_0014184 | 3300046524 | Bacteria | 5846 |
| 515 | Ga0495648_0031408 | 3300046524 | Bacteria | 3497 |
| 516 | Ga0495654_0076200 | 3300046530 | Bacteria | 1581 |
| 517 | Ga0495621_0047296 | 3300046539 | Bacteria | 1529 |
| 518 | Ga0495597_0013170 | 3300046542 | Bacteria | 3969 |
| 519 | Ga0495597_0091737 | 3300046542 | Bacteria | 1289 |
| 520 | Ga0495656_0000137 | 3300046615 | Bacteria | 27177 |
| 521 | Ga0495656_0012841 | 3300046615 | Bacteria | 3102 |
| 522 | Ga0495668_0036681 | 3300046616 | Bacteria | 2746 |
| 523 | Ga0495668_0044095 | 3300046616 | Bacteria | 2479 |
| 524 | Ga0495625_0005544 | 3300046660 | Bacteria | 11461 |
| 525 | Ga0495625_0021804 | 3300046660 | Bacteria | 4921 |
| 526 | Ga0495625_0145329 | 3300046660 | Bacteria | 1597 |
| 527 | Ga0495625_0247566 | 3300046660 | Bacteria | 1158 |
| 528 | Ga0495624_0097942 | 3300046690 | Bacteria | 1807 |
| 529 | Ga0495671_0009568 | 3300046692 | Bacteria | 5409 |
| 530 | Ga0495649_0003827 | 3300046694 | Bacteria | 9962 |
| 531 | Ga0495649_0051331 | 3300046694 | Bacteria | 2237 |
| 532 | Ga0495589_0016275 | 3300046794 | Bacteria | 3823 |
| 533 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 534 | Ga0495660_0053584 | 3300046810 | Bacteria | 2189 |
| 535 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 536 | Ga0495676_0041260 | 3300047321 | Bacteria | 3800 |
| 537 | Ga0495680_0199987 | 3300047322 | Bacteria | 1434 |
| 538 | Ga0495683_0060105 | 3300047323 | Bacteria | 1884 |
| 539 | Ga0495687_000315 | 3300047443 | Bacteria | 62841 |
| 540 | Ga0495687_004781 | 3300047443 | Bacteria | 8944 |
| 541 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 542 | Ga0495681_0046366 | 3300047470 | Bacteria | 2073 |
| 543 | Ga0495686_0024783 | 3300047472 | Bacteria | 3937 |
| 544 | Ga0495686_0025877 | 3300047472 | Bacteria | 3843 |
| 545 | Ga0495686_0052543 | 3300047472 | Bacteria | 2555 |
| 546 | Ga0495686_0058797 | 3300047472 | Bacteria | 2395 |
| 547 | Ga0495593_0034342 | 3300047673 | Bacteria | 2759 |
| 548 | Ga0495602_0349358 | 3300048088 | Bacteria | 1068 |
| 549 | Ga0495615_0019143 | 3300048090 | Bacteria | 1517 |
| 550 | Ga0495615_0031301 | 3300048090 | Bacteria | 1275 |
| 551 | Ga0496102_0031944 | 3300048905 | Bacteria | 4727 |
| 552 | Ga0496105_0431673 | 3300048908 | Bacteria | 1042 |
| 553 | Ga0496106_0015363 | 3300048909 | Bacteria | 5666 |
| 554 | Ga0496107_0057456 | 3300048910 | Bacteria | 2812 |
| 555 | Ga0496108_0083530 | 3300048911 | Bacteria | 2709 |
| 556 | Ga0496108_0137129 | 3300048911 | Bacteria | 2106 |
| 557 | Ga0496108_0559098 | 3300048911 | Bacteria | 998 |
| 558 | Ga0496109_0275367 | 3300048912 | Bacteria | 1586 |
| 559 | Ga0496110_0008710 | 3300048913 | Bacteria | 8172 |
| 560 | Ga0496111_0082657 | 3300048914 | Bacteria | 2346 |
| 561 | Ga0496112_0001731 | 3300048915 | Bacteria | 17084 |
| 562 | Ga0496112_0690544 | 3300048915 | Bacteria | 949 |
| 563 | Ga0496113_0165586 | 3300048916 | Bacteria | 1749 |
| 564 | Ga0496114_0280180 | 3300048917 | Bacteria | 1470 |
| 565 | Ga0496116_0000076 | 3300048919 | Bacteria | 229670 |
| 566 | Ga0496119_0000044 | 3300048922 | Bacteria | 191820 |
| 567 | Ga0496119_0001021 | 3300048922 | Bacteria | 35860 |
| 568 | Ga0496119_0010974 | 3300048922 | Bacteria | 7562 |
| 569 | Ga0496120_0000044 | 3300048923 | Bacteria | 192292 |
| 570 | Ga0496120_0000073 | 3300048923 | Bacteria | 164280 |
| 571 | Ga0496120_0002155 | 3300048923 | Bacteria | 20986 |
| 572 | Ga0496120_0020849 | 3300048923 | Bacteria | 4153 |
| 573 | Ga0496121_0154062 | 3300048924 | Bacteria | 1688 |
| 574 | Ga0496121_0167571 | 3300048924 | Bacteria | 1599 |
| 575 | Ga0496124_0392689 | 3300048927 | Bacteria | 966 |
| 576 | Ga0496125_0066554 | 3300048928 | Bacteria | 2846 |
| 577 | Ga0496126_0046351 | 3300048929 | Bacteria | 3988 |
| 578 | Ga0496126_0152871 | 3300048929 | Bacteria | 1977 |
| 579 | Ga0495678_000479 | 3300049459 | Bacteria | 39762 |
| 580 | Ga0495682_0000006 | 3300049460 | Bacteria | 316373 |
| 581 | Ga0501031_0026318 | 3300049568 | Bacteria | 3793 |
| 582 | Ga0501031_0058101 | 3300049568 | Bacteria | 2520 |
| 583 | Ga0501032_0000018 | 3300049569 | Bacteria | 156275 |
| 584 | Ga0501032_0012010 | 3300049569 | Bacteria | 6200 |
| 585 | Ga0501032_0016409 | 3300049569 | Bacteria | 5209 |
| 586 | Ga0501032_0145442 | 3300049569 | Bacteria | 1560 |
| 587 | Ga0501033_0000032 | 3300049570 | Bacteria | 156304 |
| 588 | Ga0501033_0010055 | 3300049570 | Bacteria | 7263 |
| 589 | Ga0501033_0022431 | 3300049570 | Bacteria | 4762 |
| 590 | Ga0501033_0048959 | 3300049570 | Bacteria | 3138 |
| 591 | Ga0501034_0000103 | 3300049571 | Bacteria | 156304 |
| 592 | Ga0501034_0000444 | 3300049571 | Bacteria | 68426 |
| 593 | Ga0501034_0013483 | 3300049571 | Bacteria | 8413 |
| 594 | Ga0501034_0026618 | 3300049571 | Bacteria | 5888 |
| 595 | Ga0501034_0043168 | 3300049571 | Bacteria | 4564 |
| 596 | Ga0501034_0050527 | 3300049571 | Bacteria | 4193 |
| 597 | Ga0501034_0051840 | 3300049571 | Bacteria | 4136 |
| 598 | Ga0501034_0053228 | 3300049571 | Bacteria | 4077 |
| 599 | Ga0501034_0085368 | 3300049571 | Bacteria | 3158 |
| 600 | Ga0501034_0176639 | 3300049571 | Bacteria | 2101 |
| 601 | Ga0501034_0177927 | 3300049571 | Bacteria | 2093 |
| 602 | Ga0501034_0201026 | 3300049571 | Bacteria | 1951 |
| 603 | Ga0501034_0371386 | 3300049571 | Bacteria | 1356 |
| 604 | Ga0501034_0584761 | 3300049571 | Bacteria | 1023 |
| 605 | Ga0501036_0000012 | 3300049572 | Bacteria | 156304 |
| 606 | Ga0501036_0021735 | 3300049572 | Bacteria | 5393 |
| 607 | Ga0501036_0357484 | 3300049572 | Bacteria | 1219 |
| 608 | Ga0501037_0000018 | 3300049573 | Bacteria | 156304 |
| 609 | Ga0501037_0070785 | 3300049573 | Bacteria | 2537 |
| 610 | Ga0501037_0361101 | 3300049573 | Bacteria | 1001 |
| 611 | Ga0501038_0000017 | 3300049574 | Bacteria | 156304 |
| 612 | Ga0501038_0035575 | 3300049574 | Bacteria | 4371 |
| 613 | Ga0501039_0000024 | 3300049575 | Bacteria | 156304 |
| 614 | Ga0501039_0085075 | 3300049575 | Bacteria | 2463 |
| 615 | Ga0501039_0095117 | 3300049575 | Bacteria | 2322 |
| 616 | Ga0501040_0040528 | 3300049576 | Bacteria | 3169 |
| 617 | Ga0501043_0004332 | 3300049579 | Bacteria | 11551 |
| 618 | Ga0501043_0035219 | 3300049579 | Bacteria | 3938 |
| 619 | Ga0501043_0040158 | 3300049579 | Bacteria | 3678 |
| 620 | Ga0501043_0047170 | 3300049579 | Bacteria | 3387 |
| 621 | Ga0501043_0126877 | 3300049579 | Bacteria | 2001 |
| 622 | Ga0501043_0210059 | 3300049579 | Bacteria | 1509 |
| 623 | Ga0501046_0020293 | 3300049580 | Bacteria | 5498 |
| 624 | Ga0501047_0004558 | 3300049581 | Bacteria | 13028 |
| 625 | Ga0501047_0008752 | 3300049581 | Bacteria | 9553 |
| 626 | Ga0501047_0075346 | 3300049581 | Bacteria | 3247 |
| 627 | Ga0501047_0084654 | 3300049581 | Bacteria | 3047 |
| 628 | Ga0501047_0086899 | 3300049581 | Bacteria | 3004 |
| 629 | Ga0501047_0134003 | 3300049581 | Bacteria | 2357 |
| 630 | Ga0501047_0242319 | 3300049581 | Bacteria | 1653 |
| 631 | Ga0501047_0289007 | 3300049581 | Bacteria | 1483 |
| 632 | Ga0501067_0017674 | 3300049583 | Bacteria | 3948 |
| 633 | Ga0501068_0000614 | 3300049584 | Bacteria | 18139 |
| 634 | Ga0501068_0026011 | 3300049584 | Bacteria | 3445 |
| 635 | Ga0501069_0010352 | 3300049585 | Bacteria | 4935 |
| 636 | Ga0501069_0013466 | 3300049585 | Bacteria | 4361 |
| 637 | Ga0501069_0043505 | 3300049585 | Bacteria | 2486 |
| 638 | Ga0501070_0007753 | 3300049586 | Bacteria | 9100 |
| 639 | Ga0501070_0026001 | 3300049586 | Bacteria | 4911 |
| 640 | Ga0501070_0093477 | 3300049586 | Bacteria | 2488 |
| 641 | Ga0501070_0145407 | 3300049586 | Bacteria | 1957 |
| 642 | Ga0501070_0364503 | 3300049586 | Bacteria | 1172 |
| 643 | Ga0501071_0014047 | 3300049587 | Bacteria | 5472 |
| 644 | Ga0501072_0274843 | 3300049588 | Bacteria | 1340 |
| 645 | Ga0501073_0000143 | 3300049589 | Bacteria | 47217 |
| 646 | Ga0501073_0016948 | 3300049589 | Bacteria | 5276 |
| 647 | Ga0501073_0025527 | 3300049589 | Bacteria | 4236 |
| 648 | Ga0501073_0031477 | 3300049589 | Bacteria | 3785 |
| 649 | Ga0501073_0087298 | 3300049589 | Bacteria | 2169 |
| 650 | Ga0501073_0090803 | 3300049589 | Bacteria | 2123 |
| 651 | Ga0501073_0099760 | 3300049589 | Bacteria | 2016 |
| 652 | Ga0501073_0144825 | 3300049589 | Bacteria | 1646 |
| 653 | Ga0501073_0248679 | 3300049589 | Bacteria | 1227 |
| 654 | Ga0501074_0031683 | 3300049590 | Bacteria | 3830 |
| 655 | Ga0501074_0043632 | 3300049590 | Bacteria | 3246 |
| 656 | Ga0501074_0185745 | 3300049590 | Bacteria | 1482 |
| 657 | Ga0501076_0069235 | 3300049592 | Bacteria | 2820 |
| 658 | Ga0501077_0004814 | 3300049593 | Bacteria | 8204 |
| 659 | Ga0501079_0172456 | 3300049741 | Bacteria | 1687 |
| 660 | Ga0501080_0000955 | 3300049742 | Bacteria | 23659 |
| 661 | Ga0501080_0016628 | 3300049742 | Bacteria | 6796 |
| 662 | Ga0501080_0035296 | 3300049742 | Bacteria | 4667 |
| 663 | Ga0501080_0290864 | 3300049742 | Bacteria | 1483 |
| 664 | Ga0501080_0311304 | 3300049742 | Bacteria | 1427 |
| 665 | Ga0501080_0408157 | 3300049742 | Bacteria | 1221 |
| 666 | Ga0501080_0691419 | 3300049742 | Bacteria | 900 |
| 667 | Ga0501083_0008455 | 3300049744 | Bacteria | 7274 |
| 668 | Ga0501083_0044759 | 3300049744 | Bacteria | 2996 |
| 669 | Ga0501083_0064134 | 3300049744 | Bacteria | 2448 |
| 670 | Ga0501083_0080260 | 3300049744 | Bacteria | 2163 |
| 671 | Ga0501035_0000040 | 3300049822 | Bacteria | 156262 |
| 672 | Ga0501035_0005942 | 3300049822 | Bacteria | 11492 |
| 673 | Ga0501035_0010917 | 3300049822 | Bacteria | 8410 |
| 674 | Ga0501035_0013756 | 3300049822 | Bacteria | 7469 |
| 675 | Ga0501035_0031169 | 3300049822 | Bacteria | 4856 |
| 676 | Ga0501035_0047332 | 3300049822 | Bacteria | 3861 |
| 677 | Ga0501035_0108123 | 3300049822 | Bacteria | 2438 |
| 678 | Ga0501035_0155127 | 3300049822 | Bacteria | 1985 |
| 679 | Ga0501044_0000040 | 3300049823 | Bacteria | 156304 |
| 680 | Ga0501044_0007916 | 3300049823 | Bacteria | 11685 |
| 681 | Ga0501044_0013108 | 3300049823 | Bacteria | 8975 |
| 682 | Ga0501044_0059837 | 3300049823 | Bacteria | 3902 |
| 683 | Ga0501044_0061348 | 3300049823 | Bacteria | 3846 |
| 684 | Ga0501044_0064588 | 3300049823 | Bacteria | 3736 |
| 685 | Ga0501044_0395455 | 3300049823 | Bacteria | 1295 |
| 686 | nmdc:mga03683_114917_c1 | 3300050489 | Bacteria | 1193 |
| 687 | nmdc:mga03683_57021_c1 | 3300050489 | Bacteria | 1643 |
| 688 | nmdc:mga0yw44_177287_c1 | 3300050492 | Bacteria | 1401 |
| 689 | nmdc:mga0yw44_315155_c1 | 3300050492 | Bacteria | 1050 |
| 690 | nmdc:mga0yw44_82007_c1 | 3300050492 | Bacteria | 2023 |
| 691 | nmdc:mga0k408_45484_c1 | 3300050493 | Bacteria | 2533 |
| 692 | nmdc:mga0k408_68018_c1 | 3300050493 | Bacteria | 2077 |
| 693 | nmdc:mga06z11_257117_c1 | 3300050494 | Bacteria | 1030 |
| 694 | nmdc:mga06z11_308338_c1 | 3300050494 | Bacteria | 942 |
| 695 | nmdc:mga04h51_79090_c1 | 3300050495 | Bacteria | 1163 |
| 696 | nmdc:mga07m45_17151_c1 | 3300050496 | Bacteria | 3884 |
| 697 | nmdc:mga07m45_378_c1 | 3300050496 | Bacteria | 18230 |
| 698 | nmdc:mga05p37_346908_c1 | 3300050507 | Bacteria | 1749 |
| 699 | nmdc:mga06r32_15012_c1 | 3300050510 | Bacteria | 7030 |
| 700 | nmdc:mga06r32_212448_c1 | 3300050510 | Bacteria | 1922 |
| 701 | nmdc:mga08y16_430057_c1 | 3300050511 | Bacteria | 1348 |
| 702 | nmdc:mga0sz30_116209_c1 | 3300050516 | Bacteria | 1174 |
| 703 | nmdc:mga0sz30_41876_c1 | 3300050516 | Bacteria | 1926 |
| 704 | Ga0495619_0314681 | 3300053085 | Bacteria | 1084 |
| 705 | Ga0500643_022254 | 3300053087 | Bacteria | 2043 |
| 706 | Ga0500555_021183 | 3300053103 | Bacteria | 1871 |
| 707 | Ga0500562_055410 | 3300053108 | Bacteria | 1063 |
| 708 | Ga0500621_000004 | 3300053126 | Bacteria | 485792 |
| 709 | Ga0500568_0000010 | 3300053139 | Bacteria | 249043 |
| 710 | Ga0500568_0017450 | 3300053139 | Bacteria | 3169 |
| 711 | Ga0500616_0055079 | 3300053153 | Bacteria | 2081 |
| 712 | Ga0500616_0145217 | 3300053153 | Bacteria | 1104 |
| 713 | Ga0500620_000598 | 3300053155 | Bacteria | 6198 |
| 714 | Ga0500622_0000734 | 3300053156 | Bacteria | 28647 |
| 715 | Ga0500622_0045878 | 3300053156 | Bacteria | 2261 |
| 716 | Ga0500627_0161288 | 3300053158 | Bacteria | 1011 |
| 717 | Ga0500645_002075 | 3300053730 | Bacteria | 9285 |
| 718 | Ga0501084_0086241 | 3300054114 | Bacteria | 2636 |
| 719 | Ga0501082_0017173 | 3300060353 | Bacteria | 6234 |
| 720 | Ga0501082_0442417 | 3300060353 | Bacteria | 1135 |
| 721 | 2871441915 | 2871435913 | Bacteria | 6880295 |
| 722 | 2503199714 | 2503198000 | Bacteria | 6884444 |
| 723 | 2506580941 | 2506520007 | Bacteria | 5442880 |
| 724 | 2506586080 | 2506520008 | Bacteria | 5443009 |
| 725 | 2509116655 | 2508501123 | Bacteria | 6283661 |
| 726 | 2509142467 | 2508501127 | Bacteria | 7037543 |
| 727 | 2509372055 | 2509276018 | Bacteria | 6910194 |
| 728 | 2509394643 | 2509276022 | Bacteria | 6200534 |
| 729 | 2510136115 | 2510065019 | Bacteria | 6903379 |
| 730 | 2510318778 | 2510065059 | Bacteria | 6847884 |
| 731 | 2510892882 | 2510461076 | Bacteria | 8618824 |
| 732 | 2512932870 | 2512875016 | Bacteria | 6529530 |
| 733 | 2512960891 | 2512875024 | Bacteria | 7195110 |
| 734 | 2513568416 | 2513237084 | Bacteria | 7231967 |
| 735 | 2513571888 | 2513237084 | Bacteria | 7231967 |
| 736 | 2513608981 | 2513237090 | Bacteria | 7096802 |
| 737 | 2513630727 | 2513237093 | Bacteria | 7545552 |
| 738 | 2513711921 | 2513237103 | Bacteria | 7647401 |
| 739 | 2514018250 | 2513237162 | Bacteria | 7468464 |
| 740 | 2514036663 | 2513237164 | Bacteria | 7563725 |
| 741 | 2514417286 | 2513237305 | Bacteria | 7293571 |
| 742 | 2514585981 | 2513237351 | Bacteria | 6968952 |
| 743 | 2515108958 | 2515075009 | Bacteria | 7288508 |
| 744 | 2515633037 | 2515154113 | Bacteria | 7807172 |
| 745 | 2515640242 | 2515154114 | Bacteria | 7848616 |
| 746 | 2515656323 | 2515154116 | Bacteria | 7552979 |
| 747 | 2515853372 | 2515154155 | Bacteria | 7985436 |
| 748 | 2517040899 | 2516653077 | Bacteria | 7555578 |
| 749 | 2517098499 | 2517093000 | Bacteria | 7412387 |
| 750 | 2588518926 | 2588253730 | Bacteria | 6881675 |
| 751 | 2597811080 | 2597489875 | Bacteria | 7010078 |
| 752 | 2599939860 | 2599185301 | Bacteria | 6161860 |
| 753 | 2616297886 | 2615840624 | Bacteria | 6557588 |
| 754 | 2643987609 | 2643221595 | Bacteria | 6565519 |
| 755 | 2644157870 | 2643221627 | Bacteria | 6761570 |
| 756 | 2644169376 | 2643221629 | Bacteria | 5850260 |
| 757 | 2644169825 | 2643221629 | Bacteria | 5850260 |
| 758 | 2644195208 | 2643221634 | Bacteria | 6705461 |
| 759 | 2644241132 | 2643221643 | Bacteria | 5749658 |
| 760 | 2644350461 | 2643221662 | Bacteria | 5851492 |
| 761 | 2644350773 | 2643221662 | Bacteria | 5851492 |
| 762 | 2656276776 | 2654587920 | Bacteria | 5475511 |
| 763 | 2688596966 | 2687453392 | Bacteria | 6880454 |
| 764 | 2689447492 | 2687453601 | Bacteria | 5546041 |
| 765 | 2694630225 | 2693429783 | Bacteria | 7019804 |
| 766 | 2694634305 | 2693429784 | Bacteria | 7241525 |
| 767 | 2723574116 | 2721755686 | Bacteria | 7343952 |
| 768 | 2725949384 | 2724679232 | Bacteria | 7646494 |
| 769 | 2739612373 | 2739367655 | Bacteria | 4051151 |
| 770 | 2765464463 | 2765235802 | Bacteria | 5618596 |
| 771 | 2766064607 | 2765235942 | Bacteria | 7445910 |
| 772 | 2776267091 | 2775506902 | Bacteria | 6208009 |
| 773 | 2776283434 | 2775506904 | Bacteria | 5954060 |
| 774 | 2792748281 | 2791355123 | Bacteria | 8049106 |
| 775 | 2793315014 | 2791355259 | Bacteria | 7254731 |
| 776 | 2793322548 | 2791355260 | Bacteria | 6598818 |
| 777 | 2793356265 | 2791355265 | Bacteria | 6539969 |
| 778 | 2838024757 | 2838022645 | Bacteria | 6494267 |
| 779 | 2838046870 | 2838042994 | Bacteria | 6046894 |
| 780 | 2838668896 | 2838668709 | Bacteria | 6671819 |
| 781 | 2838701444 | 2838701080 | Bacteria | 6669771 |
| 782 | 2839997337 | 2839993093 | Bacteria | 5512535 |
| 783 | 2840765801 | 2840764183 | Bacteria | 6358399 |
| 784 | 2841737462 | 2841734538 | Bacteria | 6784580 |
| 785 | 2842113798 | 2842110456 | Bacteria | 7656360 |
| 786 | 2842146491 | 2842146304 | Bacteria | 5957337 |
| 787 | 2842194118 | 2842192696 | Bacteria | 6147454 |
| 788 | 2842200138 | 2842198810 | Bacteria | 6608673 |
| 789 | 2842209930 | 2842205361 | Bacteria | 6340321 |
| 790 | 2842219644 | 2842217011 | Bacteria | 7497767 |
| 791 | 2842251279 | 2842250916 | Bacteria | 6579627 |
| 792 | 2842283384 | 2842278818 | Bacteria | 6340002 |
| 793 | 2842288119 | 2842285085 | Bacteria | 6011953 |
| 794 | 2842405385 | 2842402390 | Bacteria | 6681310 |
| 795 | 2842411858 | 2842409023 | Bacteria | 6687331 |
| 796 | 2842418615 | 2842415677 | Bacteria | 6596907 |
| 797 | 2842494805 | 2842489311 | Bacteria | 6620893 |
| 798 | 2842500841 | 2842495871 | Bacteria | 6820686 |
| 799 | 2844012307 | 2844009547 | Bacteria | 6728125 |
| 800 | 2847674706 | 2847670302 | Bacteria | 6165597 |
| 801 | 2847690815 | 2847686936 | Bacteria | 6278406 |
| 802 | 2851186195 | 2851182111 | Bacteria | 6047226 |
| 803 | 2854917309 | 2854916844 | Bacteria | 5725939 |
| 804 | 2855196576 | 2855195626 | Bacteria | 4927512 |
| 805 | 2856317408 | 2856314179 | Bacteria | 6477897 |
| 806 | 2856328731 | 2856328259 | Bacteria | 6528202 |
| 807 | 2856338338 | 2856334872 | Bacteria | 7037011 |
| 808 | 2856349200 | 2856342000 | Bacteria | 7176905 |
| 809 | 2856355334 | 2856349417 | Bacteria | 6230045 |
| 810 | 2856366857 | 2856364286 | Bacteria | 6939991 |
| 811 | 2857352255 | 2857349434 | Bacteria | 7926032 |
| 812 | 2857370918 | 2857367948 | Bacteria | 6965560 |
| 813 | 2857523132 | 2857516855 | Bacteria | 7787325 |
| 814 | 2869168561 | 2869162929 | Bacteria | 6399702 |
| 815 | 2869175169 | 2869169390 | Bacteria | 6659796 |
| 816 | 2869241877 | 2869234852 | Bacteria | 6654993 |
| 817 | 2869249189 | 2869242130 | Bacteria | 6609239 |
| 818 | 2869249922 | 2869249662 | Bacteria | 6868783 |
| 819 | 2869262911 | 2869256925 | Bacteria | 6981691 |
| 820 | 2869276239 | 2869271264 | Bacteria | 6908218 |
| 821 | 2869285653 | 2869278585 | Bacteria | 7077053 |
| 822 | 2869287731 | 2869285874 | Bacteria | 6901219 |
| 823 | 2871284461 | 2871282230 | Bacteria | 4917173 |
| 824 | 2871435679 | 2871429161 | Bacteria | 6547891 |
| 825 | 2871445479 | 2871444079 | Bacteria | 6423508 |
| 826 | 2871452877 | 2871451962 | Bacteria | 7336357 |
| 827 | 2871460251 | 2871459585 | Bacteria | 6866887 |
| 828 | 2871473272 | 2871466892 | Bacteria | 6923287 |
| 829 | 2871480887 | 2871474448 | Bacteria | 6806570 |
| 830 | 2871496544 | 2871495908 | Bacteria | 6935695 |
| 831 | 2874105293 | 2874102143 | Bacteria | 6342645 |
| 832 | 2874115110 | 2874109183 | Bacteria | 6517025 |
| 833 | 2874119248 | 2874116593 | Bacteria | 6674494 |
| 834 | 2874132901 | 2874131515 | Bacteria | 6820270 |
| 835 | 2874142009 | 2874139085 | Bacteria | 7021506 |
| 836 | 2874151362 | 2874146452 | Bacteria | 7533118 |
| 837 | 2874158996 | 2874155637 | Bacteria | 6724144 |
| 838 | 2874163034 | 2874162495 | Bacteria | 6174670 |
| 839 | 2874175073 | 2874168670 | Bacteria | 8062617 |
| 840 | 2876364880 | 2876363079 | Bacteria | 6544991 |
| 841 | 2876377286 | 2876369609 | Bacteria | 6807521 |
| 842 | 2876387077 | 2876386047 | Bacteria | 6698674 |
| 843 | 2876397708 | 2876392853 | Bacteria | 6660880 |
| 844 | 2876405592 | 2876399893 | Bacteria | 6927900 |
| 845 | 2876413852 | 2876406927 | Bacteria | 6191900 |
| 846 | 2876417415 | 2876413966 | Bacteria | 6831344 |
| 847 | 2878038446 | 2878035449 | Bacteria | 6555736 |
| 848 | 2878733083 | 2878730984 | Bacteria | 6380721 |
| 849 | 2878744807 | 2878738818 | Bacteria | 7136951 |
| 850 | 2878749242 | 2878745973 | Bacteria | 6867388 |
| 851 | 2878757562 | 2878753008 | Bacteria | 6922523 |
| 852 | 2878760772 | 2878760144 | Bacteria | 6823465 |
| 853 | 2878767603 | 2878767105 | Bacteria | 6898628 |
| 854 | 2878784098 | 2878781027 | Bacteria | 6834456 |
| 855 | 2878794336 | 2878788777 | Bacteria | 6567085 |
| 856 | 2881149590 | 2881147464 | Bacteria | 7779814 |
| 857 | 2881160771 | 2881155292 | Bacteria | 6461656 |
| 858 | 2881166469 | 2881161766 | Bacteria | 7127907 |
| 859 | 2881849486 | 2881845957 | Bacteria | 6611900 |
| 860 | 2881860505 | 2881853255 | Bacteria | 6698367 |
| 861 | 2881863131 | 2881861095 | Bacteria | 7128710 |
| 862 | 2882639383 | 2882632389 | Bacteria | 8154593 |
| 863 | 2882918380 | 2882912400 | Bacteria | 6801539 |
| 864 | 2885307950 | 2885305155 | Bacteria | 7348390 |
| 865 | 2885313128 | 2885312484 | Bacteria | 6415165 |
| 866 | 2885319415 | 2885318864 | Bacteria | 6729568 |
| 867 | 2885326734 | 2885326080 | Bacteria | 7134805 |
| 868 | 2885340995 | 2885334103 | Bacteria | 7216818 |
| 869 | 2885356108 | 2885350715 | Bacteria | 6787678 |
| 870 | 2888354698 | 2888350351 | Bacteria | 7372807 |
| 871 | 2889016313 | 2889010040 | Bacteria | 6749192 |
| 872 | 2889018664 | 2889016732 | Bacteria | 6700763 |
| 873 | 2889794442 | 2889790730 | Bacteria | 5689708 |
| 874 | 2889914953 | 2889914905 | Bacteria | 5702301 |
| 875 | 2894026861 | 2894023352 | Bacteria | 5167372 |
| 876 | 2900053985 | 2900051742 | Bacteria | 4985156 |
| 877 | 2900054458 | 2900051742 | Bacteria | 4985156 |
| 878 | 2903498706 | 2903492973 | Bacteria | 13473544 |
| 879 | 2903501292 | 2903492973 | Bacteria | 13473544 |
| 880 | 2903522384 | 2903521522 | Bacteria | 6525694 |
| 881 | 2903528763 | 2903528002 | Bacteria | 6586099 |
| 882 | 2903541338 | 2903540706 | Bacteria | 7062119 |
| 883 | 2904542417 | 2904541872 | Bacteria | 8915136 |
| 884 | 2904664359 | 2904659560 | Bacteria | 6685615 |
| 885 | 2906310280 | 2906308376 | Bacteria | 6841989 |
| 886 | 2906324345 | 2906321335 | Bacteria | 6579571 |
| 887 | 2906333159 | 2906328253 | Bacteria | 6585166 |
| 888 | 2906355226 | 2906354277 | Bacteria | 6991324 |
| 889 | 2906365978 | 2906363423 | Bacteria | 6856682 |
| 890 | 2906375160 | 2906370794 | Bacteria | 6881062 |
| 891 | 2906384876 | 2906378014 | Bacteria | 6911440 |
| 892 | 2906387086 | 2906386501 | Bacteria | 5977019 |
| 893 | 2906394381 | 2906393657 | Bacteria | 6790866 |
| 894 | 2906407986 | 2906401398 | Bacteria | 6693206 |
| 895 | 2906414051 | 2906408224 | Bacteria | 6162342 |
| 896 | 2906417473 | 2906414383 | Bacteria | 6580790 |
| 897 | 2913301660 | 2913295892 | Bacteria | 6333755 |
| 898 | 2919173906 | 2919171160 | Bacteria | 6499771 |
| 899 | 2922138325 | 2922130491 | Bacteria | 7173936 |
| 900 | 2922153686 | 2922151315 | Bacteria | 6902399 |
| 901 | 2922159040 | 2922158528 | Bacteria | 6573167 |
| 902 | 2922172652 | 2922172374 | Bacteria | 6167644 |
| 903 | 2922179550 | 2922178524 | Bacteria | 6025201 |
| 904 | 2922188375 | 2922185730 | Bacteria | 7113964 |
| 905 | 2924712192 | 2924710171 | Bacteria | 6752351 |
| 906 | 2924730220 | 2924726620 | Bacteria | 6271473 |
| 907 | 2924733918 | 2924733363 | Bacteria | 7574837 |
| 908 | 2924743665 | 2924741084 | Bacteria | 6661321 |
| 909 | 2924749216 | 2924748358 | Bacteria | 6154725 |
| 910 | 2924767248 | 2924762789 | Bacteria | 6561353 |
| 911 | 2924782838 | 2924776078 | Bacteria | 7492003 |
| 912 | 2924786857 | 2924784321 | Bacteria | 7416538 |
| 913 | 2929167669 | 2929160207 | Bacteria | 9075316 |
| 914 | 2933589566 | 2933586486 | Bacteria | 7667493 |
| 915 | 2936373589 | 2936367885 | Bacteria | 7324495 |
| 916 | 2936374699 | 2936367885 | Bacteria | 7324495 |
| 917 | 2936375866 | 2936375103 | Bacteria | 6652732 |
| 918 | 2937817104 | 2937813078 | Bacteria | 7783518 |
| 919 | 2937822548 | 2937822353 | Bacteria | 7290551 |
| 920 | 2937840302 | 2937836603 | Bacteria | 6811263 |
| 921 | 2937847024 | 2937843397 | Bacteria | 5256375 |
| 922 | 2937852483 | 2937848649 | Bacteria | 6983481 |
| 923 | 2937883621 | 2937877337 | Bacteria | 7246526 |
| 924 | 2937892977 | 2937891427 | Bacteria | 6357007 |
| 925 | 2937977570 | 2937972304 | Bacteria | 7532020 |
| 926 | 2937995194 | 2937994558 | Bacteria | 7036190 |
| 927 | 2938016112 | 2938014810 | Bacteria | 6700592 |
| 928 | 2958041668 | 2958034702 | Bacteria | 6989922 |
| 929 | 2958047950 | 2958041894 | Bacteria | 13082850 |
| 930 | 2958070661 | 2958064165 | Bacteria | 7158582 |
| 931 | 2958071511 | 2958071322 | Bacteria | 6815895 |
| 932 | 2958090789 | 2958084443 | Bacteria | 7312792 |
| 933 | 2958093536 | 2958092219 | Bacteria | 6861151 |
| 934 | 2958102442 | 2958100919 | Bacteria | 6800575 |
| 935 | 2958113401 | 2958108152 | Bacteria | 6681128 |
| 936 | 2958120911 | 2958115193 | Bacteria | 6923548 |
| 937 | 2958128981 | 2958122699 | Bacteria | 7280457 |
| 938 | 2958132133 | 2958130278 | Bacteria | 6897202 |
| 939 | 2958138031 | 2958137437 | Bacteria | 6050276 |
| 940 | 2958164490 | 2958158011 | Bacteria | 6058449 |
| 941 | 2958165541 | 2958165035 | Bacteria | 6906348 |
| 942 | 2958174260 | 2958172287 | Bacteria | 6716688 |
| 943 | 2958181947 | 2958179912 | Bacteria | 6874908 |
| 944 | 2961079791 | 2961077736 | Bacteria | 7079850 |
| 945 | 2961119358 | 2961114664 | Bacteria | 6680456 |
| 946 | 2961132269 | 2961127735 | Bacteria | 7196641 |
| 947 | 2961139723 | 2961136820 | Bacteria | 6775228 |
| 948 | 2961164000 | 2961163497 | Bacteria | 6901077 |
| 949 | 2961175111 | 2961170736 | Bacteria | 7072258 |
| 950 | 2961188401 | 2961183825 | Bacteria | 6688536 |
| 951 | 2963646336 | 2963644680 | Bacteria | 6530403 |
| 952 | 2965018934 | 2965018300 | Bacteria | 6883036 |
| 953 | 2965027035 | 2965025482 | Bacteria | 6532201 |
| 954 | 2965040200 | 2965032056 | Bacteria | 6887443 |
| 955 | 2965046269 | 2965040258 | Bacteria | 6855979 |
| 956 | 2965062847 | 2965062239 | Bacteria | 7412989 |
| 957 | 2965090430 | 2965089291 | Bacteria | 6866420 |
| 958 | 2965117065 | 2965110997 | Bacteria | 6693150 |
| 959 | 2965125245 | 2965119406 | Bacteria | 6956431 |
| 960 | 2967999888 | 2967996073 | Bacteria | 6787468 |
| 961 | 2968008247 | 2968003550 | Bacteria | 6929263 |
| 962 | 2968020461 | 2968016561 | Bacteria | 7022047 |
| 963 | 2968087138 | 2968083720 | Bacteria | 7351627 |
| 964 | 2968091312 | 2968091066 | Bacteria | 6052692 |
| 965 | 2968103140 | 2968097103 | Bacteria | 6107094 |
| 966 | 2968115613 | 2968110612 | Bacteria | 6814636 |
| 967 | 2968118986 | 2968117919 | Bacteria | 6536078 |
| 968 | 2968128930 | 2968128360 | Bacteria | 6270294 |
| 969 | 2968143472 | 2968138860 | Bacteria | 6605449 |
| 970 | 2968172403 | 2968171901 | Bacteria | 6894245 |
| 971 | 2970473758 | 2970469710 | Bacteria | 6969209 |
| 972 | 2970490429 | 2970489779 | Bacteria | 6517260 |
| 973 | 2970507699 | 2970503327 | Bacteria | 7099517 |
| 974 | 2970516849 | 2970510686 | Bacteria | 7006402 |
| 975 | 2970527094 | 2970524798 | Bacteria | 6840927 |
| 976 | 2970534772 | 2970532167 | Bacteria | 6553173 |
| 977 | 2970544535 | 2970540015 | Bacteria | 6977556 |
| 978 | 2970548273 | 2970547951 | Bacteria | 6931819 |
| 979 | 2970555625 | 2970554993 | Bacteria | 6814252 |
| 980 | 2970600269 | 2970593180 | Bacteria | 7073582 |
| 981 | 2970620167 | 2970619444 | Bacteria | 6986144 |
| 982 | 2977826719 | 2977821940 | Bacteria | 6906439 |
| 983 | 2977832939 | 2977828996 | Bacteria | 7007971 |
| 984 | 2977847395 | 2977843712 | Bacteria | 6753583 |
| 985 | 2977854159 | 2977851361 | Bacteria | 6694324 |
| 986 | 2977861730 | 2977858184 | Bacteria | 6215359 |
| 987 | 2977871925 | 2977864932 | Bacteria | 7534097 |
| 988 | 2977873983 | 2977872689 | Bacteria | 7270173 |
| 989 | 2977921921 | 2977915119 | Bacteria | 6829656 |
| 990 | 2977925277 | 2977922695 | Bacteria | 6956781 |
| 991 | 2977940645 | 2977935797 | Bacteria | 6252826 |
| 992 | 2977945674 | 2977942078 | Bacteria | 7570577 |
| 993 | 2977964757 | 2977957713 | Bacteria | 6877875 |
| 994 | 2977973944 | 2977971508 | Bacteria | 7472917 |
| 995 | 2977991287 | 2977986579 | Bacteria | 6581278 |
| 996 | 2979715663 | 2979710463 | Bacteria | 6785254 |
| 997 | 2979745632 | 2979742915 | Bacteria | 7301278 |
| 998 | 2979771260 | 2979764755 | Bacteria | 6610066 |
| 999 | 2979782194 | 2979779861 | Bacteria | 6219781 |
| 1000 | 2979793979 | 2979793036 | Bacteria | 6808957 |
| 1001 | 2979812883 | 2979808191 | Bacteria | 7179355 |
| 1002 | 2987639439 | 2987636660 | Bacteria | 8088555 |
| 1003 | 2987648062 | 2987645492 | Bacteria | 6117018 |
| 1004 | 2987653914 | 2987652177 | Bacteria | 6969023 |
| 1005 | 2987660008 | 2987659509 | Bacteria | 6966464 |
| 1006 | 2987673446 | 2987666974 | Bacteria | 6509233 |
| 1007 | 2996316552 | 2996310559 | Bacteria | 6357320 |
| 1008 | 2996341633 | 2996336353 | Bacteria | 5511628 |
| 1009 | 2996342788 | 2996341866 | Bacteria | 6643098 |
| 1010 | 2996352919 | 2996348954 | Bacteria | 7239054 |
| 1011 | 2996393295 | 2996386984 | Bacteria | 6978667 |
| 1012 | 2996895732 | 2996893221 | Bacteria | 5823108 |
| 1013 | 3000139312 | 3000135777 | Bacteria | 6891109 |
| 1014 | 3003931263 | 3003930520 | Bacteria | 5667563 |
| 1015 | 3004167353 | 3004167301 | Bacteria | 8330599 |
| 1016 | 3004189056 | 3004188549 | Bacteria | 6952365 |
| 1017 | 3004204317 | 3004203850 | Bacteria | 7307914 |
| 1018 | 3004217771 | 3004211236 | Bacteria | 7417683 |
| 1019 | 3004221181 | 3004218560 | Bacteria | 7421728 |
| 1020 | 3004232810 | 3004232784 | Bacteria | 6662140 |
| 1021 | 3004243378 | 3004239961 | Bacteria | 6892290 |
| 1022 | 3004269930 | 3004268573 | Bacteria | 7043476 |
| 1023 | 3004279601 | 3004275668 | Bacteria | 7114440 |
| 1024 | 3004290610 | 3004289098 | Bacteria | 6135450 |
| 1025 | 3004336058 | 3004334049 | Bacteria | 8449246 |
| 1026 | 639645356 | 639633055 | Bacteria | 7751309 |
| 1027 | 649871524 | 649633066 | Bacteria | 6690028 |
| 1028 | 8004301844 | 8004300914 | Bacteria | 6132239 |
| 1029 | 8004314683 | 8004312739 | Bacteria | 7444653 |
| 1030 | 8004379135 | 8004374579 | Bacteria | 6898112 |
| 1031 | 8004389516 | 8004387939 | Bacteria | 7049250 |
| 1032 | 8004402195 | 8004395343 | Bacteria | 6620908 |
| 1033 | 8004451787 | 8004445564 | Bacteria | 6322258 |
| 1034 | 8004637406 | 8004633249 | Bacteria | 6723080 |
| 1035 | 8004644028 | 8004640170 | Bacteria | 6723001 |
| 1036 | 8004712337 | 8004703790 | Bacteria | 8006957 |
| 1037 | 8004717914 | 8004714634 | Bacteria | 6776161 |
| 1038 | 8004734035 | 8004727605 | Bacteria | 6643904 |
| 1039 | 8005290826 | 8005289223 | Bacteria | 6634003 |
| 1040 | 8005301296 | 8005301065 | Bacteria | 6614431 |
| 1041 | 8005380540 | 8005376324 | Bacteria | 6590079 |
| 1042 | 8005384501 | 8005382845 | Bacteria | 6732062 |
| 1043 | 8005397813 | 8005395548 | Bacteria | 6806915 |
| 1044 | 8005467551 | 8005460587 | Bacteria | 7157962 |
| 1045 | 8005559466 | 8005556819 | Bacteria | 6908598 |
| 1046 | 8005566487 | 8005563573 | Bacteria | 7153261 |
| 1047 | 8005688889 | 8005688590 | Bacteria | 6610080 |
| 1048 | 8018132315 | 8018127388 | Bacteria | 7351159 |
| 1049 | 8018163761 | 8018163183 | Bacteria | 7277977 |
| 1050 | 8024481423 | 8024479707 | Bacteria | 6954785 |
| 1051 | 8024501837 | 8024501048 | Bacteria | 6427847 |
| 1052 | 8054560632 | 8054558443 | Bacteria | 5204801 |
| 1053 | 8054568395 | 8054563764 | Bacteria | 5592885 |
| 1054 | 8055619183 | 8055617313 | Bacteria | 7548464 |
| 1055 | 8057881284 | 8057874678 | Bacteria | 7494653 |
| 1056 | JGI24739J22299_10022936 | |||
| 1057 | JGI25159J45721_1000461 | |||
| 1058 | JGI25165J46597_1000034 | |||
| 1059 | rootH2_10130272 | |||
| 1060 | JGI25160J50197_1000248 | |||
| 1061 | JGI25160J50197_1002309 | |||
| 1062 | JGI25161J50226_1000183 | |||
| 1063 | Ga0055542_1001063 | |||
| 1064 | Ga0055529_1003010 | |||
| 1065 | Ga0055524_1000850 | |||
| 1066 | Ga0055528_1001807 | |||
| 1067 | Ga0055543_1000245 | |||
| 1068 | Ga0065165_1001012 | |||
| 1069 | Ga0070658_10147445 | |||
| 1070 | Ga0070658_10290359 | |||
| 1071 | Ga0070658_10332977 | |||
| 1072 | Ga0070676_10068798 | |||
| 1073 | Ga0070683_100200023 | |||
| 1074 | Ga0070690_100001510 | |||
| 1075 | Ga0070690_100148394 | |||
| 1076 | Ga0068869_100001072 | |||
| 1077 | Ga0068869_100091578 | |||
| 1078 | Ga0068869_100173041 | |||
| 1079 | Ga0068869_100287153 | |||
| 1080 | Ga0070666_10007488 | |||
| 1081 | Ga0068868_100058831 | |||
| 1082 | Ga0068868_100152931 | |||
| 1083 | Ga0068868_100211375 | |||
| 1084 | Ga0068868_100462246 | |||
| 1085 | Ga0068868_100484783 | |||
| 1086 | Ga0070660_100235649 | |||
| 1087 | Ga0070660_100332888 | |||
| 1088 | Ga0070689_100011792 | |||
| 1089 | Ga0070689_100165543 | |||
| 1090 | Ga0070661_100001089 | |||
| 1091 | Ga0070661_100077522 | |||
| 1092 | Ga0070661_100093694 | |||
| 1093 | Ga0070661_100183246 | |||
| 1094 | Ga0070692_10101388 | |||
| 1095 | Ga0070668_100105638 | |||
| 1096 | Ga0070668_100337545 | |||
| 1097 | Ga0070669_100030183 | |||
| 1098 | Ga0070669_100077937 | |||
| 1099 | Ga0070669_100099619 | |||
| 1100 | Ga0070675_100002305 | |||
| 1101 | Ga0070671_100086319 | |||
| 1102 | Ga0070671_100180420 | |||
| 1103 | Ga0070674_100017239 | |||
| 1104 | Ga0070674_100024016 | |||
| 1105 | Ga0070673_100164516 | |||
| 1106 | Ga0070659_100069612 | |||
| 1107 | Ga0070659_100083833 | |||
| 1108 | Ga0070667_100001504 | |||
| 1109 | Ga0070667_100047622 | |||
| 1110 | Ga0070667_100133328 | |||
| 1111 | Ga0070667_100163109 | |||
| 1112 | Ga0070667_100342299 | |||
| 1113 | Ga0070701_10021078 | |||
| 1114 | Ga0070705_100054268 | |||
| 1115 | Ga0070700_100102045 | |||
| 1116 | Ga0070694_100277084 | |||
| 1117 | Ga0070663_100120191 | |||
| 1118 | Ga0070678_100044742 | |||
| 1119 | Ga0070678_100103935 | |||
| 1120 | Ga0070678_100108089 | |||
| 1121 | Ga0070678_100401568 | |||
| 1122 | Ga0070662_100007515 | |||
| 1123 | Ga0070662_100023880 | |||
| 1124 | Ga0070681_10024387 | |||
| 1125 | Ga0068867_100015891 | |||
| 1126 | Ga0068867_100020391 | |||
| 1127 | Ga0068867_100165982 | |||
| 1128 | Ga0070685_10209442 | |||
| 1129 | Ga0070679_100225219 | |||
| 1130 | Ga0070684_100109601 | |||
| 1131 | Ga0068853_100006106 | |||
| 1132 | Ga0068853_100009175 | |||
| 1133 | Ga0068853_100027399 | |||
| 1134 | Ga0068853_100074345 | |||
| 1135 | Ga0070672_100067901 | |||
| 1136 | Ga0070672_100097962 | |||
| 1137 | Ga0070686_100012181 | |||
| 1138 | Ga0070686_100080814 | |||
| 1139 | Ga0070695_100366935 | |||
| 1140 | Ga0070665_100023505 | |||
| 1141 | Ga0070665_100031128 | |||
| 1142 | Ga0070665_100032562 | |||
| 1143 | Ga0070665_100063348 | |||
| 1144 | Ga0070665_100099653 | |||
| 1145 | Ga0070665_100197127 | |||
| 1146 | Ga0070665_100237090 | |||
| 1147 | Ga0070665_100477974 | |||
| 1148 | Ga0070664_100065451 | |||
| 1149 | Ga0070664_100528939 | |||
| 1150 | Ga0068857_100031257 | |||
| 1151 | Ga0068857_100032013 | |||
| 1152 | Ga0068854_100049679 | |||
| 1153 | Ga0068854_100152807 | |||
| 1154 | Ga0068854_100193943 | |||
| 1155 | Ga0068856_100034379 | |||
| 1156 | Ga0068856_100034534 | |||
| 1157 | Ga0068856_100198757 | |||
| 1158 | Ga0068852_100007354 | |||
| 1159 | Ga0068852_100205312 | |||
| 1160 | Ga0068852_100349477 | |||
| 1161 | Ga0068852_100505746 | |||
| 1162 | Ga0068859_100006383 | |||
| 1163 | Ga0068859_100028370 | |||
| 1164 | Ga0068859_100032249 | |||
| 1165 | Ga0068859_100041599 | |||
| 1166 | Ga0068859_100204119 | |||
| 1167 | Ga0068864_100028037 | |||
| 1168 | Ga0068864_100036087 | |||
| 1169 | Ga0068864_100048815 | |||
| 1170 | Ga0068864_100061768 | |||
| 1171 | Ga0068864_100125087 | |||
| 1172 | Ga0068866_10011237 | |||
| 1173 | Ga0068866_10075384 | |||
| 1174 | Ga0068861_100002678 | |||
| 1175 | Ga0068861_100018125 | |||
| 1176 | Ga0068851_10000365 | |||
| 1177 | Ga0068870_10124723 | |||
| 1178 | Ga0068863_100006580 | |||
| 1179 | Ga0068863_100080476 | |||
| 1180 | Ga0068863_100096878 | |||
| 1181 | Ga0068858_100004441 | |||
| 1182 | Ga0068858_100028194 | |||
| 1183 | Ga0068858_100035188 | |||
| 1184 | Ga0068858_100231277 | |||
| 1185 | Ga0068858_100478235 | |||
| 1186 | Ga0068860_100004331 | |||
| 1187 | Ga0068860_100022924 | |||
| 1188 | Ga0068862_100033418 | |||
| 1189 | Ga0068862_100043996 | |||
| 1190 | Ga0068862_100064488 | |||
| 1191 | Ga0068862_100121394 | |||
| 1192 | Ga0068862_100375484 | |||
| 1193 | Ga0081455_10080898 | |||
| 1194 | Ga0081455_10146886 | |||
| 1195 | Ga0081538_10004363 | |||
| 1196 | Ga0081540_1096763 | |||
| 1197 | Ga0081539_10002732 | |||
| 1198 | Ga0081539_10005538 | |||
| 1199 | Ga0081539_10006723 | |||
| 1200 | Ga0075365_10002114 | |||
| 1201 | Ga0075365_10044625 | |||
| 1202 | Ga0075365_10145851 | |||
| 1203 | Ga0075365_10271373 | |||
| 1204 | Ga0075368_10028307 | |||
| 1205 | Ga0075368_10062340 | |||
| 1206 | Ga0075368_10125673 | |||
| 1207 | Ga0075363_100163877 | |||
| 1208 | Ga0075362_10048050 | |||
| 1209 | Ga0075367_10111633 | |||
| 1210 | Ga0075367_10122285 | |||
| 1211 | Ga0075367_10125863 | |||
| 1212 | Ga0075369_10131423 | |||
| 1213 | Ga0097621_100028453 | |||
| 1214 | Ga0097621_100035235 | |||
| 1215 | Ga0097621_100040781 | |||
| 1216 | Ga0097621_100048996 | |||
| 1217 | Ga0075370_10002495 | |||
| 1218 | Ga0075370_10022024 | |||
| 1219 | Ga0075370_10181913 | |||
| 1220 | Ga0068871_100002664 | |||
| 1221 | Ga0068871_100042592 | |||
| 1222 | Ga0068871_100114905 | |||
| 1223 | Ga0068871_100373297 | |||
| 1224 | Ga0068865_100687602 | |||
| 1225 | Ga0097620_100006383 | |||
| 1226 | Ga0097620_100028370 | |||
| 1227 | Ga0097620_100032249 | |||
| 1228 | Ga0097620_100041599 | |||
| 1229 | Ga0097620_100204114 | |||
| 1230 | Ga0099794_10058192 | |||
| 1231 | Ga0105251_10023093 | |||
| 1232 | Ga0105244_10000008 | |||
| 1233 | Ga0105244_10044571 | |||
| 1234 | Ga0105240_10033261 | |||
| 1235 | Ga0105240_10066593 | |||
| 1236 | Ga0105240_10356120 | |||
| 1237 | Ga0105240_10398424 | |||
| 1238 | Ga0105240_10679558 | |||
| 1239 | Ga0105245_10036163 | |||
| 1240 | Ga0105245_10138735 | |||
| 1241 | Ga0105245_10225969 | |||
| 1242 | Ga0105245_10319392 | |||
| 1243 | Ga0105245_10458339 | |||
| 1244 | Ga0105247_10008662 | |||
| 1245 | Ga0114129_10414989 | |||
| 1246 | Ga0114129_10454489 | |||
| 1247 | Ga0114129_10773577 | |||
| 1248 | Ga0105243_10091923 | |||
| 1249 | Ga0105243_10361206 | |||
| 1250 | Ga0105241_10036083 | |||
| 1251 | Ga0105241_10157185 | |||
| 1252 | Ga0105242_10208879 | |||
| 1253 | Ga0105248_10041378 | |||
| 1254 | Ga0105248_10061180 | |||
| 1255 | Ga0105248_10088563 | |||
| 1256 | Ga0105248_10364460 | |||
| 1257 | Ga0105248_10447472 | |||
| 1258 | Ga0105248_10689781 | |||
| 1259 | Ga0105237_10000397 | |||
| 1260 | Ga0105237_10009247 | |||
| 1261 | Ga0105237_10019781 | |||
| 1262 | Ga0105237_10054607 | |||
| 1263 | Ga0105238_10001007 | |||
| 1264 | Ga0105238_10038235 | |||
| 1265 | Ga0105238_10105265 | |||
| 1266 | Ga0105238_10158573 | |||
| 1267 | Ga0105238_10314728 | |||
| 1268 | Ga0105238_10405995 | |||
| 1269 | Ga0105249_10028900 | |||
| 1270 | Ga0105249_10161350 | |||
| 1271 | Ga0105249_10388482 | |||
| 1272 | Ga0123341_1000002 | |||
| 1273 | Ga0123342_1030249 | |||
| 1274 | Ga0105239_10014766 | |||
| 1275 | Ga0105239_10050615 | |||
| 1276 | Ga0105239_10161991 | |||
| 1277 | Ga0105239_10572027 | |||
| 1278 | Ga0157373_10107585 | |||
| 1279 | Ga0157370_10009932 | |||
| 1280 | Ga0157370_10075580 | |||
| 1281 | Ga0157369_10082358 | |||
| 1282 | Ga0157369_10188646 | |||
| 1283 | Ga0157374_10025942 | |||
| 1284 | Ga0157374_10033943 | |||
| 1285 | Ga0157374_10167215 | |||
| 1286 | Ga0157378_10045061 | |||
| 1287 | Ga0157378_10136529 | |||
| 1288 | Ga0163162_10024703 | |||
| 1289 | Ga0163162_10045548 | |||
| 1290 | Ga0163162_10057983 | |||
| 1291 | Ga0163162_10423131 | |||
| 1292 | Ga0163162_10739421 | |||
| 1293 | Ga0157372_10011373 | |||
| 1294 | Ga0157372_10708737 | |||
| 1295 | Ga0157375_10008005 | |||
| 1296 | Ga0157375_10023236 | |||
| 1297 | Ga0157375_10356582 | |||
| 1298 | Ga0163163_10261173 | |||
| 1299 | Ga0157380_10014846 | |||
| 1300 | Ga0157380_10069262 | |||
| 1301 | Ga0157380_10240615 | |||
| 1302 | Ga0157380_10359558 | |||
| 1303 | Ga0182008_10036580 | |||
| 1304 | Ga0157377_10040065 | |||
| 1305 | Ga0157379_10032980 | |||
| 1306 | Ga0157379_10048368 | |||
| 1307 | Ga0157379_10079481 | |||
| 1308 | Ga0157379_10110685 | |||
| 1309 | Ga0157379_10146008 | |||
| 1310 | Ga0157379_10172661 | |||
| 1311 | Ga0157379_10188227 | |||
| 1312 | Ga0157376_10017989 | |||
| 1313 | Ga0157376_10300346 | |||
| 1314 | Ga0157376_10415360 | |||
| 1315 | Ga0163161_10000375 | |||
| 1316 | Ga0163161_10015393 | |||
| 1317 | Ga0163161_10046661 | |||
| 1318 | Ga0163161_10473372 | |||
| 1319 | Ga0214544_1000010 | |||
| 1320 | Ga0214542_1000023 | |||
| 1321 | Ga0214543_1000019 | |||
| 1322 | Ga0214543_1000132 | |||
| 1323 | Ga0213872_10025047 | |||
| 1324 | Ga0213872_10065659 | |||
| 1325 | Ga0213876_10007178 | |||
| 1326 | Ga0209026_1000100 | |||
| 1327 | Ga0209148_1000069 | |||
| 1328 | Ga0209148_1003960 | |||
| 1329 | Ga0209759_1000549 | |||
| 1330 | Ga0209233_1000028 | |||
| 1331 | Ga0209455_1000135 | |||
| 1332 | Ga0209130_1000098 | |||
| 1333 | Ga0207426_1000069 | |||
| 1334 | Ga0207656_10033061 | |||
| 1335 | Ga0207656_10093293 | |||
| 1336 | Ga0207655_1000083 | |||
| 1337 | Ga0207642_10003301 | |||
| 1338 | Ga0207642_10017892 | |||
| 1339 | Ga0207642_10079957 | |||
| 1340 | Ga0207642_10306952 | |||
| 1341 | Ga0207710_10020079 | |||
| 1342 | Ga0207688_10048621 | |||
| 1343 | Ga0207680_10008233 | |||
| 1344 | Ga0207680_10037305 | |||
| 1345 | Ga0207645_10014615 | |||
| 1346 | Ga0207645_10063671 | |||
| 1347 | Ga0207645_10080212 | |||
| 1348 | Ga0207645_10111210 | |||
| 1349 | Ga0207645_10150484 | |||
| 1350 | Ga0207643_10037483 | |||
| 1351 | Ga0207705_10193299 | |||
| 1352 | Ga0207707_10013657 | |||
| 1353 | Ga0207695_10038212 | |||
| 1354 | Ga0207695_10076226 | |||
| 1355 | Ga0207695_10096031 | |||
| 1356 | Ga0207695_10253863 | |||
| 1357 | Ga0207671_10001048 | |||
| 1358 | Ga0207671_10011147 | |||
| 1359 | Ga0207671_10048066 | |||
| 1360 | Ga0207671_10107859 | |||
| 1361 | Ga0207671_10206365 | |||
| 1362 | Ga0207660_10152323 | |||
| 1363 | Ga0207662_10091224 | |||
| 1364 | Ga0207657_10126788 | |||
| 1365 | Ga0207649_10016189 | |||
| 1366 | Ga0207649_10046174 | |||
| 1367 | Ga0207649_10092468 | |||
| 1368 | Ga0207652_10209720 | |||
| 1369 | Ga0207681_10002332 | |||
| 1370 | Ga0207681_10153866 | |||
| 1371 | Ga0207694_10000939 | |||
| 1372 | Ga0207694_10024125 | |||
| 1373 | Ga0207694_10041236 | |||
| 1374 | Ga0207650_10003921 | |||
| 1375 | Ga0207650_10329831 | |||
| 1376 | Ga0207659_10002102 | |||
| 1377 | Ga0207659_10004947 | |||
| 1378 | Ga0207659_10112987 | |||
| 1379 | Ga0207644_10000391 | |||
| 1380 | Ga0207644_10148455 | |||
| 1381 | Ga0207706_10012440 | |||
| 1382 | Ga0207706_10117616 | |||
| 1383 | Ga0207686_10061306 | |||
| 1384 | Ga0207686_10129417 | |||
| 1385 | Ga0207709_10040090 | |||
| 1386 | Ga0207709_10331959 | |||
| 1387 | Ga0207670_10363940 | |||
| 1388 | Ga0207669_10230800 | |||
| 1389 | Ga0207704_10002411 | |||
| 1390 | Ga0207704_10003969 | |||
| 1391 | Ga0207704_10156931 | |||
| 1392 | Ga0207704_10253923 | |||
| 1393 | Ga0207691_10106812 | |||
| 1394 | Ga0207691_10416751 | |||
| 1395 | Ga0207711_10075706 | |||
| 1396 | Ga0207711_10135078 | |||
| 1397 | Ga0207711_10259726 | |||
| 1398 | Ga0207711_10293817 | |||
| 1399 | Ga0207689_10001138 | |||
| 1400 | Ga0207689_10001210 | |||
| 1401 | Ga0207689_10025123 | |||
| 1402 | Ga0207689_10046936 | |||
| 1403 | Ga0207689_10068759 | |||
| 1404 | Ga0207679_10115679 | |||
| 1405 | Ga0207679_10406468 | |||
| 1406 | Ga0207667_10070326 | |||
| 1407 | Ga0207667_10168889 | |||
| 1408 | Ga0207667_10703046 | |||
| 1409 | Ga0207712_10014157 | |||
| 1410 | Ga0207712_10149895 | |||
| 1411 | Ga0207668_10081767 | |||
| 1412 | Ga0207658_10014043 | |||
| 1413 | Ga0207658_10041836 | |||
| 1414 | Ga0207658_10060711 | |||
| 1415 | Ga0207677_10002667 | |||
| 1416 | Ga0207677_10050917 | |||
| 1417 | Ga0207677_10057425 | |||
| 1418 | Ga0207703_10009260 | |||
| 1419 | Ga0207703_10021839 | |||
| 1420 | Ga0207703_10184954 | |||
| 1421 | Ga0207703_10186380 | |||
| 1422 | Ga0207703_10415708 | |||
| 1423 | Ga0207639_10007355 | |||
| 1424 | Ga0207639_10024149 | |||
| 1425 | Ga0207639_10043661 | |||
| 1426 | Ga0207639_10083123 | |||
| 1427 | Ga0207639_10188821 | |||
| 1428 | Ga0207639_10694793 | |||
| 1429 | Ga0207678_10028557 | |||
| 1430 | Ga0207678_10043551 | |||
| 1431 | Ga0207678_10322066 | |||
| 1432 | Ga0207708_10007488 | |||
| 1433 | Ga0207708_10077668 | |||
| 1434 | Ga0207708_10101084 | |||
| 1435 | Ga0207708_10551199 | |||
| 1436 | Ga0207641_10003042 | |||
| 1437 | Ga0207641_10064788 | |||
| 1438 | Ga0207641_10106666 | |||
| 1439 | Ga0207641_10171221 | |||
| 1440 | Ga0207648_10002672 | |||
| 1441 | Ga0207648_10020858 | |||
| 1442 | Ga0207648_10023482 | |||
| 1443 | Ga0207648_10082941 | |||
| 1444 | Ga0207648_10115887 | |||
| 1445 | Ga0207648_10651299 | |||
| 1446 | Ga0207676_10020763 | |||
| 1447 | Ga0207676_10103059 | |||
| 1448 | Ga0207676_10214101 | |||
| 1449 | Ga0207674_10021614 | |||
| 1450 | Ga0207674_10028028 | |||
| 1451 | Ga0207674_10041929 | |||
| 1452 | Ga0207674_10042765 | |||
| 1453 | Ga0207674_10043491 | |||
| 1454 | Ga0207675_100006819 | |||
| 1455 | Ga0207675_100013077 | |||
| 1456 | Ga0207675_100013316 | |||
| 1457 | Ga0207675_100027523 | |||
| 1458 | Ga0207683_10066240 | |||
| 1459 | Ga0207683_10087595 | |||
| 1460 | Ga0207698_10012540 | |||
| 1461 | Ga0207698_10110387 | |||
| 1462 | Ga0207428_10088859 | |||
| 1463 | Ga0268266_10000257 | |||
| 1464 | Ga0268266_10033856 | |||
| 1465 | Ga0268266_10067552 | |||
| 1466 | Ga0268266_10099515 | |||
| 1467 | Ga0268266_10123949 | |||
| 1468 | Ga0268266_10181019 | |||
| 1469 | Ga0268265_10101967 | |||
| 1470 | Ga0268265_10119785 | |||
| 1471 | Ga0268265_10136798 | |||
| 1472 | Ga0268265_10165509 | |||
| 1473 | Ga0268265_10241758 | |||
| 1474 | Ga0268264_10001001 | |||
| 1475 | Ga0268264_10003066 | |||
| 1476 | Ga0268264_10023023 | |||
| 1477 | Ga0268264_10081093 | |||
| 1478 | Ga0268264_10198848 | |||
| 1479 | Ga0307515_10001956 | |||
| 1480 | Ga0265332_10070180 | |||
| 1481 | Ga0265325_10012043 | |||
| 1482 | Ga0265340_10103457 | |||
| 1483 | Ga0265339_10215540 | |||
| 1484 | Ga0265331_10021115 | |||
| 1485 | Ga0265331_10092429 | |||
| 1486 | Ga0265316_10448039 | |||
| 1487 | Ga0307513_10154305 | |||
| 1488 | Ga0307408_100184963 | |||
| 1489 | Ga0265313_10066804 | |||
| 1490 | Ga0265314_10036505 | |||
| 1491 | Ga0265314_10207403 | |||
| 1492 | Ga0307405_10055754 | |||
| 1493 | Ga0307413_10154821 | |||
| 1494 | Ga0307413_10391905 | |||
| 1495 | Ga0307406_10165481 | |||
| 1496 | Ga0307406_10182726 | |||
| 1497 | Ga0307406_10212650 | |||
| 1498 | Ga0307407_10135268 | |||
| 1499 | Ga0307412_10364108 | |||
| 1500 | Ga0307409_100071106 | |||
| 1501 | Ga0307409_100435895 | |||
| 1502 | Ga0307416_100011529 | |||
| 1503 | Ga0307416_100025422 | |||
| 1504 | Ga0307411_10175938 | |||
| 1505 | Ga0307415_100112335 | |||
| 1506 | Ga0307415_100271516 | |||
| 1507 | Ga0373962_0019366 | |||
| 1508 | Ga0373931_0030437 | |||
| 1509 | Ga0395899_0084472 | |||
| 1510 | Ga0395900_0014410 | |||
| 1511 | Ga0395900_0117317 | |||
| 1512 | Ga0395898_0250599 | |||
| 1513 | Ga0395905_0015692 | |||
| 1514 | Ga0395905_0133797 | |||
| 1515 | Ga0395905_0252820 | |||
| 1516 | Ga0395905_0344751 | |||
| 1517 | Ga0395901_0047074 | |||
| 1518 | Ga0395901_0076932 | |||
| 1519 | Ga0395901_0151688 | |||
| 1520 | Ga0436365_0551841 | |||
| 1521 | Ga0436365_1295259 | |||
| 1522 | Ga0436361_0060394 | |||
| 1523 | Ga0436361_0845671 | |||
| 1524 | Ga0439438_000021 | |||
| 1525 | Ga0439447_002674 | |||
| 1526 | Ga0439465_0035766 | |||
| 1527 | Ga0451841_0277328 | |||
| 1528 | Ga0451843_1665491 | |||
| 1529 | Ga0451855_1135979 | |||
| 1530 | Ga0451853_1535672 | |||
| 1531 | Ga0451853_3126826 | |||
| 1532 | Ga0439445_0079000 | |||
| 1533 | Ga0439432_020645 | |||
| 1534 | Ga0439450_033059 | |||
| 1535 | Ga0450908_012082 | |||
| 1536 | Ga0439435_0050826 | |||
| 1537 | Ga0439464_0006733 | |||
| 1538 | Ga0466972_0029385 | |||
| 1539 | Ga0451576_0064685 | |||
| 1540 | Ga0466958_0157855 | |||
| 1541 | Ga0466967_0306169 | |||
| 1542 | Ga0495627_001317 | |||
| 1543 | Ga0495591_002496 | |||
| 1544 | Ga0495629_0199720 | |||
| 1545 | Ga0495638_0042235 | |||
| 1546 | Ga0495638_0215387 | |||
| 1547 | Ga0495650_0000008 | |||
| 1548 | Ga0495650_0013567 | |||
| 1549 | Ga0495650_0062159 | |||
| 1550 | Ga0495580_0016298 | |||
| 1551 | Ga0495605_0019290 | |||
| 1552 | Ga0495605_0031401 | |||
| 1553 | Ga0495584_0022473 | |||
| 1554 | Ga0495596_0112964 | |||
| 1555 | Ga0495607_0009540 | |||
| 1556 | Ga0495607_0148138 | |||
| 1557 | Ga0495606_0001619 | |||
| 1558 | Ga0495610_0018917 | |||
| 1559 | Ga0495616_0013102 | |||
| 1560 | Ga0495620_0016163 | |||
| 1561 | Ga0495628_0532409 | |||
| 1562 | Ga0495631_0056290 | |||
| 1563 | Ga0495631_0078236 | |||
| 1564 | Ga0495632_0024918 | |||
| 1565 | Ga0495637_0078976 | |||
| 1566 | Ga0495643_0128851 | |||
| 1567 | Ga0495644_0025575 | |||
| 1568 | Ga0495648_0007216 | |||
| 1569 | Ga0495648_0014184 | |||
| 1570 | Ga0495648_0031408 | |||
| 1571 | Ga0495654_0076200 | |||
| 1572 | Ga0495621_0047296 | |||
| 1573 | Ga0495597_0013170 | |||
| 1574 | Ga0495597_0091737 | |||
| 1575 | Ga0495656_0000137 | |||
| 1576 | Ga0495656_0012841 | |||
| 1577 | Ga0495668_0036681 | |||
| 1578 | Ga0495668_0044095 | |||
| 1579 | Ga0495625_0005544 | |||
| 1580 | Ga0495625_0021804 | |||
| 1581 | Ga0495625_0145329 | |||
| 1582 | Ga0495625_0247566 | |||
| 1583 | Ga0495624_0097942 | |||
| 1584 | Ga0495671_0009568 | |||
| 1585 | Ga0495649_0003827 | |||
| 1586 | Ga0495649_0051331 | |||
| 1587 | Ga0495589_0016275 | |||
| 1588 | Ga0495660_0000019 | |||
| 1589 | Ga0495660_0053584 | |||
| 1590 | Ga0495672_0000003 | |||
| 1591 | Ga0495676_0041260 | |||
| 1592 | Ga0495680_0199987 | |||
| 1593 | Ga0495683_0060105 | |||
| 1594 | Ga0495687_000315 | |||
| 1595 | Ga0495687_004781 | |||
| 1596 | Ga0495673_0000011 | |||
| 1597 | Ga0495681_0046366 | |||
| 1598 | Ga0495686_0024783 | |||
| 1599 | Ga0495686_0025877 | |||
| 1600 | Ga0495686_0052543 | |||
| 1601 | Ga0495686_0058797 | |||
| 1602 | Ga0495593_0034342 | |||
| 1603 | Ga0495602_0349358 | |||
| 1604 | Ga0495615_0019143 | |||
| 1605 | Ga0495615_0031301 | |||
| 1606 | Ga0496102_0031944 | |||
| 1607 | Ga0496105_0431673 | |||
| 1608 | Ga0496106_0015363 | |||
| 1609 | Ga0496107_0057456 | |||
| 1610 | Ga0496108_0083530 | |||
| 1611 | Ga0496108_0137129 | |||
| 1612 | Ga0496108_0559098 | |||
| 1613 | Ga0496109_0275367 | |||
| 1614 | Ga0496110_0008710 | |||
| 1615 | Ga0496111_0082657 | |||
| 1616 | Ga0496112_0001731 | |||
| 1617 | Ga0496112_0690544 | |||
| 1618 | Ga0496113_0165586 | |||
| 1619 | Ga0496114_0280180 | |||
| 1620 | Ga0496116_0000076 | |||
| 1621 | Ga0496119_0000044 | |||
| 1622 | Ga0496119_0001021 | |||
| 1623 | Ga0496119_0010974 | |||
| 1624 | Ga0496120_0000044 | |||
| 1625 | Ga0496120_0000073 | |||
| 1626 | Ga0496120_0002155 | |||
| 1627 | Ga0496120_0020849 | |||
| 1628 | Ga0496121_0154062 | |||
| 1629 | Ga0496121_0167571 | |||
| 1630 | Ga0496124_0392689 | |||
| 1631 | Ga0496125_0066554 | |||
| 1632 | Ga0496126_0046351 | |||
| 1633 | Ga0496126_0152871 | |||
| 1634 | Ga0495678_000479 | |||
| 1635 | Ga0495682_0000006 | |||
| 1636 | Ga0501031_0026318 | |||
| 1637 | Ga0501031_0058101 | |||
| 1638 | Ga0501032_0000018 | |||
| 1639 | Ga0501032_0012010 | |||
| 1640 | Ga0501032_0016409 | |||
| 1641 | Ga0501032_0145442 | |||
| 1642 | Ga0501033_0000032 | |||
| 1643 | Ga0501033_0010055 | |||
| 1644 | Ga0501033_0022431 | |||
| 1645 | Ga0501033_0048959 | |||
| 1646 | Ga0501034_0000103 | |||
| 1647 | Ga0501034_0000444 | |||
| 1648 | Ga0501034_0013483 | |||
| 1649 | Ga0501034_0026618 | |||
| 1650 | Ga0501034_0043168 | |||
| 1651 | Ga0501034_0050527 | |||
| 1652 | Ga0501034_0051840 | |||
| 1653 | Ga0501034_0053228 | |||
| 1654 | Ga0501034_0085368 | |||
| 1655 | Ga0501034_0176639 | |||
| 1656 | Ga0501034_0177927 | |||
| 1657 | Ga0501034_0201026 | |||
| 1658 | Ga0501034_0371386 | |||
| 1659 | Ga0501034_0584761 | |||
| 1660 | Ga0501036_0000012 | |||
| 1661 | Ga0501036_0021735 | |||
| 1662 | Ga0501036_0357484 | |||
| 1663 | Ga0501037_0000018 | |||
| 1664 | Ga0501037_0070785 | |||
| 1665 | Ga0501037_0361101 | |||
| 1666 | Ga0501038_0000017 | |||
| 1667 | Ga0501038_0035575 | |||
| 1668 | Ga0501039_0000024 | |||
| 1669 | Ga0501039_0085075 | |||
| 1670 | Ga0501039_0095117 | |||
| 1671 | Ga0501040_0040528 | |||
| 1672 | Ga0501043_0004332 | |||
| 1673 | Ga0501043_0035219 | |||
| 1674 | Ga0501043_0040158 | |||
| 1675 | Ga0501043_0047170 | |||
| 1676 | Ga0501043_0126877 | |||
| 1677 | Ga0501043_0210059 | |||
| 1678 | Ga0501046_0020293 | |||
| 1679 | Ga0501047_0004558 | |||
| 1680 | Ga0501047_0008752 | |||
| 1681 | Ga0501047_0075346 | |||
| 1682 | Ga0501047_0084654 | |||
| 1683 | Ga0501047_0086899 | |||
| 1684 | Ga0501047_0134003 | |||
| 1685 | Ga0501047_0242319 | |||
| 1686 | Ga0501047_0289007 | |||
| 1687 | Ga0501067_0017674 | |||
| 1688 | Ga0501068_0000614 | |||
| 1689 | Ga0501068_0026011 | |||
| 1690 | Ga0501069_0010352 | |||
| 1691 | Ga0501069_0013466 | |||
| 1692 | Ga0501069_0043505 | |||
| 1693 | Ga0501070_0007753 | |||
| 1694 | Ga0501070_0026001 | |||
| 1695 | Ga0501070_0093477 | |||
| 1696 | Ga0501070_0145407 | |||
| 1697 | Ga0501070_0364503 | |||
| 1698 | Ga0501071_0014047 | |||
| 1699 | Ga0501072_0274843 | |||
| 1700 | Ga0501073_0000143 | |||
| 1701 | Ga0501073_0016948 | |||
| 1702 | Ga0501073_0025527 | |||
| 1703 | Ga0501073_0031477 | |||
| 1704 | Ga0501073_0087298 | |||
| 1705 | Ga0501073_0090803 | |||
| 1706 | Ga0501073_0099760 | |||
| 1707 | Ga0501073_0144825 | |||
| 1708 | Ga0501073_0248679 | |||
| 1709 | Ga0501074_0031683 | |||
| 1710 | Ga0501074_0043632 | |||
| 1711 | Ga0501074_0185745 | |||
| 1712 | Ga0501076_0069235 | |||
| 1713 | Ga0501077_0004814 | |||
| 1714 | Ga0501079_0172456 | |||
| 1715 | Ga0501080_0000955 | |||
| 1716 | Ga0501080_0016628 | |||
| 1717 | Ga0501080_0035296 | |||
| 1718 | Ga0501080_0290864 | |||
| 1719 | Ga0501080_0311304 | |||
| 1720 | Ga0501080_0408157 | |||
| 1721 | Ga0501080_0691419 | |||
| 1722 | Ga0501083_0008455 | |||
| 1723 | Ga0501083_0044759 | |||
| 1724 | Ga0501083_0064134 | |||
| 1725 | Ga0501083_0080260 | |||
| 1726 | Ga0501035_0000040 | |||
| 1727 | Ga0501035_0005942 | |||
| 1728 | Ga0501035_0010917 | |||
| 1729 | Ga0501035_0013756 | |||
| 1730 | Ga0501035_0031169 | |||
| 1731 | Ga0501035_0047332 | |||
| 1732 | Ga0501035_0108123 | |||
| 1733 | Ga0501035_0155127 | |||
| 1734 | Ga0501044_0000040 | |||
| 1735 | Ga0501044_0007916 | |||
| 1736 | Ga0501044_0013108 | |||
| 1737 | Ga0501044_0059837 | |||
| 1738 | Ga0501044_0061348 | |||
| 1739 | Ga0501044_0064588 | |||
| 1740 | Ga0501044_0395455 | |||
| 1741 | nmdc:mga03683_114917_c1 | |||
| 1742 | nmdc:mga03683_57021_c1 | |||
| 1743 | nmdc:mga0yw44_177287_c1 | |||
| 1744 | nmdc:mga0yw44_315155_c1 | |||
| 1745 | nmdc:mga0yw44_82007_c1 | |||
| 1746 | nmdc:mga0k408_45484_c1 | |||
| 1747 | nmdc:mga0k408_68018_c1 | |||
| 1748 | nmdc:mga06z11_257117_c1 | |||
| 1749 | nmdc:mga06z11_308338_c1 | |||
| 1750 | nmdc:mga04h51_79090_c1 | |||
| 1751 | nmdc:mga07m45_17151_c1 | |||
| 1752 | nmdc:mga07m45_378_c1 | |||
| 1753 | nmdc:mga05p37_346908_c1 | |||
| 1754 | nmdc:mga06r32_15012_c1 | |||
| 1755 | nmdc:mga06r32_212448_c1 | |||
| 1756 | nmdc:mga08y16_430057_c1 | |||
| 1757 | nmdc:mga0sz30_116209_c1 | |||
| 1758 | nmdc:mga0sz30_41876_c1 | |||
| 1759 | Ga0495619_0314681 | |||
| 1760 | Ga0500643_022254 | |||
| 1761 | Ga0500555_021183 | |||
| 1762 | Ga0500562_055410 | |||
| 1763 | Ga0500621_000004 | |||
| 1764 | Ga0500568_0000010 | |||
| 1765 | Ga0500568_0017450 | |||
| 1766 | Ga0500616_0055079 | |||
| 1767 | Ga0500616_0145217 | |||
| 1768 | Ga0500620_000598 | |||
| 1769 | Ga0500622_0000734 | |||
| 1770 | Ga0500622_0045878 | |||
| 1771 | Ga0500627_0161288 | |||
| 1772 | Ga0500645_002075 | |||
| 1773 | Ga0501084_0086241 | |||
| 1774 | Ga0501082_0017173 | |||
| 1775 | Ga0501082_0442417 | |||
| 1776 | 2871441915 | |||
| 1777 | 2503199714 | |||
| 1778 | 2506580941 | |||
| 1779 | 2506586080 | |||
| 1780 | 2509116655 | |||
| 1781 | 2509142467 | |||
| 1782 | 2509372055 | |||
| 1783 | 2509394643 | |||
| 1784 | 2510136115 | |||
| 1785 | 2510318778 | |||
| 1786 | 2510892882 | |||
| 1787 | 2512932870 | |||
| 1788 | 2512960891 | |||
| 1789 | 2513568416 | |||
| 1790 | 2513571888 | |||
| 1791 | 2513608981 | |||
| 1792 | 2513630727 | |||
| 1793 | 2513711921 | |||
| 1794 | 2514018250 | |||
| 1795 | 2514036663 | |||
| 1796 | 2514417286 | |||
| 1797 | 2514585981 | |||
| 1798 | 2515108958 | |||
| 1799 | 2515633037 | |||
| 1800 | 2515640242 | |||
| 1801 | 2515656323 | |||
| 1802 | 2515853372 | |||
| 1803 | 2517040899 | |||
| 1804 | 2517098499 | |||
| 1805 | 2588518926 | |||
| 1806 | 2597811080 | |||
| 1807 | 2599939860 | |||
| 1808 | 2616297886 | |||
| 1809 | 2643987609 | |||
| 1810 | 2644157870 | |||
| 1811 | 2644169376 | |||
| 1812 | 2644169825 | |||
| 1813 | 2644195208 | |||
| 1814 | 2644241132 | |||
| 1815 | 2644350461 | |||
| 1816 | 2644350773 | |||
| 1817 | 2656276776 | |||
| 1818 | 2688596966 | |||
| 1819 | 2689447492 | |||
| 1820 | 2694630225 | |||
| 1821 | 2694634305 | |||
| 1822 | 2723574116 | |||
| 1823 | 2725949384 | |||
| 1824 | 2739612373 | |||
| 1825 | 2765464463 | |||
| 1826 | 2766064607 | |||
| 1827 | 2776267091 | |||
| 1828 | 2776283434 | |||
| 1829 | 2792748281 | |||
| 1830 | 2793315014 | |||
| 1831 | 2793322548 | |||
| 1832 | 2793356265 | |||
| 1833 | 2838024757 | |||
| 1834 | 2838046870 | |||
| 1835 | 2838668896 | |||
| 1836 | 2838701444 | |||
| 1837 | 2839997337 | |||
| 1838 | 2840765801 | |||
| 1839 | 2841737462 | |||
| 1840 | 2842113798 | |||
| 1841 | 2842146491 | |||
| 1842 | 2842194118 | |||
| 1843 | 2842200138 | |||
| 1844 | 2842209930 | |||
| 1845 | 2842219644 | |||
| 1846 | 2842251279 | |||
| 1847 | 2842283384 | |||
| 1848 | 2842288119 | |||
| 1849 | 2842405385 | |||
| 1850 | 2842411858 | |||
| 1851 | 2842418615 | |||
| 1852 | 2842494805 | |||
| 1853 | 2842500841 | |||
| 1854 | 2844012307 | |||
| 1855 | 2847674706 | |||
| 1856 | 2847690815 | |||
| 1857 | 2851186195 | |||
| 1858 | 2854917309 | |||
| 1859 | 2855196576 | |||
| 1860 | 2856317408 | |||
| 1861 | 2856328731 | |||
| 1862 | 2856338338 | |||
| 1863 | 2856349200 | |||
| 1864 | 2856355334 | |||
| 1865 | 2856366857 | |||
| 1866 | 2857352255 | |||
| 1867 | 2857370918 | |||
| 1868 | 2857523132 | |||
| 1869 | 2869168561 | |||
| 1870 | 2869175169 | |||
| 1871 | 2869241877 | |||
| 1872 | 2869249189 | |||
| 1873 | 2869249922 | |||
| 1874 | 2869262911 | |||
| 1875 | 2869276239 | |||
| 1876 | 2869285653 | |||
| 1877 | 2869287731 | |||
| 1878 | 2871284461 | |||
| 1879 | 2871435679 | |||
| 1880 | 2871445479 | |||
| 1881 | 2871452877 | |||
| 1882 | 2871460251 | |||
| 1883 | 2871473272 | |||
| 1884 | 2871480887 | |||
| 1885 | 2871496544 | |||
| 1886 | 2874105293 | |||
| 1887 | 2874115110 | |||
| 1888 | 2874119248 | |||
| 1889 | 2874132901 | |||
| 1890 | 2874142009 | |||
| 1891 | 2874151362 | |||
| 1892 | 2874158996 | |||
| 1893 | 2874163034 | |||
| 1894 | 2874175073 | |||
| 1895 | 2876364880 | |||
| 1896 | 2876377286 | |||
| 1897 | 2876387077 | |||
| 1898 | 2876397708 | |||
| 1899 | 2876405592 | |||
| 1900 | 2876413852 | |||
| 1901 | 2876417415 | |||
| 1902 | 2878038446 | |||
| 1903 | 2878733083 | |||
| 1904 | 2878744807 | |||
| 1905 | 2878749242 | |||
| 1906 | 2878757562 | |||
| 1907 | 2878760772 | |||
| 1908 | 2878767603 | |||
| 1909 | 2878784098 | |||
| 1910 | 2878794336 | |||
| 1911 | 2881149590 | |||
| 1912 | 2881160771 | |||
| 1913 | 2881166469 | |||
| 1914 | 2881849486 | |||
| 1915 | 2881860505 | |||
| 1916 | 2881863131 | |||
| 1917 | 2882639383 | |||
| 1918 | 2882918380 | |||
| 1919 | 2885307950 | |||
| 1920 | 2885313128 | |||
| 1921 | 2885319415 | |||
| 1922 | 2885326734 | |||
| 1923 | 2885340995 | |||
| 1924 | 2885356108 | |||
| 1925 | 2888354698 | |||
| 1926 | 2889016313 | |||
| 1927 | 2889018664 | |||
| 1928 | 2889794442 | |||
| 1929 | 2889914953 | |||
| 1930 | 2894026861 | |||
| 1931 | 2900053985 | |||
| 1932 | 2900054458 | |||
| 1933 | 2903498706 | |||
| 1934 | 2903501292 | |||
| 1935 | 2903522384 | |||
| 1936 | 2903528763 | |||
| 1937 | 2903541338 | |||
| 1938 | 2904542417 | |||
| 1939 | 2904664359 | |||
| 1940 | 2906310280 | |||
| 1941 | 2906324345 | |||
| 1942 | 2906333159 | |||
| 1943 | 2906355226 | |||
| 1944 | 2906365978 | |||
| 1945 | 2906375160 | |||
| 1946 | 2906384876 | |||
| 1947 | 2906387086 | |||
| 1948 | 2906394381 | |||
| 1949 | 2906407986 | |||
| 1950 | 2906414051 | |||
| 1951 | 2906417473 | |||
| 1952 | 2913301660 | |||
| 1953 | 2919173906 | |||
| 1954 | 2922138325 | |||
| 1955 | 2922153686 | |||
| 1956 | 2922159040 | |||
| 1957 | 2922172652 | |||
| 1958 | 2922179550 | |||
| 1959 | 2922188375 | |||
| 1960 | 2924712192 | |||
| 1961 | 2924730220 | |||
| 1962 | 2924733918 | |||
| 1963 | 2924743665 | |||
| 1964 | 2924749216 | |||
| 1965 | 2924767248 | |||
| 1966 | 2924782838 | |||
| 1967 | 2924786857 | |||
| 1968 | 2929167669 | |||
| 1969 | 2933589566 | |||
| 1970 | 2936373589 | |||
| 1971 | 2936374699 | |||
| 1972 | 2936375866 | |||
| 1973 | 2937817104 | |||
| 1974 | 2937822548 | |||
| 1975 | 2937840302 | |||
| 1976 | 2937847024 | |||
| 1977 | 2937852483 | |||
| 1978 | 2937883621 | |||
| 1979 | 2937892977 | |||
| 1980 | 2937977570 | |||
| 1981 | 2937995194 | |||
| 1982 | 2938016112 | |||
| 1983 | 2958041668 | |||
| 1984 | 2958047950 | |||
| 1985 | 2958070661 | |||
| 1986 | 2958071511 | |||
| 1987 | 2958090789 | |||
| 1988 | 2958093536 | |||
| 1989 | 2958102442 | |||
| 1990 | 2958113401 | |||
| 1991 | 2958120911 | |||
| 1992 | 2958128981 | |||
| 1993 | 2958132133 | |||
| 1994 | 2958138031 | |||
| 1995 | 2958164490 | |||
| 1996 | 2958165541 | |||
| 1997 | 2958174260 | |||
| 1998 | 2958181947 | |||
| 1999 | 2961079791 | |||
| 2000 | 2961119358 | |||
| 2001 | 2961132269 | |||
| 2002 | 2961139723 | |||
| 2003 | 2961164000 | |||
| 2004 | 2961175111 | |||
| 2005 | 2961188401 | |||
| 2006 | 2963646336 | |||
| 2007 | 2965018934 | |||
| 2008 | 2965027035 | |||
| 2009 | 2965040200 | |||
| 2010 | 2965046269 | |||
| 2011 | 2965062847 | |||
| 2012 | 2965090430 | |||
| 2013 | 2965117065 | |||
| 2014 | 2965125245 | |||
| 2015 | 2967999888 | |||
| 2016 | 2968008247 | |||
| 2017 | 2968020461 | |||
| 2018 | 2968087138 | |||
| 2019 | 2968091312 | |||
| 2020 | 2968103140 | |||
| 2021 | 2968115613 | |||
| 2022 | 2968118986 | |||
| 2023 | 2968128930 | |||
| 2024 | 2968143472 | |||
| 2025 | 2968172403 | |||
| 2026 | 2970473758 | |||
| 2027 | 2970490429 | |||
| 2028 | 2970507699 | |||
| 2029 | 2970516849 | |||
| 2030 | 2970527094 | |||
| 2031 | 2970534772 | |||
| 2032 | 2970544535 | |||
| 2033 | 2970548273 | |||
| 2034 | 2970555625 | |||
| 2035 | 2970600269 | |||
| 2036 | 2970620167 | |||
| 2037 | 2977826719 | |||
| 2038 | 2977832939 | |||
| 2039 | 2977847395 | |||
| 2040 | 2977854159 | |||
| 2041 | 2977861730 | |||
| 2042 | 2977871925 | |||
| 2043 | 2977873983 | |||
| 2044 | 2977921921 | |||
| 2045 | 2977925277 | |||
| 2046 | 2977940645 | |||
| 2047 | 2977945674 | |||
| 2048 | 2977964757 | |||
| 2049 | 2977973944 | |||
| 2050 | 2977991287 | |||
| 2051 | 2979715663 | |||
| 2052 | 2979745632 | |||
| 2053 | 2979771260 | |||
| 2054 | 2979782194 | |||
| 2055 | 2979793979 | |||
| 2056 | 2979812883 | |||
| 2057 | 2987639439 | |||
| 2058 | 2987648062 | |||
| 2059 | 2987653914 | |||
| 2060 | 2987660008 | |||
| 2061 | 2987673446 | |||
| 2062 | 2996316552 | |||
| 2063 | 2996341633 | |||
| 2064 | 2996342788 | |||
| 2065 | 2996352919 | |||
| 2066 | 2996393295 | |||
| 2067 | 2996895732 | |||
| 2068 | 3000139312 | |||
| 2069 | 3003931263 | |||
| 2070 | 3004167353 | |||
| 2071 | 3004189056 | |||
| 2072 | 3004204317 | |||
| 2073 | 3004217771 | |||
| 2074 | 3004221181 | |||
| 2075 | 3004232810 | |||
| 2076 | 3004243378 | |||
| 2077 | 3004269930 | |||
| 2078 | 3004279601 | |||
| 2079 | 3004290610 | |||
| 2080 | 3004336058 | |||
| 2081 | 639645356 | |||
| 2082 | 649871524 | |||
| 2083 | 8004301844 | |||
| 2084 | 8004314683 | |||
| 2085 | 8004379135 | |||
| 2086 | 8004389516 | |||
| 2087 | 8004402195 | |||
| 2088 | 8004451787 | |||
| 2089 | 8004637406 | |||
| 2090 | 8004644028 | |||
| 2091 | 8004712337 | |||
| 2092 | 8004717914 | |||
| 2093 | 8004734035 | |||
| 2094 | 8005290826 | |||
| 2095 | 8005301296 | |||
| 2096 | 8005380540 | |||
| 2097 | 8005384501 | |||
| 2098 | 8005397813 | |||
| 2099 | 8005467551 | |||
| 2100 | 8005559466 | |||
| 2101 | 8005566487 | |||
| 2102 | 8005688889 | |||
| 2103 | 8018132315 | |||
| 2104 | 8018163761 | |||
| 2105 | 8024481423 | |||
| 2106 | 8024501837 | |||
| 2107 | 8054560632 | |||
| 2108 | 8054568395 | |||
| 2109 | 8055619183 | |||
| 2110 | 8057881284 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p10-assembly1.cif.gz_E | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9357 | 4 | 277 |
| 2p10-assembly1.cif.gz_D | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9346 | 4 | 277 |
| 2p10-assembly1.cif.gz_E | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9295 | 4 | 277 |
| 2p10-assembly1.cif.gz_F | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9292 | 4 | 277 |
| 2p10-assembly1.cif.gz_D | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9244 | 4 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6FD56_1_198_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9354 | 55 | 252 | 3.20.20.70 |
| 2p10E01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9341 | 4 | 252 | 3.20.20.70 |
| af_A0A1D6FD56_1_198_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9308 | 55 | 252 | 3.20.20.70 |
| af_A0A1D6MLW1_1_166_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9293 | 57 | 218 | 3.20.20.70 |
| 2p10E01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9263 | 4 | 252 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527VN36-F1-model_v4 | Phosphoenolpyruvate hydrolase family protein | 0.9969 | 156 | 240 |
GO:0016787
|
| AF-A0A5K0XTA2-F1-model_v4 | TIM-barrel domain-containing protein | 0.9899 | 145 | 227 |
GO:0003824
|
| AF-A0A530ATE5-F1-model_v4 | deleted | 0.9859 | 75 | 279 |
|
| AF-A0A528AZZ8-F1-model_v4 | Phosphoenolpyruvate hydrolase family protein | 0.9844 | 110 | 245 |
GO:0016787
|
| AF-L8GJP6-F1-model_v4 | Transcriptional regulator, putative | 0.9836 | 130 | 276 |
GO:0003824
|