F489170
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1056 | 511 | 2112 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300002705|JGI25156J39149_1001066|JGI25156J39149_100106611 |
| Length | 284 |
| Sequence | MRGIYAQVLGRDKDALAWNKGGVRRGKATLQSWETATMFKRLFAEFFGTFWLVLGGCGSAVLAAAFPNLGIGFAGVALAFGLTVVTMAYACAGISGAHFNPAVTVGLFFGGRFSGKDVVPYIVSQVIGAIVAAAVLYVIASGKPGFDATASGFASNGYAAHSPGGYSLQACVVCEFVLTAMFLIVIHGATDRRAPAGFGPLAIGLALTLIHLISIPVTNTSVNPARSTGVAIFQGTWALQQLWMFWLVPLLGGAAGGLIFRFLLGEDVAKPSVAAGAQAGMSNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 138 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 244 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 246 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 247 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 283 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 284 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 285 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 286 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 287 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 288 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 289 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 290 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 294 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 295 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 296 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 297 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 300 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 301 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 302 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 303 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 304 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 305 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 306 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 307 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 308 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 396 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 397 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 398 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 399 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 402 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 403 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 404 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 405 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 406 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 407 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 408 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 409 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 410 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 411 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 412 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 413 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 414 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 415 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 444 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 445 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 448 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 458 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 459 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 461 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 463 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 464 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 465 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 466 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 468 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 469 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 472 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 473 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 474 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 475 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 476 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 477 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 478 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 479 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 480 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 481 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 482 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 483 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 484 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 485 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 486 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 487 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 488 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 489 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 490 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 491 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 492 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 493 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 494 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 495 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 496 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 497 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 498 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 499 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 500 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 501 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 502 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 503 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 504 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 505 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 506 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 507 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 508 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 509 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 510 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 511 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.21 |
| Metatranscriptomes | 0.09 |
| Isolates | 3.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 7.01 |
| Nodule | 0.47 |
| Rhizoplane | 1.52 |
| Rhizosphere | 83.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001066 | 3300002705 | Bacteria | 12662 |
| 2 | JGI25162J39368_1000995 | 3300002737 | Bacteria | 17881 |
| 3 | JGI25162J39368_1001495 | 3300002737 | Bacteria | 12188 |
| 4 | JGI25162J39368_1002049 | 3300002737 | Bacteria | 8790 |
| 5 | JGI25154J39366_1002110 | 3300002738 | Bacteria | 5581 |
| 6 | JGI25157J39369_1000342 | 3300002741 | Bacteria | 32979 |
| 7 | JGI25157J39369_1001042 | 3300002741 | Bacteria | 12663 |
| 8 | JGI25164J39214_1000078 | 3300002772 | Bacteria | 94809 |
| 9 | JGI25164J39214_1000738 | 3300002772 | Bacteria | 12191 |
| 10 | JGI25164J39214_1000760 | 3300002772 | Bacteria | 11831 |
| 11 | JGI25165J46597_1000088 | 3300003214 | Bacteria | 169821 |
| 12 | JGI25165J46597_1000245 | 3300003214 | Bacteria | 73709 |
| 13 | JGI25165J46597_1001490 | 3300003214 | Bacteria | 12004 |
| 14 | JGI25165J46597_1001854 | 3300003214 | Bacteria | 8739 |
| 15 | rootH2_10009385 | 3300003320 | Bacteria | 8751 |
| 16 | rootH2_10193234 | 3300003320 | Bacteria | 1314 |
| 17 | rootL2_10155819 | 3300003322 | Bacteria | 7965 |
| 18 | rootH1_10075165 | 3300003323 | Bacteria | 12585 |
| 19 | Ga0055525_1000146 | 3300003759 | Bacteria | 97114 |
| 20 | Ga0055527_1000074 | 3300003760 | Bacteria | 82742 |
| 21 | Ga0055535_1000359 | 3300003761 | Bacteria | 44033 |
| 22 | Ga0055535_1000372 | 3300003761 | Bacteria | 42891 |
| 23 | Ga0055542_1000151 | 3300003762 | Bacteria | 87857 |
| 24 | Ga0055542_1000168 | 3300003762 | Bacteria | 82742 |
| 25 | Ga0055542_1000352 | 3300003762 | Bacteria | 48395 |
| 26 | Ga0055529_1000163 | 3300003763 | Bacteria | 92012 |
| 27 | Ga0055529_1000543 | 3300003763 | Bacteria | 32272 |
| 28 | Ga0055526_1000232 | 3300003771 | Bacteria | 46733 |
| 29 | Ga0055537_1000030 | 3300003773 | Bacteria | 100491 |
| 30 | Ga0055524_1002681 | 3300003775 | Bacteria | 9017 |
| 31 | Ga0055534_1000447 | 3300003784 | Bacteria | 24217 |
| 32 | Ga0055528_1000439 | 3300003790 | Bacteria | 33348 |
| 33 | Ga0065703_1018836 | 3300005272 | Bacteria | 6188 |
| 34 | Ga0065704_10074548 | 3300005289 | Bacteria | 6194 |
| 35 | Ga0065704_10332195 | 3300005289 | Bacteria | 834 |
| 36 | Ga0065715_10003421 | 3300005293 | Bacteria | 4050 |
| 37 | Ga0065715_10212795 | 3300005293 | Bacteria | 1306 |
| 38 | Ga0070658_10504740 | 3300005327 | Bacteria | 1045 |
| 39 | Ga0070676_10024163 | 3300005328 | Bacteria | 3421 |
| 40 | Ga0070676_10173087 | 3300005328 | Bacteria | 1398 |
| 41 | Ga0070676_10235689 | 3300005328 | Bacteria | 1215 |
| 42 | Ga0070676_10368502 | 3300005328 | Bacteria | 992 |
| 43 | Ga0070683_100007566 | 3300005329 | Bacteria | 9184 |
| 44 | Ga0070683_100505607 | 3300005329 | Bacteria | 1154 |
| 45 | Ga0070690_100006132 | 3300005330 | Bacteria | 6805 |
| 46 | Ga0070690_100029833 | 3300005330 | Bacteria | 3386 |
| 47 | Ga0070690_100482899 | 3300005330 | Bacteria | 924 |
| 48 | Ga0070677_10020372 | 3300005333 | Bacteria | 2415 |
| 49 | Ga0070677_10042635 | 3300005333 | Bacteria | 1798 |
| 50 | Ga0068869_100015418 | 3300005334 | Bacteria | 5126 |
| 51 | Ga0070666_10007588 | 3300005335 | Bacteria | 6692 |
| 52 | Ga0070666_10051454 | 3300005335 | Bacteria | 2774 |
| 53 | Ga0070666_10067052 | 3300005335 | Bacteria | 2436 |
| 54 | Ga0070680_100553621 | 3300005336 | Bacteria | 986 |
| 55 | Ga0070682_100000474 | 3300005337 | Bacteria | 25301 |
| 56 | Ga0068868_100003208 | 3300005338 | Bacteria | 11384 |
| 57 | Ga0068868_100016571 | 3300005338 | Bacteria | 5477 |
| 58 | Ga0070660_100266428 | 3300005339 | Bacteria | 1400 |
| 59 | Ga0070660_100650995 | 3300005339 | Bacteria | 882 |
| 60 | Ga0070689_100091651 | 3300005340 | Bacteria | 2396 |
| 61 | Ga0070687_100059708 | 3300005343 | Bacteria | 2009 |
| 62 | Ga0070668_100031835 | 3300005347 | Bacteria | 4013 |
| 63 | Ga0070669_100164277 | 3300005353 | Bacteria | 1727 |
| 64 | Ga0070675_100000208 | 3300005354 | Bacteria | 37508 |
| 65 | Ga0070675_100009783 | 3300005354 | Bacteria | 7469 |
| 66 | Ga0070675_100234616 | 3300005354 | Bacteria | 1601 |
| 67 | Ga0070675_100864699 | 3300005354 | Bacteria | 828 |
| 68 | Ga0070671_100001433 | 3300005355 | Bacteria | 17805 |
| 69 | Ga0070671_100341699 | 3300005355 | Bacteria | 1277 |
| 70 | Ga0070671_100545243 | 3300005355 | Bacteria | 1000 |
| 71 | Ga0070674_100020413 | 3300005356 | Bacteria | 4233 |
| 72 | Ga0070673_100000523 | 3300005364 | Bacteria | 20606 |
| 73 | Ga0070688_100065452 | 3300005365 | Bacteria | 2310 |
| 74 | Ga0070688_100121598 | 3300005365 | Bacteria | 1750 |
| 75 | Ga0070659_100714914 | 3300005366 | Bacteria | 867 |
| 76 | Ga0070667_100001902 | 3300005367 | Bacteria | 18530 |
| 77 | Ga0070667_100112715 | 3300005367 | Bacteria | 2359 |
| 78 | Ga0070703_10000113 | 3300005406 | Bacteria | 41936 |
| 79 | Ga0070714_100056798 | 3300005435 | Bacteria | 3349 |
| 80 | Ga0070714_100117931 | 3300005435 | Bacteria | 2358 |
| 81 | Ga0070713_100032163 | 3300005436 | Bacteria | 4187 |
| 82 | Ga0070713_100162298 | 3300005436 | Bacteria | 1996 |
| 83 | Ga0070713_100228091 | 3300005436 | Bacteria | 1692 |
| 84 | Ga0070701_10011600 | 3300005438 | Bacteria | 3948 |
| 85 | Ga0070711_100126251 | 3300005439 | Bacteria | 1899 |
| 86 | Ga0070711_100188716 | 3300005439 | Bacteria | 1582 |
| 87 | Ga0070711_100211362 | 3300005439 | Bacteria | 1503 |
| 88 | Ga0070705_100296412 | 3300005440 | Bacteria | 1157 |
| 89 | Ga0070700_100009956 | 3300005441 | Bacteria | 5232 |
| 90 | Ga0070700_100048201 | 3300005441 | Bacteria | 2640 |
| 91 | Ga0070700_100367358 | 3300005441 | Bacteria | 1072 |
| 92 | Ga0070694_100005129 | 3300005444 | Bacteria | 7897 |
| 93 | Ga0070708_100084056 | 3300005445 | Bacteria | 2887 |
| 94 | Ga0070708_100370732 | 3300005445 | Bacteria | 1350 |
| 95 | Ga0070708_100373407 | 3300005445 | Bacteria | 1344 |
| 96 | Ga0070678_100000227 | 3300005456 | Bacteria | 25438 |
| 97 | Ga0070678_100023593 | 3300005456 | Bacteria | 4102 |
| 98 | Ga0070678_100103126 | 3300005456 | Bacteria | 2215 |
| 99 | Ga0070678_100380653 | 3300005456 | Bacteria | 1221 |
| 100 | Ga0070662_100030296 | 3300005457 | Bacteria | 3784 |
| 101 | Ga0070662_100135810 | 3300005457 | Bacteria | 1901 |
| 102 | Ga0070662_100277722 | 3300005457 | Bacteria | 1355 |
| 103 | Ga0068867_100025872 | 3300005459 | Bacteria | 4210 |
| 104 | Ga0068867_100051158 | 3300005459 | Bacteria | 3046 |
| 105 | Ga0068867_100615026 | 3300005459 | Bacteria | 949 |
| 106 | Ga0070685_10053945 | 3300005466 | Bacteria | 2331 |
| 107 | Ga0070685_10238652 | 3300005466 | Bacteria | 1199 |
| 108 | Ga0070707_100057853 | 3300005468 | Bacteria | 3719 |
| 109 | Ga0070707_100176789 | 3300005468 | Bacteria | 2081 |
| 110 | Ga0070698_100014238 | 3300005471 | Bacteria | 8408 |
| 111 | Ga0070698_100246073 | 3300005471 | Bacteria | 1721 |
| 112 | Ga0070699_100015650 | 3300005518 | Bacteria | 6515 |
| 113 | Ga0070699_100323386 | 3300005518 | Bacteria | 1387 |
| 114 | Ga0070699_100405362 | 3300005518 | Bacteria | 1233 |
| 115 | Ga0070679_100017929 | 3300005530 | Bacteria | 6859 |
| 116 | Ga0070679_100196955 | 3300005530 | Bacteria | 1982 |
| 117 | Ga0070684_100007379 | 3300005535 | Bacteria | 8548 |
| 118 | Ga0070697_100032621 | 3300005536 | Bacteria | 4192 |
| 119 | Ga0070697_100837722 | 3300005536 | Bacteria | 815 |
| 120 | Ga0068853_100238057 | 3300005539 | Bacteria | 1667 |
| 121 | Ga0068853_100447454 | 3300005539 | Bacteria | 1215 |
| 122 | Ga0070686_100026997 | 3300005544 | Bacteria | 3471 |
| 123 | Ga0070686_100478906 | 3300005544 | Bacteria | 962 |
| 124 | Ga0070665_100041910 | 3300005548 | Bacteria | 4601 |
| 125 | Ga0070665_100046639 | 3300005548 | Bacteria | 4352 |
| 126 | Ga0070665_100082250 | 3300005548 | Bacteria | 3225 |
| 127 | Ga0070665_100117248 | 3300005548 | Bacteria | 2665 |
| 128 | Ga0070665_100180269 | 3300005548 | Bacteria | 2113 |
| 129 | Ga0070665_100310869 | 3300005548 | Bacteria | 1579 |
| 130 | Ga0070665_100754776 | 3300005548 | Bacteria | 986 |
| 131 | Ga0070704_100005894 | 3300005549 | Bacteria | 7180 |
| 132 | Ga0070704_100161035 | 3300005549 | Bacteria | 1775 |
| 133 | Ga0068855_100001240 | 3300005563 | Bacteria | 31649 |
| 134 | Ga0068855_100002346 | 3300005563 | Bacteria | 23375 |
| 135 | Ga0068855_100013263 | 3300005563 | Bacteria | 9939 |
| 136 | Ga0068855_100634742 | 3300005563 | Bacteria | 1149 |
| 137 | Ga0070664_100012064 | 3300005564 | Bacteria | 7021 |
| 138 | Ga0070664_100145424 | 3300005564 | Bacteria | 2090 |
| 139 | Ga0070664_100148006 | 3300005564 | Bacteria | 2072 |
| 140 | Ga0070664_100534515 | 3300005564 | Bacteria | 1083 |
| 141 | Ga0068857_100207217 | 3300005577 | Bacteria | 1788 |
| 142 | Ga0068856_100010356 | 3300005614 | Bacteria | 9057 |
| 143 | Ga0068856_100235107 | 3300005614 | Bacteria | 1848 |
| 144 | Ga0068856_100724484 | 3300005614 | Bacteria | 1015 |
| 145 | Ga0070702_100111863 | 3300005615 | Bacteria | 1694 |
| 146 | Ga0070702_100242822 | 3300005615 | Bacteria | 1216 |
| 147 | Ga0068852_100031895 | 3300005616 | Bacteria | 4356 |
| 148 | Ga0068852_100064778 | 3300005616 | Bacteria | 3187 |
| 149 | Ga0068859_100000008 | 3300005617 | Bacteria | 383750 |
| 150 | Ga0068859_100004743 | 3300005617 | Bacteria | 13816 |
| 151 | Ga0068859_100021239 | 3300005617 | Bacteria | 6515 |
| 152 | Ga0068859_100197930 | 3300005617 | Bacteria | 2094 |
| 153 | Ga0068859_100393256 | 3300005617 | Bacteria | 1482 |
| 154 | Ga0068859_100468269 | 3300005617 | Bacteria | 1356 |
| 155 | Ga0068864_100000101 | 3300005618 | Bacteria | 84095 |
| 156 | Ga0068864_100085017 | 3300005618 | Unclassified | 2781 |
| 157 | Ga0068864_100316511 | 3300005618 | Bacteria | 1465 |
| 158 | Ga0068864_100504502 | 3300005618 | Bacteria | 1164 |
| 159 | Ga0068866_10011077 | 3300005718 | Bacteria | 3887 |
| 160 | Ga0068861_100023859 | 3300005719 | Bacteria | 4417 |
| 161 | Ga0068861_100304831 | 3300005719 | Bacteria | 1381 |
| 162 | Ga0068861_100436788 | 3300005719 | Bacteria | 1170 |
| 163 | Ga0068851_10097345 | 3300005834 | Bacteria | 1557 |
| 164 | Ga0068870_10485655 | 3300005840 | Bacteria | 821 |
| 165 | Ga0068863_100012306 | 3300005841 | Bacteria | 8261 |
| 166 | Ga0068863_100081804 | 3300005841 | Bacteria | 3059 |
| 167 | Ga0068863_100107301 | 3300005841 | Bacteria | 2657 |
| 168 | Ga0068863_100153171 | 3300005841 | Bacteria | 2206 |
| 169 | Ga0068863_100409320 | 3300005841 | Bacteria | 1327 |
| 170 | Ga0068858_100003390 | 3300005842 | Bacteria | 15860 |
| 171 | Ga0068858_100003419 | 3300005842 | Bacteria | 15788 |
| 172 | Ga0068858_100015795 | 3300005842 | Bacteria | 7101 |
| 173 | Ga0068858_100096380 | 3300005842 | Bacteria | 2756 |
| 174 | Ga0068858_100723917 | 3300005842 | Bacteria | 969 |
| 175 | Ga0068860_100043493 | 3300005843 | Bacteria | 4285 |
| 176 | Ga0068862_100059701 | 3300005844 | Bacteria | 3275 |
| 177 | Ga0068862_100385881 | 3300005844 | Bacteria | 1307 |
| 178 | Ga0081539_10026051 | 3300005985 | Bacteria | 3745 |
| 179 | Ga0070717_10001018 | 3300006028 | Bacteria | 18799 |
| 180 | Ga0070717_10076438 | 3300006028 | Bacteria | 2803 |
| 181 | Ga0070717_10293105 | 3300006028 | Bacteria | 1445 |
| 182 | Ga0070716_100075027 | 3300006173 | Bacteria | 2000 |
| 183 | Ga0070712_100003184 | 3300006175 | Bacteria | 10109 |
| 184 | Ga0070712_100235479 | 3300006175 | Bacteria | 1456 |
| 185 | Ga0075362_10062829 | 3300006177 | Bacteria | 1683 |
| 186 | Ga0075366_10002575 | 3300006195 | Bacteria | 9323 |
| 187 | Ga0075366_10011548 | 3300006195 | Bacteria | 4988 |
| 188 | Ga0097621_100026816 | 3300006237 | Bacteria | 4524 |
| 189 | Ga0097621_100043240 | 3300006237 | Bacteria | 3631 |
| 190 | Ga0097621_100206674 | 3300006237 | Bacteria | 1706 |
| 191 | Ga0068871_100005768 | 3300006358 | Bacteria | 8697 |
| 192 | Ga0068871_100019124 | 3300006358 | Bacteria | 5225 |
| 193 | Ga0075428_100388793 | 3300006844 | Bacteria | 1495 |
| 194 | Ga0075428_100514917 | 3300006844 | Bacteria | 1280 |
| 195 | Ga0075430_100105710 | 3300006846 | Bacteria | 2349 |
| 196 | Ga0075433_10027568 | 3300006852 | Bacteria | 4819 |
| 197 | Ga0075434_100659378 | 3300006871 | Bacteria | 1064 |
| 198 | Ga0075429_100048420 | 3300006880 | Bacteria | 3696 |
| 199 | Ga0075429_100334186 | 3300006880 | Bacteria | 1326 |
| 200 | Ga0075429_100507462 | 3300006880 | Bacteria | 1057 |
| 201 | Ga0068865_100047398 | 3300006881 | Bacteria | 2953 |
| 202 | Ga0068865_100152844 | 3300006881 | Bacteria | 1753 |
| 203 | Ga0075436_100136428 | 3300006914 | Bacteria | 1723 |
| 204 | Ga0075436_100175287 | 3300006914 | Bacteria | 1514 |
| 205 | Ga0097620_100000008 | 3300006931 | Bacteria | 383750 |
| 206 | Ga0097620_100004743 | 3300006931 | Bacteria | 13816 |
| 207 | Ga0097620_100021236 | 3300006931 | Bacteria | 6515 |
| 208 | Ga0097620_100197924 | 3300006931 | Bacteria | 2094 |
| 209 | Ga0097620_100393241 | 3300006931 | Bacteria | 1482 |
| 210 | Ga0097620_100468260 | 3300006931 | Bacteria | 1356 |
| 211 | Ga0079104_1000700 | 3300006946 | Bacteria | 30527 |
| 212 | Ga0079104_1003404 | 3300006946 | Bacteria | 7433 |
| 213 | Ga0075435_100167749 | 3300007076 | Bacteria | 1851 |
| 214 | Ga0105251_10000073 | 3300009011 | Bacteria | 97270 |
| 215 | Ga0105251_10000267 | 3300009011 | Bacteria | 52069 |
| 216 | Ga0105251_10000582 | 3300009011 | Bacteria | 33639 |
| 217 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 218 | Ga0105244_10000315 | 3300009036 | Bacteria | 46626 |
| 219 | Ga0105244_10108177 | 3300009036 | Bacteria | 1355 |
| 220 | Ga0105250_10080334 | 3300009092 | Bacteria | 1322 |
| 221 | Ga0105240_10003716 | 3300009093 | Bacteria | 23574 |
| 222 | Ga0105240_10005607 | 3300009093 | Bacteria | 18634 |
| 223 | Ga0105240_10005746 | 3300009093 | Bacteria | 18400 |
| 224 | Ga0105240_10006293 | 3300009093 | Bacteria | 17469 |
| 225 | Ga0105240_10061165 | 3300009093 | Bacteria | 4693 |
| 226 | Ga0105240_10074105 | 3300009093 | Bacteria | 4203 |
| 227 | Ga0105240_10661509 | 3300009093 | Bacteria | 1144 |
| 228 | Ga0111539_10006397 | 3300009094 | Bacteria | 15195 |
| 229 | Ga0111539_10066977 | 3300009094 | Bacteria | 4242 |
| 230 | Ga0111539_10189811 | 3300009094 | Bacteria | 2398 |
| 231 | Ga0111539_10209250 | 3300009094 | Bacteria | 2273 |
| 232 | Ga0111539_11009104 | 3300009094 | Bacteria | 967 |
| 233 | Ga0105245_10086433 | 3300009098 | Bacteria | 2876 |
| 234 | Ga0105247_10000187 | 3300009101 | Bacteria | 60332 |
| 235 | Ga0105247_10012875 | 3300009101 | Bacteria | 5020 |
| 236 | Ga0105247_10208835 | 3300009101 | Bacteria | 1316 |
| 237 | Ga0114129_10198151 | 3300009147 | Bacteria | 2722 |
| 238 | Ga0105243_10000056 | 3300009148 | Bacteria | 133442 |
| 239 | Ga0105243_10000471 | 3300009148 | Bacteria | 41457 |
| 240 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 241 | Ga0105241_10348406 | 3300009174 | Bacteria | 1285 |
| 242 | Ga0105242_10000015 | 3300009176 | Bacteria | 124678 |
| 243 | Ga0105242_10058655 | 3300009176 | Bacteria | 3157 |
| 244 | Ga0105248_10035689 | 3300009177 | Bacteria | 5561 |
| 245 | Ga0105248_10036354 | 3300009177 | Bacteria | 5507 |
| 246 | Ga0105248_10039410 | 3300009177 | Bacteria | 5291 |
| 247 | Ga0105248_10064863 | 3300009177 | Bacteria | 4100 |
| 248 | Ga0105248_10135207 | 3300009177 | Bacteria | 2781 |
| 249 | Ga0105237_10006745 | 3300009545 | Bacteria | 12679 |
| 250 | Ga0105237_10115769 | 3300009545 | Bacteria | 2674 |
| 251 | Ga0105237_10194727 | 3300009545 | Bacteria | 2026 |
| 252 | Ga0105237_10229381 | 3300009545 | Bacteria | 1858 |
| 253 | Ga0105238_10053835 | 3300009551 | Bacteria | 4044 |
| 254 | Ga0105238_10074565 | 3300009551 | Bacteria | 3385 |
| 255 | Ga0105239_10044969 | 3300010375 | Bacteria | 4840 |
| 256 | Ga0105239_10051580 | 3300010375 | Bacteria | 4510 |
| 257 | Ga0105239_10105428 | 3300010375 | Bacteria | 3122 |
| 258 | Ga0105239_10110765 | 3300010375 | Bacteria | 3043 |
| 259 | Ga0105239_10116732 | 3300010375 | Bacteria | 2962 |
| 260 | Ga0105239_10617904 | 3300010375 | Bacteria | 1236 |
| 261 | Ga0157316_1003325 | 3300012510 | Bacteria | 1153 |
| 262 | Ga0157373_10003158 | 3300013100 | Bacteria | 12444 |
| 263 | Ga0157373_10092599 | 3300013100 | Bacteria | 2129 |
| 264 | Ga0157373_10193437 | 3300013100 | Bacteria | 1433 |
| 265 | Ga0157370_10013507 | 3300013104 | Bacteria | 8408 |
| 266 | Ga0157370_10136510 | 3300013104 | Bacteria | 2286 |
| 267 | Ga0157369_10005191 | 3300013105 | Bacteria | 15223 |
| 268 | Ga0157369_10255028 | 3300013105 | Bacteria | 1830 |
| 269 | Ga0157369_10487808 | 3300013105 | Bacteria | 1275 |
| 270 | Ga0157374_10003724 | 3300013296 | Bacteria | 12812 |
| 271 | Ga0157374_10003991 | 3300013296 | Bacteria | 12401 |
| 272 | Ga0157374_10029467 | 3300013296 | Bacteria | 4971 |
| 273 | Ga0157374_10044152 | 3300013296 | Bacteria | 4120 |
| 274 | Ga0157374_10074693 | 3300013296 | Bacteria | 3202 |
| 275 | Ga0157374_10157142 | 3300013296 | Bacteria | 2214 |
| 276 | Ga0157374_10378805 | 3300013296 | Bacteria | 1409 |
| 277 | Ga0157378_10046120 | 3300013297 | Bacteria | 3874 |
| 278 | Ga0157378_10107682 | 3300013297 | Bacteria | 2551 |
| 279 | Ga0157378_10153853 | 3300013297 | Bacteria | 2145 |
| 280 | Ga0163162_10001589 | 3300013306 | Bacteria | 21243 |
| 281 | Ga0163162_10037600 | 3300013306 | Bacteria | 4830 |
| 282 | Ga0163162_10055019 | 3300013306 | Bacteria | 4005 |
| 283 | Ga0163162_10215867 | 3300013306 | Bacteria | 2048 |
| 284 | Ga0163162_11239320 | 3300013306 | Bacteria | 847 |
| 285 | Ga0157372_10010066 | 3300013307 | Bacteria | 10052 |
| 286 | Ga0157372_10519451 | 3300013307 | Bacteria | 1388 |
| 287 | Ga0157372_10799439 | 3300013307 | Bacteria | 1096 |
| 288 | Ga0157372_11410881 | 3300013307 | Bacteria | 803 |
| 289 | Ga0157375_10001221 | 3300013308 | Bacteria | 22177 |
| 290 | Ga0157375_10081196 | 3300013308 | Bacteria | 3282 |
| 291 | Ga0157375_11307461 | 3300013308 | Bacteria | 853 |
| 292 | Ga0163163_10001383 | 3300014325 | Bacteria | 20485 |
| 293 | Ga0163163_10006926 | 3300014325 | Bacteria | 9955 |
| 294 | Ga0163163_10406796 | 3300014325 | Bacteria | 1419 |
| 295 | Ga0157380_10049239 | 3300014326 | Bacteria | 3322 |
| 296 | Ga0157380_10307547 | 3300014326 | Bacteria | 1463 |
| 297 | Ga0157380_10769736 | 3300014326 | Bacteria | 976 |
| 298 | Ga0182008_10001860 | 3300014497 | Bacteria | 13719 |
| 299 | Ga0182008_10015435 | 3300014497 | Bacteria | 3985 |
| 300 | Ga0157377_10234961 | 3300014745 | Bacteria | 1181 |
| 301 | Ga0157377_10509041 | 3300014745 | Bacteria | 843 |
| 302 | Ga0157379_10015278 | 3300014968 | Bacteria | 6733 |
| 303 | Ga0157379_10069552 | 3300014968 | Bacteria | 3149 |
| 304 | Ga0157379_10533521 | 3300014968 | Bacteria | 1090 |
| 305 | Ga0157376_10006392 | 3300014969 | Bacteria | 8324 |
| 306 | Ga0157376_10268440 | 3300014969 | Bacteria | 1602 |
| 307 | Ga0157376_10430607 | 3300014969 | Bacteria | 1282 |
| 308 | Ga0157376_10477482 | 3300014969 | Bacteria | 1221 |
| 309 | Ga0157376_10708376 | 3300014969 | Bacteria | 1012 |
| 310 | Ga0182006_1000003 | 3300015261 | Bacteria | 826681 |
| 311 | Ga0182006_1000049 | 3300015261 | Bacteria | 184514 |
| 312 | Ga0182006_1000097 | 3300015261 | Bacteria | 102186 |
| 313 | Ga0182007_10000095 | 3300015262 | Bacteria | 63829 |
| 314 | Ga0182007_10002958 | 3300015262 | Bacteria | 8239 |
| 315 | Ga0182007_10015404 | 3300015262 | Bacteria | 2853 |
| 316 | Ga0182005_1000038 | 3300015265 | Bacteria | 160030 |
| 317 | Ga0182005_1020469 | 3300015265 | Bacteria | 1820 |
| 318 | Ga0182005_1020510 | 3300015265 | Bacteria | 1818 |
| 319 | Ga0163161_10000004 | 3300017792 | Bacteria | 333149 |
| 320 | Ga0163161_10062869 | 3300017792 | Bacteria | 2705 |
| 321 | Ga0163161_10531271 | 3300017792 | Bacteria | 962 |
| 322 | Ga0213872_10001170 | 3300021361 | Bacteria | 17827 |
| 323 | Ga0213872_10021407 | 3300021361 | Bacteria | 2977 |
| 324 | Ga0213872_10045192 | 3300021361 | Bacteria | 2004 |
| 325 | Ga0213872_10083172 | 3300021361 | Bacteria | 1437 |
| 326 | Ga0213871_10001458 | 3300021441 | Bacteria | 3980 |
| 327 | Ga0209674_100598 | 3300025226 | Bacteria | 13799 |
| 328 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 329 | Ga0209672_100095 | 3300025228 | Bacteria | 113474 |
| 330 | Ga0209672_101868 | 3300025228 | Bacteria | 6230 |
| 331 | Ga0209563_100131 | 3300025230 | Bacteria | 97465 |
| 332 | Ga0207427_100021 | 3300025231 | Bacteria | 494115 |
| 333 | Ga0207427_100105 | 3300025231 | Bacteria | 118241 |
| 334 | Ga0207427_100107 | 3300025231 | Bacteria | 116422 |
| 335 | Ga0209437_100039 | 3300025233 | Bacteria | 448321 |
| 336 | Ga0209437_100087 | 3300025233 | Bacteria | 253432 |
| 337 | Ga0209437_100129 | 3300025233 | Bacteria | 184661 |
| 338 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 339 | Ga0209258_100206 | 3300025242 | Bacteria | 119449 |
| 340 | Ga0209258_100272 | 3300025242 | Bacteria | 88382 |
| 341 | Ga0209646_1000246 | 3300025246 | Bacteria | 55219 |
| 342 | Ga0209646_1000485 | 3300025246 | Bacteria | 19518 |
| 343 | Ga0209026_1000051 | 3300025250 | Bacteria | 250792 |
| 344 | Ga0209026_1000878 | 3300025250 | Bacteria | 15653 |
| 345 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 346 | Ga0209148_1000176 | 3300025254 | Bacteria | 128357 |
| 347 | Ga0209148_1000185 | 3300025254 | Bacteria | 118117 |
| 348 | Ga0209759_1000145 | 3300025256 | Bacteria | 121772 |
| 349 | Ga0209233_1000023 | 3300025261 | Bacteria | 738870 |
| 350 | Ga0209233_1000224 | 3300025261 | Bacteria | 103605 |
| 351 | Ga0209233_1000447 | 3300025261 | Bacteria | 27425 |
| 352 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 353 | Ga0207666_1007773 | 3300025271 | Bacteria | 1420 |
| 354 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 355 | Ga0209455_1000081 | 3300025272 | Bacteria | 263674 |
| 356 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 357 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 358 | Ga0209675_1000077 | 3300025291 | Bacteria | 156212 |
| 359 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 360 | Ga0209564_1000230 | 3300025295 | Bacteria | 123814 |
| 361 | Ga0209256_1000559 | 3300025299 | Bacteria | 53325 |
| 362 | Ga0207426_1026348 | 3300025302 | Bacteria | 1948 |
| 363 | Ga0209051_1003306 | 3300025303 | Bacteria | 10681 |
| 364 | Ga0207697_10014064 | 3300025315 | Bacteria | 3331 |
| 365 | Ga0207697_10021800 | 3300025315 | Bacteria | 2624 |
| 366 | Ga0207696_1000033 | 3300025711 | Bacteria | 360689 |
| 367 | Ga0207655_1000011 | 3300025728 | Bacteria | 643321 |
| 368 | Ga0207655_1000013 | 3300025728 | Bacteria | 637510 |
| 369 | Ga0207713_1000065 | 3300025735 | Bacteria | 196128 |
| 370 | Ga0207713_1000108 | 3300025735 | Bacteria | 137268 |
| 371 | Ga0207713_1001983 | 3300025735 | Bacteria | 15397 |
| 372 | Ga0207653_10000011 | 3300025885 | Bacteria | 160949 |
| 373 | Ga0207682_10002230 | 3300025893 | Bacteria | 8744 |
| 374 | Ga0207642_10022924 | 3300025899 | Bacteria | 2485 |
| 375 | Ga0207710_10000016 | 3300025900 | Bacteria | 388568 |
| 376 | Ga0207710_10044398 | 3300025900 | Bacteria | 1979 |
| 377 | Ga0207710_10172342 | 3300025900 | Bacteria | 1058 |
| 378 | Ga0207688_10005672 | 3300025901 | Bacteria | 6788 |
| 379 | Ga0207680_10001266 | 3300025903 | Bacteria | 11962 |
| 380 | Ga0207680_10023747 | 3300025903 | Bacteria | 3353 |
| 381 | Ga0207680_10052911 | 3300025903 | Bacteria | 2435 |
| 382 | Ga0207699_10442958 | 3300025906 | Bacteria | 931 |
| 383 | Ga0207645_10010412 | 3300025907 | Bacteria | 6381 |
| 384 | Ga0207645_10199600 | 3300025907 | Bacteria | 1316 |
| 385 | Ga0207645_10311642 | 3300025907 | Bacteria | 1049 |
| 386 | Ga0207643_10085564 | 3300025908 | Bacteria | 1831 |
| 387 | Ga0207643_10108622 | 3300025908 | Bacteria | 1632 |
| 388 | Ga0207643_10158000 | 3300025908 | Bacteria | 1363 |
| 389 | Ga0207705_10002381 | 3300025909 | Bacteria | 14531 |
| 390 | Ga0207684_10113737 | 3300025910 | Bacteria | 2317 |
| 391 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 392 | Ga0207707_10185830 | 3300025912 | Bacteria | 1814 |
| 393 | Ga0207695_10006958 | 3300025913 | Bacteria | 14520 |
| 394 | Ga0207695_10014188 | 3300025913 | Bacteria | 9453 |
| 395 | Ga0207695_10020911 | 3300025913 | Bacteria | 7479 |
| 396 | Ga0207695_10069147 | 3300025913 | Bacteria | 3615 |
| 397 | Ga0207695_10109815 | 3300025913 | Bacteria | 2739 |
| 398 | Ga0207695_10283680 | 3300025913 | Bacteria | 1549 |
| 399 | Ga0207671_10021594 | 3300025914 | Bacteria | 4879 |
| 400 | Ga0207671_10073666 | 3300025914 | Bacteria | 2551 |
| 401 | Ga0207671_10167782 | 3300025914 | Bacteria | 1703 |
| 402 | Ga0207693_10024754 | 3300025915 | Bacteria | 4760 |
| 403 | Ga0207693_10053702 | 3300025915 | Bacteria | 3161 |
| 404 | Ga0207663_10084177 | 3300025916 | Bacteria | 2091 |
| 405 | Ga0207663_10226086 | 3300025916 | Bacteria | 1364 |
| 406 | Ga0207660_10083820 | 3300025917 | Bacteria | 2348 |
| 407 | Ga0207662_10021647 | 3300025918 | Bacteria | 3679 |
| 408 | Ga0207657_10053741 | 3300025919 | Bacteria | 3488 |
| 409 | Ga0207649_10084596 | 3300025920 | Bacteria | 2062 |
| 410 | Ga0207649_10180123 | 3300025920 | Bacteria | 1478 |
| 411 | Ga0207652_10250881 | 3300025921 | Bacteria | 1596 |
| 412 | Ga0207652_10309266 | 3300025921 | Bacteria | 1426 |
| 413 | Ga0207646_10042178 | 3300025922 | Bacteria | 4100 |
| 414 | Ga0207646_10670195 | 3300025922 | Bacteria | 928 |
| 415 | Ga0207681_10133978 | 3300025923 | Bacteria | 1835 |
| 416 | Ga0207681_10355577 | 3300025923 | Bacteria | 1173 |
| 417 | Ga0207694_10539477 | 3300025924 | Bacteria | 978 |
| 418 | Ga0207650_10008966 | 3300025925 | Bacteria | 6838 |
| 419 | Ga0207650_10066083 | 3300025925 | Bacteria | 2711 |
| 420 | Ga0207650_10277875 | 3300025925 | Bacteria | 1363 |
| 421 | Ga0207659_10000588 | 3300025926 | Bacteria | 21759 |
| 422 | Ga0207659_10029176 | 3300025926 | Bacteria | 3757 |
| 423 | Ga0207700_10051406 | 3300025928 | Bacteria | 3075 |
| 424 | Ga0207700_10272437 | 3300025928 | Bacteria | 1453 |
| 425 | Ga0207664_10069324 | 3300025929 | Bacteria | 2835 |
| 426 | Ga0207664_10164548 | 3300025929 | Bacteria | 1894 |
| 427 | Ga0207644_10002078 | 3300025931 | Bacteria | 12952 |
| 428 | Ga0207644_10004826 | 3300025931 | Bacteria | 8780 |
| 429 | Ga0207644_10032885 | 3300025931 | Bacteria | 3621 |
| 430 | Ga0207644_10102077 | 3300025931 | Bacteria | 2156 |
| 431 | Ga0207644_10421341 | 3300025931 | Bacteria | 1094 |
| 432 | Ga0207690_10022251 | 3300025932 | Bacteria | 3941 |
| 433 | Ga0207690_10273457 | 3300025932 | Bacteria | 1313 |
| 434 | Ga0207690_10648375 | 3300025932 | Bacteria | 865 |
| 435 | Ga0207706_10002872 | 3300025933 | Bacteria | 16701 |
| 436 | Ga0207706_10082095 | 3300025933 | Bacteria | 2833 |
| 437 | Ga0207706_10305056 | 3300025933 | Bacteria | 1387 |
| 438 | Ga0207686_10000007 | 3300025934 | Bacteria | 249199 |
| 439 | Ga0207686_10040916 | 3300025934 | Bacteria | 2822 |
| 440 | Ga0207686_10093174 | 3300025934 | Bacteria | 1994 |
| 441 | Ga0207709_10000101 | 3300025935 | Bacteria | 133425 |
| 442 | Ga0207709_10000161 | 3300025935 | Bacteria | 91314 |
| 443 | Ga0207709_10237979 | 3300025935 | Bacteria | 1323 |
| 444 | Ga0207670_10014040 | 3300025936 | Bacteria | 4742 |
| 445 | Ga0207670_10031541 | 3300025936 | Bacteria | 3398 |
| 446 | Ga0207670_10225360 | 3300025936 | Bacteria | 1437 |
| 447 | Ga0207670_10234084 | 3300025936 | Bacteria | 1412 |
| 448 | Ga0207669_10174886 | 3300025937 | Bacteria | 1532 |
| 449 | Ga0207704_10024325 | 3300025938 | Bacteria | 3282 |
| 450 | Ga0207704_10039218 | 3300025938 | Bacteria | 2756 |
| 451 | Ga0207704_10157544 | 3300025938 | Bacteria | 1611 |
| 452 | Ga0207665_10160044 | 3300025939 | Bacteria | 1619 |
| 453 | Ga0207691_10036906 | 3300025940 | Bacteria | 4527 |
| 454 | Ga0207691_10081108 | 3300025940 | Bacteria | 2917 |
| 455 | Ga0207691_10159650 | 3300025940 | Bacteria | 1979 |
| 456 | Ga0207711_10005419 | 3300025941 | Bacteria | 10791 |
| 457 | Ga0207711_10029539 | 3300025941 | Bacteria | 4625 |
| 458 | Ga0207711_10064678 | 3300025941 | Bacteria | 3160 |
| 459 | Ga0207711_10080900 | 3300025941 | Bacteria | 2838 |
| 460 | Ga0207689_10024667 | 3300025942 | Bacteria | 5042 |
| 461 | Ga0207689_10104860 | 3300025942 | Bacteria | 2323 |
| 462 | Ga0207689_10323356 | 3300025942 | Bacteria | 1280 |
| 463 | Ga0207661_10001327 | 3300025944 | Bacteria | 16569 |
| 464 | Ga0207661_10151832 | 3300025944 | Bacteria | 2003 |
| 465 | Ga0207679_10100194 | 3300025945 | Bacteria | 2264 |
| 466 | Ga0207679_10178036 | 3300025945 | Bacteria | 1757 |
| 467 | Ga0207679_10293684 | 3300025945 | Bacteria | 1398 |
| 468 | Ga0207667_10001671 | 3300025949 | Bacteria | 27944 |
| 469 | Ga0207667_10002349 | 3300025949 | Bacteria | 23706 |
| 470 | Ga0207667_10008952 | 3300025949 | Bacteria | 11839 |
| 471 | Ga0207667_10169277 | 3300025949 | Bacteria | 2245 |
| 472 | Ga0207667_10571675 | 3300025949 | Bacteria | 1142 |
| 473 | Ga0207651_10000179 | 3300025960 | Bacteria | 27573 |
| 474 | Ga0207651_10016407 | 3300025960 | Bacteria | 4337 |
| 475 | Ga0207651_10548597 | 3300025960 | Bacteria | 1005 |
| 476 | Ga0207712_10008695 | 3300025961 | Bacteria | 6422 |
| 477 | Ga0207712_10081944 | 3300025961 | Bacteria | 2351 |
| 478 | Ga0207712_10521389 | 3300025961 | Bacteria | 1018 |
| 479 | Ga0207712_10535290 | 3300025961 | Bacteria | 1006 |
| 480 | Ga0207668_10066865 | 3300025972 | Bacteria | 2549 |
| 481 | Ga0207658_10001572 | 3300025986 | Bacteria | 17671 |
| 482 | Ga0207677_10004081 | 3300026023 | Bacteria | 7807 |
| 483 | Ga0207677_10082448 | 3300026023 | Bacteria | 2311 |
| 484 | Ga0207703_10005653 | 3300026035 | Bacteria | 10039 |
| 485 | Ga0207703_10017041 | 3300026035 | Bacteria | 5665 |
| 486 | Ga0207703_10120128 | 3300026035 | Bacteria | 2255 |
| 487 | Ga0207703_10182196 | 3300026035 | Bacteria | 1854 |
| 488 | Ga0207703_10385639 | 3300026035 | Bacteria | 1297 |
| 489 | Ga0207639_10022786 | 3300026041 | Bacteria | 4515 |
| 490 | Ga0207639_10027657 | 3300026041 | Bacteria | 4134 |
| 491 | Ga0207639_10034078 | 3300026041 | Bacteria | 3761 |
| 492 | Ga0207639_10233772 | 3300026041 | Bacteria | 1595 |
| 493 | Ga0207708_10019637 | 3300026075 | Bacteria | 5096 |
| 494 | Ga0207708_10095035 | 3300026075 | Bacteria | 2302 |
| 495 | Ga0207708_10370931 | 3300026075 | Bacteria | 1178 |
| 496 | Ga0207641_10009505 | 3300026088 | Bacteria | 8016 |
| 497 | Ga0207641_10010646 | 3300026088 | Bacteria | 7547 |
| 498 | Ga0207641_10126045 | 3300026088 | Bacteria | 2292 |
| 499 | Ga0207641_10181212 | 3300026088 | Bacteria | 1929 |
| 500 | Ga0207641_10592141 | 3300026088 | Bacteria | 1085 |
| 501 | Ga0207641_10927352 | 3300026088 | Bacteria | 865 |
| 502 | Ga0207648_10007551 | 3300026089 | Bacteria | 10670 |
| 503 | Ga0207648_10009747 | 3300026089 | Bacteria | 9180 |
| 504 | Ga0207648_10468805 | 3300026089 | Bacteria | 1149 |
| 505 | Ga0207648_10484125 | 3300026089 | Bacteria | 1130 |
| 506 | Ga0207676_10002099 | 3300026095 | Bacteria | 14425 |
| 507 | Ga0207676_10067892 | 3300026095 | Bacteria | 2849 |
| 508 | Ga0207676_10100058 | 3300026095 | Unclassified | 2401 |
| 509 | Ga0207676_10303498 | 3300026095 | Bacteria | 1458 |
| 510 | Ga0207674_10088512 | 3300026116 | Bacteria | 3090 |
| 511 | Ga0207674_10151829 | 3300026116 | Bacteria | 2273 |
| 512 | Ga0207674_10277185 | 3300026116 | Bacteria | 1625 |
| 513 | Ga0207674_10344350 | 3300026116 | Bacteria | 1441 |
| 514 | Ga0207674_10701524 | 3300026116 | Bacteria | 977 |
| 515 | Ga0207675_100039681 | 3300026118 | Bacteria | 4394 |
| 516 | Ga0207675_100099700 | 3300026118 | Bacteria | 2736 |
| 517 | Ga0207675_100227299 | 3300026118 | Bacteria | 1799 |
| 518 | Ga0207675_100240210 | 3300026118 | Bacteria | 1750 |
| 519 | Ga0207675_101002749 | 3300026118 | Bacteria | 853 |
| 520 | Ga0207683_10001598 | 3300026121 | Bacteria | 20368 |
| 521 | Ga0207683_10146798 | 3300026121 | Bacteria | 2127 |
| 522 | Ga0207683_10184790 | 3300026121 | Bacteria | 1891 |
| 523 | Ga0207683_10364682 | 3300026121 | Bacteria | 1327 |
| 524 | Ga0207683_10407446 | 3300026121 | Bacteria | 1251 |
| 525 | Ga0207698_10067524 | 3300026142 | Bacteria | 2820 |
| 526 | Ga0207698_10132170 | 3300026142 | Bacteria | 2135 |
| 527 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 528 | Ga0209281_1004171 | 3300027111 | Bacteria | 4411 |
| 529 | Ga0209371_1002176 | 3300027312 | Bacteria | 11460 |
| 530 | Ga0209588_1073225 | 3300027671 | Bacteria | 1107 |
| 531 | Ga0207428_10038931 | 3300027907 | Bacteria | 3862 |
| 532 | Ga0265356_1000177 | 3300028017 | Bacteria | 11904 |
| 533 | Ga0268266_10000420 | 3300028379 | Bacteria | 64525 |
| 534 | Ga0268266_10024463 | 3300028379 | Bacteria | 5135 |
| 535 | Ga0268266_10033124 | 3300028379 | Bacteria | 4393 |
| 536 | Ga0268266_10065765 | 3300028379 | Bacteria | 3134 |
| 537 | Ga0268266_10072942 | 3300028379 | Bacteria | 2978 |
| 538 | Ga0268266_10093764 | 3300028379 | Bacteria | 2634 |
| 539 | Ga0268266_10096267 | 3300028379 | Bacteria | 2601 |
| 540 | Ga0268266_10231525 | 3300028379 | Bacteria | 1702 |
| 541 | Ga0268266_10413924 | 3300028379 | Bacteria | 1276 |
| 542 | Ga0268266_10579678 | 3300028379 | Bacteria | 1076 |
| 543 | Ga0268266_10821167 | 3300028379 | Bacteria | 898 |
| 544 | Ga0268265_10036989 | 3300028380 | Bacteria | 3579 |
| 545 | Ga0268265_10126671 | 3300028380 | Bacteria | 2114 |
| 546 | Ga0268264_10054629 | 3300028381 | Bacteria | 3336 |
| 547 | Ga0268264_10061722 | 3300028381 | Bacteria | 3145 |
| 548 | Ga0268264_10369170 | 3300028381 | Bacteria | 1371 |
| 549 | Ga0265326_10051178 | 3300028558 | Bacteria | 1170 |
| 550 | Ga0265318_10071790 | 3300028577 | Bacteria | 1283 |
| 551 | Ga0265338_10092476 | 3300028800 | Bacteria | 2494 |
| 552 | Ga0268256_1001097 | 3300030500 | Bacteria | 17670 |
| 553 | Ga0265760_10002206 | 3300031090 | Bacteria | 5694 |
| 554 | Ga0265332_10065200 | 3300031238 | Bacteria | 1555 |
| 555 | Ga0265328_10116024 | 3300031239 | Bacteria | 997 |
| 556 | Ga0265325_10000127 | 3300031241 | Bacteria | 52109 |
| 557 | Ga0265339_10000827 | 3300031249 | Bacteria | 23830 |
| 558 | Ga0265339_10067611 | 3300031249 | Bacteria | 1911 |
| 559 | Ga0265331_10029577 | 3300031250 | Bacteria | 2732 |
| 560 | Ga0265331_10060128 | 3300031250 | Bacteria | 1795 |
| 561 | Ga0265331_10249713 | 3300031250 | Bacteria | 796 |
| 562 | Ga0265327_10158451 | 3300031251 | Bacteria | 1047 |
| 563 | Ga0265316_10018261 | 3300031344 | Bacteria | 6032 |
| 564 | Ga0265316_10052944 | 3300031344 | Bacteria | 3182 |
| 565 | Ga0265316_10093487 | 3300031344 | Bacteria | 2291 |
| 566 | Ga0307513_10103235 | 3300031456 | Bacteria | 2868 |
| 567 | Ga0265313_10000907 | 3300031595 | Bacteria | 29634 |
| 568 | Ga0265313_10147932 | 3300031595 | Bacteria | 1006 |
| 569 | Ga0307514_10001950 | 3300031649 | Bacteria | 22540 |
| 570 | Ga0265314_10008385 | 3300031711 | Bacteria | 8856 |
| 571 | Ga0316576_10203972 | 3300031727 | Bacteria | 1489 |
| 572 | Ga0316578_10087120 | 3300031728 | Bacteria | 1862 |
| 573 | Ga0316577_10079932 | 3300031733 | Bacteria | 1827 |
| 574 | Ga0307406_10210179 | 3300031901 | Bacteria | 1439 |
| 575 | Ga0307412_10000096 | 3300031911 | Bacteria | 74069 |
| 576 | Ga0307412_10001339 | 3300031911 | Bacteria | 13744 |
| 577 | Ga0307409_100270971 | 3300031995 | Bacteria | 1563 |
| 578 | Ga0307416_100000017 | 3300032002 | Bacteria | 201722 |
| 579 | Ga0307414_10010449 | 3300032004 | Bacteria | 5386 |
| 580 | Ga0307411_10612860 | 3300032005 | Bacteria | 937 |
| 581 | Ga0307415_100615369 | 3300032126 | Bacteria | 969 |
| 582 | Ga0307415_100847747 | 3300032126 | Bacteria | 838 |
| 583 | Ga0307415_100977160 | 3300032126 | Bacteria | 785 |
| 584 | Ga0316585_10051322 | 3300032137 | Bacteria | 1325 |
| 585 | Ga0307510_10377122 | 3300033180 | Bacteria | 864 |
| 586 | Ga0373959_0025113 | 3300034820 | Bacteria | 1169 |
| 587 | Ga0373926_0219815 | 3300035083 | Bacteria | 733 |
| 588 | Ga0373934_0000391 | 3300035086 | Bacteria | 15305 |
| 589 | Ga0373934_0012247 | 3300035086 | Bacteria | 3238 |
| 590 | Ga0373934_0086340 | 3300035086 | Bacteria | 1263 |
| 591 | Ga0373923_0003108 | 3300035111 | Bacteria | 5265 |
| 592 | Ga0373923_0225851 | 3300035111 | Bacteria | 871 |
| 593 | Ga0373936_0004500 | 3300035113 | Bacteria | 5275 |
| 594 | Ga0373936_0057196 | 3300035113 | Bacteria | 1586 |
| 595 | Ga0373945_0019882 | 3300035116 | Bacteria | 2295 |
| 596 | Ga0373953_0003575 | 3300035117 | Bacteria | 4863 |
| 597 | Ga0373953_0029245 | 3300035117 | Bacteria | 2130 |
| 598 | Ga0373954_0003733 | 3300035118 | Bacteria | 6490 |
| 599 | Ga0373954_0031178 | 3300035118 | Bacteria | 2460 |
| 600 | Ga0373954_0035743 | 3300035118 | Bacteria | 2305 |
| 601 | Ga0373954_0071008 | 3300035118 | Bacteria | 1655 |
| 602 | Ga0373954_0187956 | 3300035118 | Bacteria | 1014 |
| 603 | Ga0373943_0033981 | 3300035170 | Bacteria | 2432 |
| 604 | Ga0373946_0023130 | 3300035171 | Bacteria | 2426 |
| 605 | Ga0373946_0146142 | 3300035171 | Bacteria | 1100 |
| 606 | Ga0373955_0001902 | 3300035172 | Bacteria | 9009 |
| 607 | Ga0373955_0021943 | 3300035172 | Bacteria | 3230 |
| 608 | Ga0373955_0108442 | 3300035172 | Bacteria | 1603 |
| 609 | Ga0373961_0082419 | 3300035241 | Bacteria | 1014 |
| 610 | Ga0373924_0002259 | 3300035410 | Bacteria | 6465 |
| 611 | Ga0373924_0170859 | 3300035410 | Bacteria | 955 |
| 612 | Ga0373931_0014564 | 3300035691 | Bacteria | 3846 |
| 613 | Ga0373935_0008762 | 3300035692 | Bacteria | 6061 |
| 614 | Ga0373935_0107250 | 3300035692 | Bacteria | 1849 |
| 615 | Ga0373927_0002239 | 3300035695 | Bacteria | 14208 |
| 616 | Ga0373927_0007084 | 3300035695 | Bacteria | 7605 |
| 617 | Ga0373933_0010447 | 3300035724 | Bacteria | 5090 |
| 618 | Ga0373933_0044563 | 3300035724 | Bacteria | 2628 |
| 619 | Ga0373933_0177682 | 3300035724 | Bacteria | 1357 |
| 620 | Ga0373933_0210819 | 3300035724 | Bacteria | 1245 |
| 621 | Ga0373947_0374787 | 3300035725 | Bacteria | 957 |
| 622 | Ga0373937_0001034 | 3300036401 | Bacteria | 23525 |
| 623 | Ga0373937_0008262 | 3300036401 | Bacteria | 9037 |
| 624 | Ga0373937_0032473 | 3300036401 | Bacteria | 4735 |
| 625 | Ga0373937_0107999 | 3300036401 | Bacteria | 2587 |
| 626 | Ga0373937_0211881 | 3300036401 | Bacteria | 1823 |
| 627 | Ga0316584_0315286 | 3300036712 | Bacteria | 1129 |
| 628 | Ga0373925_0000715 | 3300037068 | Bacteria | 30997 |
| 629 | Ga0373925_0025553 | 3300037068 | Bacteria | 4316 |
| 630 | Ga0373925_0090209 | 3300037068 | Bacteria | 2343 |
| 631 | Ga0373925_0299408 | 3300037068 | Bacteria | 1298 |
| 632 | Ga0373925_0304909 | 3300037068 | Bacteria | 1286 |
| 633 | Ga0395899_0019318 | 3300037312 | Bacteria | 5177 |
| 634 | Ga0395899_0042250 | 3300037312 | Bacteria | 3404 |
| 635 | Ga0395898_0001110 | 3300037466 | Bacteria | 41435 |
| 636 | Ga0395905_0417365 | 3300037471 | Bacteria | 1238 |
| 637 | Ga0436364_0089220 | 3300037853 | Bacteria | 9810 |
| 638 | Ga0436365_0001623 | 3300039437 | Bacteria | 1711 |
| 639 | Ga0436360_0137000 | 3300039438 | Bacteria | 4047 |
| 640 | Ga0436360_0386428 | 3300039438 | Bacteria | 2037 |
| 641 | Ga0436360_0469655 | 3300039438 | Bacteria | 3935 |
| 642 | Ga0436360_0708149 | 3300039438 | Bacteria | 1590 |
| 643 | Ga0436360_0824430 | 3300039438 | Bacteria | 2369 |
| 644 | Ga0436360_1098059 | 3300039438 | Bacteria | 2114 |
| 645 | Ga0436361_0041018 | 3300039447 | Bacteria | 1992 |
| 646 | Ga0436361_0133351 | 3300039447 | Bacteria | 1570 |
| 647 | Ga0436361_0191634 | 3300039447 | Bacteria | 3050 |
| 648 | Ga0436361_0282869 | 3300039447 | Bacteria | 2878 |
| 649 | Ga0436361_0300897 | 3300039447 | Bacteria | 77372 |
| 650 | Ga0436361_0508014 | 3300039447 | Bacteria | 3250 |
| 651 | Ga0436361_0785765 | 3300039447 | Bacteria | 815 |
| 652 | Ga0436361_1030428 | 3300039447 | Bacteria | 2354 |
| 653 | Ga0436363_0387766 | 3300039450 | Bacteria | 1390 |
| 654 | Ga0436363_0588950 | 3300039450 | Bacteria | 1024 |
| 655 | Ga0436363_1671843 | 3300039450 | Bacteria | 1027 |
| 656 | Ga0439438_002259 | 3300041405 | Bacteria | 8262 |
| 657 | Ga0439447_001305 | 3300041407 | Bacteria | 9066 |
| 658 | Ga0439466_0083079 | 3300041411 | Bacteria | 1009 |
| 659 | Ga0439445_0000288 | 3300042004 | Bacteria | 9789 |
| 660 | Ga0439432_023496 | 3300042006 | Bacteria | 2031 |
| 661 | Ga0439432_036474 | 3300042006 | Bacteria | 1573 |
| 662 | Ga0451577_0000101 | 3300042876 | Bacteria | 190854 |
| 663 | Ga0451577_0208072 | 3300042876 | Bacteria | 1767 |
| 664 | Ga0466969_0009932 | 3300044656 | Bacteria | 5045 |
| 665 | Ga0466969_0090988 | 3300044656 | Bacteria | 1446 |
| 666 | Ga0466972_0123062 | 3300044658 | Bacteria | 1223 |
| 667 | Ga0466989_0074246 | 3300044663 | Bacteria | 2093 |
| 668 | Ga0466965_0017505 | 3300044683 | Bacteria | 3426 |
| 669 | Ga0466965_0084935 | 3300044683 | Bacteria | 1604 |
| 670 | Ga0466966_0007469 | 3300044684 | Bacteria | 7247 |
| 671 | Ga0466961_0000412 | 3300044693 | Bacteria | 27244 |
| 672 | Ga0466961_0001299 | 3300044693 | Bacteria | 15419 |
| 673 | Ga0466961_0001373 | 3300044693 | Bacteria | 15036 |
| 674 | Ga0466961_0022862 | 3300044693 | Bacteria | 4021 |
| 675 | Ga0466963_0051014 | 3300044694 | Bacteria | 2741 |
| 676 | Ga0466963_0238926 | 3300044694 | Bacteria | 1274 |
| 677 | Ga0466964_0111020 | 3300044706 | Bacteria | 1223 |
| 678 | Ga0453684_0000679 | 3300044712 | Bacteria | 121950 |
| 679 | Ga0453684_0070521 | 3300044712 | Bacteria | 4425 |
| 680 | Ga0453684_0361100 | 3300044712 | Bacteria | 1635 |
| 681 | Ga0466971_0019617 | 3300044719 | Bacteria | 3004 |
| 682 | Ga0466971_0027166 | 3300044719 | Bacteria | 2562 |
| 683 | Ga0466968_0180669 | 3300044735 | Bacteria | 981 |
| 684 | Ga0466957_0006003 | 3300044842 | Bacteria | 6849 |
| 685 | Ga0466957_0404160 | 3300044842 | Bacteria | 934 |
| 686 | Ga0466959_0029127 | 3300045049 | Bacteria | 4091 |
| 687 | Ga0451576_0000260 | 3300045051 | Bacteria | 129222 |
| 688 | Ga0466958_0063430 | 3300045836 | Bacteria | 2253 |
| 689 | Ga0466958_0070861 | 3300045836 | Bacteria | 2134 |
| 690 | Ga0466958_0190423 | 3300045836 | Bacteria | 1304 |
| 691 | Ga0466967_0161576 | 3300045976 | Bacteria | 2103 |
| 692 | Ga0466967_0324205 | 3300045976 | Bacteria | 1486 |
| 693 | Ga0466967_0625270 | 3300045976 | Bacteria | 1064 |
| 694 | Ga0495617_000304 | 3300046452 | Bacteria | 27738 |
| 695 | Ga0495627_000141 | 3300046453 | Bacteria | 85993 |
| 696 | Ga0495627_004584 | 3300046453 | Bacteria | 5743 |
| 697 | Ga0495592_0004704 | 3300046454 | Bacteria | 10015 |
| 698 | Ga0495592_0020234 | 3300046454 | Bacteria | 5063 |
| 699 | Ga0495592_0062411 | 3300046454 | Bacteria | 2736 |
| 700 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 701 | Ga0495591_001616 | 3300046458 | Bacteria | 13611 |
| 702 | Ga0495638_0000328 | 3300046460 | Bacteria | 60200 |
| 703 | Ga0495638_0000493 | 3300046460 | Bacteria | 47046 |
| 704 | Ga0495638_0000543 | 3300046460 | Bacteria | 43505 |
| 705 | Ga0495638_0104420 | 3300046460 | Bacteria | 1690 |
| 706 | Ga0495641_0001105 | 3300046461 | Bacteria | 23196 |
| 707 | Ga0495651_0009753 | 3300046462 | Bacteria | 7385 |
| 708 | Ga0495653_0017178 | 3300046463 | Bacteria | 5884 |
| 709 | Ga0495653_0196397 | 3300046463 | Bacteria | 1373 |
| 710 | Ga0495650_0001929 | 3300046471 | Bacteria | 18373 |
| 711 | Ga0495650_0003366 | 3300046471 | Bacteria | 11722 |
| 712 | Ga0495580_0021288 | 3300046472 | Bacteria | 4785 |
| 713 | Ga0495580_0128834 | 3300046472 | Bacteria | 1756 |
| 714 | Ga0495580_0244249 | 3300046472 | Bacteria | 1230 |
| 715 | Ga0495582_0089280 | 3300046473 | Bacteria | 1717 |
| 716 | Ga0495582_0094989 | 3300046473 | Bacteria | 1665 |
| 717 | Ga0495582_0314016 | 3300046473 | Bacteria | 902 |
| 718 | Ga0495605_0000394 | 3300046474 | Bacteria | 40242 |
| 719 | Ga0495605_0025478 | 3300046474 | Bacteria | 3081 |
| 720 | Ga0495639_0003744 | 3300046475 | Bacteria | 6541 |
| 721 | Ga0495639_0008665 | 3300046475 | Bacteria | 4360 |
| 722 | Ga0495662_0016160 | 3300046476 | Bacteria | 3619 |
| 723 | Ga0495664_0003219 | 3300046477 | Bacteria | 8860 |
| 724 | Ga0495664_0009587 | 3300046477 | Bacteria | 5419 |
| 725 | Ga0495584_0003609 | 3300046491 | Bacteria | 8444 |
| 726 | Ga0495585_0000001 | 3300046492 | Bacteria | 609804 |
| 727 | Ga0495594_0009332 | 3300046499 | Bacteria | 5068 |
| 728 | Ga0495596_0006258 | 3300046500 | Bacteria | 5508 |
| 729 | Ga0495607_0000967 | 3300046501 | Bacteria | 26576 |
| 730 | Ga0495607_0004270 | 3300046501 | Bacteria | 10576 |
| 731 | Ga0495607_0006847 | 3300046501 | Bacteria | 7953 |
| 732 | Ga0495607_0217499 | 3300046501 | Bacteria | 936 |
| 733 | Ga0495583_0000310 | 3300046506 | Bacteria | 77200 |
| 734 | Ga0495583_0000626 | 3300046506 | Bacteria | 47506 |
| 735 | Ga0495583_0084943 | 3300046506 | Bacteria | 1370 |
| 736 | Ga0495606_0000326 | 3300046507 | Bacteria | 82103 |
| 737 | Ga0495606_0000660 | 3300046507 | Bacteria | 54210 |
| 738 | Ga0495606_0001121 | 3300046507 | Bacteria | 38297 |
| 739 | Ga0495608_0011280 | 3300046511 | Bacteria | 6222 |
| 740 | Ga0495608_0023435 | 3300046511 | Bacteria | 4230 |
| 741 | Ga0495610_0000006 | 3300046512 | Bacteria | 856822 |
| 742 | Ga0495616_0014232 | 3300046513 | Bacteria | 4461 |
| 743 | Ga0495628_0006322 | 3300046516 | Bacteria | 10348 |
| 744 | Ga0495628_0052427 | 3300046516 | Bacteria | 3222 |
| 745 | Ga0495628_0218511 | 3300046516 | Bacteria | 1432 |
| 746 | Ga0495628_0579662 | 3300046516 | Bacteria | 803 |
| 747 | Ga0495630_0001974 | 3300046517 | Bacteria | 14279 |
| 748 | Ga0495631_0000078 | 3300046518 | Bacteria | 63148 |
| 749 | Ga0495632_0000601 | 3300046519 | Bacteria | 33346 |
| 750 | Ga0495643_0000519 | 3300046522 | Bacteria | 48062 |
| 751 | Ga0495644_0000799 | 3300046523 | Bacteria | 12983 |
| 752 | Ga0495644_0002833 | 3300046523 | Bacteria | 6874 |
| 753 | Ga0495648_0000206 | 3300046524 | Bacteria | 68670 |
| 754 | Ga0495648_0000990 | 3300046524 | Bacteria | 29242 |
| 755 | Ga0495648_0003241 | 3300046524 | Bacteria | 14432 |
| 756 | Ga0495648_0023475 | 3300046524 | Bacteria | 4222 |
| 757 | Ga0495666_0006403 | 3300046526 | Bacteria | 5931 |
| 758 | Ga0495642_0013982 | 3300046528 | Bacteria | 3109 |
| 759 | Ga0495652_0037267 | 3300046529 | Bacteria | 4219 |
| 760 | Ga0495652_0202263 | 3300046529 | Bacteria | 1506 |
| 761 | Ga0495652_0347124 | 3300046529 | Bacteria | 1064 |
| 762 | Ga0495654_0000006 | 3300046530 | Bacteria | 451432 |
| 763 | Ga0495654_0000353 | 3300046530 | Bacteria | 39769 |
| 764 | Ga0495654_0002624 | 3300046530 | Bacteria | 11452 |
| 765 | Ga0495654_0018562 | 3300046530 | Bacteria | 3643 |
| 766 | Ga0495640_0006143 | 3300046533 | Bacteria | 9520 |
| 767 | Ga0495586_0005085 | 3300046535 | Bacteria | 7039 |
| 768 | Ga0495587_0015431 | 3300046536 | Bacteria | 4770 |
| 769 | Ga0495587_0024960 | 3300046536 | Bacteria | 3658 |
| 770 | Ga0495587_0027599 | 3300046536 | Bacteria | 3457 |
| 771 | Ga0495587_0045421 | 3300046536 | Bacteria | 2611 |
| 772 | Ga0495587_0322659 | 3300046536 | Bacteria | 862 |
| 773 | Ga0495609_0005147 | 3300046538 | Bacteria | 6965 |
| 774 | Ga0495609_0010929 | 3300046538 | Bacteria | 4337 |
| 775 | Ga0495609_0107445 | 3300046538 | Bacteria | 1206 |
| 776 | Ga0495621_0006587 | 3300046539 | Bacteria | 3399 |
| 777 | Ga0495621_0104197 | 3300046539 | Bacteria | 1082 |
| 778 | Ga0495597_0000262 | 3300046542 | Bacteria | 48054 |
| 779 | Ga0495645_0000483 | 3300046543 | Bacteria | 27603 |
| 780 | Ga0495645_0027047 | 3300046543 | Bacteria | 4166 |
| 781 | Ga0495645_0334436 | 3300046543 | Bacteria | 980 |
| 782 | Ga0495622_0000077 | 3300046557 | Bacteria | 86561 |
| 783 | Ga0495622_0113110 | 3300046557 | Bacteria | 1242 |
| 784 | Ga0495633_0000149 | 3300046558 | Bacteria | 92890 |
| 785 | Ga0495633_0002549 | 3300046558 | Bacteria | 12789 |
| 786 | Ga0495633_0007833 | 3300046558 | Bacteria | 6097 |
| 787 | Ga0495667_0005516 | 3300046559 | Bacteria | 8551 |
| 788 | Ga0495667_0014488 | 3300046559 | Bacteria | 5327 |
| 789 | Ga0495667_0015374 | 3300046559 | Bacteria | 5171 |
| 790 | Ga0495668_0000888 | 3300046616 | Bacteria | 33684 |
| 791 | Ga0495668_0034425 | 3300046616 | Bacteria | 2841 |
| 792 | Ga0495634_0008248 | 3300046642 | Bacteria | 7769 |
| 793 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 794 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 795 | Ga0495625_0000199 | 3300046660 | Bacteria | 95454 |
| 796 | Ga0495625_0001048 | 3300046660 | Bacteria | 36295 |
| 797 | Ga0495625_0062950 | 3300046660 | Bacteria | 2620 |
| 798 | Ga0495635_0312077 | 3300046663 | Bacteria | 1053 |
| 799 | Ga0495659_0002117 | 3300046664 | Bacteria | 6475 |
| 800 | Ga0495661_0000104 | 3300046665 | Bacteria | 101211 |
| 801 | Ga0495661_0043077 | 3300046665 | Bacteria | 2777 |
| 802 | Ga0495588_0048265 | 3300046674 | Bacteria | 2187 |
| 803 | Ga0495657_0003049 | 3300046675 | Bacteria | 13865 |
| 804 | Ga0495657_0017206 | 3300046675 | Bacteria | 5253 |
| 805 | Ga0495599_0001707 | 3300046678 | Bacteria | 12704 |
| 806 | Ga0495599_0001790 | 3300046678 | Bacteria | 12465 |
| 807 | Ga0495646_0026014 | 3300046680 | Bacteria | 3675 |
| 808 | Ga0495647_0001510 | 3300046681 | Bacteria | 7201 |
| 809 | Ga0495658_0335019 | 3300046683 | Bacteria | 960 |
| 810 | Ga0495658_0466913 | 3300046683 | Bacteria | 807 |
| 811 | Ga0495669_0125883 | 3300046684 | Bacteria | 1204 |
| 812 | Ga0495613_0180728 | 3300046689 | Bacteria | 1494 |
| 813 | Ga0495624_0023178 | 3300046690 | Bacteria | 4095 |
| 814 | Ga0495670_0176018 | 3300046691 | Bacteria | 1128 |
| 815 | Ga0495671_0000175 | 3300046692 | Bacteria | 57098 |
| 816 | Ga0495671_0001021 | 3300046692 | Bacteria | 19478 |
| 817 | Ga0495671_0004751 | 3300046692 | Bacteria | 8026 |
| 818 | Ga0495589_0000006 | 3300046794 | Bacteria | 303635 |
| 819 | Ga0495589_0000999 | 3300046794 | Bacteria | 17183 |
| 820 | Ga0495600_0002178 | 3300046809 | Bacteria | 11118 |
| 821 | Ga0495600_0070414 | 3300046809 | Bacteria | 2285 |
| 822 | Ga0495660_0000008 | 3300046810 | Bacteria | 435769 |
| 823 | Ga0495660_0000009 | 3300046810 | Bacteria | 427395 |
| 824 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 825 | Ga0495660_0109464 | 3300046810 | Bacteria | 1411 |
| 826 | Ga0495660_0186080 | 3300046810 | Bacteria | 1001 |
| 827 | Ga0495581_0146557 | 3300047315 | Bacteria | 1378 |
| 828 | Ga0495604_0010199 | 3300047317 | Bacteria | 7442 |
| 829 | Ga0495604_0012321 | 3300047317 | Bacteria | 6797 |
| 830 | Ga0495636_0001345 | 3300047318 | Bacteria | 9340 |
| 831 | Ga0495674_0000463 | 3300047319 | Bacteria | 36736 |
| 832 | Ga0495674_0052188 | 3300047319 | Bacteria | 3600 |
| 833 | Ga0495674_0354855 | 3300047319 | Bacteria | 1190 |
| 834 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 835 | Ga0495672_0001917 | 3300047320 | Bacteria | 19721 |
| 836 | Ga0495680_0016578 | 3300047322 | Bacteria | 6324 |
| 837 | Ga0495680_0082993 | 3300047322 | Bacteria | 2417 |
| 838 | Ga0495680_0102926 | 3300047322 | Bacteria | 2126 |
| 839 | Ga0495683_0000472 | 3300047323 | Bacteria | 31230 |
| 840 | Ga0495687_000370 | 3300047443 | Bacteria | 56035 |
| 841 | Ga0495675_0035274 | 3300047444 | Bacteria | 3195 |
| 842 | Ga0495677_0009318 | 3300047445 | Bacteria | 3627 |
| 843 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 844 | Ga0495679_057429 | 3300047446 | Bacteria | 1151 |
| 845 | Ga0495685_000091 | 3300047447 | Bacteria | 32792 |
| 846 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 847 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 848 | Ga0495673_0000089 | 3300047469 | Bacteria | 188744 |
| 849 | Ga0495673_0004212 | 3300047469 | Bacteria | 9073 |
| 850 | Ga0495684_0001586 | 3300047471 | Bacteria | 18214 |
| 851 | Ga0495684_0047674 | 3300047471 | Bacteria | 3277 |
| 852 | Ga0495686_0003986 | 3300047472 | Bacteria | 12361 |
| 853 | Ga0495686_0124293 | 3300047472 | Bacteria | 1535 |
| 854 | Ga0495602_0000196 | 3300048088 | Bacteria | 57045 |
| 855 | Ga0496100_0021624 | 3300048903 | Bacteria | 3879 |
| 856 | Ga0496101_0436596 | 3300048904 | Bacteria | 1033 |
| 857 | Ga0496102_0778275 | 3300048905 | Bacteria | 879 |
| 858 | Ga0496104_0004551 | 3300048907 | Bacteria | 12082 |
| 859 | Ga0496105_0007863 | 3300048908 | Bacteria | 8277 |
| 860 | Ga0496105_0477587 | 3300048908 | Bacteria | 981 |
| 861 | Ga0496106_0186734 | 3300048909 | Bacteria | 1647 |
| 862 | Ga0496106_0389667 | 3300048909 | Bacteria | 1120 |
| 863 | Ga0496107_0158962 | 3300048910 | Bacteria | 1674 |
| 864 | Ga0496108_0030955 | 3300048911 | Bacteria | 4435 |
| 865 | Ga0496108_0081698 | 3300048911 | Bacteria | 2739 |
| 866 | Ga0496109_0135358 | 3300048912 | Bacteria | 2302 |
| 867 | Ga0496109_0251756 | 3300048912 | Bacteria | 1663 |
| 868 | Ga0496111_0218620 | 3300048914 | Bacteria | 1415 |
| 869 | Ga0496114_0129947 | 3300048917 | Bacteria | 2174 |
| 870 | Ga0496115_0014454 | 3300048918 | Bacteria | 5975 |
| 871 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 872 | Ga0496116_0000031 | 3300048919 | Bacteria | 420043 |
| 873 | Ga0496116_0066661 | 3300048919 | Bacteria | 2303 |
| 874 | Ga0496117_0000027 | 3300048920 | Bacteria | 412234 |
| 875 | Ga0496117_0000132 | 3300048920 | Bacteria | 162117 |
| 876 | Ga0496117_0019969 | 3300048920 | Bacteria | 5480 |
| 877 | Ga0496118_0000099 | 3300048921 | Bacteria | 160412 |
| 878 | Ga0496118_0000141 | 3300048921 | Bacteria | 126552 |
| 879 | Ga0496118_0085794 | 3300048921 | Bacteria | 2190 |
| 880 | Ga0496119_0000006 | 3300048922 | Bacteria | 505999 |
| 881 | Ga0496119_0000258 | 3300048922 | Bacteria | 75132 |
| 882 | Ga0496119_0000280 | 3300048922 | Bacteria | 71494 |
| 883 | Ga0496119_0014218 | 3300048922 | Bacteria | 6252 |
| 884 | Ga0496119_0115941 | 3300048922 | Bacteria | 1479 |
| 885 | Ga0496120_0000228 | 3300048923 | Bacteria | 96403 |
| 886 | Ga0496120_0000255 | 3300048923 | Bacteria | 89200 |
| 887 | Ga0496120_0040527 | 3300048923 | Bacteria | 2736 |
| 888 | Ga0496120_0083671 | 3300048923 | Bacteria | 1722 |
| 889 | Ga0496121_0000368 | 3300048924 | Bacteria | 92730 |
| 890 | Ga0496121_0032337 | 3300048924 | Bacteria | 4757 |
| 891 | Ga0496122_0000229 | 3300048925 | Bacteria | 125600 |
| 892 | Ga0496122_0000397 | 3300048925 | Bacteria | 92511 |
| 893 | Ga0496122_0001702 | 3300048925 | Bacteria | 34087 |
| 894 | Ga0496122_0002499 | 3300048925 | Bacteria | 25974 |
| 895 | Ga0496122_0004429 | 3300048925 | Bacteria | 17454 |
| 896 | Ga0496122_0023172 | 3300048925 | Bacteria | 5485 |
| 897 | Ga0496122_0074132 | 3300048925 | Bacteria | 2409 |
| 898 | Ga0496123_0003689 | 3300048926 | Bacteria | 16868 |
| 899 | Ga0496123_0005655 | 3300048926 | Bacteria | 12483 |
| 900 | Ga0496123_0021618 | 3300048926 | Bacteria | 4995 |
| 901 | Ga0496123_0023894 | 3300048926 | Bacteria | 4666 |
| 902 | Ga0496124_0000122 | 3300048927 | Bacteria | 161741 |
| 903 | Ga0496124_0005070 | 3300048927 | Bacteria | 15021 |
| 904 | Ga0496124_0186194 | 3300048927 | Bacteria | 1593 |
| 905 | Ga0496125_0001071 | 3300048928 | Bacteria | 42210 |
| 906 | Ga0496125_0003176 | 3300048928 | Bacteria | 20363 |
| 907 | Ga0496125_0054020 | 3300048928 | Bacteria | 3287 |
| 908 | Ga0496126_0001395 | 3300048929 | Bacteria | 38244 |
| 909 | Ga0496126_0016309 | 3300048929 | Bacteria | 7433 |
| 910 | Ga0496126_0067076 | 3300048929 | Bacteria | 3207 |
| 911 | Ga0496126_0105264 | 3300048929 | Bacteria | 2464 |
| 912 | Ga0496126_0110835 | 3300048929 | Bacteria | 2390 |
| 913 | Ga0496126_0138838 | 3300048929 | Bacteria | 2094 |
| 914 | Ga0496126_0152582 | 3300048929 | Bacteria | 1979 |
| 915 | Ga0496126_0281066 | 3300048929 | Bacteria | 1379 |
| 916 | Ga0496126_0641876 | 3300048929 | Bacteria | 832 |
| 917 | Ga0495678_000023 | 3300049459 | Bacteria | 233463 |
| 918 | Ga0495678_016990 | 3300049459 | Bacteria | 3309 |
| 919 | Ga0495682_0000106 | 3300049460 | Bacteria | 74069 |
| 920 | Ga0495682_0000836 | 3300049460 | Bacteria | 19308 |
| 921 | Ga0495682_0001080 | 3300049460 | Bacteria | 16037 |
| 922 | Ga0495682_0003245 | 3300049460 | Bacteria | 7292 |
| 923 | Ga0501031_0300797 | 3300049568 | Bacteria | 1040 |
| 924 | Ga0501033_0052608 | 3300049570 | Bacteria | 3018 |
| 925 | Ga0501033_0207987 | 3300049570 | Bacteria | 1396 |
| 926 | Ga0501034_0253758 | 3300049571 | Bacteria | 1703 |
| 927 | Ga0501036_0171871 | 3300049572 | Bacteria | 1826 |
| 928 | Ga0501036_0185232 | 3300049572 | Bacteria | 1752 |
| 929 | Ga0501037_0219025 | 3300049573 | Bacteria | 1340 |
| 930 | Ga0501037_0375071 | 3300049573 | Bacteria | 978 |
| 931 | Ga0501038_0011020 | 3300049574 | Bacteria | 8254 |
| 932 | Ga0501039_0002684 | 3300049575 | Bacteria | 13279 |
| 933 | Ga0501039_0221456 | 3300049575 | Bacteria | 1488 |
| 934 | Ga0501039_0689972 | 3300049575 | Bacteria | 799 |
| 935 | Ga0501040_0002660 | 3300049576 | Bacteria | 11526 |
| 936 | Ga0501041_0189193 | 3300049577 | Bacteria | 1289 |
| 937 | Ga0501043_0025691 | 3300049579 | Bacteria | 4621 |
| 938 | Ga0501043_0039241 | 3300049579 | Bacteria | 3722 |
| 939 | Ga0501043_0043785 | 3300049579 | Bacteria | 3519 |
| 940 | Ga0501046_0109734 | 3300049580 | Bacteria | 2109 |
| 941 | Ga0501046_0131278 | 3300049580 | Bacteria | 1900 |
| 942 | Ga0501046_0255728 | 3300049580 | Bacteria | 1288 |
| 943 | Ga0501047_0065745 | 3300049581 | Bacteria | 3495 |
| 944 | Ga0501047_0130481 | 3300049581 | Bacteria | 2394 |
| 945 | Ga0501047_0144310 | 3300049581 | Bacteria | 2258 |
| 946 | Ga0501047_0423529 | 3300049581 | Bacteria | 1162 |
| 947 | Ga0501048_0009927 | 3300049582 | Bacteria | 7130 |
| 948 | Ga0501068_0028004 | 3300049584 | Bacteria | 3329 |
| 949 | Ga0501068_0104582 | 3300049584 | Bacteria | 1757 |
| 950 | Ga0501070_0052346 | 3300049586 | Bacteria | 3389 |
| 951 | Ga0501070_0721142 | 3300049586 | Bacteria | 787 |
| 952 | Ga0501071_0011773 | 3300049587 | Bacteria | 5903 |
| 953 | Ga0501071_0339466 | 3300049587 | Bacteria | 1142 |
| 954 | Ga0501072_0008811 | 3300049588 | Bacteria | 7662 |
| 955 | Ga0501072_0245166 | 3300049588 | Bacteria | 1427 |
| 956 | Ga0501073_0036993 | 3300049589 | Bacteria | 3467 |
| 957 | Ga0501073_0124613 | 3300049589 | Bacteria | 1786 |
| 958 | Ga0501073_0186704 | 3300049589 | Bacteria | 1435 |
| 959 | Ga0501074_0080946 | 3300049590 | Bacteria | 2329 |
| 960 | Ga0501074_0433317 | 3300049590 | Bacteria | 932 |
| 961 | Ga0501075_0000572 | 3300049591 | Bacteria | 22432 |
| 962 | Ga0501076_0007550 | 3300049592 | Bacteria | 7915 |
| 963 | Ga0501077_0000982 | 3300049593 | Bacteria | 17195 |
| 964 | Ga0501079_0000502 | 3300049741 | Bacteria | 25497 |
| 965 | Ga0501079_0111438 | 3300049741 | Bacteria | 2126 |
| 966 | Ga0501080_0005351 | 3300049742 | Bacteria | 11439 |
| 967 | Ga0501080_0154465 | 3300049742 | Bacteria | 2120 |
| 968 | Ga0501080_0399862 | 3300049742 | Bacteria | 1236 |
| 969 | Ga0501081_0000092 | 3300049743 | Bacteria | 36705 |
| 970 | Ga0501081_0141157 | 3300049743 | Bacteria | 1726 |
| 971 | Ga0501083_0010764 | 3300049744 | Bacteria | 6432 |
| 972 | Ga0501241_000003 | 3300049758 | Bacteria | 178857 |
| 973 | Ga0501269_000050 | 3300049766 | Bacteria | 37244 |
| 974 | Ga0501044_0459709 | 3300049823 | Bacteria | 1178 |
| 975 | Ga0501045_0000513 | 3300049824 | Bacteria | 24139 |
| 976 | nmdc:mga0k408_2569_c1 | 3300050493 | Bacteria | 9634 |
| 977 | nmdc:mga0k408_3418_c1 | 3300050493 | Bacteria | 8405 |
| 978 | nmdc:mga05p37_125234_c1 | 3300050507 | Bacteria | 3156 |
| 979 | nmdc:mga05p37_221805_c1 | 3300050507 | Bacteria | 2281 |
| 980 | nmdc:mga09592_235446_c1 | 3300050508 | Bacteria | 1586 |
| 981 | nmdc:mga09592_308647_c1 | 3300050508 | Bacteria | 1371 |
| 982 | nmdc:mga09592_37007_c1 | 3300050508 | Bacteria | 4090 |
| 983 | nmdc:mga09592_465938_c1 | 3300050508 | Bacteria | 1089 |
| 984 | nmdc:mga0qj67_244258_c1 | 3300050509 | Bacteria | 1456 |
| 985 | nmdc:mga0qj67_94824_c1 | 3300050509 | Bacteria | 2401 |
| 986 | nmdc:mga06r32_741098_c1 | 3300050510 | Bacteria | 946 |
| 987 | nmdc:mga08y16_123766_c1 | 3300050511 | Bacteria | 2691 |
| 988 | nmdc:mga08y16_43526_c1 | 3300050511 | Bacteria | 4706 |
| 989 | nmdc:mga08y16_860711_c1 | 3300050511 | Bacteria | 895 |
| 990 | Ga0495601_0002906 | 3300053077 | Bacteria | 9748 |
| 991 | Ga0495601_0017419 | 3300053077 | Bacteria | 4361 |
| 992 | Ga0495601_0026240 | 3300053077 | Bacteria | 3596 |
| 993 | Ga0495601_0096987 | 3300053077 | Bacteria | 1902 |
| 994 | Ga0495612_0000301 | 3300053078 | Bacteria | 20083 |
| 995 | Ga0495595_0053071 | 3300053084 | Bacteria | 1882 |
| 996 | Ga0495619_0000944 | 3300053085 | Bacteria | 19038 |
| 997 | Ga0495619_0022615 | 3300053085 | Bacteria | 4026 |
| 998 | Ga0495619_0047926 | 3300053085 | Bacteria | 2815 |
| 999 | Ga0495619_0129937 | 3300053085 | Bacteria | 1730 |
| 1000 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 1001 | Ga0500651_0000723 | 3300053093 | Bacteria | 16223 |
| 1002 | Ga0500555_000242 | 3300053103 | Bacteria | 24278 |
| 1003 | Ga0500555_009159 | 3300053103 | Bacteria | 2830 |
| 1004 | Ga0500562_000130 | 3300053108 | Bacteria | 23570 |
| 1005 | Ga0500592_000252 | 3300053116 | Bacteria | 9612 |
| 1006 | Ga0500642_0077572 | 3300053130 | Bacteria | 1521 |
| 1007 | Ga0500568_0034536 | 3300053139 | Bacteria | 2069 |
| 1008 | Ga0500573_0021147 | 3300053140 | Bacteria | 3727 |
| 1009 | Ga0500616_0000019 | 3300053153 | Bacteria | 549964 |
| 1010 | Ga0500619_000037 | 3300053154 | Bacteria | 41109 |
| 1011 | Ga0500637_0251453 | 3300053178 | Bacteria | 986 |
| 1012 | Ga0500645_001224 | 3300053730 | Bacteria | 13535 |
| 1013 | Ga0500645_012815 | 3300053730 | Bacteria | 2705 |
| 1014 | Ga0501084_0001064 | 3300054114 | Bacteria | 21323 |
| 1015 | Ga0501082_0067389 | 3300060353 | Bacteria | 3082 |
| 1016 | Ga0466962_0036085 | 3300061719 | Bacteria | 2365 |
| 1017 | Ga0530510_0008078 | 3300061734 | Bacteria | 7339 |
| 1018 | 2511231668 | 2511231000 | Bacteria | 4488346 |
| 1019 | 2585145033 | 2582581278 | Bacteria | 5296881 |
| 1020 | 2585156106 | 2582581281 | Bacteria | 4487904 |
| 1021 | 2585160315 | 2582581282 | Bacteria | 4495830 |
| 1022 | 2587678591 | 2585428045 | Bacteria | 5203023 |
| 1023 | 2587746246 | 2585428060 | Bacteria | 5304711 |
| 1024 | 2588210351 | 2585428182 | Bacteria | 5007281 |
| 1025 | 2588214405 | 2585428183 | Bacteria | 5166119 |
| 1026 | 2588217631 | 2585428184 | Bacteria | 4978681 |
| 1027 | 2588223148 | 2585428185 | Bacteria | 4969476 |
| 1028 | 2588232868 | 2585428187 | Bacteria | 4629388 |
| 1029 | 2588443990 | 2588253712 | Bacteria | 5403181 |
| 1030 | 2590601608 | 2588254255 | Bacteria | 5014294 |
| 1031 | 2590609243 | 2588254257 | Bacteria | 5436094 |
| 1032 | 2723878444 | 2721755763 | Bacteria | 4464185 |
| 1033 | 2729200139 | 2728369107 | Bacteria | 5082720 |
| 1034 | 2738699871 | 2738541273 | Bacteria | 4048577 |
| 1035 | 2739253620 | 2738543014 | Bacteria | 4048139 |
| 1036 | 2740059118 | 2739367874 | Bacteria | 4872888 |
| 1037 | 2753673169 | 2751185877 | Bacteria | 4921427 |
| 1038 | 2765574262 | 2765235839 | Bacteria | 5314748 |
| 1039 | 2772604781 | 2772190705 | Bacteria | 4666226 |
| 1040 | 2775671904 | 2775506739 | Bacteria | 3855222 |
| 1041 | 2816874473 | 2816332188 | Bacteria | 5133218 |
| 1042 | 2842085836 | 2842083920 | Bacteria | 4857652 |
| 1043 | 2871724158 | 2871720351 | Bacteria | 4862476 |
| 1044 | 2881418509 | 2881412998 | Bacteria | 6492157 |
| 1045 | 2889295208 | 2889290771 | Bacteria | 5530962 |
| 1046 | 2890740132 | 2890737413 | Bacteria | 4269751 |
| 1047 | 2898713989 | 2898713307 | Bacteria | 4110805 |
| 1048 | 2906000103 | 2905999023 | Bacteria | 4591259 |
| 1049 | 2914763196 | 2914759650 | Bacteria | 4701441 |
| 1050 | 2919098657 | 2919097161 | Bacteria | 3860339 |
| 1051 | 2919403791 | 2919399522 | Bacteria | 5164947 |
| 1052 | 2946022745 | 2946019816 | Bacteria | 4621265 |
| 1053 | 2984573195 | 2984572630 | Bacteria | 4186940 |
| 1054 | 2984610647 | 2984606641 | Bacteria | 4186971 |
| 1055 | 8036739605 | 8036736890 | Bacteria | 2944828 |
| 1056 | 8057102843 | 8057101203 | Bacteria | 5034064 |
| 1057 | JGI25156J39149_1001066 | |||
| 1058 | JGI25162J39368_1000995 | |||
| 1059 | JGI25162J39368_1001495 | |||
| 1060 | JGI25162J39368_1002049 | |||
| 1061 | JGI25154J39366_1002110 | |||
| 1062 | JGI25157J39369_1000342 | |||
| 1063 | JGI25157J39369_1001042 | |||
| 1064 | JGI25164J39214_1000078 | |||
| 1065 | JGI25164J39214_1000738 | |||
| 1066 | JGI25164J39214_1000760 | |||
| 1067 | JGI25165J46597_1000088 | |||
| 1068 | JGI25165J46597_1000245 | |||
| 1069 | JGI25165J46597_1001490 | |||
| 1070 | JGI25165J46597_1001854 | |||
| 1071 | rootH2_10009385 | |||
| 1072 | rootH2_10193234 | |||
| 1073 | rootL2_10155819 | |||
| 1074 | rootH1_10075165 | |||
| 1075 | Ga0055525_1000146 | |||
| 1076 | Ga0055527_1000074 | |||
| 1077 | Ga0055535_1000359 | |||
| 1078 | Ga0055535_1000372 | |||
| 1079 | Ga0055542_1000151 | |||
| 1080 | Ga0055542_1000168 | |||
| 1081 | Ga0055542_1000352 | |||
| 1082 | Ga0055529_1000163 | |||
| 1083 | Ga0055529_1000543 | |||
| 1084 | Ga0055526_1000232 | |||
| 1085 | Ga0055537_1000030 | |||
| 1086 | Ga0055524_1002681 | |||
| 1087 | Ga0055534_1000447 | |||
| 1088 | Ga0055528_1000439 | |||
| 1089 | Ga0065703_1018836 | |||
| 1090 | Ga0065704_10074548 | |||
| 1091 | Ga0065704_10332195 | |||
| 1092 | Ga0065715_10003421 | |||
| 1093 | Ga0065715_10212795 | |||
| 1094 | Ga0070658_10504740 | |||
| 1095 | Ga0070676_10024163 | |||
| 1096 | Ga0070676_10173087 | |||
| 1097 | Ga0070676_10235689 | |||
| 1098 | Ga0070676_10368502 | |||
| 1099 | Ga0070683_100007566 | |||
| 1100 | Ga0070683_100505607 | |||
| 1101 | Ga0070690_100006132 | |||
| 1102 | Ga0070690_100029833 | |||
| 1103 | Ga0070690_100482899 | |||
| 1104 | Ga0070677_10020372 | |||
| 1105 | Ga0070677_10042635 | |||
| 1106 | Ga0068869_100015418 | |||
| 1107 | Ga0070666_10007588 | |||
| 1108 | Ga0070666_10051454 | |||
| 1109 | Ga0070666_10067052 | |||
| 1110 | Ga0070680_100553621 | |||
| 1111 | Ga0070682_100000474 | |||
| 1112 | Ga0068868_100003208 | |||
| 1113 | Ga0068868_100016571 | |||
| 1114 | Ga0070660_100266428 | |||
| 1115 | Ga0070660_100650995 | |||
| 1116 | Ga0070689_100091651 | |||
| 1117 | Ga0070687_100059708 | |||
| 1118 | Ga0070668_100031835 | |||
| 1119 | Ga0070669_100164277 | |||
| 1120 | Ga0070675_100000208 | |||
| 1121 | Ga0070675_100009783 | |||
| 1122 | Ga0070675_100234616 | |||
| 1123 | Ga0070675_100864699 | |||
| 1124 | Ga0070671_100001433 | |||
| 1125 | Ga0070671_100341699 | |||
| 1126 | Ga0070671_100545243 | |||
| 1127 | Ga0070674_100020413 | |||
| 1128 | Ga0070673_100000523 | |||
| 1129 | Ga0070688_100065452 | |||
| 1130 | Ga0070688_100121598 | |||
| 1131 | Ga0070659_100714914 | |||
| 1132 | Ga0070667_100001902 | |||
| 1133 | Ga0070667_100112715 | |||
| 1134 | Ga0070703_10000113 | |||
| 1135 | Ga0070714_100056798 | |||
| 1136 | Ga0070714_100117931 | |||
| 1137 | Ga0070713_100032163 | |||
| 1138 | Ga0070713_100162298 | |||
| 1139 | Ga0070713_100228091 | |||
| 1140 | Ga0070701_10011600 | |||
| 1141 | Ga0070711_100126251 | |||
| 1142 | Ga0070711_100188716 | |||
| 1143 | Ga0070711_100211362 | |||
| 1144 | Ga0070705_100296412 | |||
| 1145 | Ga0070700_100009956 | |||
| 1146 | Ga0070700_100048201 | |||
| 1147 | Ga0070700_100367358 | |||
| 1148 | Ga0070694_100005129 | |||
| 1149 | Ga0070708_100084056 | |||
| 1150 | Ga0070708_100370732 | |||
| 1151 | Ga0070708_100373407 | |||
| 1152 | Ga0070678_100000227 | |||
| 1153 | Ga0070678_100023593 | |||
| 1154 | Ga0070678_100103126 | |||
| 1155 | Ga0070678_100380653 | |||
| 1156 | Ga0070662_100030296 | |||
| 1157 | Ga0070662_100135810 | |||
| 1158 | Ga0070662_100277722 | |||
| 1159 | Ga0068867_100025872 | |||
| 1160 | Ga0068867_100051158 | |||
| 1161 | Ga0068867_100615026 | |||
| 1162 | Ga0070685_10053945 | |||
| 1163 | Ga0070685_10238652 | |||
| 1164 | Ga0070707_100057853 | |||
| 1165 | Ga0070707_100176789 | |||
| 1166 | Ga0070698_100014238 | |||
| 1167 | Ga0070698_100246073 | |||
| 1168 | Ga0070699_100015650 | |||
| 1169 | Ga0070699_100323386 | |||
| 1170 | Ga0070699_100405362 | |||
| 1171 | Ga0070679_100017929 | |||
| 1172 | Ga0070679_100196955 | |||
| 1173 | Ga0070684_100007379 | |||
| 1174 | Ga0070697_100032621 | |||
| 1175 | Ga0070697_100837722 | |||
| 1176 | Ga0068853_100238057 | |||
| 1177 | Ga0068853_100447454 | |||
| 1178 | Ga0070686_100026997 | |||
| 1179 | Ga0070686_100478906 | |||
| 1180 | Ga0070665_100041910 | |||
| 1181 | Ga0070665_100046639 | |||
| 1182 | Ga0070665_100082250 | |||
| 1183 | Ga0070665_100117248 | |||
| 1184 | Ga0070665_100180269 | |||
| 1185 | Ga0070665_100310869 | |||
| 1186 | Ga0070665_100754776 | |||
| 1187 | Ga0070704_100005894 | |||
| 1188 | Ga0070704_100161035 | |||
| 1189 | Ga0068855_100001240 | |||
| 1190 | Ga0068855_100002346 | |||
| 1191 | Ga0068855_100013263 | |||
| 1192 | Ga0068855_100634742 | |||
| 1193 | Ga0070664_100012064 | |||
| 1194 | Ga0070664_100145424 | |||
| 1195 | Ga0070664_100148006 | |||
| 1196 | Ga0070664_100534515 | |||
| 1197 | Ga0068857_100207217 | |||
| 1198 | Ga0068856_100010356 | |||
| 1199 | Ga0068856_100235107 | |||
| 1200 | Ga0068856_100724484 | |||
| 1201 | Ga0070702_100111863 | |||
| 1202 | Ga0070702_100242822 | |||
| 1203 | Ga0068852_100031895 | |||
| 1204 | Ga0068852_100064778 | |||
| 1205 | Ga0068859_100000008 | |||
| 1206 | Ga0068859_100004743 | |||
| 1207 | Ga0068859_100021239 | |||
| 1208 | Ga0068859_100197930 | |||
| 1209 | Ga0068859_100393256 | |||
| 1210 | Ga0068859_100468269 | |||
| 1211 | Ga0068864_100000101 | |||
| 1212 | Ga0068864_100085017 | |||
| 1213 | Ga0068864_100316511 | |||
| 1214 | Ga0068864_100504502 | |||
| 1215 | Ga0068866_10011077 | |||
| 1216 | Ga0068861_100023859 | |||
| 1217 | Ga0068861_100304831 | |||
| 1218 | Ga0068861_100436788 | |||
| 1219 | Ga0068851_10097345 | |||
| 1220 | Ga0068870_10485655 | |||
| 1221 | Ga0068863_100012306 | |||
| 1222 | Ga0068863_100081804 | |||
| 1223 | Ga0068863_100107301 | |||
| 1224 | Ga0068863_100153171 | |||
| 1225 | Ga0068863_100409320 | |||
| 1226 | Ga0068858_100003390 | |||
| 1227 | Ga0068858_100003419 | |||
| 1228 | Ga0068858_100015795 | |||
| 1229 | Ga0068858_100096380 | |||
| 1230 | Ga0068858_100723917 | |||
| 1231 | Ga0068860_100043493 | |||
| 1232 | Ga0068862_100059701 | |||
| 1233 | Ga0068862_100385881 | |||
| 1234 | Ga0081539_10026051 | |||
| 1235 | Ga0070717_10001018 | |||
| 1236 | Ga0070717_10076438 | |||
| 1237 | Ga0070717_10293105 | |||
| 1238 | Ga0070716_100075027 | |||
| 1239 | Ga0070712_100003184 | |||
| 1240 | Ga0070712_100235479 | |||
| 1241 | Ga0075362_10062829 | |||
| 1242 | Ga0075366_10002575 | |||
| 1243 | Ga0075366_10011548 | |||
| 1244 | Ga0097621_100026816 | |||
| 1245 | Ga0097621_100043240 | |||
| 1246 | Ga0097621_100206674 | |||
| 1247 | Ga0068871_100005768 | |||
| 1248 | Ga0068871_100019124 | |||
| 1249 | Ga0075428_100388793 | |||
| 1250 | Ga0075428_100514917 | |||
| 1251 | Ga0075430_100105710 | |||
| 1252 | Ga0075433_10027568 | |||
| 1253 | Ga0075434_100659378 | |||
| 1254 | Ga0075429_100048420 | |||
| 1255 | Ga0075429_100334186 | |||
| 1256 | Ga0075429_100507462 | |||
| 1257 | Ga0068865_100047398 | |||
| 1258 | Ga0068865_100152844 | |||
| 1259 | Ga0075436_100136428 | |||
| 1260 | Ga0075436_100175287 | |||
| 1261 | Ga0097620_100000008 | |||
| 1262 | Ga0097620_100004743 | |||
| 1263 | Ga0097620_100021236 | |||
| 1264 | Ga0097620_100197924 | |||
| 1265 | Ga0097620_100393241 | |||
| 1266 | Ga0097620_100468260 | |||
| 1267 | Ga0079104_1000700 | |||
| 1268 | Ga0079104_1003404 | |||
| 1269 | Ga0075435_100167749 | |||
| 1270 | Ga0105251_10000073 | |||
| 1271 | Ga0105251_10000267 | |||
| 1272 | Ga0105251_10000582 | |||
| 1273 | Ga0105244_10000001 | |||
| 1274 | Ga0105244_10000315 | |||
| 1275 | Ga0105244_10108177 | |||
| 1276 | Ga0105250_10080334 | |||
| 1277 | Ga0105240_10003716 | |||
| 1278 | Ga0105240_10005607 | |||
| 1279 | Ga0105240_10005746 | |||
| 1280 | Ga0105240_10006293 | |||
| 1281 | Ga0105240_10061165 | |||
| 1282 | Ga0105240_10074105 | |||
| 1283 | Ga0105240_10661509 | |||
| 1284 | Ga0111539_10006397 | |||
| 1285 | Ga0111539_10066977 | |||
| 1286 | Ga0111539_10189811 | |||
| 1287 | Ga0111539_10209250 | |||
| 1288 | Ga0111539_11009104 | |||
| 1289 | Ga0105245_10086433 | |||
| 1290 | Ga0105247_10000187 | |||
| 1291 | Ga0105247_10012875 | |||
| 1292 | Ga0105247_10208835 | |||
| 1293 | Ga0114129_10198151 | |||
| 1294 | Ga0105243_10000056 | |||
| 1295 | Ga0105243_10000471 | |||
| 1296 | Ga0105241_10000004 | |||
| 1297 | Ga0105241_10348406 | |||
| 1298 | Ga0105242_10000015 | |||
| 1299 | Ga0105242_10058655 | |||
| 1300 | Ga0105248_10035689 | |||
| 1301 | Ga0105248_10036354 | |||
| 1302 | Ga0105248_10039410 | |||
| 1303 | Ga0105248_10064863 | |||
| 1304 | Ga0105248_10135207 | |||
| 1305 | Ga0105237_10006745 | |||
| 1306 | Ga0105237_10115769 | |||
| 1307 | Ga0105237_10194727 | |||
| 1308 | Ga0105237_10229381 | |||
| 1309 | Ga0105238_10053835 | |||
| 1310 | Ga0105238_10074565 | |||
| 1311 | Ga0105239_10044969 | |||
| 1312 | Ga0105239_10051580 | |||
| 1313 | Ga0105239_10105428 | |||
| 1314 | Ga0105239_10110765 | |||
| 1315 | Ga0105239_10116732 | |||
| 1316 | Ga0105239_10617904 | |||
| 1317 | Ga0157316_1003325 | |||
| 1318 | Ga0157373_10003158 | |||
| 1319 | Ga0157373_10092599 | |||
| 1320 | Ga0157373_10193437 | |||
| 1321 | Ga0157370_10013507 | |||
| 1322 | Ga0157370_10136510 | |||
| 1323 | Ga0157369_10005191 | |||
| 1324 | Ga0157369_10255028 | |||
| 1325 | Ga0157369_10487808 | |||
| 1326 | Ga0157374_10003724 | |||
| 1327 | Ga0157374_10003991 | |||
| 1328 | Ga0157374_10029467 | |||
| 1329 | Ga0157374_10044152 | |||
| 1330 | Ga0157374_10074693 | |||
| 1331 | Ga0157374_10157142 | |||
| 1332 | Ga0157374_10378805 | |||
| 1333 | Ga0157378_10046120 | |||
| 1334 | Ga0157378_10107682 | |||
| 1335 | Ga0157378_10153853 | |||
| 1336 | Ga0163162_10001589 | |||
| 1337 | Ga0163162_10037600 | |||
| 1338 | Ga0163162_10055019 | |||
| 1339 | Ga0163162_10215867 | |||
| 1340 | Ga0163162_11239320 | |||
| 1341 | Ga0157372_10010066 | |||
| 1342 | Ga0157372_10519451 | |||
| 1343 | Ga0157372_10799439 | |||
| 1344 | Ga0157372_11410881 | |||
| 1345 | Ga0157375_10001221 | |||
| 1346 | Ga0157375_10081196 | |||
| 1347 | Ga0157375_11307461 | |||
| 1348 | Ga0163163_10001383 | |||
| 1349 | Ga0163163_10006926 | |||
| 1350 | Ga0163163_10406796 | |||
| 1351 | Ga0157380_10049239 | |||
| 1352 | Ga0157380_10307547 | |||
| 1353 | Ga0157380_10769736 | |||
| 1354 | Ga0182008_10001860 | |||
| 1355 | Ga0182008_10015435 | |||
| 1356 | Ga0157377_10234961 | |||
| 1357 | Ga0157377_10509041 | |||
| 1358 | Ga0157379_10015278 | |||
| 1359 | Ga0157379_10069552 | |||
| 1360 | Ga0157379_10533521 | |||
| 1361 | Ga0157376_10006392 | |||
| 1362 | Ga0157376_10268440 | |||
| 1363 | Ga0157376_10430607 | |||
| 1364 | Ga0157376_10477482 | |||
| 1365 | Ga0157376_10708376 | |||
| 1366 | Ga0182006_1000003 | |||
| 1367 | Ga0182006_1000049 | |||
| 1368 | Ga0182006_1000097 | |||
| 1369 | Ga0182007_10000095 | |||
| 1370 | Ga0182007_10002958 | |||
| 1371 | Ga0182007_10015404 | |||
| 1372 | Ga0182005_1000038 | |||
| 1373 | Ga0182005_1020469 | |||
| 1374 | Ga0182005_1020510 | |||
| 1375 | Ga0163161_10000004 | |||
| 1376 | Ga0163161_10062869 | |||
| 1377 | Ga0163161_10531271 | |||
| 1378 | Ga0213872_10001170 | |||
| 1379 | Ga0213872_10021407 | |||
| 1380 | Ga0213872_10045192 | |||
| 1381 | Ga0213872_10083172 | |||
| 1382 | Ga0213871_10001458 | |||
| 1383 | Ga0209674_100598 | |||
| 1384 | Ga0209672_100007 | |||
| 1385 | Ga0209672_100095 | |||
| 1386 | Ga0209672_101868 | |||
| 1387 | Ga0209563_100131 | |||
| 1388 | Ga0207427_100021 | |||
| 1389 | Ga0207427_100105 | |||
| 1390 | Ga0207427_100107 | |||
| 1391 | Ga0209437_100039 | |||
| 1392 | Ga0209437_100087 | |||
| 1393 | Ga0209437_100129 | |||
| 1394 | Ga0209258_100017 | |||
| 1395 | Ga0209258_100206 | |||
| 1396 | Ga0209258_100272 | |||
| 1397 | Ga0209646_1000246 | |||
| 1398 | Ga0209646_1000485 | |||
| 1399 | Ga0209026_1000051 | |||
| 1400 | Ga0209026_1000878 | |||
| 1401 | Ga0209148_1000044 | |||
| 1402 | Ga0209148_1000176 | |||
| 1403 | Ga0209148_1000185 | |||
| 1404 | Ga0209759_1000145 | |||
| 1405 | Ga0209233_1000023 | |||
| 1406 | Ga0209233_1000224 | |||
| 1407 | Ga0209233_1000447 | |||
| 1408 | Ga0209565_1000017 | |||
| 1409 | Ga0207666_1007773 | |||
| 1410 | Ga0209455_1000010 | |||
| 1411 | Ga0209455_1000081 | |||
| 1412 | Ga0209673_1000007 | |||
| 1413 | Ga0209675_1000009 | |||
| 1414 | Ga0209675_1000077 | |||
| 1415 | Ga0209564_1000055 | |||
| 1416 | Ga0209564_1000230 | |||
| 1417 | Ga0209256_1000559 | |||
| 1418 | Ga0207426_1026348 | |||
| 1419 | Ga0209051_1003306 | |||
| 1420 | Ga0207697_10014064 | |||
| 1421 | Ga0207697_10021800 | |||
| 1422 | Ga0207696_1000033 | |||
| 1423 | Ga0207655_1000011 | |||
| 1424 | Ga0207655_1000013 | |||
| 1425 | Ga0207713_1000065 | |||
| 1426 | Ga0207713_1000108 | |||
| 1427 | Ga0207713_1001983 | |||
| 1428 | Ga0207653_10000011 | |||
| 1429 | Ga0207682_10002230 | |||
| 1430 | Ga0207642_10022924 | |||
| 1431 | Ga0207710_10000016 | |||
| 1432 | Ga0207710_10044398 | |||
| 1433 | Ga0207710_10172342 | |||
| 1434 | Ga0207688_10005672 | |||
| 1435 | Ga0207680_10001266 | |||
| 1436 | Ga0207680_10023747 | |||
| 1437 | Ga0207680_10052911 | |||
| 1438 | Ga0207699_10442958 | |||
| 1439 | Ga0207645_10010412 | |||
| 1440 | Ga0207645_10199600 | |||
| 1441 | Ga0207645_10311642 | |||
| 1442 | Ga0207643_10085564 | |||
| 1443 | Ga0207643_10108622 | |||
| 1444 | Ga0207643_10158000 | |||
| 1445 | Ga0207705_10002381 | |||
| 1446 | Ga0207684_10113737 | |||
| 1447 | Ga0207654_10000006 | |||
| 1448 | Ga0207707_10185830 | |||
| 1449 | Ga0207695_10006958 | |||
| 1450 | Ga0207695_10014188 | |||
| 1451 | Ga0207695_10020911 | |||
| 1452 | Ga0207695_10069147 | |||
| 1453 | Ga0207695_10109815 | |||
| 1454 | Ga0207695_10283680 | |||
| 1455 | Ga0207671_10021594 | |||
| 1456 | Ga0207671_10073666 | |||
| 1457 | Ga0207671_10167782 | |||
| 1458 | Ga0207693_10024754 | |||
| 1459 | Ga0207693_10053702 | |||
| 1460 | Ga0207663_10084177 | |||
| 1461 | Ga0207663_10226086 | |||
| 1462 | Ga0207660_10083820 | |||
| 1463 | Ga0207662_10021647 | |||
| 1464 | Ga0207657_10053741 | |||
| 1465 | Ga0207649_10084596 | |||
| 1466 | Ga0207649_10180123 | |||
| 1467 | Ga0207652_10250881 | |||
| 1468 | Ga0207652_10309266 | |||
| 1469 | Ga0207646_10042178 | |||
| 1470 | Ga0207646_10670195 | |||
| 1471 | Ga0207681_10133978 | |||
| 1472 | Ga0207681_10355577 | |||
| 1473 | Ga0207694_10539477 | |||
| 1474 | Ga0207650_10008966 | |||
| 1475 | Ga0207650_10066083 | |||
| 1476 | Ga0207650_10277875 | |||
| 1477 | Ga0207659_10000588 | |||
| 1478 | Ga0207659_10029176 | |||
| 1479 | Ga0207700_10051406 | |||
| 1480 | Ga0207700_10272437 | |||
| 1481 | Ga0207664_10069324 | |||
| 1482 | Ga0207664_10164548 | |||
| 1483 | Ga0207644_10002078 | |||
| 1484 | Ga0207644_10004826 | |||
| 1485 | Ga0207644_10032885 | |||
| 1486 | Ga0207644_10102077 | |||
| 1487 | Ga0207644_10421341 | |||
| 1488 | Ga0207690_10022251 | |||
| 1489 | Ga0207690_10273457 | |||
| 1490 | Ga0207690_10648375 | |||
| 1491 | Ga0207706_10002872 | |||
| 1492 | Ga0207706_10082095 | |||
| 1493 | Ga0207706_10305056 | |||
| 1494 | Ga0207686_10000007 | |||
| 1495 | Ga0207686_10040916 | |||
| 1496 | Ga0207686_10093174 | |||
| 1497 | Ga0207709_10000101 | |||
| 1498 | Ga0207709_10000161 | |||
| 1499 | Ga0207709_10237979 | |||
| 1500 | Ga0207670_10014040 | |||
| 1501 | Ga0207670_10031541 | |||
| 1502 | Ga0207670_10225360 | |||
| 1503 | Ga0207670_10234084 | |||
| 1504 | Ga0207669_10174886 | |||
| 1505 | Ga0207704_10024325 | |||
| 1506 | Ga0207704_10039218 | |||
| 1507 | Ga0207704_10157544 | |||
| 1508 | Ga0207665_10160044 | |||
| 1509 | Ga0207691_10036906 | |||
| 1510 | Ga0207691_10081108 | |||
| 1511 | Ga0207691_10159650 | |||
| 1512 | Ga0207711_10005419 | |||
| 1513 | Ga0207711_10029539 | |||
| 1514 | Ga0207711_10064678 | |||
| 1515 | Ga0207711_10080900 | |||
| 1516 | Ga0207689_10024667 | |||
| 1517 | Ga0207689_10104860 | |||
| 1518 | Ga0207689_10323356 | |||
| 1519 | Ga0207661_10001327 | |||
| 1520 | Ga0207661_10151832 | |||
| 1521 | Ga0207679_10100194 | |||
| 1522 | Ga0207679_10178036 | |||
| 1523 | Ga0207679_10293684 | |||
| 1524 | Ga0207667_10001671 | |||
| 1525 | Ga0207667_10002349 | |||
| 1526 | Ga0207667_10008952 | |||
| 1527 | Ga0207667_10169277 | |||
| 1528 | Ga0207667_10571675 | |||
| 1529 | Ga0207651_10000179 | |||
| 1530 | Ga0207651_10016407 | |||
| 1531 | Ga0207651_10548597 | |||
| 1532 | Ga0207712_10008695 | |||
| 1533 | Ga0207712_10081944 | |||
| 1534 | Ga0207712_10521389 | |||
| 1535 | Ga0207712_10535290 | |||
| 1536 | Ga0207668_10066865 | |||
| 1537 | Ga0207658_10001572 | |||
| 1538 | Ga0207677_10004081 | |||
| 1539 | Ga0207677_10082448 | |||
| 1540 | Ga0207703_10005653 | |||
| 1541 | Ga0207703_10017041 | |||
| 1542 | Ga0207703_10120128 | |||
| 1543 | Ga0207703_10182196 | |||
| 1544 | Ga0207703_10385639 | |||
| 1545 | Ga0207639_10022786 | |||
| 1546 | Ga0207639_10027657 | |||
| 1547 | Ga0207639_10034078 | |||
| 1548 | Ga0207639_10233772 | |||
| 1549 | Ga0207708_10019637 | |||
| 1550 | Ga0207708_10095035 | |||
| 1551 | Ga0207708_10370931 | |||
| 1552 | Ga0207641_10009505 | |||
| 1553 | Ga0207641_10010646 | |||
| 1554 | Ga0207641_10126045 | |||
| 1555 | Ga0207641_10181212 | |||
| 1556 | Ga0207641_10592141 | |||
| 1557 | Ga0207641_10927352 | |||
| 1558 | Ga0207648_10007551 | |||
| 1559 | Ga0207648_10009747 | |||
| 1560 | Ga0207648_10468805 | |||
| 1561 | Ga0207648_10484125 | |||
| 1562 | Ga0207676_10002099 | |||
| 1563 | Ga0207676_10067892 | |||
| 1564 | Ga0207676_10100058 | |||
| 1565 | Ga0207676_10303498 | |||
| 1566 | Ga0207674_10088512 | |||
| 1567 | Ga0207674_10151829 | |||
| 1568 | Ga0207674_10277185 | |||
| 1569 | Ga0207674_10344350 | |||
| 1570 | Ga0207674_10701524 | |||
| 1571 | Ga0207675_100039681 | |||
| 1572 | Ga0207675_100099700 | |||
| 1573 | Ga0207675_100227299 | |||
| 1574 | Ga0207675_100240210 | |||
| 1575 | Ga0207675_101002749 | |||
| 1576 | Ga0207683_10001598 | |||
| 1577 | Ga0207683_10146798 | |||
| 1578 | Ga0207683_10184790 | |||
| 1579 | Ga0207683_10364682 | |||
| 1580 | Ga0207683_10407446 | |||
| 1581 | Ga0207698_10067524 | |||
| 1582 | Ga0207698_10132170 | |||
| 1583 | Ga0209281_1000008 | |||
| 1584 | Ga0209281_1004171 | |||
| 1585 | Ga0209371_1002176 | |||
| 1586 | Ga0209588_1073225 | |||
| 1587 | Ga0207428_10038931 | |||
| 1588 | Ga0265356_1000177 | |||
| 1589 | Ga0268266_10000420 | |||
| 1590 | Ga0268266_10024463 | |||
| 1591 | Ga0268266_10033124 | |||
| 1592 | Ga0268266_10065765 | |||
| 1593 | Ga0268266_10072942 | |||
| 1594 | Ga0268266_10093764 | |||
| 1595 | Ga0268266_10096267 | |||
| 1596 | Ga0268266_10231525 | |||
| 1597 | Ga0268266_10413924 | |||
| 1598 | Ga0268266_10579678 | |||
| 1599 | Ga0268266_10821167 | |||
| 1600 | Ga0268265_10036989 | |||
| 1601 | Ga0268265_10126671 | |||
| 1602 | Ga0268264_10054629 | |||
| 1603 | Ga0268264_10061722 | |||
| 1604 | Ga0268264_10369170 | |||
| 1605 | Ga0265326_10051178 | |||
| 1606 | Ga0265318_10071790 | |||
| 1607 | Ga0265338_10092476 | |||
| 1608 | Ga0268256_1001097 | |||
| 1609 | Ga0265760_10002206 | |||
| 1610 | Ga0265332_10065200 | |||
| 1611 | Ga0265328_10116024 | |||
| 1612 | Ga0265325_10000127 | |||
| 1613 | Ga0265339_10000827 | |||
| 1614 | Ga0265339_10067611 | |||
| 1615 | Ga0265331_10029577 | |||
| 1616 | Ga0265331_10060128 | |||
| 1617 | Ga0265331_10249713 | |||
| 1618 | Ga0265327_10158451 | |||
| 1619 | Ga0265316_10018261 | |||
| 1620 | Ga0265316_10052944 | |||
| 1621 | Ga0265316_10093487 | |||
| 1622 | Ga0307513_10103235 | |||
| 1623 | Ga0265313_10000907 | |||
| 1624 | Ga0265313_10147932 | |||
| 1625 | Ga0307514_10001950 | |||
| 1626 | Ga0265314_10008385 | |||
| 1627 | Ga0316576_10203972 | |||
| 1628 | Ga0316578_10087120 | |||
| 1629 | Ga0316577_10079932 | |||
| 1630 | Ga0307406_10210179 | |||
| 1631 | Ga0307412_10000096 | |||
| 1632 | Ga0307412_10001339 | |||
| 1633 | Ga0307409_100270971 | |||
| 1634 | Ga0307416_100000017 | |||
| 1635 | Ga0307414_10010449 | |||
| 1636 | Ga0307411_10612860 | |||
| 1637 | Ga0307415_100615369 | |||
| 1638 | Ga0307415_100847747 | |||
| 1639 | Ga0307415_100977160 | |||
| 1640 | Ga0316585_10051322 | |||
| 1641 | Ga0307510_10377122 | |||
| 1642 | Ga0373959_0025113 | |||
| 1643 | Ga0373926_0219815 | |||
| 1644 | Ga0373934_0000391 | |||
| 1645 | Ga0373934_0012247 | |||
| 1646 | Ga0373934_0086340 | |||
| 1647 | Ga0373923_0003108 | |||
| 1648 | Ga0373923_0225851 | |||
| 1649 | Ga0373936_0004500 | |||
| 1650 | Ga0373936_0057196 | |||
| 1651 | Ga0373945_0019882 | |||
| 1652 | Ga0373953_0003575 | |||
| 1653 | Ga0373953_0029245 | |||
| 1654 | Ga0373954_0003733 | |||
| 1655 | Ga0373954_0031178 | |||
| 1656 | Ga0373954_0035743 | |||
| 1657 | Ga0373954_0071008 | |||
| 1658 | Ga0373954_0187956 | |||
| 1659 | Ga0373943_0033981 | |||
| 1660 | Ga0373946_0023130 | |||
| 1661 | Ga0373946_0146142 | |||
| 1662 | Ga0373955_0001902 | |||
| 1663 | Ga0373955_0021943 | |||
| 1664 | Ga0373955_0108442 | |||
| 1665 | Ga0373961_0082419 | |||
| 1666 | Ga0373924_0002259 | |||
| 1667 | Ga0373924_0170859 | |||
| 1668 | Ga0373931_0014564 | |||
| 1669 | Ga0373935_0008762 | |||
| 1670 | Ga0373935_0107250 | |||
| 1671 | Ga0373927_0002239 | |||
| 1672 | Ga0373927_0007084 | |||
| 1673 | Ga0373933_0010447 | |||
| 1674 | Ga0373933_0044563 | |||
| 1675 | Ga0373933_0177682 | |||
| 1676 | Ga0373933_0210819 | |||
| 1677 | Ga0373947_0374787 | |||
| 1678 | Ga0373937_0001034 | |||
| 1679 | Ga0373937_0008262 | |||
| 1680 | Ga0373937_0032473 | |||
| 1681 | Ga0373937_0107999 | |||
| 1682 | Ga0373937_0211881 | |||
| 1683 | Ga0316584_0315286 | |||
| 1684 | Ga0373925_0000715 | |||
| 1685 | Ga0373925_0025553 | |||
| 1686 | Ga0373925_0090209 | |||
| 1687 | Ga0373925_0299408 | |||
| 1688 | Ga0373925_0304909 | |||
| 1689 | Ga0395899_0019318 | |||
| 1690 | Ga0395899_0042250 | |||
| 1691 | Ga0395898_0001110 | |||
| 1692 | Ga0395905_0417365 | |||
| 1693 | Ga0436364_0089220 | |||
| 1694 | Ga0436365_0001623 | |||
| 1695 | Ga0436360_0137000 | |||
| 1696 | Ga0436360_0386428 | |||
| 1697 | Ga0436360_0469655 | |||
| 1698 | Ga0436360_0708149 | |||
| 1699 | Ga0436360_0824430 | |||
| 1700 | Ga0436360_1098059 | |||
| 1701 | Ga0436361_0041018 | |||
| 1702 | Ga0436361_0133351 | |||
| 1703 | Ga0436361_0191634 | |||
| 1704 | Ga0436361_0282869 | |||
| 1705 | Ga0436361_0300897 | |||
| 1706 | Ga0436361_0508014 | |||
| 1707 | Ga0436361_0785765 | |||
| 1708 | Ga0436361_1030428 | |||
| 1709 | Ga0436363_0387766 | |||
| 1710 | Ga0436363_0588950 | |||
| 1711 | Ga0436363_1671843 | |||
| 1712 | Ga0439438_002259 | |||
| 1713 | Ga0439447_001305 | |||
| 1714 | Ga0439466_0083079 | |||
| 1715 | Ga0439445_0000288 | |||
| 1716 | Ga0439432_023496 | |||
| 1717 | Ga0439432_036474 | |||
| 1718 | Ga0451577_0000101 | |||
| 1719 | Ga0451577_0208072 | |||
| 1720 | Ga0466969_0009932 | |||
| 1721 | Ga0466969_0090988 | |||
| 1722 | Ga0466972_0123062 | |||
| 1723 | Ga0466989_0074246 | |||
| 1724 | Ga0466965_0017505 | |||
| 1725 | Ga0466965_0084935 | |||
| 1726 | Ga0466966_0007469 | |||
| 1727 | Ga0466961_0000412 | |||
| 1728 | Ga0466961_0001299 | |||
| 1729 | Ga0466961_0001373 | |||
| 1730 | Ga0466961_0022862 | |||
| 1731 | Ga0466963_0051014 | |||
| 1732 | Ga0466963_0238926 | |||
| 1733 | Ga0466964_0111020 | |||
| 1734 | Ga0453684_0000679 | |||
| 1735 | Ga0453684_0070521 | |||
| 1736 | Ga0453684_0361100 | |||
| 1737 | Ga0466971_0019617 | |||
| 1738 | Ga0466971_0027166 | |||
| 1739 | Ga0466968_0180669 | |||
| 1740 | Ga0466957_0006003 | |||
| 1741 | Ga0466957_0404160 | |||
| 1742 | Ga0466959_0029127 | |||
| 1743 | Ga0451576_0000260 | |||
| 1744 | Ga0466958_0063430 | |||
| 1745 | Ga0466958_0070861 | |||
| 1746 | Ga0466958_0190423 | |||
| 1747 | Ga0466967_0161576 | |||
| 1748 | Ga0466967_0324205 | |||
| 1749 | Ga0466967_0625270 | |||
| 1750 | Ga0495617_000304 | |||
| 1751 | Ga0495627_000141 | |||
| 1752 | Ga0495627_004584 | |||
| 1753 | Ga0495592_0004704 | |||
| 1754 | Ga0495592_0020234 | |||
| 1755 | Ga0495592_0062411 | |||
| 1756 | Ga0495590_0000020 | |||
| 1757 | Ga0495591_001616 | |||
| 1758 | Ga0495638_0000328 | |||
| 1759 | Ga0495638_0000493 | |||
| 1760 | Ga0495638_0000543 | |||
| 1761 | Ga0495638_0104420 | |||
| 1762 | Ga0495641_0001105 | |||
| 1763 | Ga0495651_0009753 | |||
| 1764 | Ga0495653_0017178 | |||
| 1765 | Ga0495653_0196397 | |||
| 1766 | Ga0495650_0001929 | |||
| 1767 | Ga0495650_0003366 | |||
| 1768 | Ga0495580_0021288 | |||
| 1769 | Ga0495580_0128834 | |||
| 1770 | Ga0495580_0244249 | |||
| 1771 | Ga0495582_0089280 | |||
| 1772 | Ga0495582_0094989 | |||
| 1773 | Ga0495582_0314016 | |||
| 1774 | Ga0495605_0000394 | |||
| 1775 | Ga0495605_0025478 | |||
| 1776 | Ga0495639_0003744 | |||
| 1777 | Ga0495639_0008665 | |||
| 1778 | Ga0495662_0016160 | |||
| 1779 | Ga0495664_0003219 | |||
| 1780 | Ga0495664_0009587 | |||
| 1781 | Ga0495584_0003609 | |||
| 1782 | Ga0495585_0000001 | |||
| 1783 | Ga0495594_0009332 | |||
| 1784 | Ga0495596_0006258 | |||
| 1785 | Ga0495607_0000967 | |||
| 1786 | Ga0495607_0004270 | |||
| 1787 | Ga0495607_0006847 | |||
| 1788 | Ga0495607_0217499 | |||
| 1789 | Ga0495583_0000310 | |||
| 1790 | Ga0495583_0000626 | |||
| 1791 | Ga0495583_0084943 | |||
| 1792 | Ga0495606_0000326 | |||
| 1793 | Ga0495606_0000660 | |||
| 1794 | Ga0495606_0001121 | |||
| 1795 | Ga0495608_0011280 | |||
| 1796 | Ga0495608_0023435 | |||
| 1797 | Ga0495610_0000006 | |||
| 1798 | Ga0495616_0014232 | |||
| 1799 | Ga0495628_0006322 | |||
| 1800 | Ga0495628_0052427 | |||
| 1801 | Ga0495628_0218511 | |||
| 1802 | Ga0495628_0579662 | |||
| 1803 | Ga0495630_0001974 | |||
| 1804 | Ga0495631_0000078 | |||
| 1805 | Ga0495632_0000601 | |||
| 1806 | Ga0495643_0000519 | |||
| 1807 | Ga0495644_0000799 | |||
| 1808 | Ga0495644_0002833 | |||
| 1809 | Ga0495648_0000206 | |||
| 1810 | Ga0495648_0000990 | |||
| 1811 | Ga0495648_0003241 | |||
| 1812 | Ga0495648_0023475 | |||
| 1813 | Ga0495666_0006403 | |||
| 1814 | Ga0495642_0013982 | |||
| 1815 | Ga0495652_0037267 | |||
| 1816 | Ga0495652_0202263 | |||
| 1817 | Ga0495652_0347124 | |||
| 1818 | Ga0495654_0000006 | |||
| 1819 | Ga0495654_0000353 | |||
| 1820 | Ga0495654_0002624 | |||
| 1821 | Ga0495654_0018562 | |||
| 1822 | Ga0495640_0006143 | |||
| 1823 | Ga0495586_0005085 | |||
| 1824 | Ga0495587_0015431 | |||
| 1825 | Ga0495587_0024960 | |||
| 1826 | Ga0495587_0027599 | |||
| 1827 | Ga0495587_0045421 | |||
| 1828 | Ga0495587_0322659 | |||
| 1829 | Ga0495609_0005147 | |||
| 1830 | Ga0495609_0010929 | |||
| 1831 | Ga0495609_0107445 | |||
| 1832 | Ga0495621_0006587 | |||
| 1833 | Ga0495621_0104197 | |||
| 1834 | Ga0495597_0000262 | |||
| 1835 | Ga0495645_0000483 | |||
| 1836 | Ga0495645_0027047 | |||
| 1837 | Ga0495645_0334436 | |||
| 1838 | Ga0495622_0000077 | |||
| 1839 | Ga0495622_0113110 | |||
| 1840 | Ga0495633_0000149 | |||
| 1841 | Ga0495633_0002549 | |||
| 1842 | Ga0495633_0007833 | |||
| 1843 | Ga0495667_0005516 | |||
| 1844 | Ga0495667_0014488 | |||
| 1845 | Ga0495667_0015374 | |||
| 1846 | Ga0495668_0000888 | |||
| 1847 | Ga0495668_0034425 | |||
| 1848 | Ga0495634_0008248 | |||
| 1849 | Ga0495611_0000001 | |||
| 1850 | Ga0495625_0000001 | |||
| 1851 | Ga0495625_0000199 | |||
| 1852 | Ga0495625_0001048 | |||
| 1853 | Ga0495625_0062950 | |||
| 1854 | Ga0495635_0312077 | |||
| 1855 | Ga0495659_0002117 | |||
| 1856 | Ga0495661_0000104 | |||
| 1857 | Ga0495661_0043077 | |||
| 1858 | Ga0495588_0048265 | |||
| 1859 | Ga0495657_0003049 | |||
| 1860 | Ga0495657_0017206 | |||
| 1861 | Ga0495599_0001707 | |||
| 1862 | Ga0495599_0001790 | |||
| 1863 | Ga0495646_0026014 | |||
| 1864 | Ga0495647_0001510 | |||
| 1865 | Ga0495658_0335019 | |||
| 1866 | Ga0495658_0466913 | |||
| 1867 | Ga0495669_0125883 | |||
| 1868 | Ga0495613_0180728 | |||
| 1869 | Ga0495624_0023178 | |||
| 1870 | Ga0495670_0176018 | |||
| 1871 | Ga0495671_0000175 | |||
| 1872 | Ga0495671_0001021 | |||
| 1873 | Ga0495671_0004751 | |||
| 1874 | Ga0495589_0000006 | |||
| 1875 | Ga0495589_0000999 | |||
| 1876 | Ga0495600_0002178 | |||
| 1877 | Ga0495600_0070414 | |||
| 1878 | Ga0495660_0000008 | |||
| 1879 | Ga0495660_0000009 | |||
| 1880 | Ga0495660_0000019 | |||
| 1881 | Ga0495660_0109464 | |||
| 1882 | Ga0495660_0186080 | |||
| 1883 | Ga0495581_0146557 | |||
| 1884 | Ga0495604_0010199 | |||
| 1885 | Ga0495604_0012321 | |||
| 1886 | Ga0495636_0001345 | |||
| 1887 | Ga0495674_0000463 | |||
| 1888 | Ga0495674_0052188 | |||
| 1889 | Ga0495674_0354855 | |||
| 1890 | Ga0495672_0000003 | |||
| 1891 | Ga0495672_0001917 | |||
| 1892 | Ga0495680_0016578 | |||
| 1893 | Ga0495680_0082993 | |||
| 1894 | Ga0495680_0102926 | |||
| 1895 | Ga0495683_0000472 | |||
| 1896 | Ga0495687_000370 | |||
| 1897 | Ga0495675_0035274 | |||
| 1898 | Ga0495677_0009318 | |||
| 1899 | Ga0495679_000001 | |||
| 1900 | Ga0495679_057429 | |||
| 1901 | Ga0495685_000091 | |||
| 1902 | Ga0495673_0000001 | |||
| 1903 | Ga0495673_0000011 | |||
| 1904 | Ga0495673_0000089 | |||
| 1905 | Ga0495673_0004212 | |||
| 1906 | Ga0495684_0001586 | |||
| 1907 | Ga0495684_0047674 | |||
| 1908 | Ga0495686_0003986 | |||
| 1909 | Ga0495686_0124293 | |||
| 1910 | Ga0495602_0000196 | |||
| 1911 | Ga0496100_0021624 | |||
| 1912 | Ga0496101_0436596 | |||
| 1913 | Ga0496102_0778275 | |||
| 1914 | Ga0496104_0004551 | |||
| 1915 | Ga0496105_0007863 | |||
| 1916 | Ga0496105_0477587 | |||
| 1917 | Ga0496106_0186734 | |||
| 1918 | Ga0496106_0389667 | |||
| 1919 | Ga0496107_0158962 | |||
| 1920 | Ga0496108_0030955 | |||
| 1921 | Ga0496108_0081698 | |||
| 1922 | Ga0496109_0135358 | |||
| 1923 | Ga0496109_0251756 | |||
| 1924 | Ga0496111_0218620 | |||
| 1925 | Ga0496114_0129947 | |||
| 1926 | Ga0496115_0014454 | |||
| 1927 | Ga0496116_0000006 | |||
| 1928 | Ga0496116_0000031 | |||
| 1929 | Ga0496116_0066661 | |||
| 1930 | Ga0496117_0000027 | |||
| 1931 | Ga0496117_0000132 | |||
| 1932 | Ga0496117_0019969 | |||
| 1933 | Ga0496118_0000099 | |||
| 1934 | Ga0496118_0000141 | |||
| 1935 | Ga0496118_0085794 | |||
| 1936 | Ga0496119_0000006 | |||
| 1937 | Ga0496119_0000258 | |||
| 1938 | Ga0496119_0000280 | |||
| 1939 | Ga0496119_0014218 | |||
| 1940 | Ga0496119_0115941 | |||
| 1941 | Ga0496120_0000228 | |||
| 1942 | Ga0496120_0000255 | |||
| 1943 | Ga0496120_0040527 | |||
| 1944 | Ga0496120_0083671 | |||
| 1945 | Ga0496121_0000368 | |||
| 1946 | Ga0496121_0032337 | |||
| 1947 | Ga0496122_0000229 | |||
| 1948 | Ga0496122_0000397 | |||
| 1949 | Ga0496122_0001702 | |||
| 1950 | Ga0496122_0002499 | |||
| 1951 | Ga0496122_0004429 | |||
| 1952 | Ga0496122_0023172 | |||
| 1953 | Ga0496122_0074132 | |||
| 1954 | Ga0496123_0003689 | |||
| 1955 | Ga0496123_0005655 | |||
| 1956 | Ga0496123_0021618 | |||
| 1957 | Ga0496123_0023894 | |||
| 1958 | Ga0496124_0000122 | |||
| 1959 | Ga0496124_0005070 | |||
| 1960 | Ga0496124_0186194 | |||
| 1961 | Ga0496125_0001071 | |||
| 1962 | Ga0496125_0003176 | |||
| 1963 | Ga0496125_0054020 | |||
| 1964 | Ga0496126_0001395 | |||
| 1965 | Ga0496126_0016309 | |||
| 1966 | Ga0496126_0067076 | |||
| 1967 | Ga0496126_0105264 | |||
| 1968 | Ga0496126_0110835 | |||
| 1969 | Ga0496126_0138838 | |||
| 1970 | Ga0496126_0152582 | |||
| 1971 | Ga0496126_0281066 | |||
| 1972 | Ga0496126_0641876 | |||
| 1973 | Ga0495678_000023 | |||
| 1974 | Ga0495678_016990 | |||
| 1975 | Ga0495682_0000106 | |||
| 1976 | Ga0495682_0000836 | |||
| 1977 | Ga0495682_0001080 | |||
| 1978 | Ga0495682_0003245 | |||
| 1979 | Ga0501031_0300797 | |||
| 1980 | Ga0501033_0052608 | |||
| 1981 | Ga0501033_0207987 | |||
| 1982 | Ga0501034_0253758 | |||
| 1983 | Ga0501036_0171871 | |||
| 1984 | Ga0501036_0185232 | |||
| 1985 | Ga0501037_0219025 | |||
| 1986 | Ga0501037_0375071 | |||
| 1987 | Ga0501038_0011020 | |||
| 1988 | Ga0501039_0002684 | |||
| 1989 | Ga0501039_0221456 | |||
| 1990 | Ga0501039_0689972 | |||
| 1991 | Ga0501040_0002660 | |||
| 1992 | Ga0501041_0189193 | |||
| 1993 | Ga0501043_0025691 | |||
| 1994 | Ga0501043_0039241 | |||
| 1995 | Ga0501043_0043785 | |||
| 1996 | Ga0501046_0109734 | |||
| 1997 | Ga0501046_0131278 | |||
| 1998 | Ga0501046_0255728 | |||
| 1999 | Ga0501047_0065745 | |||
| 2000 | Ga0501047_0130481 | |||
| 2001 | Ga0501047_0144310 | |||
| 2002 | Ga0501047_0423529 | |||
| 2003 | Ga0501048_0009927 | |||
| 2004 | Ga0501068_0028004 | |||
| 2005 | Ga0501068_0104582 | |||
| 2006 | Ga0501070_0052346 | |||
| 2007 | Ga0501070_0721142 | |||
| 2008 | Ga0501071_0011773 | |||
| 2009 | Ga0501071_0339466 | |||
| 2010 | Ga0501072_0008811 | |||
| 2011 | Ga0501072_0245166 | |||
| 2012 | Ga0501073_0036993 | |||
| 2013 | Ga0501073_0124613 | |||
| 2014 | Ga0501073_0186704 | |||
| 2015 | Ga0501074_0080946 | |||
| 2016 | Ga0501074_0433317 | |||
| 2017 | Ga0501075_0000572 | |||
| 2018 | Ga0501076_0007550 | |||
| 2019 | Ga0501077_0000982 | |||
| 2020 | Ga0501079_0000502 | |||
| 2021 | Ga0501079_0111438 | |||
| 2022 | Ga0501080_0005351 | |||
| 2023 | Ga0501080_0154465 | |||
| 2024 | Ga0501080_0399862 | |||
| 2025 | Ga0501081_0000092 | |||
| 2026 | Ga0501081_0141157 | |||
| 2027 | Ga0501083_0010764 | |||
| 2028 | Ga0501241_000003 | |||
| 2029 | Ga0501269_000050 | |||
| 2030 | Ga0501044_0459709 | |||
| 2031 | Ga0501045_0000513 | |||
| 2032 | nmdc:mga0k408_2569_c1 | |||
| 2033 | nmdc:mga0k408_3418_c1 | |||
| 2034 | nmdc:mga05p37_125234_c1 | |||
| 2035 | nmdc:mga05p37_221805_c1 | |||
| 2036 | nmdc:mga09592_235446_c1 | |||
| 2037 | nmdc:mga09592_308647_c1 | |||
| 2038 | nmdc:mga09592_37007_c1 | |||
| 2039 | nmdc:mga09592_465938_c1 | |||
| 2040 | nmdc:mga0qj67_244258_c1 | |||
| 2041 | nmdc:mga0qj67_94824_c1 | |||
| 2042 | nmdc:mga06r32_741098_c1 | |||
| 2043 | nmdc:mga08y16_123766_c1 | |||
| 2044 | nmdc:mga08y16_43526_c1 | |||
| 2045 | nmdc:mga08y16_860711_c1 | |||
| 2046 | Ga0495601_0002906 | |||
| 2047 | Ga0495601_0017419 | |||
| 2048 | Ga0495601_0026240 | |||
| 2049 | Ga0495601_0096987 | |||
| 2050 | Ga0495612_0000301 | |||
| 2051 | Ga0495595_0053071 | |||
| 2052 | Ga0495619_0000944 | |||
| 2053 | Ga0495619_0022615 | |||
| 2054 | Ga0495619_0047926 | |||
| 2055 | Ga0495619_0129937 | |||
| 2056 | Ga0500643_000002 | |||
| 2057 | Ga0500651_0000723 | |||
| 2058 | Ga0500555_000242 | |||
| 2059 | Ga0500555_009159 | |||
| 2060 | Ga0500562_000130 | |||
| 2061 | Ga0500592_000252 | |||
| 2062 | Ga0500642_0077572 | |||
| 2063 | Ga0500568_0034536 | |||
| 2064 | Ga0500573_0021147 | |||
| 2065 | Ga0500616_0000019 | |||
| 2066 | Ga0500619_000037 | |||
| 2067 | Ga0500637_0251453 | |||
| 2068 | Ga0500645_001224 | |||
| 2069 | Ga0500645_012815 | |||
| 2070 | Ga0501084_0001064 | |||
| 2071 | Ga0501082_0067389 | |||
| 2072 | Ga0466962_0036085 | |||
| 2073 | Ga0530510_0008078 | |||
| 2074 | 2511231668 | |||
| 2075 | 2585145033 | |||
| 2076 | 2585156106 | |||
| 2077 | 2585160315 | |||
| 2078 | 2587678591 | |||
| 2079 | 2587746246 | |||
| 2080 | 2588210351 | |||
| 2081 | 2588214405 | |||
| 2082 | 2588217631 | |||
| 2083 | 2588223148 | |||
| 2084 | 2588232868 | |||
| 2085 | 2588443990 | |||
| 2086 | 2590601608 | |||
| 2087 | 2590609243 | |||
| 2088 | 2723878444 | |||
| 2089 | 2729200139 | |||
| 2090 | 2738699871 | |||
| 2091 | 2739253620 | |||
| 2092 | 2740059118 | |||
| 2093 | 2753673169 | |||
| 2094 | 2765574262 | |||
| 2095 | 2772604781 | |||
| 2096 | 2775671904 | |||
| 2097 | 2816874473 | |||
| 2098 | 2842085836 | |||
| 2099 | 2871724158 | |||
| 2100 | 2881418509 | |||
| 2101 | 2889295208 | |||
| 2102 | 2890740132 | |||
| 2103 | 2898713989 | |||
| 2104 | 2906000103 | |||
| 2105 | 2914763196 | |||
| 2106 | 2919098657 | |||
| 2107 | 2919403791 | |||
| 2108 | 2946022745 | |||
| 2109 | 2984573195 | |||
| 2110 | 2984610647 | |||
| 2111 | 8036739605 | |||
| 2112 | 8057102843 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o9e-assembly1.cif.gz_A | crystal structure of aqpz mutant t183c complexed with mercury | 0.9973 | 38 | 267 |
| 2abm-assembly1.cif.gz_A | crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels | 0.9973 | 39 | 264 |
| 2o9g-assembly1.cif.gz_A | crystal structure of aqpz mutant l170c complexed with mercury. | 0.9969 | 38 | 267 |
| 3nk5-assembly2.cif.gz_B | crystal structure of aqpz mutant f43w | 0.9969 | 38 | 267 |
| 2o9d-assembly2.cif.gz_B | crystal structure of aqpz mutant t183c. | 0.9969 | 38 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3llqB00 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.992 | 38 | 266 | 1.20.1080.10 |
| 3llqB00 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9625 | 38 | 266 | 1.20.1080.10 |
| af_Q7Z138_18_164_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9341 | 38 | 137 | 1.20.1080.10 |
| af_Q9V5Z7_14_242_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9332 | 34 | 267 | 1.20.1080.10 |
| af_Q0JPT5_51_289_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9289 | 38 | 263 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A485CCH7-F1-model_v4 | Aquaporin Z | 1.001 | 39 | 266 |
GO:0005886
GO:0015250 |
| AF-A0A1C6Z0X6-F1-model_v4 | Aquaporin Z | 1.001 | 39 | 220 |
GO:0005886
GO:0015250 |
| AF-A0A2J4YQS4-F1-model_v4 | Aquaporin Z | 1.001 | 85 | 266 |
GO:0005886
GO:0015250 |
| AF-A0A4U9HQ78-F1-model_v4 | Bacterial nodulin-like intrinsic protein | 1.001 | 39 | 204 |
GO:0005886
GO:0015250 |
| AF-A0A0A2VTY1-F1-model_v4 | Uncharacterized protein ybjE | 1.001 | 88 | 247 |
GO:0005886
GO:0015267 GO:0015661 |