F489170

General Info

Members Datasets Scaffolds Average Seq Length
1056 511 2112 238

Family's Representative Sequence

Representative Sequence 3300002705|JGI25156J39149_1001066|JGI25156J39149_100106611
Length 284
Sequence MRGIYAQVLGRDKDALAWNKGGVRRGKATLQSWETATMFKRLFAEFFGTFWLVLGGCGSAVLAAAFPNLGIGFAGVALAFGLTVVTMAYACAGISGAHFNPAVTVGLFFGGRFSGKDVVPYIVSQVIGAIVAAAVLYVIASGKPGFDATASGFASNGYAAHSPGGYSLQACVVCEFVLTAMFLIVIHGATDRRAPAGFGPLAIGLALTLIHLISIPVTNTSVNPARSTGVAIFQGTWALQQLWMFWLVPLLGGAAGGLIFRFLLGEDVAKPSVAAGAQAGMSNA

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
138 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
222 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
230 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
233 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
235 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
239 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
243 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
246 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
284 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
285 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
286 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
287 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
288 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
289 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
295 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
300 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
308 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
309 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
310 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
311 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
312 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
313 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
314 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
320 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
325 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
326 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
327 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
328 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
329 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
333 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
349 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
350 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
351 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
352 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
353 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
354 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
360 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
361 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
362 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
363 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
364 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
365 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
369 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
370 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
371 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
372 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
373 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
374 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
375 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
379 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
380 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
381 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
382 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
383 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
384 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
385 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
386 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
387 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
388 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
396 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
397 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
398 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
399 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
400 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
403 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
404 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
405 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
406 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
407 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
408 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
409 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
410 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
411 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
412 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
413 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
414 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
415 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
416 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
437 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
438 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
442 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
443 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
444 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
448 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
449 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
450 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
451 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
452 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
453 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
454 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
458 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
459 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
460 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
461 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
462 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
467 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
468 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
469 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
470 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
471 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
472 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
473 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
474 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
475 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
476 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
477 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
478 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
479 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
480 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
481 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
482 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
483 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
484 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
485 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
486 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
487 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
488 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
489 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
490 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
491 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
492 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
493 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
494 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
495 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
496 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
497 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
498 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
499 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
500 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
501 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
502 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
503 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
504 2914759650 Rhizosphaericola mali Isolate Rhizosphere
505 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
506 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
507 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
508 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
509 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
510 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
511 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0.09
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 7.01
Nodule 0.47
Rhizoplane 1.52
Rhizosphere 83.52
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001066 3300002705 Bacteria 12662
2 JGI25162J39368_1000995 3300002737 Bacteria 17881
3 JGI25162J39368_1001495 3300002737 Bacteria 12188
4 JGI25162J39368_1002049 3300002737 Bacteria 8790
5 JGI25154J39366_1002110 3300002738 Bacteria 5581
6 JGI25157J39369_1000342 3300002741 Bacteria 32979
7 JGI25157J39369_1001042 3300002741 Bacteria 12663
8 JGI25164J39214_1000078 3300002772 Bacteria 94809
9 JGI25164J39214_1000738 3300002772 Bacteria 12191
10 JGI25164J39214_1000760 3300002772 Bacteria 11831
11 JGI25165J46597_1000088 3300003214 Bacteria 169821
12 JGI25165J46597_1000245 3300003214 Bacteria 73709
13 JGI25165J46597_1001490 3300003214 Bacteria 12004
14 JGI25165J46597_1001854 3300003214 Bacteria 8739
15 rootH2_10009385 3300003320 Bacteria 8751
16 rootH2_10193234 3300003320 Bacteria 1314
17 rootL2_10155819 3300003322 Bacteria 7965
18 rootH1_10075165 3300003323 Bacteria 12585
19 Ga0055525_1000146 3300003759 Bacteria 97114
20 Ga0055527_1000074 3300003760 Bacteria 82742
21 Ga0055535_1000359 3300003761 Bacteria 44033
22 Ga0055535_1000372 3300003761 Bacteria 42891
23 Ga0055542_1000151 3300003762 Bacteria 87857
24 Ga0055542_1000168 3300003762 Bacteria 82742
25 Ga0055542_1000352 3300003762 Bacteria 48395
26 Ga0055529_1000163 3300003763 Bacteria 92012
27 Ga0055529_1000543 3300003763 Bacteria 32272
28 Ga0055526_1000232 3300003771 Bacteria 46733
29 Ga0055537_1000030 3300003773 Bacteria 100491
30 Ga0055524_1002681 3300003775 Bacteria 9017
31 Ga0055534_1000447 3300003784 Bacteria 24217
32 Ga0055528_1000439 3300003790 Bacteria 33348
33 Ga0065703_1018836 3300005272 Bacteria 6188
34 Ga0065704_10074548 3300005289 Bacteria 6194
35 Ga0065704_10332195 3300005289 Bacteria 834
36 Ga0065715_10003421 3300005293 Bacteria 4050
37 Ga0065715_10212795 3300005293 Bacteria 1306
38 Ga0070658_10504740 3300005327 Bacteria 1045
39 Ga0070676_10024163 3300005328 Bacteria 3421
40 Ga0070676_10173087 3300005328 Bacteria 1398
41 Ga0070676_10235689 3300005328 Bacteria 1215
42 Ga0070676_10368502 3300005328 Bacteria 992
43 Ga0070683_100007566 3300005329 Bacteria 9184
44 Ga0070683_100505607 3300005329 Bacteria 1154
45 Ga0070690_100006132 3300005330 Bacteria 6805
46 Ga0070690_100029833 3300005330 Bacteria 3386
47 Ga0070690_100482899 3300005330 Bacteria 924
48 Ga0070677_10020372 3300005333 Bacteria 2415
49 Ga0070677_10042635 3300005333 Bacteria 1798
50 Ga0068869_100015418 3300005334 Bacteria 5126
51 Ga0070666_10007588 3300005335 Bacteria 6692
52 Ga0070666_10051454 3300005335 Bacteria 2774
53 Ga0070666_10067052 3300005335 Bacteria 2436
54 Ga0070680_100553621 3300005336 Bacteria 986
55 Ga0070682_100000474 3300005337 Bacteria 25301
56 Ga0068868_100003208 3300005338 Bacteria 11384
57 Ga0068868_100016571 3300005338 Bacteria 5477
58 Ga0070660_100266428 3300005339 Bacteria 1400
59 Ga0070660_100650995 3300005339 Bacteria 882
60 Ga0070689_100091651 3300005340 Bacteria 2396
61 Ga0070687_100059708 3300005343 Bacteria 2009
62 Ga0070668_100031835 3300005347 Bacteria 4013
63 Ga0070669_100164277 3300005353 Bacteria 1727
64 Ga0070675_100000208 3300005354 Bacteria 37508
65 Ga0070675_100009783 3300005354 Bacteria 7469
66 Ga0070675_100234616 3300005354 Bacteria 1601
67 Ga0070675_100864699 3300005354 Bacteria 828
68 Ga0070671_100001433 3300005355 Bacteria 17805
69 Ga0070671_100341699 3300005355 Bacteria 1277
70 Ga0070671_100545243 3300005355 Bacteria 1000
71 Ga0070674_100020413 3300005356 Bacteria 4233
72 Ga0070673_100000523 3300005364 Bacteria 20606
73 Ga0070688_100065452 3300005365 Bacteria 2310
74 Ga0070688_100121598 3300005365 Bacteria 1750
75 Ga0070659_100714914 3300005366 Bacteria 867
76 Ga0070667_100001902 3300005367 Bacteria 18530
77 Ga0070667_100112715 3300005367 Bacteria 2359
78 Ga0070703_10000113 3300005406 Bacteria 41936
79 Ga0070714_100056798 3300005435 Bacteria 3349
80 Ga0070714_100117931 3300005435 Bacteria 2358
81 Ga0070713_100032163 3300005436 Bacteria 4187
82 Ga0070713_100162298 3300005436 Bacteria 1996
83 Ga0070713_100228091 3300005436 Bacteria 1692
84 Ga0070701_10011600 3300005438 Bacteria 3948
85 Ga0070711_100126251 3300005439 Bacteria 1899
86 Ga0070711_100188716 3300005439 Bacteria 1582
87 Ga0070711_100211362 3300005439 Bacteria 1503
88 Ga0070705_100296412 3300005440 Bacteria 1157
89 Ga0070700_100009956 3300005441 Bacteria 5232
90 Ga0070700_100048201 3300005441 Bacteria 2640
91 Ga0070700_100367358 3300005441 Bacteria 1072
92 Ga0070694_100005129 3300005444 Bacteria 7897
93 Ga0070708_100084056 3300005445 Bacteria 2887
94 Ga0070708_100370732 3300005445 Bacteria 1350
95 Ga0070708_100373407 3300005445 Bacteria 1344
96 Ga0070678_100000227 3300005456 Bacteria 25438
97 Ga0070678_100023593 3300005456 Bacteria 4102
98 Ga0070678_100103126 3300005456 Bacteria 2215
99 Ga0070678_100380653 3300005456 Bacteria 1221
100 Ga0070662_100030296 3300005457 Bacteria 3784
101 Ga0070662_100135810 3300005457 Bacteria 1901
102 Ga0070662_100277722 3300005457 Bacteria 1355
103 Ga0068867_100025872 3300005459 Bacteria 4210
104 Ga0068867_100051158 3300005459 Bacteria 3046
105 Ga0068867_100615026 3300005459 Bacteria 949
106 Ga0070685_10053945 3300005466 Bacteria 2331
107 Ga0070685_10238652 3300005466 Bacteria 1199
108 Ga0070707_100057853 3300005468 Bacteria 3719
109 Ga0070707_100176789 3300005468 Bacteria 2081
110 Ga0070698_100014238 3300005471 Bacteria 8408
111 Ga0070698_100246073 3300005471 Bacteria 1721
112 Ga0070699_100015650 3300005518 Bacteria 6515
113 Ga0070699_100323386 3300005518 Bacteria 1387
114 Ga0070699_100405362 3300005518 Bacteria 1233
115 Ga0070679_100017929 3300005530 Bacteria 6859
116 Ga0070679_100196955 3300005530 Bacteria 1982
117 Ga0070684_100007379 3300005535 Bacteria 8548
118 Ga0070697_100032621 3300005536 Bacteria 4192
119 Ga0070697_100837722 3300005536 Bacteria 815
120 Ga0068853_100238057 3300005539 Bacteria 1667
121 Ga0068853_100447454 3300005539 Bacteria 1215
122 Ga0070686_100026997 3300005544 Bacteria 3471
123 Ga0070686_100478906 3300005544 Bacteria 962
124 Ga0070665_100041910 3300005548 Bacteria 4601
125 Ga0070665_100046639 3300005548 Bacteria 4352
126 Ga0070665_100082250 3300005548 Bacteria 3225
127 Ga0070665_100117248 3300005548 Bacteria 2665
128 Ga0070665_100180269 3300005548 Bacteria 2113
129 Ga0070665_100310869 3300005548 Bacteria 1579
130 Ga0070665_100754776 3300005548 Bacteria 986
131 Ga0070704_100005894 3300005549 Bacteria 7180
132 Ga0070704_100161035 3300005549 Bacteria 1775
133 Ga0068855_100001240 3300005563 Bacteria 31649
134 Ga0068855_100002346 3300005563 Bacteria 23375
135 Ga0068855_100013263 3300005563 Bacteria 9939
136 Ga0068855_100634742 3300005563 Bacteria 1149
137 Ga0070664_100012064 3300005564 Bacteria 7021
138 Ga0070664_100145424 3300005564 Bacteria 2090
139 Ga0070664_100148006 3300005564 Bacteria 2072
140 Ga0070664_100534515 3300005564 Bacteria 1083
141 Ga0068857_100207217 3300005577 Bacteria 1788
142 Ga0068856_100010356 3300005614 Bacteria 9057
143 Ga0068856_100235107 3300005614 Bacteria 1848
144 Ga0068856_100724484 3300005614 Bacteria 1015
145 Ga0070702_100111863 3300005615 Bacteria 1694
146 Ga0070702_100242822 3300005615 Bacteria 1216
147 Ga0068852_100031895 3300005616 Bacteria 4356
148 Ga0068852_100064778 3300005616 Bacteria 3187
149 Ga0068859_100000008 3300005617 Bacteria 383750
150 Ga0068859_100004743 3300005617 Bacteria 13816
151 Ga0068859_100021239 3300005617 Bacteria 6515
152 Ga0068859_100197930 3300005617 Bacteria 2094
153 Ga0068859_100393256 3300005617 Bacteria 1482
154 Ga0068859_100468269 3300005617 Bacteria 1356
155 Ga0068864_100000101 3300005618 Bacteria 84095
156 Ga0068864_100085017 3300005618 Unclassified 2781
157 Ga0068864_100316511 3300005618 Bacteria 1465
158 Ga0068864_100504502 3300005618 Bacteria 1164
159 Ga0068866_10011077 3300005718 Bacteria 3887
160 Ga0068861_100023859 3300005719 Bacteria 4417
161 Ga0068861_100304831 3300005719 Bacteria 1381
162 Ga0068861_100436788 3300005719 Bacteria 1170
163 Ga0068851_10097345 3300005834 Bacteria 1557
164 Ga0068870_10485655 3300005840 Bacteria 821
165 Ga0068863_100012306 3300005841 Bacteria 8261
166 Ga0068863_100081804 3300005841 Bacteria 3059
167 Ga0068863_100107301 3300005841 Bacteria 2657
168 Ga0068863_100153171 3300005841 Bacteria 2206
169 Ga0068863_100409320 3300005841 Bacteria 1327
170 Ga0068858_100003390 3300005842 Bacteria 15860
171 Ga0068858_100003419 3300005842 Bacteria 15788
172 Ga0068858_100015795 3300005842 Bacteria 7101
173 Ga0068858_100096380 3300005842 Bacteria 2756
174 Ga0068858_100723917 3300005842 Bacteria 969
175 Ga0068860_100043493 3300005843 Bacteria 4285
176 Ga0068862_100059701 3300005844 Bacteria 3275
177 Ga0068862_100385881 3300005844 Bacteria 1307
178 Ga0081539_10026051 3300005985 Bacteria 3745
179 Ga0070717_10001018 3300006028 Bacteria 18799
180 Ga0070717_10076438 3300006028 Bacteria 2803
181 Ga0070717_10293105 3300006028 Bacteria 1445
182 Ga0070716_100075027 3300006173 Bacteria 2000
183 Ga0070712_100003184 3300006175 Bacteria 10109
184 Ga0070712_100235479 3300006175 Bacteria 1456
185 Ga0075362_10062829 3300006177 Bacteria 1683
186 Ga0075366_10002575 3300006195 Bacteria 9323
187 Ga0075366_10011548 3300006195 Bacteria 4988
188 Ga0097621_100026816 3300006237 Bacteria 4524
189 Ga0097621_100043240 3300006237 Bacteria 3631
190 Ga0097621_100206674 3300006237 Bacteria 1706
191 Ga0068871_100005768 3300006358 Bacteria 8697
192 Ga0068871_100019124 3300006358 Bacteria 5225
193 Ga0075428_100388793 3300006844 Bacteria 1495
194 Ga0075428_100514917 3300006844 Bacteria 1280
195 Ga0075430_100105710 3300006846 Bacteria 2349
196 Ga0075433_10027568 3300006852 Bacteria 4819
197 Ga0075434_100659378 3300006871 Bacteria 1064
198 Ga0075429_100048420 3300006880 Bacteria 3696
199 Ga0075429_100334186 3300006880 Bacteria 1326
200 Ga0075429_100507462 3300006880 Bacteria 1057
201 Ga0068865_100047398 3300006881 Bacteria 2953
202 Ga0068865_100152844 3300006881 Bacteria 1753
203 Ga0075436_100136428 3300006914 Bacteria 1723
204 Ga0075436_100175287 3300006914 Bacteria 1514
205 Ga0097620_100000008 3300006931 Bacteria 383750
206 Ga0097620_100004743 3300006931 Bacteria 13816
207 Ga0097620_100021236 3300006931 Bacteria 6515
208 Ga0097620_100197924 3300006931 Bacteria 2094
209 Ga0097620_100393241 3300006931 Bacteria 1482
210 Ga0097620_100468260 3300006931 Bacteria 1356
211 Ga0079104_1000700 3300006946 Bacteria 30527
212 Ga0079104_1003404 3300006946 Bacteria 7433
213 Ga0075435_100167749 3300007076 Bacteria 1851
214 Ga0105251_10000073 3300009011 Bacteria 97270
215 Ga0105251_10000267 3300009011 Bacteria 52069
216 Ga0105251_10000582 3300009011 Bacteria 33639
217 Ga0105244_10000001 3300009036 Bacteria 1034899
218 Ga0105244_10000315 3300009036 Bacteria 46626
219 Ga0105244_10108177 3300009036 Bacteria 1355
220 Ga0105250_10080334 3300009092 Bacteria 1322
221 Ga0105240_10003716 3300009093 Bacteria 23574
222 Ga0105240_10005607 3300009093 Bacteria 18634
223 Ga0105240_10005746 3300009093 Bacteria 18400
224 Ga0105240_10006293 3300009093 Bacteria 17469
225 Ga0105240_10061165 3300009093 Bacteria 4693
226 Ga0105240_10074105 3300009093 Bacteria 4203
227 Ga0105240_10661509 3300009093 Bacteria 1144
228 Ga0111539_10006397 3300009094 Bacteria 15195
229 Ga0111539_10066977 3300009094 Bacteria 4242
230 Ga0111539_10189811 3300009094 Bacteria 2398
231 Ga0111539_10209250 3300009094 Bacteria 2273
232 Ga0111539_11009104 3300009094 Bacteria 967
233 Ga0105245_10086433 3300009098 Bacteria 2876
234 Ga0105247_10000187 3300009101 Bacteria 60332
235 Ga0105247_10012875 3300009101 Bacteria 5020
236 Ga0105247_10208835 3300009101 Bacteria 1316
237 Ga0114129_10198151 3300009147 Bacteria 2722
238 Ga0105243_10000056 3300009148 Bacteria 133442
239 Ga0105243_10000471 3300009148 Bacteria 41457
240 Ga0105241_10000004 3300009174 Bacteria 803007
241 Ga0105241_10348406 3300009174 Bacteria 1285
242 Ga0105242_10000015 3300009176 Bacteria 124678
243 Ga0105242_10058655 3300009176 Bacteria 3157
244 Ga0105248_10035689 3300009177 Bacteria 5561
245 Ga0105248_10036354 3300009177 Bacteria 5507
246 Ga0105248_10039410 3300009177 Bacteria 5291
247 Ga0105248_10064863 3300009177 Bacteria 4100
248 Ga0105248_10135207 3300009177 Bacteria 2781
249 Ga0105237_10006745 3300009545 Bacteria 12679
250 Ga0105237_10115769 3300009545 Bacteria 2674
251 Ga0105237_10194727 3300009545 Bacteria 2026
252 Ga0105237_10229381 3300009545 Bacteria 1858
253 Ga0105238_10053835 3300009551 Bacteria 4044
254 Ga0105238_10074565 3300009551 Bacteria 3385
255 Ga0105239_10044969 3300010375 Bacteria 4840
256 Ga0105239_10051580 3300010375 Bacteria 4510
257 Ga0105239_10105428 3300010375 Bacteria 3122
258 Ga0105239_10110765 3300010375 Bacteria 3043
259 Ga0105239_10116732 3300010375 Bacteria 2962
260 Ga0105239_10617904 3300010375 Bacteria 1236
261 Ga0157316_1003325 3300012510 Bacteria 1153
262 Ga0157373_10003158 3300013100 Bacteria 12444
263 Ga0157373_10092599 3300013100 Bacteria 2129
264 Ga0157373_10193437 3300013100 Bacteria 1433
265 Ga0157370_10013507 3300013104 Bacteria 8408
266 Ga0157370_10136510 3300013104 Bacteria 2286
267 Ga0157369_10005191 3300013105 Bacteria 15223
268 Ga0157369_10255028 3300013105 Bacteria 1830
269 Ga0157369_10487808 3300013105 Bacteria 1275
270 Ga0157374_10003724 3300013296 Bacteria 12812
271 Ga0157374_10003991 3300013296 Bacteria 12401
272 Ga0157374_10029467 3300013296 Bacteria 4971
273 Ga0157374_10044152 3300013296 Bacteria 4120
274 Ga0157374_10074693 3300013296 Bacteria 3202
275 Ga0157374_10157142 3300013296 Bacteria 2214
276 Ga0157374_10378805 3300013296 Bacteria 1409
277 Ga0157378_10046120 3300013297 Bacteria 3874
278 Ga0157378_10107682 3300013297 Bacteria 2551
279 Ga0157378_10153853 3300013297 Bacteria 2145
280 Ga0163162_10001589 3300013306 Bacteria 21243
281 Ga0163162_10037600 3300013306 Bacteria 4830
282 Ga0163162_10055019 3300013306 Bacteria 4005
283 Ga0163162_10215867 3300013306 Bacteria 2048
284 Ga0163162_11239320 3300013306 Bacteria 847
285 Ga0157372_10010066 3300013307 Bacteria 10052
286 Ga0157372_10519451 3300013307 Bacteria 1388
287 Ga0157372_10799439 3300013307 Bacteria 1096
288 Ga0157372_11410881 3300013307 Bacteria 803
289 Ga0157375_10001221 3300013308 Bacteria 22177
290 Ga0157375_10081196 3300013308 Bacteria 3282
291 Ga0157375_11307461 3300013308 Bacteria 853
292 Ga0163163_10001383 3300014325 Bacteria 20485
293 Ga0163163_10006926 3300014325 Bacteria 9955
294 Ga0163163_10406796 3300014325 Bacteria 1419
295 Ga0157380_10049239 3300014326 Bacteria 3322
296 Ga0157380_10307547 3300014326 Bacteria 1463
297 Ga0157380_10769736 3300014326 Bacteria 976
298 Ga0182008_10001860 3300014497 Bacteria 13719
299 Ga0182008_10015435 3300014497 Bacteria 3985
300 Ga0157377_10234961 3300014745 Bacteria 1181
301 Ga0157377_10509041 3300014745 Bacteria 843
302 Ga0157379_10015278 3300014968 Bacteria 6733
303 Ga0157379_10069552 3300014968 Bacteria 3149
304 Ga0157379_10533521 3300014968 Bacteria 1090
305 Ga0157376_10006392 3300014969 Bacteria 8324
306 Ga0157376_10268440 3300014969 Bacteria 1602
307 Ga0157376_10430607 3300014969 Bacteria 1282
308 Ga0157376_10477482 3300014969 Bacteria 1221
309 Ga0157376_10708376 3300014969 Bacteria 1012
310 Ga0182006_1000003 3300015261 Bacteria 826681
311 Ga0182006_1000049 3300015261 Bacteria 184514
312 Ga0182006_1000097 3300015261 Bacteria 102186
313 Ga0182007_10000095 3300015262 Bacteria 63829
314 Ga0182007_10002958 3300015262 Bacteria 8239
315 Ga0182007_10015404 3300015262 Bacteria 2853
316 Ga0182005_1000038 3300015265 Bacteria 160030
317 Ga0182005_1020469 3300015265 Bacteria 1820
318 Ga0182005_1020510 3300015265 Bacteria 1818
319 Ga0163161_10000004 3300017792 Bacteria 333149
320 Ga0163161_10062869 3300017792 Bacteria 2705
321 Ga0163161_10531271 3300017792 Bacteria 962
322 Ga0213872_10001170 3300021361 Bacteria 17827
323 Ga0213872_10021407 3300021361 Bacteria 2977
324 Ga0213872_10045192 3300021361 Bacteria 2004
325 Ga0213872_10083172 3300021361 Bacteria 1437
326 Ga0213871_10001458 3300021441 Bacteria 3980
327 Ga0209674_100598 3300025226 Bacteria 13799
328 Ga0209672_100007 3300025228 Bacteria 959482
329 Ga0209672_100095 3300025228 Bacteria 113474
330 Ga0209672_101868 3300025228 Bacteria 6230
331 Ga0209563_100131 3300025230 Bacteria 97465
332 Ga0207427_100021 3300025231 Bacteria 494115
333 Ga0207427_100105 3300025231 Bacteria 118241
334 Ga0207427_100107 3300025231 Bacteria 116422
335 Ga0209437_100039 3300025233 Bacteria 448321
336 Ga0209437_100087 3300025233 Bacteria 253432
337 Ga0209437_100129 3300025233 Bacteria 184661
338 Ga0209258_100017 3300025242 Bacteria 590785
339 Ga0209258_100206 3300025242 Bacteria 119449
340 Ga0209258_100272 3300025242 Bacteria 88382
341 Ga0209646_1000246 3300025246 Bacteria 55219
342 Ga0209646_1000485 3300025246 Bacteria 19518
343 Ga0209026_1000051 3300025250 Bacteria 250792
344 Ga0209026_1000878 3300025250 Bacteria 15653
345 Ga0209148_1000044 3300025254 Bacteria 458417
346 Ga0209148_1000176 3300025254 Bacteria 128357
347 Ga0209148_1000185 3300025254 Bacteria 118117
348 Ga0209759_1000145 3300025256 Bacteria 121772
349 Ga0209233_1000023 3300025261 Bacteria 738870
350 Ga0209233_1000224 3300025261 Bacteria 103605
351 Ga0209233_1000447 3300025261 Bacteria 27425
352 Ga0209565_1000017 3300025263 Bacteria 462438
353 Ga0207666_1007773 3300025271 Bacteria 1420
354 Ga0209455_1000010 3300025272 Bacteria 959482
355 Ga0209455_1000081 3300025272 Bacteria 263674
356 Ga0209673_1000007 3300025273 Bacteria 634477
357 Ga0209675_1000009 3300025291 Bacteria 562872
358 Ga0209675_1000077 3300025291 Bacteria 156212
359 Ga0209564_1000055 3300025295 Bacteria 343782
360 Ga0209564_1000230 3300025295 Bacteria 123814
361 Ga0209256_1000559 3300025299 Bacteria 53325
362 Ga0207426_1026348 3300025302 Bacteria 1948
363 Ga0209051_1003306 3300025303 Bacteria 10681
364 Ga0207697_10014064 3300025315 Bacteria 3331
365 Ga0207697_10021800 3300025315 Bacteria 2624
366 Ga0207696_1000033 3300025711 Bacteria 360689
367 Ga0207655_1000011 3300025728 Bacteria 643321
368 Ga0207655_1000013 3300025728 Bacteria 637510
369 Ga0207713_1000065 3300025735 Bacteria 196128
370 Ga0207713_1000108 3300025735 Bacteria 137268
371 Ga0207713_1001983 3300025735 Bacteria 15397
372 Ga0207653_10000011 3300025885 Bacteria 160949
373 Ga0207682_10002230 3300025893 Bacteria 8744
374 Ga0207642_10022924 3300025899 Bacteria 2485
375 Ga0207710_10000016 3300025900 Bacteria 388568
376 Ga0207710_10044398 3300025900 Bacteria 1979
377 Ga0207710_10172342 3300025900 Bacteria 1058
378 Ga0207688_10005672 3300025901 Bacteria 6788
379 Ga0207680_10001266 3300025903 Bacteria 11962
380 Ga0207680_10023747 3300025903 Bacteria 3353
381 Ga0207680_10052911 3300025903 Bacteria 2435
382 Ga0207699_10442958 3300025906 Bacteria 931
383 Ga0207645_10010412 3300025907 Bacteria 6381
384 Ga0207645_10199600 3300025907 Bacteria 1316
385 Ga0207645_10311642 3300025907 Bacteria 1049
386 Ga0207643_10085564 3300025908 Bacteria 1831
387 Ga0207643_10108622 3300025908 Bacteria 1632
388 Ga0207643_10158000 3300025908 Bacteria 1363
389 Ga0207705_10002381 3300025909 Bacteria 14531
390 Ga0207684_10113737 3300025910 Bacteria 2317
391 Ga0207654_10000006 3300025911 Bacteria 815027
392 Ga0207707_10185830 3300025912 Bacteria 1814
393 Ga0207695_10006958 3300025913 Bacteria 14520
394 Ga0207695_10014188 3300025913 Bacteria 9453
395 Ga0207695_10020911 3300025913 Bacteria 7479
396 Ga0207695_10069147 3300025913 Bacteria 3615
397 Ga0207695_10109815 3300025913 Bacteria 2739
398 Ga0207695_10283680 3300025913 Bacteria 1549
399 Ga0207671_10021594 3300025914 Bacteria 4879
400 Ga0207671_10073666 3300025914 Bacteria 2551
401 Ga0207671_10167782 3300025914 Bacteria 1703
402 Ga0207693_10024754 3300025915 Bacteria 4760
403 Ga0207693_10053702 3300025915 Bacteria 3161
404 Ga0207663_10084177 3300025916 Bacteria 2091
405 Ga0207663_10226086 3300025916 Bacteria 1364
406 Ga0207660_10083820 3300025917 Bacteria 2348
407 Ga0207662_10021647 3300025918 Bacteria 3679
408 Ga0207657_10053741 3300025919 Bacteria 3488
409 Ga0207649_10084596 3300025920 Bacteria 2062
410 Ga0207649_10180123 3300025920 Bacteria 1478
411 Ga0207652_10250881 3300025921 Bacteria 1596
412 Ga0207652_10309266 3300025921 Bacteria 1426
413 Ga0207646_10042178 3300025922 Bacteria 4100
414 Ga0207646_10670195 3300025922 Bacteria 928
415 Ga0207681_10133978 3300025923 Bacteria 1835
416 Ga0207681_10355577 3300025923 Bacteria 1173
417 Ga0207694_10539477 3300025924 Bacteria 978
418 Ga0207650_10008966 3300025925 Bacteria 6838
419 Ga0207650_10066083 3300025925 Bacteria 2711
420 Ga0207650_10277875 3300025925 Bacteria 1363
421 Ga0207659_10000588 3300025926 Bacteria 21759
422 Ga0207659_10029176 3300025926 Bacteria 3757
423 Ga0207700_10051406 3300025928 Bacteria 3075
424 Ga0207700_10272437 3300025928 Bacteria 1453
425 Ga0207664_10069324 3300025929 Bacteria 2835
426 Ga0207664_10164548 3300025929 Bacteria 1894
427 Ga0207644_10002078 3300025931 Bacteria 12952
428 Ga0207644_10004826 3300025931 Bacteria 8780
429 Ga0207644_10032885 3300025931 Bacteria 3621
430 Ga0207644_10102077 3300025931 Bacteria 2156
431 Ga0207644_10421341 3300025931 Bacteria 1094
432 Ga0207690_10022251 3300025932 Bacteria 3941
433 Ga0207690_10273457 3300025932 Bacteria 1313
434 Ga0207690_10648375 3300025932 Bacteria 865
435 Ga0207706_10002872 3300025933 Bacteria 16701
436 Ga0207706_10082095 3300025933 Bacteria 2833
437 Ga0207706_10305056 3300025933 Bacteria 1387
438 Ga0207686_10000007 3300025934 Bacteria 249199
439 Ga0207686_10040916 3300025934 Bacteria 2822
440 Ga0207686_10093174 3300025934 Bacteria 1994
441 Ga0207709_10000101 3300025935 Bacteria 133425
442 Ga0207709_10000161 3300025935 Bacteria 91314
443 Ga0207709_10237979 3300025935 Bacteria 1323
444 Ga0207670_10014040 3300025936 Bacteria 4742
445 Ga0207670_10031541 3300025936 Bacteria 3398
446 Ga0207670_10225360 3300025936 Bacteria 1437
447 Ga0207670_10234084 3300025936 Bacteria 1412
448 Ga0207669_10174886 3300025937 Bacteria 1532
449 Ga0207704_10024325 3300025938 Bacteria 3282
450 Ga0207704_10039218 3300025938 Bacteria 2756
451 Ga0207704_10157544 3300025938 Bacteria 1611
452 Ga0207665_10160044 3300025939 Bacteria 1619
453 Ga0207691_10036906 3300025940 Bacteria 4527
454 Ga0207691_10081108 3300025940 Bacteria 2917
455 Ga0207691_10159650 3300025940 Bacteria 1979
456 Ga0207711_10005419 3300025941 Bacteria 10791
457 Ga0207711_10029539 3300025941 Bacteria 4625
458 Ga0207711_10064678 3300025941 Bacteria 3160
459 Ga0207711_10080900 3300025941 Bacteria 2838
460 Ga0207689_10024667 3300025942 Bacteria 5042
461 Ga0207689_10104860 3300025942 Bacteria 2323
462 Ga0207689_10323356 3300025942 Bacteria 1280
463 Ga0207661_10001327 3300025944 Bacteria 16569
464 Ga0207661_10151832 3300025944 Bacteria 2003
465 Ga0207679_10100194 3300025945 Bacteria 2264
466 Ga0207679_10178036 3300025945 Bacteria 1757
467 Ga0207679_10293684 3300025945 Bacteria 1398
468 Ga0207667_10001671 3300025949 Bacteria 27944
469 Ga0207667_10002349 3300025949 Bacteria 23706
470 Ga0207667_10008952 3300025949 Bacteria 11839
471 Ga0207667_10169277 3300025949 Bacteria 2245
472 Ga0207667_10571675 3300025949 Bacteria 1142
473 Ga0207651_10000179 3300025960 Bacteria 27573
474 Ga0207651_10016407 3300025960 Bacteria 4337
475 Ga0207651_10548597 3300025960 Bacteria 1005
476 Ga0207712_10008695 3300025961 Bacteria 6422
477 Ga0207712_10081944 3300025961 Bacteria 2351
478 Ga0207712_10521389 3300025961 Bacteria 1018
479 Ga0207712_10535290 3300025961 Bacteria 1006
480 Ga0207668_10066865 3300025972 Bacteria 2549
481 Ga0207658_10001572 3300025986 Bacteria 17671
482 Ga0207677_10004081 3300026023 Bacteria 7807
483 Ga0207677_10082448 3300026023 Bacteria 2311
484 Ga0207703_10005653 3300026035 Bacteria 10039
485 Ga0207703_10017041 3300026035 Bacteria 5665
486 Ga0207703_10120128 3300026035 Bacteria 2255
487 Ga0207703_10182196 3300026035 Bacteria 1854
488 Ga0207703_10385639 3300026035 Bacteria 1297
489 Ga0207639_10022786 3300026041 Bacteria 4515
490 Ga0207639_10027657 3300026041 Bacteria 4134
491 Ga0207639_10034078 3300026041 Bacteria 3761
492 Ga0207639_10233772 3300026041 Bacteria 1595
493 Ga0207708_10019637 3300026075 Bacteria 5096
494 Ga0207708_10095035 3300026075 Bacteria 2302
495 Ga0207708_10370931 3300026075 Bacteria 1178
496 Ga0207641_10009505 3300026088 Bacteria 8016
497 Ga0207641_10010646 3300026088 Bacteria 7547
498 Ga0207641_10126045 3300026088 Bacteria 2292
499 Ga0207641_10181212 3300026088 Bacteria 1929
500 Ga0207641_10592141 3300026088 Bacteria 1085
501 Ga0207641_10927352 3300026088 Bacteria 865
502 Ga0207648_10007551 3300026089 Bacteria 10670
503 Ga0207648_10009747 3300026089 Bacteria 9180
504 Ga0207648_10468805 3300026089 Bacteria 1149
505 Ga0207648_10484125 3300026089 Bacteria 1130
506 Ga0207676_10002099 3300026095 Bacteria 14425
507 Ga0207676_10067892 3300026095 Bacteria 2849
508 Ga0207676_10100058 3300026095 Unclassified 2401
509 Ga0207676_10303498 3300026095 Bacteria 1458
510 Ga0207674_10088512 3300026116 Bacteria 3090
511 Ga0207674_10151829 3300026116 Bacteria 2273
512 Ga0207674_10277185 3300026116 Bacteria 1625
513 Ga0207674_10344350 3300026116 Bacteria 1441
514 Ga0207674_10701524 3300026116 Bacteria 977
515 Ga0207675_100039681 3300026118 Bacteria 4394
516 Ga0207675_100099700 3300026118 Bacteria 2736
517 Ga0207675_100227299 3300026118 Bacteria 1799
518 Ga0207675_100240210 3300026118 Bacteria 1750
519 Ga0207675_101002749 3300026118 Bacteria 853
520 Ga0207683_10001598 3300026121 Bacteria 20368
521 Ga0207683_10146798 3300026121 Bacteria 2127
522 Ga0207683_10184790 3300026121 Bacteria 1891
523 Ga0207683_10364682 3300026121 Bacteria 1327
524 Ga0207683_10407446 3300026121 Bacteria 1251
525 Ga0207698_10067524 3300026142 Bacteria 2820
526 Ga0207698_10132170 3300026142 Bacteria 2135
527 Ga0209281_1000008 3300027111 Bacteria 867470
528 Ga0209281_1004171 3300027111 Bacteria 4411
529 Ga0209371_1002176 3300027312 Bacteria 11460
530 Ga0209588_1073225 3300027671 Bacteria 1107
531 Ga0207428_10038931 3300027907 Bacteria 3862
532 Ga0265356_1000177 3300028017 Bacteria 11904
533 Ga0268266_10000420 3300028379 Bacteria 64525
534 Ga0268266_10024463 3300028379 Bacteria 5135
535 Ga0268266_10033124 3300028379 Bacteria 4393
536 Ga0268266_10065765 3300028379 Bacteria 3134
537 Ga0268266_10072942 3300028379 Bacteria 2978
538 Ga0268266_10093764 3300028379 Bacteria 2634
539 Ga0268266_10096267 3300028379 Bacteria 2601
540 Ga0268266_10231525 3300028379 Bacteria 1702
541 Ga0268266_10413924 3300028379 Bacteria 1276
542 Ga0268266_10579678 3300028379 Bacteria 1076
543 Ga0268266_10821167 3300028379 Bacteria 898
544 Ga0268265_10036989 3300028380 Bacteria 3579
545 Ga0268265_10126671 3300028380 Bacteria 2114
546 Ga0268264_10054629 3300028381 Bacteria 3336
547 Ga0268264_10061722 3300028381 Bacteria 3145
548 Ga0268264_10369170 3300028381 Bacteria 1371
549 Ga0265326_10051178 3300028558 Bacteria 1170
550 Ga0265318_10071790 3300028577 Bacteria 1283
551 Ga0265338_10092476 3300028800 Bacteria 2494
552 Ga0268256_1001097 3300030500 Bacteria 17670
553 Ga0265760_10002206 3300031090 Bacteria 5694
554 Ga0265332_10065200 3300031238 Bacteria 1555
555 Ga0265328_10116024 3300031239 Bacteria 997
556 Ga0265325_10000127 3300031241 Bacteria 52109
557 Ga0265339_10000827 3300031249 Bacteria 23830
558 Ga0265339_10067611 3300031249 Bacteria 1911
559 Ga0265331_10029577 3300031250 Bacteria 2732
560 Ga0265331_10060128 3300031250 Bacteria 1795
561 Ga0265331_10249713 3300031250 Bacteria 796
562 Ga0265327_10158451 3300031251 Bacteria 1047
563 Ga0265316_10018261 3300031344 Bacteria 6032
564 Ga0265316_10052944 3300031344 Bacteria 3182
565 Ga0265316_10093487 3300031344 Bacteria 2291
566 Ga0307513_10103235 3300031456 Bacteria 2868
567 Ga0265313_10000907 3300031595 Bacteria 29634
568 Ga0265313_10147932 3300031595 Bacteria 1006
569 Ga0307514_10001950 3300031649 Bacteria 22540
570 Ga0265314_10008385 3300031711 Bacteria 8856
571 Ga0316576_10203972 3300031727 Bacteria 1489
572 Ga0316578_10087120 3300031728 Bacteria 1862
573 Ga0316577_10079932 3300031733 Bacteria 1827
574 Ga0307406_10210179 3300031901 Bacteria 1439
575 Ga0307412_10000096 3300031911 Bacteria 74069
576 Ga0307412_10001339 3300031911 Bacteria 13744
577 Ga0307409_100270971 3300031995 Bacteria 1563
578 Ga0307416_100000017 3300032002 Bacteria 201722
579 Ga0307414_10010449 3300032004 Bacteria 5386
580 Ga0307411_10612860 3300032005 Bacteria 937
581 Ga0307415_100615369 3300032126 Bacteria 969
582 Ga0307415_100847747 3300032126 Bacteria 838
583 Ga0307415_100977160 3300032126 Bacteria 785
584 Ga0316585_10051322 3300032137 Bacteria 1325
585 Ga0307510_10377122 3300033180 Bacteria 864
586 Ga0373959_0025113 3300034820 Bacteria 1169
587 Ga0373926_0219815 3300035083 Bacteria 733
588 Ga0373934_0000391 3300035086 Bacteria 15305
589 Ga0373934_0012247 3300035086 Bacteria 3238
590 Ga0373934_0086340 3300035086 Bacteria 1263
591 Ga0373923_0003108 3300035111 Bacteria 5265
592 Ga0373923_0225851 3300035111 Bacteria 871
593 Ga0373936_0004500 3300035113 Bacteria 5275
594 Ga0373936_0057196 3300035113 Bacteria 1586
595 Ga0373945_0019882 3300035116 Bacteria 2295
596 Ga0373953_0003575 3300035117 Bacteria 4863
597 Ga0373953_0029245 3300035117 Bacteria 2130
598 Ga0373954_0003733 3300035118 Bacteria 6490
599 Ga0373954_0031178 3300035118 Bacteria 2460
600 Ga0373954_0035743 3300035118 Bacteria 2305
601 Ga0373954_0071008 3300035118 Bacteria 1655
602 Ga0373954_0187956 3300035118 Bacteria 1014
603 Ga0373943_0033981 3300035170 Bacteria 2432
604 Ga0373946_0023130 3300035171 Bacteria 2426
605 Ga0373946_0146142 3300035171 Bacteria 1100
606 Ga0373955_0001902 3300035172 Bacteria 9009
607 Ga0373955_0021943 3300035172 Bacteria 3230
608 Ga0373955_0108442 3300035172 Bacteria 1603
609 Ga0373961_0082419 3300035241 Bacteria 1014
610 Ga0373924_0002259 3300035410 Bacteria 6465
611 Ga0373924_0170859 3300035410 Bacteria 955
612 Ga0373931_0014564 3300035691 Bacteria 3846
613 Ga0373935_0008762 3300035692 Bacteria 6061
614 Ga0373935_0107250 3300035692 Bacteria 1849
615 Ga0373927_0002239 3300035695 Bacteria 14208
616 Ga0373927_0007084 3300035695 Bacteria 7605
617 Ga0373933_0010447 3300035724 Bacteria 5090
618 Ga0373933_0044563 3300035724 Bacteria 2628
619 Ga0373933_0177682 3300035724 Bacteria 1357
620 Ga0373933_0210819 3300035724 Bacteria 1245
621 Ga0373947_0374787 3300035725 Bacteria 957
622 Ga0373937_0001034 3300036401 Bacteria 23525
623 Ga0373937_0008262 3300036401 Bacteria 9037
624 Ga0373937_0032473 3300036401 Bacteria 4735
625 Ga0373937_0107999 3300036401 Bacteria 2587
626 Ga0373937_0211881 3300036401 Bacteria 1823
627 Ga0316584_0315286 3300036712 Bacteria 1129
628 Ga0373925_0000715 3300037068 Bacteria 30997
629 Ga0373925_0025553 3300037068 Bacteria 4316
630 Ga0373925_0090209 3300037068 Bacteria 2343
631 Ga0373925_0299408 3300037068 Bacteria 1298
632 Ga0373925_0304909 3300037068 Bacteria 1286
633 Ga0395899_0019318 3300037312 Bacteria 5177
634 Ga0395899_0042250 3300037312 Bacteria 3404
635 Ga0395898_0001110 3300037466 Bacteria 41435
636 Ga0395905_0417365 3300037471 Bacteria 1238
637 Ga0436364_0089220 3300037853 Bacteria 9810
638 Ga0436365_0001623 3300039437 Bacteria 1711
639 Ga0436360_0137000 3300039438 Bacteria 4047
640 Ga0436360_0386428 3300039438 Bacteria 2037
641 Ga0436360_0469655 3300039438 Bacteria 3935
642 Ga0436360_0708149 3300039438 Bacteria 1590
643 Ga0436360_0824430 3300039438 Bacteria 2369
644 Ga0436360_1098059 3300039438 Bacteria 2114
645 Ga0436361_0041018 3300039447 Bacteria 1992
646 Ga0436361_0133351 3300039447 Bacteria 1570
647 Ga0436361_0191634 3300039447 Bacteria 3050
648 Ga0436361_0282869 3300039447 Bacteria 2878
649 Ga0436361_0300897 3300039447 Bacteria 77372
650 Ga0436361_0508014 3300039447 Bacteria 3250
651 Ga0436361_0785765 3300039447 Bacteria 815
652 Ga0436361_1030428 3300039447 Bacteria 2354
653 Ga0436363_0387766 3300039450 Bacteria 1390
654 Ga0436363_0588950 3300039450 Bacteria 1024
655 Ga0436363_1671843 3300039450 Bacteria 1027
656 Ga0439438_002259 3300041405 Bacteria 8262
657 Ga0439447_001305 3300041407 Bacteria 9066
658 Ga0439466_0083079 3300041411 Bacteria 1009
659 Ga0439445_0000288 3300042004 Bacteria 9789
660 Ga0439432_023496 3300042006 Bacteria 2031
661 Ga0439432_036474 3300042006 Bacteria 1573
662 Ga0451577_0000101 3300042876 Bacteria 190854
663 Ga0451577_0208072 3300042876 Bacteria 1767
664 Ga0466969_0009932 3300044656 Bacteria 5045
665 Ga0466969_0090988 3300044656 Bacteria 1446
666 Ga0466972_0123062 3300044658 Bacteria 1223
667 Ga0466989_0074246 3300044663 Bacteria 2093
668 Ga0466965_0017505 3300044683 Bacteria 3426
669 Ga0466965_0084935 3300044683 Bacteria 1604
670 Ga0466966_0007469 3300044684 Bacteria 7247
671 Ga0466961_0000412 3300044693 Bacteria 27244
672 Ga0466961_0001299 3300044693 Bacteria 15419
673 Ga0466961_0001373 3300044693 Bacteria 15036
674 Ga0466961_0022862 3300044693 Bacteria 4021
675 Ga0466963_0051014 3300044694 Bacteria 2741
676 Ga0466963_0238926 3300044694 Bacteria 1274
677 Ga0466964_0111020 3300044706 Bacteria 1223
678 Ga0453684_0000679 3300044712 Bacteria 121950
679 Ga0453684_0070521 3300044712 Bacteria 4425
680 Ga0453684_0361100 3300044712 Bacteria 1635
681 Ga0466971_0019617 3300044719 Bacteria 3004
682 Ga0466971_0027166 3300044719 Bacteria 2562
683 Ga0466968_0180669 3300044735 Bacteria 981
684 Ga0466957_0006003 3300044842 Bacteria 6849
685 Ga0466957_0404160 3300044842 Bacteria 934
686 Ga0466959_0029127 3300045049 Bacteria 4091
687 Ga0451576_0000260 3300045051 Bacteria 129222
688 Ga0466958_0063430 3300045836 Bacteria 2253
689 Ga0466958_0070861 3300045836 Bacteria 2134
690 Ga0466958_0190423 3300045836 Bacteria 1304
691 Ga0466967_0161576 3300045976 Bacteria 2103
692 Ga0466967_0324205 3300045976 Bacteria 1486
693 Ga0466967_0625270 3300045976 Bacteria 1064
694 Ga0495617_000304 3300046452 Bacteria 27738
695 Ga0495627_000141 3300046453 Bacteria 85993
696 Ga0495627_004584 3300046453 Bacteria 5743
697 Ga0495592_0004704 3300046454 Bacteria 10015
698 Ga0495592_0020234 3300046454 Bacteria 5063
699 Ga0495592_0062411 3300046454 Bacteria 2736
700 Ga0495590_0000020 3300046457 Bacteria 212352
701 Ga0495591_001616 3300046458 Bacteria 13611
702 Ga0495638_0000328 3300046460 Bacteria 60200
703 Ga0495638_0000493 3300046460 Bacteria 47046
704 Ga0495638_0000543 3300046460 Bacteria 43505
705 Ga0495638_0104420 3300046460 Bacteria 1690
706 Ga0495641_0001105 3300046461 Bacteria 23196
707 Ga0495651_0009753 3300046462 Bacteria 7385
708 Ga0495653_0017178 3300046463 Bacteria 5884
709 Ga0495653_0196397 3300046463 Bacteria 1373
710 Ga0495650_0001929 3300046471 Bacteria 18373
711 Ga0495650_0003366 3300046471 Bacteria 11722
712 Ga0495580_0021288 3300046472 Bacteria 4785
713 Ga0495580_0128834 3300046472 Bacteria 1756
714 Ga0495580_0244249 3300046472 Bacteria 1230
715 Ga0495582_0089280 3300046473 Bacteria 1717
716 Ga0495582_0094989 3300046473 Bacteria 1665
717 Ga0495582_0314016 3300046473 Bacteria 902
718 Ga0495605_0000394 3300046474 Bacteria 40242
719 Ga0495605_0025478 3300046474 Bacteria 3081
720 Ga0495639_0003744 3300046475 Bacteria 6541
721 Ga0495639_0008665 3300046475 Bacteria 4360
722 Ga0495662_0016160 3300046476 Bacteria 3619
723 Ga0495664_0003219 3300046477 Bacteria 8860
724 Ga0495664_0009587 3300046477 Bacteria 5419
725 Ga0495584_0003609 3300046491 Bacteria 8444
726 Ga0495585_0000001 3300046492 Bacteria 609804
727 Ga0495594_0009332 3300046499 Bacteria 5068
728 Ga0495596_0006258 3300046500 Bacteria 5508
729 Ga0495607_0000967 3300046501 Bacteria 26576
730 Ga0495607_0004270 3300046501 Bacteria 10576
731 Ga0495607_0006847 3300046501 Bacteria 7953
732 Ga0495607_0217499 3300046501 Bacteria 936
733 Ga0495583_0000310 3300046506 Bacteria 77200
734 Ga0495583_0000626 3300046506 Bacteria 47506
735 Ga0495583_0084943 3300046506 Bacteria 1370
736 Ga0495606_0000326 3300046507 Bacteria 82103
737 Ga0495606_0000660 3300046507 Bacteria 54210
738 Ga0495606_0001121 3300046507 Bacteria 38297
739 Ga0495608_0011280 3300046511 Bacteria 6222
740 Ga0495608_0023435 3300046511 Bacteria 4230
741 Ga0495610_0000006 3300046512 Bacteria 856822
742 Ga0495616_0014232 3300046513 Bacteria 4461
743 Ga0495628_0006322 3300046516 Bacteria 10348
744 Ga0495628_0052427 3300046516 Bacteria 3222
745 Ga0495628_0218511 3300046516 Bacteria 1432
746 Ga0495628_0579662 3300046516 Bacteria 803
747 Ga0495630_0001974 3300046517 Bacteria 14279
748 Ga0495631_0000078 3300046518 Bacteria 63148
749 Ga0495632_0000601 3300046519 Bacteria 33346
750 Ga0495643_0000519 3300046522 Bacteria 48062
751 Ga0495644_0000799 3300046523 Bacteria 12983
752 Ga0495644_0002833 3300046523 Bacteria 6874
753 Ga0495648_0000206 3300046524 Bacteria 68670
754 Ga0495648_0000990 3300046524 Bacteria 29242
755 Ga0495648_0003241 3300046524 Bacteria 14432
756 Ga0495648_0023475 3300046524 Bacteria 4222
757 Ga0495666_0006403 3300046526 Bacteria 5931
758 Ga0495642_0013982 3300046528 Bacteria 3109
759 Ga0495652_0037267 3300046529 Bacteria 4219
760 Ga0495652_0202263 3300046529 Bacteria 1506
761 Ga0495652_0347124 3300046529 Bacteria 1064
762 Ga0495654_0000006 3300046530 Bacteria 451432
763 Ga0495654_0000353 3300046530 Bacteria 39769
764 Ga0495654_0002624 3300046530 Bacteria 11452
765 Ga0495654_0018562 3300046530 Bacteria 3643
766 Ga0495640_0006143 3300046533 Bacteria 9520
767 Ga0495586_0005085 3300046535 Bacteria 7039
768 Ga0495587_0015431 3300046536 Bacteria 4770
769 Ga0495587_0024960 3300046536 Bacteria 3658
770 Ga0495587_0027599 3300046536 Bacteria 3457
771 Ga0495587_0045421 3300046536 Bacteria 2611
772 Ga0495587_0322659 3300046536 Bacteria 862
773 Ga0495609_0005147 3300046538 Bacteria 6965
774 Ga0495609_0010929 3300046538 Bacteria 4337
775 Ga0495609_0107445 3300046538 Bacteria 1206
776 Ga0495621_0006587 3300046539 Bacteria 3399
777 Ga0495621_0104197 3300046539 Bacteria 1082
778 Ga0495597_0000262 3300046542 Bacteria 48054
779 Ga0495645_0000483 3300046543 Bacteria 27603
780 Ga0495645_0027047 3300046543 Bacteria 4166
781 Ga0495645_0334436 3300046543 Bacteria 980
782 Ga0495622_0000077 3300046557 Bacteria 86561
783 Ga0495622_0113110 3300046557 Bacteria 1242
784 Ga0495633_0000149 3300046558 Bacteria 92890
785 Ga0495633_0002549 3300046558 Bacteria 12789
786 Ga0495633_0007833 3300046558 Bacteria 6097
787 Ga0495667_0005516 3300046559 Bacteria 8551
788 Ga0495667_0014488 3300046559 Bacteria 5327
789 Ga0495667_0015374 3300046559 Bacteria 5171
790 Ga0495668_0000888 3300046616 Bacteria 33684
791 Ga0495668_0034425 3300046616 Bacteria 2841
792 Ga0495634_0008248 3300046642 Bacteria 7769
793 Ga0495611_0000001 3300046648 Bacteria 2628469
794 Ga0495625_0000001 3300046660 Bacteria 1641829
795 Ga0495625_0000199 3300046660 Bacteria 95454
796 Ga0495625_0001048 3300046660 Bacteria 36295
797 Ga0495625_0062950 3300046660 Bacteria 2620
798 Ga0495635_0312077 3300046663 Bacteria 1053
799 Ga0495659_0002117 3300046664 Bacteria 6475
800 Ga0495661_0000104 3300046665 Bacteria 101211
801 Ga0495661_0043077 3300046665 Bacteria 2777
802 Ga0495588_0048265 3300046674 Bacteria 2187
803 Ga0495657_0003049 3300046675 Bacteria 13865
804 Ga0495657_0017206 3300046675 Bacteria 5253
805 Ga0495599_0001707 3300046678 Bacteria 12704
806 Ga0495599_0001790 3300046678 Bacteria 12465
807 Ga0495646_0026014 3300046680 Bacteria 3675
808 Ga0495647_0001510 3300046681 Bacteria 7201
809 Ga0495658_0335019 3300046683 Bacteria 960
810 Ga0495658_0466913 3300046683 Bacteria 807
811 Ga0495669_0125883 3300046684 Bacteria 1204
812 Ga0495613_0180728 3300046689 Bacteria 1494
813 Ga0495624_0023178 3300046690 Bacteria 4095
814 Ga0495670_0176018 3300046691 Bacteria 1128
815 Ga0495671_0000175 3300046692 Bacteria 57098
816 Ga0495671_0001021 3300046692 Bacteria 19478
817 Ga0495671_0004751 3300046692 Bacteria 8026
818 Ga0495589_0000006 3300046794 Bacteria 303635
819 Ga0495589_0000999 3300046794 Bacteria 17183
820 Ga0495600_0002178 3300046809 Bacteria 11118
821 Ga0495600_0070414 3300046809 Bacteria 2285
822 Ga0495660_0000008 3300046810 Bacteria 435769
823 Ga0495660_0000009 3300046810 Bacteria 427395
824 Ga0495660_0000019 3300046810 Bacteria 311047
825 Ga0495660_0109464 3300046810 Bacteria 1411
826 Ga0495660_0186080 3300046810 Bacteria 1001
827 Ga0495581_0146557 3300047315 Bacteria 1378
828 Ga0495604_0010199 3300047317 Bacteria 7442
829 Ga0495604_0012321 3300047317 Bacteria 6797
830 Ga0495636_0001345 3300047318 Bacteria 9340
831 Ga0495674_0000463 3300047319 Bacteria 36736
832 Ga0495674_0052188 3300047319 Bacteria 3600
833 Ga0495674_0354855 3300047319 Bacteria 1190
834 Ga0495672_0000003 3300047320 Bacteria 728845
835 Ga0495672_0001917 3300047320 Bacteria 19721
836 Ga0495680_0016578 3300047322 Bacteria 6324
837 Ga0495680_0082993 3300047322 Bacteria 2417
838 Ga0495680_0102926 3300047322 Bacteria 2126
839 Ga0495683_0000472 3300047323 Bacteria 31230
840 Ga0495687_000370 3300047443 Bacteria 56035
841 Ga0495675_0035274 3300047444 Bacteria 3195
842 Ga0495677_0009318 3300047445 Bacteria 3627
843 Ga0495679_000001 3300047446 Bacteria 1607568
844 Ga0495679_057429 3300047446 Bacteria 1151
845 Ga0495685_000091 3300047447 Bacteria 32792
846 Ga0495673_0000001 3300047469 Bacteria 1630730
847 Ga0495673_0000011 3300047469 Bacteria 674140
848 Ga0495673_0000089 3300047469 Bacteria 188744
849 Ga0495673_0004212 3300047469 Bacteria 9073
850 Ga0495684_0001586 3300047471 Bacteria 18214
851 Ga0495684_0047674 3300047471 Bacteria 3277
852 Ga0495686_0003986 3300047472 Bacteria 12361
853 Ga0495686_0124293 3300047472 Bacteria 1535
854 Ga0495602_0000196 3300048088 Bacteria 57045
855 Ga0496100_0021624 3300048903 Bacteria 3879
856 Ga0496101_0436596 3300048904 Bacteria 1033
857 Ga0496102_0778275 3300048905 Bacteria 879
858 Ga0496104_0004551 3300048907 Bacteria 12082
859 Ga0496105_0007863 3300048908 Bacteria 8277
860 Ga0496105_0477587 3300048908 Bacteria 981
861 Ga0496106_0186734 3300048909 Bacteria 1647
862 Ga0496106_0389667 3300048909 Bacteria 1120
863 Ga0496107_0158962 3300048910 Bacteria 1674
864 Ga0496108_0030955 3300048911 Bacteria 4435
865 Ga0496108_0081698 3300048911 Bacteria 2739
866 Ga0496109_0135358 3300048912 Bacteria 2302
867 Ga0496109_0251756 3300048912 Bacteria 1663
868 Ga0496111_0218620 3300048914 Bacteria 1415
869 Ga0496114_0129947 3300048917 Bacteria 2174
870 Ga0496115_0014454 3300048918 Bacteria 5975
871 Ga0496116_0000006 3300048919 Bacteria 811937
872 Ga0496116_0000031 3300048919 Bacteria 420043
873 Ga0496116_0066661 3300048919 Bacteria 2303
874 Ga0496117_0000027 3300048920 Bacteria 412234
875 Ga0496117_0000132 3300048920 Bacteria 162117
876 Ga0496117_0019969 3300048920 Bacteria 5480
877 Ga0496118_0000099 3300048921 Bacteria 160412
878 Ga0496118_0000141 3300048921 Bacteria 126552
879 Ga0496118_0085794 3300048921 Bacteria 2190
880 Ga0496119_0000006 3300048922 Bacteria 505999
881 Ga0496119_0000258 3300048922 Bacteria 75132
882 Ga0496119_0000280 3300048922 Bacteria 71494
883 Ga0496119_0014218 3300048922 Bacteria 6252
884 Ga0496119_0115941 3300048922 Bacteria 1479
885 Ga0496120_0000228 3300048923 Bacteria 96403
886 Ga0496120_0000255 3300048923 Bacteria 89200
887 Ga0496120_0040527 3300048923 Bacteria 2736
888 Ga0496120_0083671 3300048923 Bacteria 1722
889 Ga0496121_0000368 3300048924 Bacteria 92730
890 Ga0496121_0032337 3300048924 Bacteria 4757
891 Ga0496122_0000229 3300048925 Bacteria 125600
892 Ga0496122_0000397 3300048925 Bacteria 92511
893 Ga0496122_0001702 3300048925 Bacteria 34087
894 Ga0496122_0002499 3300048925 Bacteria 25974
895 Ga0496122_0004429 3300048925 Bacteria 17454
896 Ga0496122_0023172 3300048925 Bacteria 5485
897 Ga0496122_0074132 3300048925 Bacteria 2409
898 Ga0496123_0003689 3300048926 Bacteria 16868
899 Ga0496123_0005655 3300048926 Bacteria 12483
900 Ga0496123_0021618 3300048926 Bacteria 4995
901 Ga0496123_0023894 3300048926 Bacteria 4666
902 Ga0496124_0000122 3300048927 Bacteria 161741
903 Ga0496124_0005070 3300048927 Bacteria 15021
904 Ga0496124_0186194 3300048927 Bacteria 1593
905 Ga0496125_0001071 3300048928 Bacteria 42210
906 Ga0496125_0003176 3300048928 Bacteria 20363
907 Ga0496125_0054020 3300048928 Bacteria 3287
908 Ga0496126_0001395 3300048929 Bacteria 38244
909 Ga0496126_0016309 3300048929 Bacteria 7433
910 Ga0496126_0067076 3300048929 Bacteria 3207
911 Ga0496126_0105264 3300048929 Bacteria 2464
912 Ga0496126_0110835 3300048929 Bacteria 2390
913 Ga0496126_0138838 3300048929 Bacteria 2094
914 Ga0496126_0152582 3300048929 Bacteria 1979
915 Ga0496126_0281066 3300048929 Bacteria 1379
916 Ga0496126_0641876 3300048929 Bacteria 832
917 Ga0495678_000023 3300049459 Bacteria 233463
918 Ga0495678_016990 3300049459 Bacteria 3309
919 Ga0495682_0000106 3300049460 Bacteria 74069
920 Ga0495682_0000836 3300049460 Bacteria 19308
921 Ga0495682_0001080 3300049460 Bacteria 16037
922 Ga0495682_0003245 3300049460 Bacteria 7292
923 Ga0501031_0300797 3300049568 Bacteria 1040
924 Ga0501033_0052608 3300049570 Bacteria 3018
925 Ga0501033_0207987 3300049570 Bacteria 1396
926 Ga0501034_0253758 3300049571 Bacteria 1703
927 Ga0501036_0171871 3300049572 Bacteria 1826
928 Ga0501036_0185232 3300049572 Bacteria 1752
929 Ga0501037_0219025 3300049573 Bacteria 1340
930 Ga0501037_0375071 3300049573 Bacteria 978
931 Ga0501038_0011020 3300049574 Bacteria 8254
932 Ga0501039_0002684 3300049575 Bacteria 13279
933 Ga0501039_0221456 3300049575 Bacteria 1488
934 Ga0501039_0689972 3300049575 Bacteria 799
935 Ga0501040_0002660 3300049576 Bacteria 11526
936 Ga0501041_0189193 3300049577 Bacteria 1289
937 Ga0501043_0025691 3300049579 Bacteria 4621
938 Ga0501043_0039241 3300049579 Bacteria 3722
939 Ga0501043_0043785 3300049579 Bacteria 3519
940 Ga0501046_0109734 3300049580 Bacteria 2109
941 Ga0501046_0131278 3300049580 Bacteria 1900
942 Ga0501046_0255728 3300049580 Bacteria 1288
943 Ga0501047_0065745 3300049581 Bacteria 3495
944 Ga0501047_0130481 3300049581 Bacteria 2394
945 Ga0501047_0144310 3300049581 Bacteria 2258
946 Ga0501047_0423529 3300049581 Bacteria 1162
947 Ga0501048_0009927 3300049582 Bacteria 7130
948 Ga0501068_0028004 3300049584 Bacteria 3329
949 Ga0501068_0104582 3300049584 Bacteria 1757
950 Ga0501070_0052346 3300049586 Bacteria 3389
951 Ga0501070_0721142 3300049586 Bacteria 787
952 Ga0501071_0011773 3300049587 Bacteria 5903
953 Ga0501071_0339466 3300049587 Bacteria 1142
954 Ga0501072_0008811 3300049588 Bacteria 7662
955 Ga0501072_0245166 3300049588 Bacteria 1427
956 Ga0501073_0036993 3300049589 Bacteria 3467
957 Ga0501073_0124613 3300049589 Bacteria 1786
958 Ga0501073_0186704 3300049589 Bacteria 1435
959 Ga0501074_0080946 3300049590 Bacteria 2329
960 Ga0501074_0433317 3300049590 Bacteria 932
961 Ga0501075_0000572 3300049591 Bacteria 22432
962 Ga0501076_0007550 3300049592 Bacteria 7915
963 Ga0501077_0000982 3300049593 Bacteria 17195
964 Ga0501079_0000502 3300049741 Bacteria 25497
965 Ga0501079_0111438 3300049741 Bacteria 2126
966 Ga0501080_0005351 3300049742 Bacteria 11439
967 Ga0501080_0154465 3300049742 Bacteria 2120
968 Ga0501080_0399862 3300049742 Bacteria 1236
969 Ga0501081_0000092 3300049743 Bacteria 36705
970 Ga0501081_0141157 3300049743 Bacteria 1726
971 Ga0501083_0010764 3300049744 Bacteria 6432
972 Ga0501241_000003 3300049758 Bacteria 178857
973 Ga0501269_000050 3300049766 Bacteria 37244
974 Ga0501044_0459709 3300049823 Bacteria 1178
975 Ga0501045_0000513 3300049824 Bacteria 24139
976 nmdc:mga0k408_2569_c1 3300050493 Bacteria 9634
977 nmdc:mga0k408_3418_c1 3300050493 Bacteria 8405
978 nmdc:mga05p37_125234_c1 3300050507 Bacteria 3156
979 nmdc:mga05p37_221805_c1 3300050507 Bacteria 2281
980 nmdc:mga09592_235446_c1 3300050508 Bacteria 1586
981 nmdc:mga09592_308647_c1 3300050508 Bacteria 1371
982 nmdc:mga09592_37007_c1 3300050508 Bacteria 4090
983 nmdc:mga09592_465938_c1 3300050508 Bacteria 1089
984 nmdc:mga0qj67_244258_c1 3300050509 Bacteria 1456
985 nmdc:mga0qj67_94824_c1 3300050509 Bacteria 2401
986 nmdc:mga06r32_741098_c1 3300050510 Bacteria 946
987 nmdc:mga08y16_123766_c1 3300050511 Bacteria 2691
988 nmdc:mga08y16_43526_c1 3300050511 Bacteria 4706
989 nmdc:mga08y16_860711_c1 3300050511 Bacteria 895
990 Ga0495601_0002906 3300053077 Bacteria 9748
991 Ga0495601_0017419 3300053077 Bacteria 4361
992 Ga0495601_0026240 3300053077 Bacteria 3596
993 Ga0495601_0096987 3300053077 Bacteria 1902
994 Ga0495612_0000301 3300053078 Bacteria 20083
995 Ga0495595_0053071 3300053084 Bacteria 1882
996 Ga0495619_0000944 3300053085 Bacteria 19038
997 Ga0495619_0022615 3300053085 Bacteria 4026
998 Ga0495619_0047926 3300053085 Bacteria 2815
999 Ga0495619_0129937 3300053085 Bacteria 1730
1000 Ga0500643_000002 3300053087 Bacteria 1277657
1001 Ga0500651_0000723 3300053093 Bacteria 16223
1002 Ga0500555_000242 3300053103 Bacteria 24278
1003 Ga0500555_009159 3300053103 Bacteria 2830
1004 Ga0500562_000130 3300053108 Bacteria 23570
1005 Ga0500592_000252 3300053116 Bacteria 9612
1006 Ga0500642_0077572 3300053130 Bacteria 1521
1007 Ga0500568_0034536 3300053139 Bacteria 2069
1008 Ga0500573_0021147 3300053140 Bacteria 3727
1009 Ga0500616_0000019 3300053153 Bacteria 549964
1010 Ga0500619_000037 3300053154 Bacteria 41109
1011 Ga0500637_0251453 3300053178 Bacteria 986
1012 Ga0500645_001224 3300053730 Bacteria 13535
1013 Ga0500645_012815 3300053730 Bacteria 2705
1014 Ga0501084_0001064 3300054114 Bacteria 21323
1015 Ga0501082_0067389 3300060353 Bacteria 3082
1016 Ga0466962_0036085 3300061719 Bacteria 2365
1017 Ga0530510_0008078 3300061734 Bacteria 7339
1018 2511231668 2511231000 Bacteria 4488346
1019 2585145033 2582581278 Bacteria 5296881
1020 2585156106 2582581281 Bacteria 4487904
1021 2585160315 2582581282 Bacteria 4495830
1022 2587678591 2585428045 Bacteria 5203023
1023 2587746246 2585428060 Bacteria 5304711
1024 2588210351 2585428182 Bacteria 5007281
1025 2588214405 2585428183 Bacteria 5166119
1026 2588217631 2585428184 Bacteria 4978681
1027 2588223148 2585428185 Bacteria 4969476
1028 2588232868 2585428187 Bacteria 4629388
1029 2588443990 2588253712 Bacteria 5403181
1030 2590601608 2588254255 Bacteria 5014294
1031 2590609243 2588254257 Bacteria 5436094
1032 2723878444 2721755763 Bacteria 4464185
1033 2729200139 2728369107 Bacteria 5082720
1034 2738699871 2738541273 Bacteria 4048577
1035 2739253620 2738543014 Bacteria 4048139
1036 2740059118 2739367874 Bacteria 4872888
1037 2753673169 2751185877 Bacteria 4921427
1038 2765574262 2765235839 Bacteria 5314748
1039 2772604781 2772190705 Bacteria 4666226
1040 2775671904 2775506739 Bacteria 3855222
1041 2816874473 2816332188 Bacteria 5133218
1042 2842085836 2842083920 Bacteria 4857652
1043 2871724158 2871720351 Bacteria 4862476
1044 2881418509 2881412998 Bacteria 6492157
1045 2889295208 2889290771 Bacteria 5530962
1046 2890740132 2890737413 Bacteria 4269751
1047 2898713989 2898713307 Bacteria 4110805
1048 2906000103 2905999023 Bacteria 4591259
1049 2914763196 2914759650 Bacteria 4701441
1050 2919098657 2919097161 Bacteria 3860339
1051 2919403791 2919399522 Bacteria 5164947
1052 2946022745 2946019816 Bacteria 4621265
1053 2984573195 2984572630 Bacteria 4186940
1054 2984610647 2984606641 Bacteria 4186971
1055 8036739605 8036736890 Bacteria 2944828
1056 8057102843 8057101203 Bacteria 5034064
1057 JGI25156J39149_1001066
1058 JGI25162J39368_1000995
1059 JGI25162J39368_1001495
1060 JGI25162J39368_1002049
1061 JGI25154J39366_1002110
1062 JGI25157J39369_1000342
1063 JGI25157J39369_1001042
1064 JGI25164J39214_1000078
1065 JGI25164J39214_1000738
1066 JGI25164J39214_1000760
1067 JGI25165J46597_1000088
1068 JGI25165J46597_1000245
1069 JGI25165J46597_1001490
1070 JGI25165J46597_1001854
1071 rootH2_10009385
1072 rootH2_10193234
1073 rootL2_10155819
1074 rootH1_10075165
1075 Ga0055525_1000146
1076 Ga0055527_1000074
1077 Ga0055535_1000359
1078 Ga0055535_1000372
1079 Ga0055542_1000151
1080 Ga0055542_1000168
1081 Ga0055542_1000352
1082 Ga0055529_1000163
1083 Ga0055529_1000543
1084 Ga0055526_1000232
1085 Ga0055537_1000030
1086 Ga0055524_1002681
1087 Ga0055534_1000447
1088 Ga0055528_1000439
1089 Ga0065703_1018836
1090 Ga0065704_10074548
1091 Ga0065704_10332195
1092 Ga0065715_10003421
1093 Ga0065715_10212795
1094 Ga0070658_10504740
1095 Ga0070676_10024163
1096 Ga0070676_10173087
1097 Ga0070676_10235689
1098 Ga0070676_10368502
1099 Ga0070683_100007566
1100 Ga0070683_100505607
1101 Ga0070690_100006132
1102 Ga0070690_100029833
1103 Ga0070690_100482899
1104 Ga0070677_10020372
1105 Ga0070677_10042635
1106 Ga0068869_100015418
1107 Ga0070666_10007588
1108 Ga0070666_10051454
1109 Ga0070666_10067052
1110 Ga0070680_100553621
1111 Ga0070682_100000474
1112 Ga0068868_100003208
1113 Ga0068868_100016571
1114 Ga0070660_100266428
1115 Ga0070660_100650995
1116 Ga0070689_100091651
1117 Ga0070687_100059708
1118 Ga0070668_100031835
1119 Ga0070669_100164277
1120 Ga0070675_100000208
1121 Ga0070675_100009783
1122 Ga0070675_100234616
1123 Ga0070675_100864699
1124 Ga0070671_100001433
1125 Ga0070671_100341699
1126 Ga0070671_100545243
1127 Ga0070674_100020413
1128 Ga0070673_100000523
1129 Ga0070688_100065452
1130 Ga0070688_100121598
1131 Ga0070659_100714914
1132 Ga0070667_100001902
1133 Ga0070667_100112715
1134 Ga0070703_10000113
1135 Ga0070714_100056798
1136 Ga0070714_100117931
1137 Ga0070713_100032163
1138 Ga0070713_100162298
1139 Ga0070713_100228091
1140 Ga0070701_10011600
1141 Ga0070711_100126251
1142 Ga0070711_100188716
1143 Ga0070711_100211362
1144 Ga0070705_100296412
1145 Ga0070700_100009956
1146 Ga0070700_100048201
1147 Ga0070700_100367358
1148 Ga0070694_100005129
1149 Ga0070708_100084056
1150 Ga0070708_100370732
1151 Ga0070708_100373407
1152 Ga0070678_100000227
1153 Ga0070678_100023593
1154 Ga0070678_100103126
1155 Ga0070678_100380653
1156 Ga0070662_100030296
1157 Ga0070662_100135810
1158 Ga0070662_100277722
1159 Ga0068867_100025872
1160 Ga0068867_100051158
1161 Ga0068867_100615026
1162 Ga0070685_10053945
1163 Ga0070685_10238652
1164 Ga0070707_100057853
1165 Ga0070707_100176789
1166 Ga0070698_100014238
1167 Ga0070698_100246073
1168 Ga0070699_100015650
1169 Ga0070699_100323386
1170 Ga0070699_100405362
1171 Ga0070679_100017929
1172 Ga0070679_100196955
1173 Ga0070684_100007379
1174 Ga0070697_100032621
1175 Ga0070697_100837722
1176 Ga0068853_100238057
1177 Ga0068853_100447454
1178 Ga0070686_100026997
1179 Ga0070686_100478906
1180 Ga0070665_100041910
1181 Ga0070665_100046639
1182 Ga0070665_100082250
1183 Ga0070665_100117248
1184 Ga0070665_100180269
1185 Ga0070665_100310869
1186 Ga0070665_100754776
1187 Ga0070704_100005894
1188 Ga0070704_100161035
1189 Ga0068855_100001240
1190 Ga0068855_100002346
1191 Ga0068855_100013263
1192 Ga0068855_100634742
1193 Ga0070664_100012064
1194 Ga0070664_100145424
1195 Ga0070664_100148006
1196 Ga0070664_100534515
1197 Ga0068857_100207217
1198 Ga0068856_100010356
1199 Ga0068856_100235107
1200 Ga0068856_100724484
1201 Ga0070702_100111863
1202 Ga0070702_100242822
1203 Ga0068852_100031895
1204 Ga0068852_100064778
1205 Ga0068859_100000008
1206 Ga0068859_100004743
1207 Ga0068859_100021239
1208 Ga0068859_100197930
1209 Ga0068859_100393256
1210 Ga0068859_100468269
1211 Ga0068864_100000101
1212 Ga0068864_100085017
1213 Ga0068864_100316511
1214 Ga0068864_100504502
1215 Ga0068866_10011077
1216 Ga0068861_100023859
1217 Ga0068861_100304831
1218 Ga0068861_100436788
1219 Ga0068851_10097345
1220 Ga0068870_10485655
1221 Ga0068863_100012306
1222 Ga0068863_100081804
1223 Ga0068863_100107301
1224 Ga0068863_100153171
1225 Ga0068863_100409320
1226 Ga0068858_100003390
1227 Ga0068858_100003419
1228 Ga0068858_100015795
1229 Ga0068858_100096380
1230 Ga0068858_100723917
1231 Ga0068860_100043493
1232 Ga0068862_100059701
1233 Ga0068862_100385881
1234 Ga0081539_10026051
1235 Ga0070717_10001018
1236 Ga0070717_10076438
1237 Ga0070717_10293105
1238 Ga0070716_100075027
1239 Ga0070712_100003184
1240 Ga0070712_100235479
1241 Ga0075362_10062829
1242 Ga0075366_10002575
1243 Ga0075366_10011548
1244 Ga0097621_100026816
1245 Ga0097621_100043240
1246 Ga0097621_100206674
1247 Ga0068871_100005768
1248 Ga0068871_100019124
1249 Ga0075428_100388793
1250 Ga0075428_100514917
1251 Ga0075430_100105710
1252 Ga0075433_10027568
1253 Ga0075434_100659378
1254 Ga0075429_100048420
1255 Ga0075429_100334186
1256 Ga0075429_100507462
1257 Ga0068865_100047398
1258 Ga0068865_100152844
1259 Ga0075436_100136428
1260 Ga0075436_100175287
1261 Ga0097620_100000008
1262 Ga0097620_100004743
1263 Ga0097620_100021236
1264 Ga0097620_100197924
1265 Ga0097620_100393241
1266 Ga0097620_100468260
1267 Ga0079104_1000700
1268 Ga0079104_1003404
1269 Ga0075435_100167749
1270 Ga0105251_10000073
1271 Ga0105251_10000267
1272 Ga0105251_10000582
1273 Ga0105244_10000001
1274 Ga0105244_10000315
1275 Ga0105244_10108177
1276 Ga0105250_10080334
1277 Ga0105240_10003716
1278 Ga0105240_10005607
1279 Ga0105240_10005746
1280 Ga0105240_10006293
1281 Ga0105240_10061165
1282 Ga0105240_10074105
1283 Ga0105240_10661509
1284 Ga0111539_10006397
1285 Ga0111539_10066977
1286 Ga0111539_10189811
1287 Ga0111539_10209250
1288 Ga0111539_11009104
1289 Ga0105245_10086433
1290 Ga0105247_10000187
1291 Ga0105247_10012875
1292 Ga0105247_10208835
1293 Ga0114129_10198151
1294 Ga0105243_10000056
1295 Ga0105243_10000471
1296 Ga0105241_10000004
1297 Ga0105241_10348406
1298 Ga0105242_10000015
1299 Ga0105242_10058655
1300 Ga0105248_10035689
1301 Ga0105248_10036354
1302 Ga0105248_10039410
1303 Ga0105248_10064863
1304 Ga0105248_10135207
1305 Ga0105237_10006745
1306 Ga0105237_10115769
1307 Ga0105237_10194727
1308 Ga0105237_10229381
1309 Ga0105238_10053835
1310 Ga0105238_10074565
1311 Ga0105239_10044969
1312 Ga0105239_10051580
1313 Ga0105239_10105428
1314 Ga0105239_10110765
1315 Ga0105239_10116732
1316 Ga0105239_10617904
1317 Ga0157316_1003325
1318 Ga0157373_10003158
1319 Ga0157373_10092599
1320 Ga0157373_10193437
1321 Ga0157370_10013507
1322 Ga0157370_10136510
1323 Ga0157369_10005191
1324 Ga0157369_10255028
1325 Ga0157369_10487808
1326 Ga0157374_10003724
1327 Ga0157374_10003991
1328 Ga0157374_10029467
1329 Ga0157374_10044152
1330 Ga0157374_10074693
1331 Ga0157374_10157142
1332 Ga0157374_10378805
1333 Ga0157378_10046120
1334 Ga0157378_10107682
1335 Ga0157378_10153853
1336 Ga0163162_10001589
1337 Ga0163162_10037600
1338 Ga0163162_10055019
1339 Ga0163162_10215867
1340 Ga0163162_11239320
1341 Ga0157372_10010066
1342 Ga0157372_10519451
1343 Ga0157372_10799439
1344 Ga0157372_11410881
1345 Ga0157375_10001221
1346 Ga0157375_10081196
1347 Ga0157375_11307461
1348 Ga0163163_10001383
1349 Ga0163163_10006926
1350 Ga0163163_10406796
1351 Ga0157380_10049239
1352 Ga0157380_10307547
1353 Ga0157380_10769736
1354 Ga0182008_10001860
1355 Ga0182008_10015435
1356 Ga0157377_10234961
1357 Ga0157377_10509041
1358 Ga0157379_10015278
1359 Ga0157379_10069552
1360 Ga0157379_10533521
1361 Ga0157376_10006392
1362 Ga0157376_10268440
1363 Ga0157376_10430607
1364 Ga0157376_10477482
1365 Ga0157376_10708376
1366 Ga0182006_1000003
1367 Ga0182006_1000049
1368 Ga0182006_1000097
1369 Ga0182007_10000095
1370 Ga0182007_10002958
1371 Ga0182007_10015404
1372 Ga0182005_1000038
1373 Ga0182005_1020469
1374 Ga0182005_1020510
1375 Ga0163161_10000004
1376 Ga0163161_10062869
1377 Ga0163161_10531271
1378 Ga0213872_10001170
1379 Ga0213872_10021407
1380 Ga0213872_10045192
1381 Ga0213872_10083172
1382 Ga0213871_10001458
1383 Ga0209674_100598
1384 Ga0209672_100007
1385 Ga0209672_100095
1386 Ga0209672_101868
1387 Ga0209563_100131
1388 Ga0207427_100021
1389 Ga0207427_100105
1390 Ga0207427_100107
1391 Ga0209437_100039
1392 Ga0209437_100087
1393 Ga0209437_100129
1394 Ga0209258_100017
1395 Ga0209258_100206
1396 Ga0209258_100272
1397 Ga0209646_1000246
1398 Ga0209646_1000485
1399 Ga0209026_1000051
1400 Ga0209026_1000878
1401 Ga0209148_1000044
1402 Ga0209148_1000176
1403 Ga0209148_1000185
1404 Ga0209759_1000145
1405 Ga0209233_1000023
1406 Ga0209233_1000224
1407 Ga0209233_1000447
1408 Ga0209565_1000017
1409 Ga0207666_1007773
1410 Ga0209455_1000010
1411 Ga0209455_1000081
1412 Ga0209673_1000007
1413 Ga0209675_1000009
1414 Ga0209675_1000077
1415 Ga0209564_1000055
1416 Ga0209564_1000230
1417 Ga0209256_1000559
1418 Ga0207426_1026348
1419 Ga0209051_1003306
1420 Ga0207697_10014064
1421 Ga0207697_10021800
1422 Ga0207696_1000033
1423 Ga0207655_1000011
1424 Ga0207655_1000013
1425 Ga0207713_1000065
1426 Ga0207713_1000108
1427 Ga0207713_1001983
1428 Ga0207653_10000011
1429 Ga0207682_10002230
1430 Ga0207642_10022924
1431 Ga0207710_10000016
1432 Ga0207710_10044398
1433 Ga0207710_10172342
1434 Ga0207688_10005672
1435 Ga0207680_10001266
1436 Ga0207680_10023747
1437 Ga0207680_10052911
1438 Ga0207699_10442958
1439 Ga0207645_10010412
1440 Ga0207645_10199600
1441 Ga0207645_10311642
1442 Ga0207643_10085564
1443 Ga0207643_10108622
1444 Ga0207643_10158000
1445 Ga0207705_10002381
1446 Ga0207684_10113737
1447 Ga0207654_10000006
1448 Ga0207707_10185830
1449 Ga0207695_10006958
1450 Ga0207695_10014188
1451 Ga0207695_10020911
1452 Ga0207695_10069147
1453 Ga0207695_10109815
1454 Ga0207695_10283680
1455 Ga0207671_10021594
1456 Ga0207671_10073666
1457 Ga0207671_10167782
1458 Ga0207693_10024754
1459 Ga0207693_10053702
1460 Ga0207663_10084177
1461 Ga0207663_10226086
1462 Ga0207660_10083820
1463 Ga0207662_10021647
1464 Ga0207657_10053741
1465 Ga0207649_10084596
1466 Ga0207649_10180123
1467 Ga0207652_10250881
1468 Ga0207652_10309266
1469 Ga0207646_10042178
1470 Ga0207646_10670195
1471 Ga0207681_10133978
1472 Ga0207681_10355577
1473 Ga0207694_10539477
1474 Ga0207650_10008966
1475 Ga0207650_10066083
1476 Ga0207650_10277875
1477 Ga0207659_10000588
1478 Ga0207659_10029176
1479 Ga0207700_10051406
1480 Ga0207700_10272437
1481 Ga0207664_10069324
1482 Ga0207664_10164548
1483 Ga0207644_10002078
1484 Ga0207644_10004826
1485 Ga0207644_10032885
1486 Ga0207644_10102077
1487 Ga0207644_10421341
1488 Ga0207690_10022251
1489 Ga0207690_10273457
1490 Ga0207690_10648375
1491 Ga0207706_10002872
1492 Ga0207706_10082095
1493 Ga0207706_10305056
1494 Ga0207686_10000007
1495 Ga0207686_10040916
1496 Ga0207686_10093174
1497 Ga0207709_10000101
1498 Ga0207709_10000161
1499 Ga0207709_10237979
1500 Ga0207670_10014040
1501 Ga0207670_10031541
1502 Ga0207670_10225360
1503 Ga0207670_10234084
1504 Ga0207669_10174886
1505 Ga0207704_10024325
1506 Ga0207704_10039218
1507 Ga0207704_10157544
1508 Ga0207665_10160044
1509 Ga0207691_10036906
1510 Ga0207691_10081108
1511 Ga0207691_10159650
1512 Ga0207711_10005419
1513 Ga0207711_10029539
1514 Ga0207711_10064678
1515 Ga0207711_10080900
1516 Ga0207689_10024667
1517 Ga0207689_10104860
1518 Ga0207689_10323356
1519 Ga0207661_10001327
1520 Ga0207661_10151832
1521 Ga0207679_10100194
1522 Ga0207679_10178036
1523 Ga0207679_10293684
1524 Ga0207667_10001671
1525 Ga0207667_10002349
1526 Ga0207667_10008952
1527 Ga0207667_10169277
1528 Ga0207667_10571675
1529 Ga0207651_10000179
1530 Ga0207651_10016407
1531 Ga0207651_10548597
1532 Ga0207712_10008695
1533 Ga0207712_10081944
1534 Ga0207712_10521389
1535 Ga0207712_10535290
1536 Ga0207668_10066865
1537 Ga0207658_10001572
1538 Ga0207677_10004081
1539 Ga0207677_10082448
1540 Ga0207703_10005653
1541 Ga0207703_10017041
1542 Ga0207703_10120128
1543 Ga0207703_10182196
1544 Ga0207703_10385639
1545 Ga0207639_10022786
1546 Ga0207639_10027657
1547 Ga0207639_10034078
1548 Ga0207639_10233772
1549 Ga0207708_10019637
1550 Ga0207708_10095035
1551 Ga0207708_10370931
1552 Ga0207641_10009505
1553 Ga0207641_10010646
1554 Ga0207641_10126045
1555 Ga0207641_10181212
1556 Ga0207641_10592141
1557 Ga0207641_10927352
1558 Ga0207648_10007551
1559 Ga0207648_10009747
1560 Ga0207648_10468805
1561 Ga0207648_10484125
1562 Ga0207676_10002099
1563 Ga0207676_10067892
1564 Ga0207676_10100058
1565 Ga0207676_10303498
1566 Ga0207674_10088512
1567 Ga0207674_10151829
1568 Ga0207674_10277185
1569 Ga0207674_10344350
1570 Ga0207674_10701524
1571 Ga0207675_100039681
1572 Ga0207675_100099700
1573 Ga0207675_100227299
1574 Ga0207675_100240210
1575 Ga0207675_101002749
1576 Ga0207683_10001598
1577 Ga0207683_10146798
1578 Ga0207683_10184790
1579 Ga0207683_10364682
1580 Ga0207683_10407446
1581 Ga0207698_10067524
1582 Ga0207698_10132170
1583 Ga0209281_1000008
1584 Ga0209281_1004171
1585 Ga0209371_1002176
1586 Ga0209588_1073225
1587 Ga0207428_10038931
1588 Ga0265356_1000177
1589 Ga0268266_10000420
1590 Ga0268266_10024463
1591 Ga0268266_10033124
1592 Ga0268266_10065765
1593 Ga0268266_10072942
1594 Ga0268266_10093764
1595 Ga0268266_10096267
1596 Ga0268266_10231525
1597 Ga0268266_10413924
1598 Ga0268266_10579678
1599 Ga0268266_10821167
1600 Ga0268265_10036989
1601 Ga0268265_10126671
1602 Ga0268264_10054629
1603 Ga0268264_10061722
1604 Ga0268264_10369170
1605 Ga0265326_10051178
1606 Ga0265318_10071790
1607 Ga0265338_10092476
1608 Ga0268256_1001097
1609 Ga0265760_10002206
1610 Ga0265332_10065200
1611 Ga0265328_10116024
1612 Ga0265325_10000127
1613 Ga0265339_10000827
1614 Ga0265339_10067611
1615 Ga0265331_10029577
1616 Ga0265331_10060128
1617 Ga0265331_10249713
1618 Ga0265327_10158451
1619 Ga0265316_10018261
1620 Ga0265316_10052944
1621 Ga0265316_10093487
1622 Ga0307513_10103235
1623 Ga0265313_10000907
1624 Ga0265313_10147932
1625 Ga0307514_10001950
1626 Ga0265314_10008385
1627 Ga0316576_10203972
1628 Ga0316578_10087120
1629 Ga0316577_10079932
1630 Ga0307406_10210179
1631 Ga0307412_10000096
1632 Ga0307412_10001339
1633 Ga0307409_100270971
1634 Ga0307416_100000017
1635 Ga0307414_10010449
1636 Ga0307411_10612860
1637 Ga0307415_100615369
1638 Ga0307415_100847747
1639 Ga0307415_100977160
1640 Ga0316585_10051322
1641 Ga0307510_10377122
1642 Ga0373959_0025113
1643 Ga0373926_0219815
1644 Ga0373934_0000391
1645 Ga0373934_0012247
1646 Ga0373934_0086340
1647 Ga0373923_0003108
1648 Ga0373923_0225851
1649 Ga0373936_0004500
1650 Ga0373936_0057196
1651 Ga0373945_0019882
1652 Ga0373953_0003575
1653 Ga0373953_0029245
1654 Ga0373954_0003733
1655 Ga0373954_0031178
1656 Ga0373954_0035743
1657 Ga0373954_0071008
1658 Ga0373954_0187956
1659 Ga0373943_0033981
1660 Ga0373946_0023130
1661 Ga0373946_0146142
1662 Ga0373955_0001902
1663 Ga0373955_0021943
1664 Ga0373955_0108442
1665 Ga0373961_0082419
1666 Ga0373924_0002259
1667 Ga0373924_0170859
1668 Ga0373931_0014564
1669 Ga0373935_0008762
1670 Ga0373935_0107250
1671 Ga0373927_0002239
1672 Ga0373927_0007084
1673 Ga0373933_0010447
1674 Ga0373933_0044563
1675 Ga0373933_0177682
1676 Ga0373933_0210819
1677 Ga0373947_0374787
1678 Ga0373937_0001034
1679 Ga0373937_0008262
1680 Ga0373937_0032473
1681 Ga0373937_0107999
1682 Ga0373937_0211881
1683 Ga0316584_0315286
1684 Ga0373925_0000715
1685 Ga0373925_0025553
1686 Ga0373925_0090209
1687 Ga0373925_0299408
1688 Ga0373925_0304909
1689 Ga0395899_0019318
1690 Ga0395899_0042250
1691 Ga0395898_0001110
1692 Ga0395905_0417365
1693 Ga0436364_0089220
1694 Ga0436365_0001623
1695 Ga0436360_0137000
1696 Ga0436360_0386428
1697 Ga0436360_0469655
1698 Ga0436360_0708149
1699 Ga0436360_0824430
1700 Ga0436360_1098059
1701 Ga0436361_0041018
1702 Ga0436361_0133351
1703 Ga0436361_0191634
1704 Ga0436361_0282869
1705 Ga0436361_0300897
1706 Ga0436361_0508014
1707 Ga0436361_0785765
1708 Ga0436361_1030428
1709 Ga0436363_0387766
1710 Ga0436363_0588950
1711 Ga0436363_1671843
1712 Ga0439438_002259
1713 Ga0439447_001305
1714 Ga0439466_0083079
1715 Ga0439445_0000288
1716 Ga0439432_023496
1717 Ga0439432_036474
1718 Ga0451577_0000101
1719 Ga0451577_0208072
1720 Ga0466969_0009932
1721 Ga0466969_0090988
1722 Ga0466972_0123062
1723 Ga0466989_0074246
1724 Ga0466965_0017505
1725 Ga0466965_0084935
1726 Ga0466966_0007469
1727 Ga0466961_0000412
1728 Ga0466961_0001299
1729 Ga0466961_0001373
1730 Ga0466961_0022862
1731 Ga0466963_0051014
1732 Ga0466963_0238926
1733 Ga0466964_0111020
1734 Ga0453684_0000679
1735 Ga0453684_0070521
1736 Ga0453684_0361100
1737 Ga0466971_0019617
1738 Ga0466971_0027166
1739 Ga0466968_0180669
1740 Ga0466957_0006003
1741 Ga0466957_0404160
1742 Ga0466959_0029127
1743 Ga0451576_0000260
1744 Ga0466958_0063430
1745 Ga0466958_0070861
1746 Ga0466958_0190423
1747 Ga0466967_0161576
1748 Ga0466967_0324205
1749 Ga0466967_0625270
1750 Ga0495617_000304
1751 Ga0495627_000141
1752 Ga0495627_004584
1753 Ga0495592_0004704
1754 Ga0495592_0020234
1755 Ga0495592_0062411
1756 Ga0495590_0000020
1757 Ga0495591_001616
1758 Ga0495638_0000328
1759 Ga0495638_0000493
1760 Ga0495638_0000543
1761 Ga0495638_0104420
1762 Ga0495641_0001105
1763 Ga0495651_0009753
1764 Ga0495653_0017178
1765 Ga0495653_0196397
1766 Ga0495650_0001929
1767 Ga0495650_0003366
1768 Ga0495580_0021288
1769 Ga0495580_0128834
1770 Ga0495580_0244249
1771 Ga0495582_0089280
1772 Ga0495582_0094989
1773 Ga0495582_0314016
1774 Ga0495605_0000394
1775 Ga0495605_0025478
1776 Ga0495639_0003744
1777 Ga0495639_0008665
1778 Ga0495662_0016160
1779 Ga0495664_0003219
1780 Ga0495664_0009587
1781 Ga0495584_0003609
1782 Ga0495585_0000001
1783 Ga0495594_0009332
1784 Ga0495596_0006258
1785 Ga0495607_0000967
1786 Ga0495607_0004270
1787 Ga0495607_0006847
1788 Ga0495607_0217499
1789 Ga0495583_0000310
1790 Ga0495583_0000626
1791 Ga0495583_0084943
1792 Ga0495606_0000326
1793 Ga0495606_0000660
1794 Ga0495606_0001121
1795 Ga0495608_0011280
1796 Ga0495608_0023435
1797 Ga0495610_0000006
1798 Ga0495616_0014232
1799 Ga0495628_0006322
1800 Ga0495628_0052427
1801 Ga0495628_0218511
1802 Ga0495628_0579662
1803 Ga0495630_0001974
1804 Ga0495631_0000078
1805 Ga0495632_0000601
1806 Ga0495643_0000519
1807 Ga0495644_0000799
1808 Ga0495644_0002833
1809 Ga0495648_0000206
1810 Ga0495648_0000990
1811 Ga0495648_0003241
1812 Ga0495648_0023475
1813 Ga0495666_0006403
1814 Ga0495642_0013982
1815 Ga0495652_0037267
1816 Ga0495652_0202263
1817 Ga0495652_0347124
1818 Ga0495654_0000006
1819 Ga0495654_0000353
1820 Ga0495654_0002624
1821 Ga0495654_0018562
1822 Ga0495640_0006143
1823 Ga0495586_0005085
1824 Ga0495587_0015431
1825 Ga0495587_0024960
1826 Ga0495587_0027599
1827 Ga0495587_0045421
1828 Ga0495587_0322659
1829 Ga0495609_0005147
1830 Ga0495609_0010929
1831 Ga0495609_0107445
1832 Ga0495621_0006587
1833 Ga0495621_0104197
1834 Ga0495597_0000262
1835 Ga0495645_0000483
1836 Ga0495645_0027047
1837 Ga0495645_0334436
1838 Ga0495622_0000077
1839 Ga0495622_0113110
1840 Ga0495633_0000149
1841 Ga0495633_0002549
1842 Ga0495633_0007833
1843 Ga0495667_0005516
1844 Ga0495667_0014488
1845 Ga0495667_0015374
1846 Ga0495668_0000888
1847 Ga0495668_0034425
1848 Ga0495634_0008248
1849 Ga0495611_0000001
1850 Ga0495625_0000001
1851 Ga0495625_0000199
1852 Ga0495625_0001048
1853 Ga0495625_0062950
1854 Ga0495635_0312077
1855 Ga0495659_0002117
1856 Ga0495661_0000104
1857 Ga0495661_0043077
1858 Ga0495588_0048265
1859 Ga0495657_0003049
1860 Ga0495657_0017206
1861 Ga0495599_0001707
1862 Ga0495599_0001790
1863 Ga0495646_0026014
1864 Ga0495647_0001510
1865 Ga0495658_0335019
1866 Ga0495658_0466913
1867 Ga0495669_0125883
1868 Ga0495613_0180728
1869 Ga0495624_0023178
1870 Ga0495670_0176018
1871 Ga0495671_0000175
1872 Ga0495671_0001021
1873 Ga0495671_0004751
1874 Ga0495589_0000006
1875 Ga0495589_0000999
1876 Ga0495600_0002178
1877 Ga0495600_0070414
1878 Ga0495660_0000008
1879 Ga0495660_0000009
1880 Ga0495660_0000019
1881 Ga0495660_0109464
1882 Ga0495660_0186080
1883 Ga0495581_0146557
1884 Ga0495604_0010199
1885 Ga0495604_0012321
1886 Ga0495636_0001345
1887 Ga0495674_0000463
1888 Ga0495674_0052188
1889 Ga0495674_0354855
1890 Ga0495672_0000003
1891 Ga0495672_0001917
1892 Ga0495680_0016578
1893 Ga0495680_0082993
1894 Ga0495680_0102926
1895 Ga0495683_0000472
1896 Ga0495687_000370
1897 Ga0495675_0035274
1898 Ga0495677_0009318
1899 Ga0495679_000001
1900 Ga0495679_057429
1901 Ga0495685_000091
1902 Ga0495673_0000001
1903 Ga0495673_0000011
1904 Ga0495673_0000089
1905 Ga0495673_0004212
1906 Ga0495684_0001586
1907 Ga0495684_0047674
1908 Ga0495686_0003986
1909 Ga0495686_0124293
1910 Ga0495602_0000196
1911 Ga0496100_0021624
1912 Ga0496101_0436596
1913 Ga0496102_0778275
1914 Ga0496104_0004551
1915 Ga0496105_0007863
1916 Ga0496105_0477587
1917 Ga0496106_0186734
1918 Ga0496106_0389667
1919 Ga0496107_0158962
1920 Ga0496108_0030955
1921 Ga0496108_0081698
1922 Ga0496109_0135358
1923 Ga0496109_0251756
1924 Ga0496111_0218620
1925 Ga0496114_0129947
1926 Ga0496115_0014454
1927 Ga0496116_0000006
1928 Ga0496116_0000031
1929 Ga0496116_0066661
1930 Ga0496117_0000027
1931 Ga0496117_0000132
1932 Ga0496117_0019969
1933 Ga0496118_0000099
1934 Ga0496118_0000141
1935 Ga0496118_0085794
1936 Ga0496119_0000006
1937 Ga0496119_0000258
1938 Ga0496119_0000280
1939 Ga0496119_0014218
1940 Ga0496119_0115941
1941 Ga0496120_0000228
1942 Ga0496120_0000255
1943 Ga0496120_0040527
1944 Ga0496120_0083671
1945 Ga0496121_0000368
1946 Ga0496121_0032337
1947 Ga0496122_0000229
1948 Ga0496122_0000397
1949 Ga0496122_0001702
1950 Ga0496122_0002499
1951 Ga0496122_0004429
1952 Ga0496122_0023172
1953 Ga0496122_0074132
1954 Ga0496123_0003689
1955 Ga0496123_0005655
1956 Ga0496123_0021618
1957 Ga0496123_0023894
1958 Ga0496124_0000122
1959 Ga0496124_0005070
1960 Ga0496124_0186194
1961 Ga0496125_0001071
1962 Ga0496125_0003176
1963 Ga0496125_0054020
1964 Ga0496126_0001395
1965 Ga0496126_0016309
1966 Ga0496126_0067076
1967 Ga0496126_0105264
1968 Ga0496126_0110835
1969 Ga0496126_0138838
1970 Ga0496126_0152582
1971 Ga0496126_0281066
1972 Ga0496126_0641876
1973 Ga0495678_000023
1974 Ga0495678_016990
1975 Ga0495682_0000106
1976 Ga0495682_0000836
1977 Ga0495682_0001080
1978 Ga0495682_0003245
1979 Ga0501031_0300797
1980 Ga0501033_0052608
1981 Ga0501033_0207987
1982 Ga0501034_0253758
1983 Ga0501036_0171871
1984 Ga0501036_0185232
1985 Ga0501037_0219025
1986 Ga0501037_0375071
1987 Ga0501038_0011020
1988 Ga0501039_0002684
1989 Ga0501039_0221456
1990 Ga0501039_0689972
1991 Ga0501040_0002660
1992 Ga0501041_0189193
1993 Ga0501043_0025691
1994 Ga0501043_0039241
1995 Ga0501043_0043785
1996 Ga0501046_0109734
1997 Ga0501046_0131278
1998 Ga0501046_0255728
1999 Ga0501047_0065745
2000 Ga0501047_0130481
2001 Ga0501047_0144310
2002 Ga0501047_0423529
2003 Ga0501048_0009927
2004 Ga0501068_0028004
2005 Ga0501068_0104582
2006 Ga0501070_0052346
2007 Ga0501070_0721142
2008 Ga0501071_0011773
2009 Ga0501071_0339466
2010 Ga0501072_0008811
2011 Ga0501072_0245166
2012 Ga0501073_0036993
2013 Ga0501073_0124613
2014 Ga0501073_0186704
2015 Ga0501074_0080946
2016 Ga0501074_0433317
2017 Ga0501075_0000572
2018 Ga0501076_0007550
2019 Ga0501077_0000982
2020 Ga0501079_0000502
2021 Ga0501079_0111438
2022 Ga0501080_0005351
2023 Ga0501080_0154465
2024 Ga0501080_0399862
2025 Ga0501081_0000092
2026 Ga0501081_0141157
2027 Ga0501083_0010764
2028 Ga0501241_000003
2029 Ga0501269_000050
2030 Ga0501044_0459709
2031 Ga0501045_0000513
2032 nmdc:mga0k408_2569_c1
2033 nmdc:mga0k408_3418_c1
2034 nmdc:mga05p37_125234_c1
2035 nmdc:mga05p37_221805_c1
2036 nmdc:mga09592_235446_c1
2037 nmdc:mga09592_308647_c1
2038 nmdc:mga09592_37007_c1
2039 nmdc:mga09592_465938_c1
2040 nmdc:mga0qj67_244258_c1
2041 nmdc:mga0qj67_94824_c1
2042 nmdc:mga06r32_741098_c1
2043 nmdc:mga08y16_123766_c1
2044 nmdc:mga08y16_43526_c1
2045 nmdc:mga08y16_860711_c1
2046 Ga0495601_0002906
2047 Ga0495601_0017419
2048 Ga0495601_0026240
2049 Ga0495601_0096987
2050 Ga0495612_0000301
2051 Ga0495595_0053071
2052 Ga0495619_0000944
2053 Ga0495619_0022615
2054 Ga0495619_0047926
2055 Ga0495619_0129937
2056 Ga0500643_000002
2057 Ga0500651_0000723
2058 Ga0500555_000242
2059 Ga0500555_009159
2060 Ga0500562_000130
2061 Ga0500592_000252
2062 Ga0500642_0077572
2063 Ga0500568_0034536
2064 Ga0500573_0021147
2065 Ga0500616_0000019
2066 Ga0500619_000037
2067 Ga0500637_0251453
2068 Ga0500645_001224
2069 Ga0500645_012815
2070 Ga0501084_0001064
2071 Ga0501082_0067389
2072 Ga0466962_0036085
2073 Ga0530510_0008078
2074 2511231668
2075 2585145033
2076 2585156106
2077 2585160315
2078 2587678591
2079 2587746246
2080 2588210351
2081 2588214405
2082 2588217631
2083 2588223148
2084 2588232868
2085 2588443990
2086 2590601608
2087 2590609243
2088 2723878444
2089 2729200139
2090 2738699871
2091 2739253620
2092 2740059118
2093 2753673169
2094 2765574262
2095 2772604781
2096 2775671904
2097 2816874473
2098 2842085836
2099 2871724158
2100 2881418509
2101 2889295208
2102 2890740132
2103 2898713989
2104 2906000103
2105 2914763196
2106 2919098657
2107 2919403791
2108 2946022745
2109 2984573195
2110 2984610647
2111 8036739605
2112 8057102843

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

32

260

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9973 38 267
2abm-assembly1.cif.gz_A crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels 0.9973 39 264
2o9g-assembly1.cif.gz_A crystal structure of aqpz mutant l170c complexed with mercury. 0.9969 38 267
3nk5-assembly2.cif.gz_B crystal structure of aqpz mutant f43w 0.9969 38 267
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.9969 38 267
ID Description Score Start End Superfamily
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.992 38 266 1.20.1080.10
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9625 38 266 1.20.1080.10
af_Q7Z138_18_164_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9341 38 137 1.20.1080.10
af_Q9V5Z7_14_242_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9332 34 267 1.20.1080.10
af_Q0JPT5_51_289_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9289 38 263 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A485CCH7-F1-model_v4 Aquaporin Z 1.001 39 266 GO:0005886
GO:0015250
AF-A0A1C6Z0X6-F1-model_v4 Aquaporin Z 1.001 39 220 GO:0005886
GO:0015250
AF-A0A2J4YQS4-F1-model_v4 Aquaporin Z 1.001 85 266 GO:0005886
GO:0015250
AF-A0A4U9HQ78-F1-model_v4 Bacterial nodulin-like intrinsic protein 1.001 39 204 GO:0005886
GO:0015250
AF-A0A0A2VTY1-F1-model_v4 Uncharacterized protein ybjE 1.001 88 247 GO:0005886
GO:0015267
GO:0015661

Map