F489177
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1056 | 374 | 1047 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100079646|Ga0068853_1000796464 |
| Length | 126 |
| Sequence | MKNPRFAVRQHTLPTIPAMSYFERHIFFCLNKRDKGEECCADQGAQAGFDHCKSRVKAERLAGPGGVRVNKSGCLDRCAGGPVAVVYPEAVWYTYVDKNDIDEIVDSHLRGGRVVERLLLPPDVGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 2 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 3 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 4 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 5 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 6 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 7 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 8 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 9 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 229 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 236 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 237 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 238 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 331 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 332 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 333 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 335 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 336 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 353 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 354 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 355 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 356 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 357 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 358 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 359 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 365 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 367 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 368 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 370 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 374 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.05 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.93 |
| Nodule | 0 |
| Rhizoplane | 2.94 |
| Rhizosphere | 79.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10019594 | 3300001979 | Bacteria | 2379 |
| 2 | JGI25153J46596_10006137 | 3300003215 | Bacteria | 6160 |
| 3 | Ga0065712_10517541 | 3300005290 | Bacteria | 638 |
| 4 | Ga0070658_10274738 | 3300005327 | Bacteria | 1434 |
| 5 | Ga0070658_10933212 | 3300005327 | Bacteria | 755 |
| 6 | Ga0070676_10002478 | 3300005328 | Bacteria | 9462 |
| 7 | Ga0070676_10031932 | 3300005328 | Bacteria | 3014 |
| 8 | Ga0070683_101351563 | 3300005329 | Bacteria | 685 |
| 9 | Ga0070690_100102793 | 3300005330 | Bacteria | 1897 |
| 10 | Ga0070690_101045909 | 3300005330 | Bacteria | 645 |
| 11 | Ga0070670_100000775 | 3300005331 | Bacteria | 24812 |
| 12 | Ga0070670_100019018 | 3300005331 | Bacteria | 5891 |
| 13 | Ga0070670_100067838 | 3300005331 | Bacteria | 3060 |
| 14 | Ga0070670_100127781 | 3300005331 | Bacteria | 2194 |
| 15 | Ga0070670_100134480 | 3300005331 | Bacteria | 2136 |
| 16 | Ga0070670_100223566 | 3300005331 | Bacteria | 1638 |
| 17 | Ga0070670_100282417 | 3300005331 | Bacteria | 1449 |
| 18 | Ga0070670_100307717 | 3300005331 | Bacteria | 1387 |
| 19 | Ga0070670_100363089 | 3300005331 | Bacteria | 1274 |
| 20 | Ga0070670_101042747 | 3300005331 | Bacteria | 744 |
| 21 | Ga0070677_10004477 | 3300005333 | Bacteria | 4566 |
| 22 | Ga0070677_10024937 | 3300005333 | Bacteria | 2228 |
| 23 | Ga0070677_10032776 | 3300005333 | Bacteria | 1996 |
| 24 | Ga0070677_10039794 | 3300005333 | Bacteria | 1847 |
| 25 | Ga0070677_10055466 | 3300005333 | Bacteria | 1618 |
| 26 | Ga0070677_10247812 | 3300005333 | Bacteria | 883 |
| 27 | Ga0070677_10549853 | 3300005333 | Bacteria | 633 |
| 28 | Ga0068869_100001648 | 3300005334 | Bacteria | 13321 |
| 29 | Ga0068869_100024199 | 3300005334 | Bacteria | 4205 |
| 30 | Ga0068869_100177501 | 3300005334 | Bacteria | 1668 |
| 31 | Ga0068869_100575017 | 3300005334 | Bacteria | 949 |
| 32 | Ga0070666_10002795 | 3300005335 | Bacteria | 10542 |
| 33 | Ga0070666_10045779 | 3300005335 | Bacteria | 2933 |
| 34 | Ga0070666_10070708 | 3300005335 | Bacteria | 2374 |
| 35 | Ga0070666_10155665 | 3300005335 | Bacteria | 1596 |
| 36 | Ga0070666_10756903 | 3300005335 | Bacteria | 714 |
| 37 | Ga0070666_11097180 | 3300005335 | Bacteria | 592 |
| 38 | Ga0070682_100965057 | 3300005337 | Bacteria | 705 |
| 39 | Ga0068868_100035720 | 3300005338 | Bacteria | 3843 |
| 40 | Ga0068868_100108975 | 3300005338 | Bacteria | 2248 |
| 41 | Ga0068868_100164549 | 3300005338 | Bacteria | 1834 |
| 42 | Ga0068868_100169169 | 3300005338 | Bacteria | 1809 |
| 43 | Ga0068868_100532513 | 3300005338 | Bacteria | 1033 |
| 44 | Ga0068868_100634143 | 3300005338 | Bacteria | 950 |
| 45 | Ga0068868_100760915 | 3300005338 | Bacteria | 871 |
| 46 | Ga0068868_100774899 | 3300005338 | Bacteria | 863 |
| 47 | Ga0070660_100878335 | 3300005339 | Bacteria | 755 |
| 48 | Ga0070660_101828726 | 3300005339 | Bacteria | 518 |
| 49 | Ga0070689_101117843 | 3300005340 | Bacteria | 705 |
| 50 | Ga0070687_100311939 | 3300005343 | Bacteria | 1002 |
| 51 | Ga0070661_100748476 | 3300005344 | Bacteria | 799 |
| 52 | Ga0070661_101018060 | 3300005344 | Bacteria | 688 |
| 53 | Ga0070668_100013107 | 3300005347 | Bacteria | 6178 |
| 54 | Ga0070668_100188821 | 3300005347 | Bacteria | 1687 |
| 55 | Ga0070668_100546617 | 3300005347 | Bacteria | 1008 |
| 56 | Ga0070668_101437646 | 3300005347 | Bacteria | 629 |
| 57 | Ga0070669_100005859 | 3300005353 | Bacteria | 8865 |
| 58 | Ga0070669_100013170 | 3300005353 | Bacteria | 5878 |
| 59 | Ga0070669_100045646 | 3300005353 | Bacteria | 3193 |
| 60 | Ga0070669_101004781 | 3300005353 | Bacteria | 716 |
| 61 | Ga0070669_101005154 | 3300005353 | Bacteria | 716 |
| 62 | Ga0070675_100001482 | 3300005354 | Bacteria | 17319 |
| 63 | Ga0070675_100020379 | 3300005354 | Bacteria | 5292 |
| 64 | Ga0070675_100024332 | 3300005354 | Bacteria | 4849 |
| 65 | Ga0070675_100092713 | 3300005354 | Bacteria | 2532 |
| 66 | Ga0070675_100198527 | 3300005354 | Bacteria | 1740 |
| 67 | Ga0070675_100214868 | 3300005354 | Bacteria | 1673 |
| 68 | Ga0070675_100218486 | 3300005354 | Bacteria | 1659 |
| 69 | Ga0070675_100658978 | 3300005354 | Bacteria | 952 |
| 70 | Ga0070675_101250616 | 3300005354 | Bacteria | 684 |
| 71 | Ga0070675_101548308 | 3300005354 | Bacteria | 612 |
| 72 | Ga0070671_100005666 | 3300005355 | Bacteria | 9939 |
| 73 | Ga0070671_100030454 | 3300005355 | Bacteria | 4453 |
| 74 | Ga0070671_100074874 | 3300005355 | Bacteria | 2828 |
| 75 | Ga0070671_100076135 | 3300005355 | Bacteria | 2803 |
| 76 | Ga0070671_100089324 | 3300005355 | Bacteria | 2580 |
| 77 | Ga0070674_100005009 | 3300005356 | Bacteria | 7604 |
| 78 | Ga0070674_100009279 | 3300005356 | Bacteria | 5889 |
| 79 | Ga0070674_100177682 | 3300005356 | Bacteria | 1628 |
| 80 | Ga0070674_101338292 | 3300005356 | Bacteria | 640 |
| 81 | Ga0070674_101607414 | 3300005356 | Bacteria | 586 |
| 82 | Ga0070674_101809086 | 3300005356 | Bacteria | 554 |
| 83 | Ga0070673_100003372 | 3300005364 | Bacteria | 9941 |
| 84 | Ga0070673_100029454 | 3300005364 | Bacteria | 4094 |
| 85 | Ga0070673_100035511 | 3300005364 | Bacteria | 3781 |
| 86 | Ga0070673_100069367 | 3300005364 | Bacteria | 2825 |
| 87 | Ga0070673_100161601 | 3300005364 | Bacteria | 1905 |
| 88 | Ga0070673_100223986 | 3300005364 | Bacteria | 1629 |
| 89 | Ga0070673_100417265 | 3300005364 | Bacteria | 1203 |
| 90 | Ga0070673_100520427 | 3300005364 | Bacteria | 1078 |
| 91 | Ga0070673_101952480 | 3300005364 | Bacteria | 557 |
| 92 | Ga0070688_100053688 | 3300005365 | Bacteria | 2522 |
| 93 | Ga0070688_100096372 | 3300005365 | Bacteria | 1943 |
| 94 | Ga0070659_100170105 | 3300005366 | Bacteria | 1784 |
| 95 | Ga0070659_100276123 | 3300005366 | Bacteria | 1397 |
| 96 | Ga0070659_100978184 | 3300005366 | Bacteria | 742 |
| 97 | Ga0070667_100001504 | 3300005367 | Bacteria | 20851 |
| 98 | Ga0070667_100120197 | 3300005367 | Bacteria | 2285 |
| 99 | Ga0070667_100279507 | 3300005367 | Bacteria | 1499 |
| 100 | Ga0070667_100376399 | 3300005367 | Bacteria | 1289 |
| 101 | Ga0070667_100599779 | 3300005367 | Bacteria | 1015 |
| 102 | Ga0070667_100788205 | 3300005367 | Bacteria | 882 |
| 103 | Ga0070667_101197729 | 3300005367 | Bacteria | 711 |
| 104 | Ga0070667_101465799 | 3300005367 | Bacteria | 641 |
| 105 | Ga0070713_100000031 | 3300005436 | Bacteria | 88727 |
| 106 | Ga0070701_10486249 | 3300005438 | Bacteria | 799 |
| 107 | Ga0070700_100073191 | 3300005441 | Bacteria | 2193 |
| 108 | Ga0070700_100734653 | 3300005441 | Bacteria | 788 |
| 109 | Ga0070700_100754424 | 3300005441 | Bacteria | 779 |
| 110 | Ga0070708_100710240 | 3300005445 | Bacteria | 946 |
| 111 | Ga0070663_100032448 | 3300005455 | Bacteria | 3600 |
| 112 | Ga0070663_100265425 | 3300005455 | Bacteria | 1363 |
| 113 | Ga0070663_100273859 | 3300005455 | Bacteria | 1343 |
| 114 | Ga0070678_100017348 | 3300005456 | Bacteria | 4632 |
| 115 | Ga0070678_100076806 | 3300005456 | Bacteria | 2517 |
| 116 | Ga0070678_100077397 | 3300005456 | Bacteria | 2509 |
| 117 | Ga0070678_100107750 | 3300005456 | Bacteria | 2174 |
| 118 | Ga0070678_100108943 | 3300005456 | Bacteria | 2163 |
| 119 | Ga0070678_100267040 | 3300005456 | Bacteria | 1441 |
| 120 | Ga0070678_100337227 | 3300005456 | Bacteria | 1292 |
| 121 | Ga0070678_100353662 | 3300005456 | Bacteria | 1264 |
| 122 | Ga0070678_100437635 | 3300005456 | Bacteria | 1143 |
| 123 | Ga0070678_100677488 | 3300005456 | Bacteria | 927 |
| 124 | Ga0070678_100738649 | 3300005456 | Bacteria | 889 |
| 125 | Ga0070678_100778852 | 3300005456 | Bacteria | 867 |
| 126 | Ga0070678_101272963 | 3300005456 | Bacteria | 684 |
| 127 | Ga0070678_101488809 | 3300005456 | Bacteria | 634 |
| 128 | Ga0070678_101563137 | 3300005456 | Bacteria | 619 |
| 129 | Ga0070678_102261053 | 3300005456 | Bacteria | 516 |
| 130 | Ga0070662_100013829 | 3300005457 | Bacteria | 5376 |
| 131 | Ga0070662_100076193 | 3300005457 | Bacteria | 2486 |
| 132 | Ga0070662_100356970 | 3300005457 | Bacteria | 1199 |
| 133 | Ga0070662_100427554 | 3300005457 | Bacteria | 1097 |
| 134 | Ga0070662_100970130 | 3300005457 | Bacteria | 727 |
| 135 | Ga0070681_10197743 | 3300005458 | Bacteria | 1929 |
| 136 | Ga0068867_100002317 | 3300005459 | Bacteria | 13397 |
| 137 | Ga0068867_100005331 | 3300005459 | Bacteria | 9088 |
| 138 | Ga0068867_100006908 | 3300005459 | Bacteria | 8032 |
| 139 | Ga0068867_100055304 | 3300005459 | Bacteria | 2934 |
| 140 | Ga0068867_100056848 | 3300005459 | Bacteria | 2896 |
| 141 | Ga0068867_100077545 | 3300005459 | Bacteria | 2497 |
| 142 | Ga0068867_100147428 | 3300005459 | Bacteria | 1846 |
| 143 | Ga0068867_100233881 | 3300005459 | Bacteria | 1487 |
| 144 | Ga0068867_100241274 | 3300005459 | Bacteria | 1466 |
| 145 | Ga0068867_100477329 | 3300005459 | Bacteria | 1068 |
| 146 | Ga0068867_100574557 | 3300005459 | Bacteria | 979 |
| 147 | Ga0068867_100654761 | 3300005459 | Bacteria | 922 |
| 148 | Ga0068867_101268806 | 3300005459 | Bacteria | 679 |
| 149 | Ga0070685_10412280 | 3300005466 | Bacteria | 938 |
| 150 | Ga0070685_10667608 | 3300005466 | Bacteria | 755 |
| 151 | Ga0070706_100000367 | 3300005467 | Bacteria | 54314 |
| 152 | Ga0070707_100054004 | 3300005468 | Bacteria | 3852 |
| 153 | Ga0070707_100686286 | 3300005468 | Bacteria | 987 |
| 154 | Ga0070698_100327392 | 3300005471 | Bacteria | 1463 |
| 155 | Ga0070699_100030764 | 3300005518 | Bacteria | 4634 |
| 156 | Ga0070679_100055562 | 3300005530 | Bacteria | 3942 |
| 157 | Ga0070679_101016454 | 3300005530 | Bacteria | 773 |
| 158 | Ga0070684_100159016 | 3300005535 | Bacteria | 2049 |
| 159 | Ga0068853_100079646 | 3300005539 | Bacteria | 2865 |
| 160 | Ga0068853_100917267 | 3300005539 | Bacteria | 842 |
| 161 | Ga0068853_101735799 | 3300005539 | Bacteria | 605 |
| 162 | Ga0070672_100000485 | 3300005543 | Bacteria | 23134 |
| 163 | Ga0070672_100016669 | 3300005543 | Bacteria | 5267 |
| 164 | Ga0070672_100030860 | 3300005543 | Bacteria | 4030 |
| 165 | Ga0070672_100074313 | 3300005543 | Bacteria | 2711 |
| 166 | Ga0070672_100118478 | 3300005543 | Bacteria | 2165 |
| 167 | Ga0070672_100129179 | 3300005543 | Bacteria | 2075 |
| 168 | Ga0070672_100133758 | 3300005543 | Bacteria | 2040 |
| 169 | Ga0070672_100255897 | 3300005543 | Bacteria | 1475 |
| 170 | Ga0070672_100339769 | 3300005543 | Bacteria | 1278 |
| 171 | Ga0070672_101240598 | 3300005543 | Bacteria | 665 |
| 172 | Ga0070672_101248646 | 3300005543 | Bacteria | 662 |
| 173 | Ga0070686_100323357 | 3300005544 | Bacteria | 1151 |
| 174 | Ga0070686_101675827 | 3300005544 | Bacteria | 539 |
| 175 | Ga0070665_100028038 | 3300005548 | Bacteria | 5672 |
| 176 | Ga0070665_100335794 | 3300005548 | Bacteria | 1516 |
| 177 | Ga0070665_100338241 | 3300005548 | Bacteria | 1510 |
| 178 | Ga0070665_100546975 | 3300005548 | Bacteria | 1170 |
| 179 | Ga0070665_100753413 | 3300005548 | Bacteria | 987 |
| 180 | Ga0070665_101524301 | 3300005548 | Bacteria | 677 |
| 181 | Ga0070664_100012848 | 3300005564 | Bacteria | 6812 |
| 182 | Ga0070664_100113896 | 3300005564 | Bacteria | 2362 |
| 183 | Ga0070664_100377425 | 3300005564 | Bacteria | 1293 |
| 184 | Ga0070664_100534554 | 3300005564 | Bacteria | 1083 |
| 185 | Ga0070664_101180664 | 3300005564 | Bacteria | 722 |
| 186 | Ga0070664_101223881 | 3300005564 | Bacteria | 708 |
| 187 | Ga0068857_100095028 | 3300005577 | Bacteria | 2669 |
| 188 | Ga0068857_100447095 | 3300005577 | Bacteria | 1208 |
| 189 | Ga0068857_101461259 | 3300005577 | Bacteria | 666 |
| 190 | Ga0068854_100090840 | 3300005578 | Bacteria | 2272 |
| 191 | Ga0068854_100113081 | 3300005578 | Bacteria | 2050 |
| 192 | Ga0068854_100156755 | 3300005578 | Bacteria | 1760 |
| 193 | Ga0068854_100223915 | 3300005578 | Bacteria | 1489 |
| 194 | Ga0068854_101458403 | 3300005578 | Bacteria | 620 |
| 195 | Ga0068856_100205955 | 3300005614 | Bacteria | 1982 |
| 196 | Ga0068856_101302221 | 3300005614 | Bacteria | 742 |
| 197 | Ga0070702_101758564 | 3300005615 | Bacteria | 517 |
| 198 | Ga0068852_100092155 | 3300005616 | Bacteria | 2713 |
| 199 | Ga0068852_100194266 | 3300005616 | Bacteria | 1917 |
| 200 | Ga0068852_100206199 | 3300005616 | Bacteria | 1862 |
| 201 | Ga0068852_100320799 | 3300005616 | Bacteria | 1504 |
| 202 | Ga0068852_100607949 | 3300005616 | Bacteria | 1098 |
| 203 | Ga0068852_101336581 | 3300005616 | Bacteria | 738 |
| 204 | Ga0068852_102027063 | 3300005616 | Bacteria | 597 |
| 205 | Ga0068859_100070277 | 3300005617 | Bacteria | 3536 |
| 206 | Ga0068859_100136538 | 3300005617 | Bacteria | 2525 |
| 207 | Ga0068859_100986015 | 3300005617 | Bacteria | 925 |
| 208 | Ga0068864_100006073 | 3300005618 | Bacteria | 9912 |
| 209 | Ga0068864_100076573 | 3300005618 | Bacteria | 2924 |
| 210 | Ga0068864_100118711 | 3300005618 | Bacteria | 2362 |
| 211 | Ga0068864_100195683 | 3300005618 | Bacteria | 1855 |
| 212 | Ga0068864_100449106 | 3300005618 | Bacteria | 1233 |
| 213 | Ga0068864_100845441 | 3300005618 | Bacteria | 901 |
| 214 | Ga0068866_10005941 | 3300005718 | Bacteria | 5074 |
| 215 | Ga0068866_10498545 | 3300005718 | Bacteria | 805 |
| 216 | Ga0068861_100007796 | 3300005719 | Bacteria | 7358 |
| 217 | Ga0068861_100010477 | 3300005719 | Bacteria | 6434 |
| 218 | Ga0068861_100059399 | 3300005719 | Bacteria | 2928 |
| 219 | Ga0068861_101539259 | 3300005719 | Bacteria | 653 |
| 220 | Ga0068851_10054329 | 3300005834 | Bacteria | 2040 |
| 221 | Ga0068851_10134243 | 3300005834 | Bacteria | 1341 |
| 222 | Ga0068851_10192843 | 3300005834 | Bacteria | 1133 |
| 223 | Ga0068851_10207691 | 3300005834 | Bacteria | 1095 |
| 224 | Ga0068851_10326610 | 3300005834 | Bacteria | 887 |
| 225 | Ga0068870_10104166 | 3300005840 | Bacteria | 1609 |
| 226 | Ga0068870_10162280 | 3300005840 | Bacteria | 1326 |
| 227 | Ga0068870_10353722 | 3300005840 | Bacteria | 943 |
| 228 | Ga0068863_100006580 | 3300005841 | Bacteria | 11405 |
| 229 | Ga0068863_100010999 | 3300005841 | Bacteria | 8776 |
| 230 | Ga0068863_100056110 | 3300005841 | Bacteria | 3729 |
| 231 | Ga0068863_100094986 | 3300005841 | Bacteria | 2830 |
| 232 | Ga0068863_100251725 | 3300005841 | Bacteria | 1706 |
| 233 | Ga0068863_100464831 | 3300005841 | Bacteria | 1243 |
| 234 | Ga0068863_101062392 | 3300005841 | Bacteria | 813 |
| 235 | Ga0068863_101239218 | 3300005841 | Bacteria | 752 |
| 236 | Ga0068858_100004441 | 3300005842 | Bacteria | 13757 |
| 237 | Ga0068858_100055279 | 3300005842 | Bacteria | 3669 |
| 238 | Ga0068858_101420961 | 3300005842 | Bacteria | 684 |
| 239 | Ga0068860_100006168 | 3300005843 | Bacteria | 12055 |
| 240 | Ga0068860_100122793 | 3300005843 | Bacteria | 2488 |
| 241 | Ga0068860_100306129 | 3300005843 | Bacteria | 1558 |
| 242 | Ga0068860_100579483 | 3300005843 | Bacteria | 1126 |
| 243 | Ga0068862_100011734 | 3300005844 | Bacteria | 7230 |
| 244 | Ga0068862_100086216 | 3300005844 | Bacteria | 2729 |
| 245 | Ga0068862_100178666 | 3300005844 | Bacteria | 1904 |
| 246 | Ga0068862_100216042 | 3300005844 | Bacteria | 1734 |
| 247 | Ga0068862_101949855 | 3300005844 | Bacteria | 598 |
| 248 | Ga0070717_10888792 | 3300006028 | Bacteria | 811 |
| 249 | Ga0075365_10314835 | 3300006038 | Bacteria | 1102 |
| 250 | Ga0075368_10003231 | 3300006042 | Bacteria | 5425 |
| 251 | Ga0075368_10005709 | 3300006042 | Bacteria | 4300 |
| 252 | Ga0075368_10527534 | 3300006042 | Bacteria | 529 |
| 253 | Ga0075363_100000145 | 3300006048 | Bacteria | 17501 |
| 254 | Ga0075363_100012536 | 3300006048 | Bacteria | 4091 |
| 255 | Ga0075363_100295166 | 3300006048 | Bacteria | 940 |
| 256 | Ga0075363_100454751 | 3300006048 | Bacteria | 757 |
| 257 | Ga0075363_100485893 | 3300006048 | Bacteria | 732 |
| 258 | Ga0075363_100539762 | 3300006048 | Bacteria | 695 |
| 259 | Ga0075364_10013229 | 3300006051 | Bacteria | 5065 |
| 260 | Ga0075364_10264221 | 3300006051 | Bacteria | 1170 |
| 261 | Ga0070716_100131326 | 3300006173 | Bacteria | 1583 |
| 262 | Ga0070712_100203974 | 3300006175 | Bacteria | 1555 |
| 263 | Ga0075362_10000580 | 3300006177 | Bacteria | 10685 |
| 264 | Ga0075362_10003899 | 3300006177 | Bacteria | 5296 |
| 265 | Ga0075362_10009196 | 3300006177 | Bacteria | 3810 |
| 266 | Ga0075362_10059103 | 3300006177 | Bacteria | 1731 |
| 267 | Ga0075362_10171464 | 3300006177 | Bacteria | 1049 |
| 268 | Ga0075362_10292023 | 3300006177 | Bacteria | 808 |
| 269 | Ga0075362_10297218 | 3300006177 | Bacteria | 801 |
| 270 | Ga0075362_10557038 | 3300006177 | Bacteria | 590 |
| 271 | Ga0075367_10002249 | 3300006178 | Bacteria | 8731 |
| 272 | Ga0075367_10004330 | 3300006178 | Bacteria | 6910 |
| 273 | Ga0075367_10021570 | 3300006178 | Bacteria | 3601 |
| 274 | Ga0075367_10026303 | 3300006178 | Bacteria | 3299 |
| 275 | Ga0075367_10154559 | 3300006178 | Bacteria | 1425 |
| 276 | Ga0075367_10513061 | 3300006178 | Bacteria | 761 |
| 277 | Ga0075369_10003203 | 3300006186 | Bacteria | 5939 |
| 278 | Ga0075369_10339395 | 3300006186 | Bacteria | 704 |
| 279 | Ga0075366_10000582 | 3300006195 | Bacteria | 17130 |
| 280 | Ga0075366_10009057 | 3300006195 | Bacteria | 5551 |
| 281 | Ga0075366_10009118 | 3300006195 | Bacteria | 5533 |
| 282 | Ga0075366_10010938 | 3300006195 | Bacteria | 5107 |
| 283 | Ga0075366_10012436 | 3300006195 | Bacteria | 4827 |
| 284 | Ga0075366_10064499 | 3300006195 | Bacteria | 2178 |
| 285 | Ga0075366_10117119 | 3300006195 | Bacteria | 1604 |
| 286 | Ga0075366_10226494 | 3300006195 | Bacteria | 1139 |
| 287 | Ga0075366_10547006 | 3300006195 | Bacteria | 717 |
| 288 | Ga0075366_10549934 | 3300006195 | Bacteria | 715 |
| 289 | Ga0075366_10577617 | 3300006195 | Bacteria | 696 |
| 290 | Ga0097621_100025465 | 3300006237 | Bacteria | 4630 |
| 291 | Ga0097621_100147122 | 3300006237 | Bacteria | 2018 |
| 292 | Ga0075370_10000854 | 3300006353 | Bacteria | 12360 |
| 293 | Ga0075370_10002800 | 3300006353 | Bacteria | 8175 |
| 294 | Ga0075370_10003383 | 3300006353 | Bacteria | 7579 |
| 295 | Ga0075370_10045133 | 3300006353 | Bacteria | 2492 |
| 296 | Ga0075370_10097322 | 3300006353 | Bacteria | 1701 |
| 297 | Ga0075370_10133920 | 3300006353 | Bacteria | 1447 |
| 298 | Ga0075370_10211259 | 3300006353 | Bacteria | 1146 |
| 299 | Ga0075370_10278882 | 3300006353 | Bacteria | 993 |
| 300 | Ga0075370_10382760 | 3300006353 | Bacteria | 843 |
| 301 | Ga0068871_100040253 | 3300006358 | Bacteria | 3743 |
| 302 | Ga0068871_100124281 | 3300006358 | Bacteria | 2182 |
| 303 | Ga0068871_100222012 | 3300006358 | Bacteria | 1637 |
| 304 | Ga0068871_100691793 | 3300006358 | Bacteria | 934 |
| 305 | Ga0068871_100873779 | 3300006358 | Bacteria | 832 |
| 306 | Ga0068871_100887637 | 3300006358 | Bacteria | 826 |
| 307 | Ga0075430_100045709 | 3300006846 | Bacteria | 3698 |
| 308 | Ga0068865_100023882 | 3300006881 | Bacteria | 4008 |
| 309 | Ga0068865_100074584 | 3300006881 | Bacteria | 2416 |
| 310 | Ga0068865_101233065 | 3300006881 | Bacteria | 663 |
| 311 | Ga0068865_101692914 | 3300006881 | Bacteria | 570 |
| 312 | Ga0097620_100070277 | 3300006931 | Bacteria | 3536 |
| 313 | Ga0097620_100136542 | 3300006931 | Bacteria | 2525 |
| 314 | Ga0097620_100986196 | 3300006931 | Bacteria | 925 |
| 315 | Ga0105250_10091014 | 3300009092 | Bacteria | 1241 |
| 316 | Ga0105240_10018949 | 3300009093 | Bacteria | 9215 |
| 317 | Ga0105240_10081673 | 3300009093 | Bacteria | 3971 |
| 318 | Ga0111539_10132095 | 3300009094 | Bacteria | 2923 |
| 319 | Ga0111539_11926734 | 3300009094 | Bacteria | 685 |
| 320 | Ga0111539_12012739 | 3300009094 | Bacteria | 670 |
| 321 | Ga0105245_10048172 | 3300009098 | Bacteria | 3812 |
| 322 | Ga0105245_10822413 | 3300009098 | Bacteria | 968 |
| 323 | Ga0105245_11098617 | 3300009098 | Bacteria | 841 |
| 324 | Ga0114129_10078156 | 3300009147 | Bacteria | 4603 |
| 325 | Ga0105243_10000649 | 3300009148 | Bacteria | 34418 |
| 326 | Ga0105243_10018605 | 3300009148 | Bacteria | 5264 |
| 327 | Ga0105243_10035667 | 3300009148 | Bacteria | 3856 |
| 328 | Ga0105243_10219249 | 3300009148 | Bacteria | 1680 |
| 329 | Ga0105243_10718625 | 3300009148 | Bacteria | 976 |
| 330 | Ga0105241_10277484 | 3300009174 | Bacteria | 1430 |
| 331 | Ga0105241_10981838 | 3300009174 | Bacteria | 789 |
| 332 | Ga0105242_10147470 | 3300009176 | Bacteria | 2048 |
| 333 | Ga0105242_10764653 | 3300009176 | Bacteria | 953 |
| 334 | Ga0105248_10033310 | 3300009177 | Bacteria | 5755 |
| 335 | Ga0105248_10044143 | 3300009177 | Bacteria | 4999 |
| 336 | Ga0105248_10134398 | 3300009177 | Bacteria | 2791 |
| 337 | Ga0105248_10194699 | 3300009177 | Bacteria | 2284 |
| 338 | Ga0105248_11059248 | 3300009177 | Bacteria | 916 |
| 339 | Ga0105248_11615637 | 3300009177 | Bacteria | 734 |
| 340 | Ga0105248_13039546 | 3300009177 | Bacteria | 534 |
| 341 | Ga0105237_10001988 | 3300009545 | Bacteria | 26016 |
| 342 | Ga0105237_10881549 | 3300009545 | Bacteria | 902 |
| 343 | Ga0105238_10014640 | 3300009551 | Bacteria | 7932 |
| 344 | Ga0105238_11637287 | 3300009551 | Bacteria | 674 |
| 345 | Ga0105249_10009613 | 3300009553 | Bacteria | 8474 |
| 346 | Ga0105249_10128897 | 3300009553 | Bacteria | 2413 |
| 347 | Ga0105249_10767916 | 3300009553 | Bacteria | 1027 |
| 348 | Ga0105249_10797317 | 3300009553 | Bacteria | 1008 |
| 349 | Ga0105249_11514723 | 3300009553 | Bacteria | 743 |
| 350 | Ga0105249_12548904 | 3300009553 | Bacteria | 584 |
| 351 | Ga0105249_13231722 | 3300009553 | Bacteria | 524 |
| 352 | Ga0105249_13258103 | 3300009553 | Bacteria | 522 |
| 353 | Ga0105239_10004146 | 3300010375 | Bacteria | 17401 |
| 354 | Ga0105239_10050251 | 3300010375 | Bacteria | 4574 |
| 355 | Ga0105246_10219053 | 3300011119 | Bacteria | 1491 |
| 356 | Ga0105246_10969817 | 3300011119 | Bacteria | 767 |
| 357 | Ga0105246_12048846 | 3300011119 | Bacteria | 553 |
| 358 | Ga0157373_10448390 | 3300013100 | Bacteria | 928 |
| 359 | Ga0157371_10579855 | 3300013102 | Bacteria | 833 |
| 360 | Ga0157370_11057125 | 3300013104 | Bacteria | 734 |
| 361 | Ga0157369_10483949 | 3300013105 | Bacteria | 1281 |
| 362 | Ga0157374_10084889 | 3300013296 | Bacteria | 3010 |
| 363 | Ga0157374_10208548 | 3300013296 | Bacteria | 1915 |
| 364 | Ga0157378_10137192 | 3300013297 | Bacteria | 2268 |
| 365 | Ga0157378_10461686 | 3300013297 | Bacteria | 1262 |
| 366 | Ga0157378_10566919 | 3300013297 | Bacteria | 1143 |
| 367 | Ga0157378_10627283 | 3300013297 | Bacteria | 1089 |
| 368 | Ga0157378_10661483 | 3300013297 | Bacteria | 1061 |
| 369 | Ga0157378_12555060 | 3300013297 | Bacteria | 563 |
| 370 | Ga0163162_10011522 | 3300013306 | Bacteria | 8623 |
| 371 | Ga0163162_10161373 | 3300013306 | Bacteria | 2363 |
| 372 | Ga0163162_10721023 | 3300013306 | Bacteria | 1118 |
| 373 | Ga0163162_10934355 | 3300013306 | Bacteria | 979 |
| 374 | Ga0163162_12373692 | 3300013306 | Bacteria | 610 |
| 375 | Ga0157372_10604790 | 3300013307 | Bacteria | 1278 |
| 376 | Ga0157375_10076831 | 3300013308 | Bacteria | 3367 |
| 377 | Ga0157375_10085627 | 3300013308 | Bacteria | 3201 |
| 378 | Ga0157375_10293371 | 3300013308 | Bacteria | 1789 |
| 379 | Ga0157375_10457810 | 3300013308 | Bacteria | 1441 |
| 380 | Ga0157375_11068663 | 3300013308 | Bacteria | 944 |
| 381 | Ga0163163_10011394 | 3300014325 | Bacteria | 8062 |
| 382 | Ga0163163_10775432 | 3300014325 | Bacteria | 1022 |
| 383 | Ga0163163_10881802 | 3300014325 | Bacteria | 958 |
| 384 | Ga0163163_11524831 | 3300014325 | Bacteria | 730 |
| 385 | Ga0157380_10006323 | 3300014326 | Bacteria | 8324 |
| 386 | Ga0157380_10797607 | 3300014326 | Bacteria | 961 |
| 387 | Ga0157380_10882670 | 3300014326 | Bacteria | 919 |
| 388 | Ga0157380_12683823 | 3300014326 | Bacteria | 565 |
| 389 | Ga0157380_13119147 | 3300014326 | Bacteria | 529 |
| 390 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 391 | Ga0157377_10359191 | 3300014745 | Bacteria | 980 |
| 392 | Ga0157377_11662769 | 3300014745 | Bacteria | 514 |
| 393 | Ga0157379_10015125 | 3300014968 | Bacteria | 6768 |
| 394 | Ga0157379_10016325 | 3300014968 | Bacteria | 6531 |
| 395 | Ga0157379_10021583 | 3300014968 | Bacteria | 5701 |
| 396 | Ga0157379_11054654 | 3300014968 | Bacteria | 777 |
| 397 | Ga0157379_11594545 | 3300014968 | Bacteria | 637 |
| 398 | Ga0157379_12419342 | 3300014968 | Bacteria | 524 |
| 399 | Ga0157376_10079207 | 3300014969 | Bacteria | 2816 |
| 400 | Ga0157376_10288786 | 3300014969 | Bacteria | 1548 |
| 401 | Ga0157376_10450520 | 3300014969 | Bacteria | 1255 |
| 402 | Ga0157376_11887229 | 3300014969 | Bacteria | 634 |
| 403 | Ga0157376_12068523 | 3300014969 | Bacteria | 607 |
| 404 | Ga0157376_12388383 | 3300014969 | Bacteria | 568 |
| 405 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 406 | Ga0163161_10009633 | 3300017792 | Bacteria | 6682 |
| 407 | Ga0163161_10045002 | 3300017792 | Bacteria | 3181 |
| 408 | Ga0163161_10231198 | 3300017792 | Bacteria | 1435 |
| 409 | Ga0163161_10389612 | 3300017792 | Bacteria | 1115 |
| 410 | Ga0163161_10816384 | 3300017792 | Bacteria | 785 |
| 411 | Ga0163161_11142281 | 3300017792 | Bacteria | 671 |
| 412 | Ga0163161_11332321 | 3300017792 | Bacteria | 625 |
| 413 | Ga0206353_11452919 | 3300020082 | Bacteria | 531 |
| 414 | Ga0213872_10000155 | 3300021361 | Bacteria | 62940 |
| 415 | Ga0213872_10157498 | 3300021361 | Bacteria | 989 |
| 416 | Ga0209673_1005560 | 3300025273 | Bacteria | 6304 |
| 417 | Ga0209758_1000769 | 3300025297 | Bacteria | 46067 |
| 418 | Ga0207697_10020852 | 3300025315 | Bacteria | 2683 |
| 419 | Ga0207697_10025463 | 3300025315 | Bacteria | 2418 |
| 420 | Ga0207697_10069111 | 3300025315 | Bacteria | 1478 |
| 421 | Ga0207656_10036342 | 3300025321 | Bacteria | 2067 |
| 422 | Ga0207656_10072974 | 3300025321 | Bacteria | 1529 |
| 423 | Ga0207682_10009442 | 3300025893 | Bacteria | 3850 |
| 424 | Ga0207682_10010609 | 3300025893 | Bacteria | 3607 |
| 425 | Ga0207682_10021298 | 3300025893 | Bacteria | 2550 |
| 426 | Ga0207682_10052694 | 3300025893 | Bacteria | 1686 |
| 427 | Ga0207682_10060390 | 3300025893 | Bacteria | 1585 |
| 428 | Ga0207682_10335808 | 3300025893 | Bacteria | 711 |
| 429 | Ga0207642_10231839 | 3300025899 | Bacteria | 1038 |
| 430 | Ga0207642_10456802 | 3300025899 | Bacteria | 775 |
| 431 | Ga0207688_10038491 | 3300025901 | Bacteria | 2654 |
| 432 | Ga0207688_10325346 | 3300025901 | Bacteria | 944 |
| 433 | Ga0207680_10040979 | 3300025903 | Bacteria | 2699 |
| 434 | Ga0207680_10052240 | 3300025903 | Bacteria | 2448 |
| 435 | Ga0207680_10189659 | 3300025903 | Bacteria | 1395 |
| 436 | Ga0207680_10271428 | 3300025903 | Bacteria | 1176 |
| 437 | Ga0207680_10589399 | 3300025903 | Bacteria | 795 |
| 438 | Ga0207647_10391251 | 3300025904 | Bacteria | 784 |
| 439 | Ga0207645_10009868 | 3300025907 | Bacteria | 6581 |
| 440 | Ga0207645_10030778 | 3300025907 | Bacteria | 3458 |
| 441 | Ga0207645_10038838 | 3300025907 | Bacteria | 3051 |
| 442 | Ga0207643_10023918 | 3300025908 | Bacteria | 3370 |
| 443 | Ga0207643_10085762 | 3300025908 | Bacteria | 1829 |
| 444 | Ga0207643_10343902 | 3300025908 | Bacteria | 935 |
| 445 | Ga0207643_10447133 | 3300025908 | Bacteria | 822 |
| 446 | Ga0207705_10257093 | 3300025909 | Bacteria | 1333 |
| 447 | Ga0207705_11402711 | 3300025909 | Bacteria | 531 |
| 448 | Ga0207684_10008798 | 3300025910 | Bacteria | 8962 |
| 449 | Ga0207707_10101940 | 3300025912 | Bacteria | 2509 |
| 450 | Ga0207695_10138322 | 3300025913 | Bacteria | 2387 |
| 451 | Ga0207695_10199733 | 3300025913 | Bacteria | 1914 |
| 452 | Ga0207671_10002519 | 3300025914 | Bacteria | 19541 |
| 453 | Ga0207671_10685381 | 3300025914 | Bacteria | 815 |
| 454 | Ga0207693_10463920 | 3300025915 | Bacteria | 989 |
| 455 | Ga0207663_10613812 | 3300025916 | Bacteria | 856 |
| 456 | Ga0207660_10025648 | 3300025917 | Bacteria | 4004 |
| 457 | Ga0207662_10020118 | 3300025918 | Bacteria | 3807 |
| 458 | Ga0207657_10055458 | 3300025919 | Bacteria | 3423 |
| 459 | Ga0207649_10405692 | 3300025920 | Bacteria | 1021 |
| 460 | Ga0207652_10008831 | 3300025921 | Bacteria | 8117 |
| 461 | Ga0207646_10067500 | 3300025922 | Bacteria | 3193 |
| 462 | Ga0207646_11465963 | 3300025922 | Bacteria | 592 |
| 463 | Ga0207646_11797157 | 3300025922 | Bacteria | 524 |
| 464 | Ga0207681_10001432 | 3300025923 | Bacteria | 15375 |
| 465 | Ga0207681_10004120 | 3300025923 | Bacteria | 9011 |
| 466 | Ga0207681_10510064 | 3300025923 | Bacteria | 986 |
| 467 | Ga0207681_10822179 | 3300025923 | Bacteria | 776 |
| 468 | Ga0207681_11408044 | 3300025923 | Bacteria | 585 |
| 469 | Ga0207694_10615943 | 3300025924 | Bacteria | 913 |
| 470 | Ga0207694_10694490 | 3300025924 | Bacteria | 858 |
| 471 | Ga0207650_10000275 | 3300025925 | Bacteria | 53824 |
| 472 | Ga0207650_10003921 | 3300025925 | Bacteria | 10179 |
| 473 | Ga0207650_10133334 | 3300025925 | Bacteria | 1946 |
| 474 | Ga0207650_10138977 | 3300025925 | Bacteria | 1908 |
| 475 | Ga0207650_10328804 | 3300025925 | Bacteria | 1253 |
| 476 | Ga0207650_10485089 | 3300025925 | Bacteria | 1032 |
| 477 | Ga0207650_11205008 | 3300025925 | Bacteria | 645 |
| 478 | Ga0207659_10000418 | 3300025926 | Bacteria | 25657 |
| 479 | Ga0207659_10050329 | 3300025926 | Bacteria | 2959 |
| 480 | Ga0207659_10162669 | 3300025926 | Bacteria | 1754 |
| 481 | Ga0207659_10165106 | 3300025926 | Bacteria | 1742 |
| 482 | Ga0207659_10223288 | 3300025926 | Bacteria | 1516 |
| 483 | Ga0207659_10297181 | 3300025926 | Bacteria | 1325 |
| 484 | Ga0207659_10395497 | 3300025926 | Bacteria | 1155 |
| 485 | Ga0207659_10702554 | 3300025926 | Bacteria | 866 |
| 486 | Ga0207687_10074870 | 3300025927 | Bacteria | 2428 |
| 487 | Ga0207700_10012392 | 3300025928 | Bacteria | 5497 |
| 488 | Ga0207644_10000391 | 3300025931 | Bacteria | 28488 |
| 489 | Ga0207644_10014706 | 3300025931 | Bacteria | 5244 |
| 490 | Ga0207644_10016461 | 3300025931 | Bacteria | 4975 |
| 491 | Ga0207644_10045088 | 3300025931 | Bacteria | 3135 |
| 492 | Ga0207644_10077054 | 3300025931 | Bacteria | 2454 |
| 493 | Ga0207644_10095589 | 3300025931 | Bacteria | 2222 |
| 494 | Ga0207644_10203851 | 3300025931 | Bacteria | 1561 |
| 495 | Ga0207644_10455672 | 3300025931 | Bacteria | 1051 |
| 496 | Ga0207690_10191676 | 3300025932 | Bacteria | 1546 |
| 497 | Ga0207690_10925860 | 3300025932 | Bacteria | 723 |
| 498 | Ga0207690_11172189 | 3300025932 | Bacteria | 641 |
| 499 | Ga0207706_10020545 | 3300025933 | Bacteria | 5935 |
| 500 | Ga0207706_10076989 | 3300025933 | Bacteria | 2934 |
| 501 | Ga0207706_10092441 | 3300025933 | Bacteria | 2660 |
| 502 | Ga0207706_10151073 | 3300025933 | Bacteria | 2042 |
| 503 | Ga0207706_10312047 | 3300025933 | Bacteria | 1369 |
| 504 | Ga0207706_10619713 | 3300025933 | Bacteria | 928 |
| 505 | Ga0207706_10743301 | 3300025933 | Bacteria | 836 |
| 506 | Ga0207706_11040293 | 3300025933 | Bacteria | 686 |
| 507 | Ga0207686_10051491 | 3300025934 | Bacteria | 2565 |
| 508 | Ga0207709_10001139 | 3300025935 | Bacteria | 19377 |
| 509 | Ga0207709_10038669 | 3300025935 | Bacteria | 2844 |
| 510 | Ga0207709_10156862 | 3300025935 | Bacteria | 1583 |
| 511 | Ga0207709_10167640 | 3300025935 | Bacteria | 1538 |
| 512 | Ga0207709_10187336 | 3300025935 | Bacteria | 1467 |
| 513 | Ga0207709_10190764 | 3300025935 | Bacteria | 1455 |
| 514 | Ga0207670_10607228 | 3300025936 | Bacteria | 899 |
| 515 | Ga0207670_10864801 | 3300025936 | Bacteria | 756 |
| 516 | Ga0207670_10930038 | 3300025936 | Bacteria | 729 |
| 517 | Ga0207669_10001031 | 3300025937 | Bacteria | 11905 |
| 518 | Ga0207669_10037849 | 3300025937 | Bacteria | 2772 |
| 519 | Ga0207669_10342495 | 3300025937 | Bacteria | 1152 |
| 520 | Ga0207669_10347604 | 3300025937 | Bacteria | 1144 |
| 521 | Ga0207669_11080222 | 3300025937 | Bacteria | 677 |
| 522 | Ga0207669_11292715 | 3300025937 | Bacteria | 619 |
| 523 | Ga0207704_10002411 | 3300025938 | Bacteria | 8409 |
| 524 | Ga0207704_10046121 | 3300025938 | Bacteria | 2595 |
| 525 | Ga0207704_10053687 | 3300025938 | Bacteria | 2452 |
| 526 | Ga0207704_10845688 | 3300025938 | Bacteria | 767 |
| 527 | Ga0207665_10040480 | 3300025939 | Bacteria | 3109 |
| 528 | Ga0207691_10001335 | 3300025940 | Bacteria | 24610 |
| 529 | Ga0207691_10041584 | 3300025940 | Bacteria | 4242 |
| 530 | Ga0207691_10055504 | 3300025940 | Bacteria | 3610 |
| 531 | Ga0207691_10092874 | 3300025940 | Bacteria | 2702 |
| 532 | Ga0207691_10103023 | 3300025940 | Bacteria | 2545 |
| 533 | Ga0207691_10126606 | 3300025940 | Bacteria | 2260 |
| 534 | Ga0207691_10166503 | 3300025940 | Bacteria | 1931 |
| 535 | Ga0207691_10185111 | 3300025940 | Bacteria | 1818 |
| 536 | Ga0207691_10196453 | 3300025940 | Bacteria | 1757 |
| 537 | Ga0207691_10424365 | 3300025940 | Bacteria | 1133 |
| 538 | Ga0207691_10923689 | 3300025940 | Bacteria | 730 |
| 539 | Ga0207711_10033637 | 3300025941 | Bacteria | 4339 |
| 540 | Ga0207711_10040559 | 3300025941 | Bacteria | 3961 |
| 541 | Ga0207711_10081075 | 3300025941 | Bacteria | 2835 |
| 542 | Ga0207711_10431707 | 3300025941 | Bacteria | 1226 |
| 543 | Ga0207711_10554146 | 3300025941 | Bacteria | 1072 |
| 544 | Ga0207689_10013440 | 3300025942 | Bacteria | 6990 |
| 545 | Ga0207689_10024935 | 3300025942 | Bacteria | 5013 |
| 546 | Ga0207689_10051233 | 3300025942 | Bacteria | 3403 |
| 547 | Ga0207689_10183308 | 3300025942 | Bacteria | 1726 |
| 548 | Ga0207679_10467880 | 3300025945 | Bacteria | 1120 |
| 549 | Ga0207679_10486146 | 3300025945 | Bacteria | 1100 |
| 550 | Ga0207679_11545652 | 3300025945 | Bacteria | 608 |
| 551 | Ga0207679_11795853 | 3300025945 | Bacteria | 560 |
| 552 | Ga0207679_11919821 | 3300025945 | Bacteria | 540 |
| 553 | Ga0207651_10007014 | 3300025960 | Bacteria | 5969 |
| 554 | Ga0207651_10015270 | 3300025960 | Bacteria | 4458 |
| 555 | Ga0207651_10016846 | 3300025960 | Bacteria | 4297 |
| 556 | Ga0207651_10028855 | 3300025960 | Bacteria | 3507 |
| 557 | Ga0207651_10062806 | 3300025960 | Bacteria | 2590 |
| 558 | Ga0207651_10125560 | 3300025960 | Bacteria | 1954 |
| 559 | Ga0207651_10699355 | 3300025960 | Bacteria | 893 |
| 560 | Ga0207651_10734155 | 3300025960 | Bacteria | 872 |
| 561 | Ga0207651_10799990 | 3300025960 | Bacteria | 836 |
| 562 | Ga0207651_10991920 | 3300025960 | Bacteria | 750 |
| 563 | Ga0207712_10601774 | 3300025961 | Bacteria | 951 |
| 564 | Ga0207712_10727672 | 3300025961 | Bacteria | 868 |
| 565 | Ga0207712_11214133 | 3300025961 | Bacteria | 673 |
| 566 | Ga0207668_10021137 | 3300025972 | Bacteria | 4148 |
| 567 | Ga0207668_10341957 | 3300025972 | Bacteria | 1248 |
| 568 | Ga0207668_10962970 | 3300025972 | Bacteria | 761 |
| 569 | Ga0207640_10105092 | 3300025981 | Bacteria | 1989 |
| 570 | Ga0207640_10148648 | 3300025981 | Bacteria | 1718 |
| 571 | Ga0207658_10007334 | 3300025986 | Bacteria | 7517 |
| 572 | Ga0207658_10041765 | 3300025986 | Bacteria | 3323 |
| 573 | Ga0207658_10091681 | 3300025986 | Bacteria | 2358 |
| 574 | Ga0207658_10126880 | 3300025986 | Bacteria | 2044 |
| 575 | Ga0207658_10127968 | 3300025986 | Bacteria | 2035 |
| 576 | Ga0207658_10715849 | 3300025986 | Bacteria | 905 |
| 577 | Ga0207658_10730551 | 3300025986 | Bacteria | 896 |
| 578 | Ga0207658_11120673 | 3300025986 | Bacteria | 719 |
| 579 | Ga0207677_10015892 | 3300026023 | Bacteria | 4443 |
| 580 | Ga0207677_10021624 | 3300026023 | Bacteria | 3935 |
| 581 | Ga0207677_10072057 | 3300026023 | Bacteria | 2441 |
| 582 | Ga0207677_10144850 | 3300026023 | Bacteria | 1824 |
| 583 | Ga0207677_10157790 | 3300026023 | Bacteria | 1759 |
| 584 | Ga0207677_10189242 | 3300026023 | Bacteria | 1626 |
| 585 | Ga0207677_10515405 | 3300026023 | Bacteria | 1036 |
| 586 | Ga0207677_11042481 | 3300026023 | Bacteria | 743 |
| 587 | Ga0207677_11840639 | 3300026023 | Bacteria | 562 |
| 588 | Ga0207703_10087205 | 3300026035 | Bacteria | 2616 |
| 589 | Ga0207703_10105129 | 3300026035 | Bacteria | 2399 |
| 590 | Ga0207703_11008853 | 3300026035 | Bacteria | 799 |
| 591 | Ga0207703_11822644 | 3300026035 | Bacteria | 585 |
| 592 | Ga0207639_10041469 | 3300026041 | Bacteria | 3444 |
| 593 | Ga0207639_10613085 | 3300026041 | Bacteria | 1004 |
| 594 | Ga0207639_10878009 | 3300026041 | Bacteria | 838 |
| 595 | Ga0207639_11654294 | 3300026041 | Bacteria | 600 |
| 596 | Ga0207678_10005281 | 3300026067 | Bacteria | 11568 |
| 597 | Ga0207678_10058082 | 3300026067 | Bacteria | 3329 |
| 598 | Ga0207678_10183557 | 3300026067 | Bacteria | 1787 |
| 599 | Ga0207678_10205257 | 3300026067 | Bacteria | 1686 |
| 600 | Ga0207678_10207929 | 3300026067 | Bacteria | 1674 |
| 601 | Ga0207678_10482559 | 3300026067 | Bacteria | 1079 |
| 602 | Ga0207678_10499662 | 3300026067 | Bacteria | 1060 |
| 603 | Ga0207678_10958979 | 3300026067 | Bacteria | 757 |
| 604 | Ga0207708_10121206 | 3300026075 | Bacteria | 2038 |
| 605 | Ga0207708_10779827 | 3300026075 | Bacteria | 822 |
| 606 | Ga0207641_10003042 | 3300026088 | Bacteria | 15111 |
| 607 | Ga0207641_10010456 | 3300026088 | Bacteria | 7626 |
| 608 | Ga0207641_10016486 | 3300026088 | Bacteria | 6051 |
| 609 | Ga0207641_10094164 | 3300026088 | Bacteria | 2626 |
| 610 | Ga0207641_10157115 | 3300026088 | Bacteria | 2064 |
| 611 | Ga0207641_10221469 | 3300026088 | Bacteria | 1755 |
| 612 | Ga0207641_10223313 | 3300026088 | Bacteria | 1748 |
| 613 | Ga0207641_10658583 | 3300026088 | Bacteria | 1029 |
| 614 | Ga0207648_10000254 | 3300026089 | Bacteria | 57696 |
| 615 | Ga0207648_10011874 | 3300026089 | Bacteria | 8185 |
| 616 | Ga0207648_10012495 | 3300026089 | Bacteria | 7950 |
| 617 | Ga0207648_10024822 | 3300026089 | Bacteria | 5347 |
| 618 | Ga0207648_10026116 | 3300026089 | Bacteria | 5193 |
| 619 | Ga0207648_10027411 | 3300026089 | Bacteria | 5056 |
| 620 | Ga0207648_10047044 | 3300026089 | Bacteria | 3782 |
| 621 | Ga0207648_10079214 | 3300026089 | Bacteria | 2866 |
| 622 | Ga0207648_10178201 | 3300026089 | Bacteria | 1880 |
| 623 | Ga0207648_10279993 | 3300026089 | Bacteria | 1491 |
| 624 | Ga0207648_10338752 | 3300026089 | Bacteria | 1354 |
| 625 | Ga0207648_10408765 | 3300026089 | Bacteria | 1231 |
| 626 | Ga0207648_10521432 | 3300026089 | Bacteria | 1089 |
| 627 | Ga0207648_10616807 | 3300026089 | Bacteria | 1001 |
| 628 | Ga0207648_10648523 | 3300026089 | Bacteria | 976 |
| 629 | Ga0207648_10938210 | 3300026089 | Bacteria | 809 |
| 630 | Ga0207648_11363671 | 3300026089 | Bacteria | 666 |
| 631 | Ga0207676_10028858 | 3300026095 | Bacteria | 4149 |
| 632 | Ga0207676_10038596 | 3300026095 | Bacteria | 3647 |
| 633 | Ga0207676_10084895 | 3300026095 | Bacteria | 2582 |
| 634 | Ga0207676_10242910 | 3300026095 | Bacteria | 1616 |
| 635 | Ga0207676_10269247 | 3300026095 | Bacteria | 1542 |
| 636 | Ga0207676_10722831 | 3300026095 | Bacteria | 966 |
| 637 | Ga0207674_10066692 | 3300026116 | Bacteria | 3624 |
| 638 | Ga0207674_10457960 | 3300026116 | Bacteria | 1233 |
| 639 | Ga0207674_10802411 | 3300026116 | Bacteria | 908 |
| 640 | Ga0207674_11158821 | 3300026116 | Bacteria | 742 |
| 641 | Ga0207674_11483297 | 3300026116 | Bacteria | 647 |
| 642 | Ga0207675_100012087 | 3300026118 | Bacteria | 8066 |
| 643 | Ga0207675_100055408 | 3300026118 | Bacteria | 3699 |
| 644 | Ga0207675_100270136 | 3300026118 | Bacteria | 1650 |
| 645 | Ga0207675_100685789 | 3300026118 | Bacteria | 1032 |
| 646 | Ga0207675_101177667 | 3300026118 | Bacteria | 787 |
| 647 | Ga0207683_10002658 | 3300026121 | Bacteria | 15609 |
| 648 | Ga0207683_10024382 | 3300026121 | Bacteria | 5210 |
| 649 | Ga0207683_10106353 | 3300026121 | Bacteria | 2509 |
| 650 | Ga0207683_10197116 | 3300026121 | Bacteria | 1830 |
| 651 | Ga0207683_10494706 | 3300026121 | Bacteria | 1129 |
| 652 | Ga0207683_10519610 | 3300026121 | Bacteria | 1100 |
| 653 | Ga0207683_10694932 | 3300026121 | Bacteria | 943 |
| 654 | Ga0207683_10980081 | 3300026121 | Bacteria | 785 |
| 655 | Ga0207683_11065038 | 3300026121 | Bacteria | 750 |
| 656 | Ga0207698_10004407 | 3300026142 | Bacteria | 8577 |
| 657 | Ga0207698_10011597 | 3300026142 | Bacteria | 5722 |
| 658 | Ga0207698_10372073 | 3300026142 | Bacteria | 1357 |
| 659 | Ga0207698_10385757 | 3300026142 | Bacteria | 1334 |
| 660 | Ga0207698_10632760 | 3300026142 | Bacteria | 1058 |
| 661 | Ga0207698_10951748 | 3300026142 | Bacteria | 868 |
| 662 | Ga0207698_11199941 | 3300026142 | Bacteria | 773 |
| 663 | Ga0207698_12325852 | 3300026142 | Bacteria | 548 |
| 664 | Ga0209813_10025988 | 3300027866 | Bacteria | 1689 |
| 665 | Ga0209974_10108363 | 3300027876 | Bacteria | 976 |
| 666 | Ga0207428_10208745 | 3300027907 | Bacteria | 1468 |
| 667 | Ga0268266_10021143 | 3300028379 | Bacteria | 5544 |
| 668 | Ga0268266_10310709 | 3300028379 | Bacteria | 1473 |
| 669 | Ga0268266_10336655 | 3300028379 | Bacteria | 1416 |
| 670 | Ga0268266_10750313 | 3300028379 | Bacteria | 942 |
| 671 | Ga0268266_10772781 | 3300028379 | Bacteria | 927 |
| 672 | Ga0268266_12152924 | 3300028379 | Bacteria | 530 |
| 673 | Ga0268266_12366112 | 3300028379 | Bacteria | 502 |
| 674 | Ga0268265_10009051 | 3300028380 | Bacteria | 6733 |
| 675 | Ga0268265_10069137 | 3300028380 | Bacteria | 2741 |
| 676 | Ga0268265_10254183 | 3300028380 | Bacteria | 1558 |
| 677 | Ga0268264_10081809 | 3300028381 | Bacteria | 2761 |
| 678 | Ga0268264_10117511 | 3300028381 | Bacteria | 2339 |
| 679 | Ga0268264_10166217 | 3300028381 | Bacteria | 1992 |
| 680 | Ga0268264_10240598 | 3300028381 | Bacteria | 1676 |
| 681 | Ga0268264_11175629 | 3300028381 | Bacteria | 776 |
| 682 | Ga0307517_10004486 | 3300028786 | Bacteria | 21426 |
| 683 | Ga0307517_10143293 | 3300028786 | Bacteria | 1668 |
| 684 | Ga0307517_10345304 | 3300028786 | Bacteria | 811 |
| 685 | Ga0307517_10380696 | 3300028786 | Bacteria | 754 |
| 686 | Ga0307515_10011753 | 3300028794 | Bacteria | 16566 |
| 687 | Ga0307515_10093089 | 3300028794 | Bacteria | 3742 |
| 688 | Ga0307515_10419442 | 3300028794 | Bacteria | 959 |
| 689 | Ga0307512_10049162 | 3300030522 | Bacteria | 3404 |
| 690 | Ga0307512_10364039 | 3300030522 | Bacteria | 629 |
| 691 | Ga0307512_10432363 | 3300030522 | Bacteria | 539 |
| 692 | Ga0307513_10218243 | 3300031456 | Bacteria | 1731 |
| 693 | Ga0307513_10269145 | 3300031456 | Bacteria | 1488 |
| 694 | Ga0307513_10321275 | 3300031456 | Bacteria | 1306 |
| 695 | Ga0307509_10000405 | 3300031507 | Bacteria | 72472 |
| 696 | Ga0307509_10012044 | 3300031507 | Bacteria | 10379 |
| 697 | Ga0307509_10015076 | 3300031507 | Bacteria | 9049 |
| 698 | Ga0307509_10169723 | 3300031507 | Bacteria | 2063 |
| 699 | Ga0307509_10193952 | 3300031507 | Bacteria | 1878 |
| 700 | Ga0307509_10196996 | 3300031507 | Bacteria | 1857 |
| 701 | Ga0307509_10234529 | 3300031507 | Bacteria | 1634 |
| 702 | Ga0307509_10304116 | 3300031507 | Bacteria | 1341 |
| 703 | Ga0307408_100001878 | 3300031548 | Bacteria | 15299 |
| 704 | Ga0307408_100969204 | 3300031548 | Bacteria | 782 |
| 705 | Ga0307408_101491191 | 3300031548 | Bacteria | 639 |
| 706 | Ga0307508_10004752 | 3300031616 | Bacteria | 13130 |
| 707 | Ga0307508_10123561 | 3300031616 | Bacteria | 2191 |
| 708 | Ga0307508_10232954 | 3300031616 | Bacteria | 1439 |
| 709 | Ga0307508_10283804 | 3300031616 | Bacteria | 1249 |
| 710 | Ga0307508_10660378 | 3300031616 | Bacteria | 651 |
| 711 | Ga0307514_10561509 | 3300031649 | Bacteria | 523 |
| 712 | Ga0307516_10001028 | 3300031730 | Bacteria | 38713 |
| 713 | Ga0307516_10001642 | 3300031730 | Bacteria | 30785 |
| 714 | Ga0307516_10048713 | 3300031730 | Bacteria | 4169 |
| 715 | Ga0307516_10286548 | 3300031730 | Bacteria | 1327 |
| 716 | Ga0307516_10403535 | 3300031730 | Bacteria | 1026 |
| 717 | Ga0307516_10450040 | 3300031730 | Bacteria | 944 |
| 718 | Ga0307516_10489815 | 3300031730 | Bacteria | 884 |
| 719 | Ga0307516_10544084 | 3300031730 | Bacteria | 815 |
| 720 | Ga0307405_10223750 | 3300031731 | Bacteria | 1382 |
| 721 | Ga0307405_10836870 | 3300031731 | Bacteria | 774 |
| 722 | Ga0307413_10030664 | 3300031824 | Bacteria | 3023 |
| 723 | Ga0307413_10080463 | 3300031824 | Bacteria | 2086 |
| 724 | Ga0307413_10728086 | 3300031824 | Bacteria | 827 |
| 725 | Ga0307410_10029244 | 3300031852 | Bacteria | 3507 |
| 726 | Ga0307410_10199727 | 3300031852 | Bacteria | 1526 |
| 727 | Ga0307410_10598432 | 3300031852 | Bacteria | 919 |
| 728 | Ga0307410_10602599 | 3300031852 | Bacteria | 916 |
| 729 | Ga0307406_10041914 | 3300031901 | Bacteria | 2855 |
| 730 | Ga0307406_10101387 | 3300031901 | Bacteria | 1962 |
| 731 | Ga0307406_10983346 | 3300031901 | Bacteria | 723 |
| 732 | Ga0307407_10057120 | 3300031903 | Bacteria | 2263 |
| 733 | Ga0307412_10095495 | 3300031911 | Bacteria | 2090 |
| 734 | Ga0307412_10212572 | 3300031911 | Bacteria | 1477 |
| 735 | Ga0307412_10353583 | 3300031911 | Bacteria | 1180 |
| 736 | Ga0307412_10470367 | 3300031911 | Bacteria | 1040 |
| 737 | Ga0307409_100067396 | 3300031995 | Bacteria | 2826 |
| 738 | Ga0307409_100604516 | 3300031995 | Bacteria | 1084 |
| 739 | Ga0307409_101037350 | 3300031995 | Bacteria | 839 |
| 740 | Ga0307416_100039492 | 3300032002 | Bacteria | 3655 |
| 741 | Ga0307416_100043918 | 3300032002 | Bacteria | 3505 |
| 742 | Ga0307416_100134299 | 3300032002 | Bacteria | 2235 |
| 743 | Ga0307416_100238961 | 3300032002 | Bacteria | 1758 |
| 744 | Ga0307416_101459125 | 3300032002 | Bacteria | 790 |
| 745 | Ga0307414_10159719 | 3300032004 | Bacteria | 1789 |
| 746 | Ga0307414_10160768 | 3300032004 | Bacteria | 1784 |
| 747 | Ga0307411_10001013 | 3300032005 | Bacteria | 10853 |
| 748 | Ga0307411_10295538 | 3300032005 | Bacteria | 1296 |
| 749 | Ga0307411_10461735 | 3300032005 | Bacteria | 1065 |
| 750 | Ga0307411_10518349 | 3300032005 | Bacteria | 1011 |
| 751 | Ga0307411_10561000 | 3300032005 | Bacteria | 976 |
| 752 | Ga0307411_11453152 | 3300032005 | Bacteria | 629 |
| 753 | Ga0307507_10125384 | 3300033179 | Bacteria | 2034 |
| 754 | Ga0307507_10425208 | 3300033179 | Bacteria | 744 |
| 755 | Ga0307510_10003419 | 3300033180 | Bacteria | 18519 |
| 756 | Ga0307510_10016969 | 3300033180 | Bacteria | 8587 |
| 757 | Ga0307510_10027695 | 3300033180 | Bacteria | 6486 |
| 758 | Ga0307510_10063734 | 3300033180 | Bacteria | 3750 |
| 759 | Ga0307510_10144662 | 3300033180 | Bacteria | 2012 |
| 760 | Ga0307510_10346113 | 3300033180 | Bacteria | 937 |
| 761 | Ga0373928_0033341 | 3300035084 | Bacteria | 1152 |
| 762 | Ga0373949_0076740 | 3300035090 | Bacteria | 884 |
| 763 | Ga0373946_0188725 | 3300035171 | Bacteria | 982 |
| 764 | Ga0373962_0281805 | 3300035242 | Bacteria | 585 |
| 765 | Ga0373931_0007514 | 3300035691 | Bacteria | 5133 |
| 766 | Ga0373947_0691068 | 3300035725 | Bacteria | 696 |
| 767 | Ga0373937_0181250 | 3300036401 | Bacteria | 1978 |
| 768 | Ga0373925_0260936 | 3300037068 | Bacteria | 1392 |
| 769 | Ga0373925_0306696 | 3300037068 | Bacteria | 1283 |
| 770 | Ga0395905_0018518 | 3300037471 | Bacteria | 6610 |
| 771 | Ga0395905_0115051 | 3300037471 | Bacteria | 2527 |
| 772 | Ga0395905_0211446 | 3300037471 | Bacteria | 1817 |
| 773 | Ga0395905_0795054 | 3300037471 | Bacteria | 849 |
| 774 | Ga0436361_0098091 | 3300039447 | Bacteria | 3975 |
| 775 | Ga0436361_0813098 | 3300039447 | Bacteria | 136133 |
| 776 | Ga0436363_0192400 | 3300039450 | Bacteria | 693 |
| 777 | Ga0439465_0335315 | 3300041413 | Bacteria | 570 |
| 778 | Ga0451787_398756 | 3300041441 | Bacteria | 723 |
| 779 | Ga0451789_0762797 | 3300041443 | Bacteria | 570 |
| 780 | Ga0451789_1294840 | 3300041443 | Bacteria | 549 |
| 781 | Ga0451793_0718359 | 3300041452 | Bacteria | 600 |
| 782 | Ga0451797_1495146 | 3300041453 | Bacteria | 552 |
| 783 | Ga0451795_0388746 | 3300041456 | Bacteria | 537 |
| 784 | Ga0451800_0517538 | 3300041459 | Bacteria | 1166 |
| 785 | Ga0451800_0691594 | 3300041459 | Bacteria | 631 |
| 786 | Ga0451802_0547687 | 3300041460 | Bacteria | 3814 |
| 787 | Ga0451807_0151166 | 3300041486 | Bacteria | 656 |
| 788 | Ga0451807_2629084 | 3300041486 | Bacteria | 714 |
| 789 | Ga0451833_0828330 | 3300041491 | Bacteria | 903 |
| 790 | Ga0451833_1322048 | 3300041491 | Bacteria | 574 |
| 791 | Ga0451835_0876415 | 3300041492 | Bacteria | 725 |
| 792 | Ga0451849_0798363 | 3300041505 | Bacteria | 553 |
| 793 | Ga0451851_0809976 | 3300041507 | Bacteria | 508 |
| 794 | Ga0451853_0687148 | 3300041512 | Bacteria | 1011 |
| 795 | Ga0451853_2072669 | 3300041512 | Bacteria | 617 |
| 796 | Ga0451853_3655248 | 3300041512 | Bacteria | 886 |
| 797 | Ga0439441_049695 | 3300042001 | Bacteria | 861 |
| 798 | Ga0439448_0180170 | 3300042005 | Bacteria | 738 |
| 799 | Ga0439455_0021077 | 3300042012 | Bacteria | 1551 |
| 800 | Ga0439455_0157156 | 3300042012 | Bacteria | 649 |
| 801 | Ga0439446_0092475 | 3300042156 | Bacteria | 948 |
| 802 | Ga0439464_0002359 | 3300042439 | Bacteria | 4640 |
| 803 | Ga0439460_0379642 | 3300042461 | Bacteria | 500 |
| 804 | Ga0451577_0004943 | 3300042876 | Bacteria | 13870 |
| 805 | Ga0451577_0063786 | 3300042876 | Bacteria | 3286 |
| 806 | Ga0466969_0000860 | 3300044656 | Bacteria | 16459 |
| 807 | Ga0466972_0206460 | 3300044658 | Bacteria | 920 |
| 808 | Ga0453683_0744322 | 3300044673 | Bacteria | 644 |
| 809 | Ga0466965_0029302 | 3300044683 | Bacteria | 2678 |
| 810 | Ga0466965_0199774 | 3300044683 | Bacteria | 1060 |
| 811 | Ga0466966_0311232 | 3300044684 | Bacteria | 946 |
| 812 | Ga0466961_0010705 | 3300044693 | Bacteria | 5859 |
| 813 | Ga0453684_0029228 | 3300044712 | Bacteria | 7838 |
| 814 | Ga0453684_0144657 | 3300044712 | Bacteria | 2834 |
| 815 | Ga0453684_0922518 | 3300044712 | Bacteria | 934 |
| 816 | Ga0466970_0170156 | 3300044765 | Bacteria | 1207 |
| 817 | Ga0466960_0176729 | 3300044901 | Bacteria | 1155 |
| 818 | Ga0466959_0267976 | 3300045049 | Bacteria | 1174 |
| 819 | Ga0451576_0479912 | 3300045051 | Bacteria | 1306 |
| 820 | Ga0495617_055008 | 3300046452 | Bacteria | 1320 |
| 821 | Ga0495592_0000528 | 3300046454 | Bacteria | 27565 |
| 822 | Ga0495592_0246343 | 3300046454 | Bacteria | 1183 |
| 823 | Ga0495590_0018281 | 3300046457 | Bacteria | 2510 |
| 824 | Ga0495629_0211042 | 3300046459 | Bacteria | 1341 |
| 825 | Ga0495638_0004523 | 3300046460 | Bacteria | 10535 |
| 826 | Ga0495580_0107207 | 3300046472 | Bacteria | 1940 |
| 827 | Ga0495605_0004232 | 3300046474 | Bacteria | 8451 |
| 828 | Ga0495584_0001867 | 3300046491 | Bacteria | 12189 |
| 829 | Ga0495584_0068955 | 3300046491 | Bacteria | 1776 |
| 830 | Ga0495585_0074940 | 3300046492 | Bacteria | 1840 |
| 831 | Ga0495594_0575797 | 3300046499 | Bacteria | 639 |
| 832 | Ga0495607_0040080 | 3300046501 | Bacteria | 2791 |
| 833 | Ga0495607_0066876 | 3300046501 | Bacteria | 2020 |
| 834 | Ga0495607_0175587 | 3300046501 | Bacteria | 1078 |
| 835 | Ga0495583_0001555 | 3300046506 | Bacteria | 22720 |
| 836 | Ga0495583_0143968 | 3300046506 | Bacteria | 991 |
| 837 | Ga0495606_0007799 | 3300046507 | Bacteria | 9473 |
| 838 | Ga0495606_0117924 | 3300046507 | Bacteria | 1592 |
| 839 | Ga0495606_0164460 | 3300046507 | Bacteria | 1292 |
| 840 | Ga0495606_0341593 | 3300046507 | Bacteria | 797 |
| 841 | Ga0495608_0724432 | 3300046511 | Bacteria | 591 |
| 842 | Ga0495616_0004741 | 3300046513 | Bacteria | 8526 |
| 843 | Ga0495616_0052594 | 3300046513 | Bacteria | 2027 |
| 844 | Ga0495620_0232947 | 3300046515 | Bacteria | 704 |
| 845 | Ga0495620_0281191 | 3300046515 | Bacteria | 633 |
| 846 | Ga0495630_0122940 | 3300046517 | Bacteria | 1969 |
| 847 | Ga0495632_0023035 | 3300046519 | Bacteria | 3330 |
| 848 | Ga0495632_0116379 | 3300046519 | Bacteria | 1252 |
| 849 | Ga0495632_0192975 | 3300046519 | Bacteria | 930 |
| 850 | Ga0495632_0280547 | 3300046519 | Bacteria | 742 |
| 851 | Ga0495632_0334097 | 3300046519 | Bacteria | 668 |
| 852 | Ga0495644_0002361 | 3300046523 | Bacteria | 7521 |
| 853 | Ga0495648_0003454 | 3300046524 | Bacteria | 13901 |
| 854 | Ga0495648_0351288 | 3300046524 | Bacteria | 673 |
| 855 | Ga0495666_0151471 | 3300046526 | Bacteria | 1078 |
| 856 | Ga0495642_0322436 | 3300046528 | Bacteria | 678 |
| 857 | Ga0495654_0008873 | 3300046530 | Bacteria | 5527 |
| 858 | Ga0495598_0062228 | 3300046537 | Bacteria | 1154 |
| 859 | Ga0495609_0001862 | 3300046538 | Bacteria | 13482 |
| 860 | Ga0495609_0050493 | 3300046538 | Bacteria | 1854 |
| 861 | Ga0495621_0122910 | 3300046539 | Bacteria | 1004 |
| 862 | Ga0495621_0526240 | 3300046539 | Bacteria | 512 |
| 863 | Ga0495597_0010750 | 3300046542 | Bacteria | 4460 |
| 864 | Ga0495597_0022118 | 3300046542 | Bacteria | 2951 |
| 865 | Ga0495597_0070235 | 3300046542 | Bacteria | 1510 |
| 866 | Ga0495622_0073490 | 3300046557 | Bacteria | 1577 |
| 867 | Ga0495622_0128267 | 3300046557 | Bacteria | 1156 |
| 868 | Ga0495633_0017117 | 3300046558 | Bacteria | 3715 |
| 869 | Ga0495633_0025217 | 3300046558 | Bacteria | 2928 |
| 870 | Ga0495633_0205740 | 3300046558 | Bacteria | 903 |
| 871 | Ga0495633_0366106 | 3300046558 | Bacteria | 653 |
| 872 | Ga0495656_0199628 | 3300046615 | Bacteria | 992 |
| 873 | Ga0495656_0721720 | 3300046615 | Bacteria | 537 |
| 874 | Ga0495668_0035434 | 3300046616 | Bacteria | 2798 |
| 875 | Ga0495668_0234797 | 3300046616 | Bacteria | 1004 |
| 876 | Ga0495668_0560540 | 3300046616 | Bacteria | 631 |
| 877 | Ga0495611_0002648 | 3300046648 | Bacteria | 8097 |
| 878 | Ga0495625_0007078 | 3300046660 | Bacteria | 9859 |
| 879 | Ga0495625_0007549 | 3300046660 | Bacteria | 9441 |
| 880 | Ga0495625_0023081 | 3300046660 | Bacteria | 4757 |
| 881 | Ga0495625_0339089 | 3300046660 | Bacteria | 953 |
| 882 | Ga0495625_0734200 | 3300046660 | Bacteria | 580 |
| 883 | Ga0495625_0870058 | 3300046660 | Bacteria | 519 |
| 884 | Ga0495659_0000345 | 3300046664 | Bacteria | 18182 |
| 885 | Ga0495659_0000524 | 3300046664 | Bacteria | 14141 |
| 886 | Ga0495661_0274167 | 3300046665 | Bacteria | 852 |
| 887 | Ga0495646_0339154 | 3300046680 | Bacteria | 789 |
| 888 | Ga0495658_0043155 | 3300046683 | Bacteria | 2521 |
| 889 | Ga0495658_0245873 | 3300046683 | Bacteria | 1124 |
| 890 | Ga0495658_0339260 | 3300046683 | Bacteria | 954 |
| 891 | Ga0495658_0429785 | 3300046683 | Bacteria | 843 |
| 892 | Ga0495613_0280342 | 3300046689 | Bacteria | 1158 |
| 893 | Ga0495670_0002602 | 3300046691 | Bacteria | 8915 |
| 894 | Ga0495670_0089367 | 3300046691 | Bacteria | 1575 |
| 895 | Ga0495670_0221475 | 3300046691 | Bacteria | 1005 |
| 896 | Ga0495671_0001130 | 3300046692 | Bacteria | 18376 |
| 897 | Ga0495671_0027894 | 3300046692 | Bacteria | 2911 |
| 898 | Ga0495671_0099900 | 3300046692 | Bacteria | 1419 |
| 899 | Ga0495649_0003993 | 3300046694 | Bacteria | 9723 |
| 900 | Ga0495649_0334166 | 3300046694 | Bacteria | 767 |
| 901 | Ga0495649_0493811 | 3300046694 | Bacteria | 609 |
| 902 | Ga0495589_0091284 | 3300046794 | Bacteria | 1479 |
| 903 | Ga0495589_0199789 | 3300046794 | Bacteria | 944 |
| 904 | Ga0495660_0002065 | 3300046810 | Bacteria | 13039 |
| 905 | Ga0495660_0037919 | 3300046810 | Bacteria | 2683 |
| 906 | Ga0495636_0000487 | 3300047318 | Bacteria | 14598 |
| 907 | Ga0495636_0143061 | 3300047318 | Bacteria | 1069 |
| 908 | Ga0495672_0000859 | 3300047320 | Bacteria | 32082 |
| 909 | Ga0495672_0008878 | 3300047320 | Bacteria | 7350 |
| 910 | Ga0495672_0020386 | 3300047320 | Bacteria | 4347 |
| 911 | Ga0495676_0019792 | 3300047321 | Bacteria | 5917 |
| 912 | Ga0495683_0003705 | 3300047323 | Bacteria | 8849 |
| 913 | Ga0495687_001797 | 3300047443 | Bacteria | 18906 |
| 914 | Ga0495687_005076 | 3300047443 | Bacteria | 8543 |
| 915 | Ga0495687_007155 | 3300047443 | Bacteria | 6646 |
| 916 | Ga0495677_0002310 | 3300047445 | Bacteria | 7517 |
| 917 | Ga0495685_000157 | 3300047447 | Bacteria | 23115 |
| 918 | Ga0495673_0009315 | 3300047469 | Bacteria | 5441 |
| 919 | Ga0495673_0234209 | 3300047469 | Bacteria | 675 |
| 920 | Ga0495686_0022949 | 3300047472 | Bacteria | 4122 |
| 921 | Ga0495686_0138968 | 3300047472 | Bacteria | 1434 |
| 922 | Ga0495686_0280092 | 3300047472 | Bacteria | 927 |
| 923 | Ga0495686_0600943 | 3300047472 | Bacteria | 570 |
| 924 | Ga0495593_0088879 | 3300047673 | Bacteria | 1592 |
| 925 | Ga0495626_0028432 | 3300048091 | Bacteria | 2711 |
| 926 | Ga0495626_0124891 | 3300048091 | Bacteria | 1103 |
| 927 | Ga0496100_0089918 | 3300048903 | Bacteria | 2093 |
| 928 | Ga0496100_1027182 | 3300048903 | Bacteria | 649 |
| 929 | Ga0496101_0255575 | 3300048904 | Bacteria | 1366 |
| 930 | Ga0496102_0018789 | 3300048905 | Bacteria | 6080 |
| 931 | Ga0496104_0043886 | 3300048907 | Bacteria | 4200 |
| 932 | Ga0496104_0077218 | 3300048907 | Bacteria | 3173 |
| 933 | Ga0496105_0061054 | 3300048908 | Bacteria | 3110 |
| 934 | Ga0496105_0147542 | 3300048908 | Bacteria | 1934 |
| 935 | Ga0496106_0007832 | 3300048909 | Bacteria | 7908 |
| 936 | Ga0496106_0385977 | 3300048909 | Bacteria | 1125 |
| 937 | Ga0496107_0482624 | 3300048910 | Bacteria | 920 |
| 938 | Ga0496108_0144096 | 3300048911 | Bacteria | 2053 |
| 939 | Ga0496108_0252797 | 3300048911 | Bacteria | 1533 |
| 940 | Ga0496108_0789342 | 3300048911 | Bacteria | 820 |
| 941 | Ga0496109_0874340 | 3300048912 | Bacteria | 837 |
| 942 | Ga0496110_0280909 | 3300048913 | Bacteria | 1516 |
| 943 | Ga0496112_0074682 | 3300048915 | Bacteria | 3352 |
| 944 | Ga0496113_0383216 | 3300048916 | Bacteria | 1128 |
| 945 | Ga0496114_0062845 | 3300048917 | Bacteria | 3108 |
| 946 | Ga0496114_0436284 | 3300048917 | Bacteria | 1160 |
| 947 | Ga0496125_0687232 | 3300048928 | Bacteria | 545 |
| 948 | Ga0495678_002154 | 3300049459 | Bacteria | 13912 |
| 949 | Ga0495682_0001880 | 3300049460 | Bacteria | 10462 |
| 950 | Ga0495682_0002150 | 3300049460 | Bacteria | 9565 |
| 951 | Ga0501292_068260 | 3300049515 | Bacteria | 657 |
| 952 | Ga0501034_0461977 | 3300049571 | Bacteria | 1186 |
| 953 | Ga0501037_0225616 | 3300049573 | Bacteria | 1317 |
| 954 | Ga0501039_0785637 | 3300049575 | Bacteria | 743 |
| 955 | Ga0501043_0000277 | 3300049579 | Bacteria | 46284 |
| 956 | Ga0501046_0000345 | 3300049580 | Bacteria | 46730 |
| 957 | Ga0501047_0000395 | 3300049581 | Bacteria | 48969 |
| 958 | Ga0501048_0000111 | 3300049582 | Bacteria | 46009 |
| 959 | Ga0501198_000023 | 3300049649 | Bacteria | 69100 |
| 960 | Ga0501201_038908 | 3300049651 | Bacteria | 566 |
| 961 | Ga0501206_009613 | 3300049653 | Bacteria | 1288 |
| 962 | Ga0501222_000031 | 3300049662 | Bacteria | 56867 |
| 963 | Ga0501222_014492 | 3300049662 | Bacteria | 1040 |
| 964 | Ga0501262_011227 | 3300049759 | Bacteria | 1131 |
| 965 | Ga0501263_064676 | 3300049760 | Bacteria | 580 |
| 966 | Ga0501265_000558 | 3300049762 | Bacteria | 3981 |
| 967 | Ga0501283_021568 | 3300049779 | Bacteria | 1034 |
| 968 | Ga0501044_0423434 | 3300049823 | Bacteria | 1241 |
| 969 | nmdc:mga03683_127196_c1 | 3300050489 | Bacteria | 1137 |
| 970 | nmdc:mga03683_13510_c1 | 3300050489 | Bacteria | 3007 |
| 971 | nmdc:mga03683_13639_c1 | 3300050489 | Bacteria | 2995 |
| 972 | nmdc:mga03683_452130_c1 | 3300050489 | Bacteria | 618 |
| 973 | nmdc:mga03683_48065_c1 | 3300050489 | Bacteria | 1772 |
| 974 | nmdc:mga03n38_184761_c1 | 3300050490 | Bacteria | 1070 |
| 975 | nmdc:mga03n38_75773_c1 | 3300050490 | Bacteria | 1568 |
| 976 | nmdc:mga00v17_263901_c1 | 3300050491 | Bacteria | 1117 |
| 977 | nmdc:mga00v17_65035_c1 | 3300050491 | Bacteria | 2249 |
| 978 | nmdc:mga0yw44_56212_c1 | 3300050492 | Bacteria | 2396 |
| 979 | nmdc:mga0k408_129748_c1 | 3300050493 | Bacteria | 556 |
| 980 | nmdc:mga0k408_203701_c1 | 3300050493 | Bacteria | 1181 |
| 981 | nmdc:mga0k408_214788_c1 | 3300050493 | Bacteria | 1149 |
| 982 | nmdc:mga0k408_284702_c1 | 3300050493 | Bacteria | 987 |
| 983 | nmdc:mga0k408_28979_c1 | 3300050493 | Bacteria | 3150 |
| 984 | nmdc:mga0k408_31847_c1 | 3300050493 | Bacteria | 3013 |
| 985 | nmdc:mga0k408_339950_c1 | 3300050493 | Bacteria | 895 |
| 986 | nmdc:mga0k408_37631_c1 | 3300050493 | Bacteria | 2778 |
| 987 | nmdc:mga0k408_38083_c1 | 3300050493 | Bacteria | 2761 |
| 988 | nmdc:mga0k408_382402_c1 | 3300050493 | Bacteria | 838 |
| 989 | nmdc:mga0k408_4980_c1 | 3300050493 | Bacteria | 7039 |
| 990 | nmdc:mga0k408_5321_c1 | 3300050493 | Bacteria | 6838 |
| 991 | nmdc:mga0k408_5383_c1 | 3300050493 | Bacteria | 6807 |
| 992 | nmdc:mga0k408_75494_c1 | 3300050493 | Bacteria | 1970 |
| 993 | nmdc:mga0k408_9031_c1 | 3300050493 | Bacteria | 5365 |
| 994 | nmdc:mga06z11_10035_c1 | 3300050494 | Bacteria | 4016 |
| 995 | nmdc:mga06z11_13948_c1 | 3300050494 | Bacteria | 3544 |
| 996 | nmdc:mga06z11_16145_c1 | 3300050494 | Bacteria | 3355 |
| 997 | nmdc:mga06z11_44839_c1 | 3300050494 | Bacteria | 2232 |
| 998 | nmdc:mga06z11_452992_c1 | 3300050494 | Bacteria | 775 |
| 999 | nmdc:mga04h51_277511_c1 | 3300050495 | Bacteria | 678 |
| 1000 | nmdc:mga07m45_13934_c1 | 3300050496 | Bacteria | 4274 |
| 1001 | nmdc:mga07m45_1876_c1 | 3300050496 | Bacteria | 9712 |
| 1002 | nmdc:mga07m45_2290_c1 | 3300050496 | Bacteria | 8955 |
| 1003 | nmdc:mga07m45_23091_c1 | 3300050496 | Bacteria | 3399 |
| 1004 | nmdc:mga07m45_30797_c1 | 3300050496 | Bacteria | 2973 |
| 1005 | nmdc:mga07m45_34263_c1 | 3300050496 | Bacteria | 2822 |
| 1006 | nmdc:mga07m45_444839_c1 | 3300050496 | Bacteria | 752 |
| 1007 | nmdc:mga07m45_4610_c1 | 3300050496 | Bacteria | 6757 |
| 1008 | nmdc:mga07m45_580003_c1 | 3300050496 | Bacteria | 648 |
| 1009 | nmdc:mga07m45_8408_c1 | 3300050496 | Bacteria | 5304 |
| 1010 | nmdc:mga07m45_921045_c1 | 3300050496 | Bacteria | 500 |
| 1011 | nmdc:mga05p37_66948_c1 | 3300050507 | Bacteria | 4418 |
| 1012 | nmdc:mga09592_9369_c1 | 3300050508 | Bacteria | 7965 |
| 1013 | nmdc:mga0qj67_41652_c1 | 3300050509 | Bacteria | 3613 |
| 1014 | nmdc:mga0sz30_165268_c1 | 3300050516 | Bacteria | 981 |
| 1015 | nmdc:mga0sz30_52667_c1 | 3300050516 | Bacteria | 1728 |
| 1016 | nmdc:mga0sz30_543115_c1 | 3300050516 | Bacteria | 524 |
| 1017 | nmdc:mga0sz30_9319_c1 | 3300050516 | Bacteria | 3732 |
| 1018 | Ga0495612_0198813 | 3300053078 | Bacteria | 884 |
| 1019 | Ga0500578_0037855 | 3300053086 | Bacteria | 3098 |
| 1020 | Ga0500578_0759735 | 3300053086 | Bacteria | 516 |
| 1021 | Ga0500646_0038237 | 3300053090 | Bacteria | 1343 |
| 1022 | Ga0500583_0503473 | 3300053092 | Bacteria | 568 |
| 1023 | Ga0500651_0045454 | 3300053093 | Bacteria | 2762 |
| 1024 | Ga0500651_0096277 | 3300053093 | Bacteria | 1819 |
| 1025 | Ga0500651_0170159 | 3300053093 | Bacteria | 1299 |
| 1026 | Ga0500650_0139340 | 3300053098 | Bacteria | 1125 |
| 1027 | Ga0500607_046582 | 3300053121 | Bacteria | 2324 |
| 1028 | Ga0500652_006725 | 3300053131 | Bacteria | 3721 |
| 1029 | Ga0500655_017681 | 3300053133 | Bacteria | 1320 |
| 1030 | Ga0500658_0006265 | 3300053134 | Bacteria | 4423 |
| 1031 | Ga0500559_0000265 | 3300053136 | Bacteria | 40939 |
| 1032 | Ga0500559_0564832 | 3300053136 | Bacteria | 518 |
| 1033 | Ga0500561_0181695 | 3300053137 | Bacteria | 662 |
| 1034 | Ga0500564_133917 | 3300053138 | Bacteria | 1070 |
| 1035 | Ga0500568_0011911 | 3300053139 | Bacteria | 4014 |
| 1036 | Ga0500568_0045866 | 3300053139 | Bacteria | 1738 |
| 1037 | Ga0500590_232170 | 3300053148 | Bacteria | 750 |
| 1038 | Ga0500619_000116 | 3300053154 | Bacteria | 21263 |
| 1039 | Ga0500620_258650 | 3300053155 | Bacteria | 577 |
| 1040 | Ga0500622_0002039 | 3300053156 | Bacteria | 15066 |
| 1041 | Ga0500627_0380069 | 3300053158 | Bacteria | 605 |
| 1042 | Ga0500633_0306625 | 3300053160 | Bacteria | 583 |
| 1043 | Ga0500636_0053627 | 3300053177 | Bacteria | 2366 |
| 1044 | Ga0500649_123212 | 3300053722 | Bacteria | 984 |
| 1045 | Ga0500645_003124 | 3300053730 | Bacteria | 6902 |
| 1046 | Ga0500587_030467 | 3300053739 | Bacteria | 738 |
| 1047 | Ga0590071_002620 | 3300059421 | Bacteria | 4521 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0922518 | Ga0453684_0922518_115_423 | 100 |
| 2 | 3300045051 | Ga0451576_0479912 | Ga0451576_0479912_827_1135 | 100 |
| 3 | 3300005436 | Ga0070713_100000031 | Ga0070713_10000003162 | 102 |
| 4 | 3300006175 | Ga0070712_100203974 | Ga0070712_1002039742 | 102 |
| 5 | 3300025915 | Ga0207693_10463920 | Ga0207693_104639202 | 102 |
| 6 | 3300025928 | Ga0207700_10012392 | Ga0207700_100123925 | 102 |
| 7 | 3300025936 | Ga0207670_10607228 | Ga0207670_106072282 | 102 |
| 8 | 3300031548 | Ga0307408_100001878 | Ga0307408_1000018788 | 102 |
| 9 | 3300044658 | Ga0466972_0206460 | Ga0466972_0206460_327_647 | 102 |
| 10 | 3300044683 | Ga0466965_0029302 | Ga0466965_0029302_848_1168 | 102 |
| 11 | 3300044901 | Ga0466960_0176729 | Ga0466960_0176729_644_964 | 102 |
| 12 | 3300046452 | Ga0495617_055008 | Ga0495617_055008_939_1256 | 102 |
| 13 | 3300046457 | Ga0495590_0018281 | Ga0495590_0018281_327_644 | 102 |
| 14 | 3300046460 | Ga0495638_0004523 | Ga0495638_0004523_3560_3877 | 102 |
| 15 | 3300046474 | Ga0495605_0004232 | Ga0495605_0004232_1483_1800 | 102 |
| 16 | 3300046491 | Ga0495584_0001867 | Ga0495584_0001867_8854_9171 | 102 |
| 17 | 3300046491 | Ga0495584_0068955 | Ga0495584_0068955_1205_1522 | 102 |
| 18 | 3300046492 | Ga0495585_0074940 | Ga0495585_0074940_1169_1486 | 102 |
| 19 | 3300046501 | Ga0495607_0040080 | Ga0495607_0040080_367_684 | 102 |
| 20 | 3300046501 | Ga0495607_0066876 | Ga0495607_0066876_1654_1971 | 102 |
| 21 | 3300046501 | Ga0495607_0175587 | Ga0495607_0175587_548_868 | 102 |
| 22 | 3300046506 | Ga0495583_0001555 | Ga0495583_0001555_6556_6873 | 102 |
| 23 | 3300046507 | Ga0495606_0007799 | Ga0495606_0007799_6483_6803 | 102 |
| 24 | 3300046507 | Ga0495606_0117924 | Ga0495606_0117924_1175_1495 | 102 |
| 25 | 3300046507 | Ga0495606_0341593 | Ga0495606_0341593_380_700 | 102 |
| 26 | 3300046513 | Ga0495616_0004741 | Ga0495616_0004741_7455_7772 | 102 |
| 27 | 3300046513 | Ga0495616_0052594 | Ga0495616_0052594_1309_1626 | 102 |
| 28 | 3300046519 | Ga0495632_0116379 | Ga0495632_0116379_302_619 | 102 |
| 29 | 3300046523 | Ga0495644_0002361 | Ga0495644_0002361_4335_4652 | 102 |
| 30 | 3300046524 | Ga0495648_0003454 | Ga0495648_0003454_7031_7348 | 102 |
| 31 | 3300046530 | Ga0495654_0008873 | Ga0495654_0008873_4391_4711 | 102 |
| 32 | 3300046538 | Ga0495609_0001862 | Ga0495609_0001862_10650_10967 | 102 |
| 33 | 3300046538 | Ga0495609_0050493 | Ga0495609_0050493_622_942 | 102 |
| 34 | 3300046542 | Ga0495597_0022118 | Ga0495597_0022118_1835_2155 | 102 |
| 35 | 3300046557 | Ga0495622_0128267 | Ga0495622_0128267_575_892 | 102 |
| 36 | 3300046558 | Ga0495633_0017117 | Ga0495633_0017117_2659_2976 | 102 |
| 37 | 3300046558 | Ga0495633_0025217 | Ga0495633_0025217_2308_2625 | 102 |
| 38 | 3300046648 | Ga0495611_0002648 | Ga0495611_0002648_7081_7398 | 102 |
| 39 | 3300046660 | Ga0495625_0007078 | Ga0495625_0007078_1878_2198 | 102 |
| 40 | 3300046660 | Ga0495625_0007549 | Ga0495625_0007549_3583_3900 | 102 |
| 41 | 3300046660 | Ga0495625_0734200 | Ga0495625_0734200_184_504 | 102 |
| 42 | 3300046664 | Ga0495659_0000345 | Ga0495659_0000345_11017_11337 | 102 |
| 43 | 3300046664 | Ga0495659_0000524 | Ga0495659_0000524_2396_2713 | 102 |
| 44 | 3300046665 | Ga0495661_0274167 | Ga0495661_0274167_349_666 | 102 |
| 45 | 3300046691 | Ga0495670_0002602 | Ga0495670_0002602_5740_6057 | 102 |
| 46 | 3300046691 | Ga0495670_0089367 | Ga0495670_0089367_57_374 | 102 |
| 47 | 3300046692 | Ga0495671_0001130 | Ga0495671_0001130_6977_7297 | 102 |
| 48 | 3300046692 | Ga0495671_0027894 | Ga0495671_0027894_2013_2330 | 102 |
| 49 | 3300046694 | Ga0495649_0493811 | Ga0495649_0493811_93_413 | 102 |
| 50 | 3300046794 | Ga0495589_0091284 | Ga0495589_0091284_450_770 | 102 |
| 51 | 3300046794 | Ga0495589_0199789 | Ga0495589_0199789_594_911 | 102 |
| 52 | 3300046810 | Ga0495660_0002065 | Ga0495660_0002065_6563_6883 | 102 |
| 53 | 3300047318 | Ga0495636_0000487 | Ga0495636_0000487_3114_3431 | 102 |
| 54 | 3300047320 | Ga0495672_0000859 | Ga0495672_0000859_24916_25236 | 102 |
| 55 | 3300047320 | Ga0495672_0008878 | Ga0495672_0008878_5670_5987 | 102 |
| 56 | 3300047320 | Ga0495672_0020386 | Ga0495672_0020386_934_1251 | 102 |
| 57 | 3300047323 | Ga0495683_0003705 | Ga0495683_0003705_1989_2306 | 102 |
| 58 | 3300047443 | Ga0495687_005076 | Ga0495687_005076_1664_1981 | 102 |
| 59 | 3300047445 | Ga0495677_0002310 | Ga0495677_0002310_5999_6316 | 102 |
| 60 | 3300047447 | Ga0495685_000157 | Ga0495685_000157_16236_16553 | 102 |
| 61 | 3300047469 | Ga0495673_0009315 | Ga0495673_0009315_1242_1559 | 102 |
| 62 | 3300047469 | Ga0495673_0234209 | Ga0495673_0234209_298_615 | 102 |
| 63 | 3300047472 | Ga0495686_0022949 | Ga0495686_0022949_190_510 | 102 |
| 64 | 3300047472 | Ga0495686_0280092 | Ga0495686_0280092_383_700 | 102 |
| 65 | 3300049459 | Ga0495678_002154 | Ga0495678_002154_7033_7350 | 102 |
| 66 | 3300049460 | Ga0495682_0001880 | Ga0495682_0001880_3583_3900 | 102 |
| 67 | 3300049460 | Ga0495682_0002150 | Ga0495682_0002150_7822_8139 | 102 |
| 68 | iso_pu_bacteria | 2643221645 | 2644251728 | 102 |
| 69 | iso_pu_bacteria | 2643221664 | 2644356084 | 102 |
| 70 | iso_pu_bacteria | 2738541280 | 2738742644 | 102 |
| 71 | iso_pu_bacteria | 2738541300 | 2738842342 | 102 |
| 72 | iso_pu_bacteria | 2738543018 | 2739273096 | 102 |
| 73 | iso_pu_bacteria | 2738543030 | 2739342140 | 102 |
| 74 | 3300037471 | Ga0395905_0795054 | Ga0395905_0795054_274_627 | 104 |
| 75 | iso_pu_bacteria | 2643221654 | 2644303493 | 104 |
| 76 | iso_pu_bacteria | 2928115317 | 2928118931 | 105 |
| 77 | 3300005331 | Ga0070670_100019018 | Ga0070670_1000190186 | 107 |
| 78 | 3300005333 | Ga0070677_10039794 | Ga0070677_100397942 | 107 |
| 79 | 3300005334 | Ga0068869_100177501 | Ga0068869_1001775013 | 107 |
| 80 | 3300005335 | Ga0070666_10756903 | Ga0070666_107569032 | 107 |
| 81 | 3300005338 | Ga0068868_100108975 | Ga0068868_1001089753 | 107 |
| 82 | 3300005338 | Ga0068868_100760915 | Ga0068868_1007609152 | 107 |
| 83 | 3300005353 | Ga0070669_101004781 | Ga0070669_1010047811 | 107 |
| 84 | 3300005354 | Ga0070675_100218486 | Ga0070675_1002184862 | 107 |
| 85 | 3300005355 | Ga0070671_100089324 | Ga0070671_1000893243 | 107 |
| 86 | 3300005364 | Ga0070673_100003372 | Ga0070673_1000033725 | 107 |
| 87 | 3300005367 | Ga0070667_100376399 | Ga0070667_1003763993 | 107 |
| 88 | 3300005367 | Ga0070667_100788205 | Ga0070667_1007882052 | 107 |
| 89 | 3300005455 | Ga0070663_100032448 | Ga0070663_1000324483 | 107 |
| 90 | 3300005456 | Ga0070678_100778852 | Ga0070678_1007788522 | 107 |
| 91 | 3300005457 | Ga0070662_100076193 | Ga0070662_1000761933 | 107 |
| 92 | 3300005457 | Ga0070662_100970130 | Ga0070662_1009701302 | 107 |
| 93 | 3300005459 | Ga0068867_100006908 | Ga0068867_1000069084 | 107 |
| 94 | 3300005467 | Ga0070706_100000367 | Ga0070706_10000036719 | 107 |
| 95 | 3300005468 | Ga0070707_100054004 | Ga0070707_1000540044 | 107 |
| 96 | 3300005471 | Ga0070698_100327392 | Ga0070698_1003273922 | 107 |
| 97 | 3300005518 | Ga0070699_100030764 | Ga0070699_1000307643 | 107 |
| 98 | 3300005539 | Ga0068853_101735799 | Ga0068853_1017357992 | 107 |
| 99 | 3300005543 | Ga0070672_100133758 | Ga0070672_1001337582 | 107 |
| 100 | 3300005548 | Ga0070665_100335794 | Ga0070665_1003357942 | 107 |
| 101 | 3300005577 | Ga0068857_100095028 | Ga0068857_1000950283 | 107 |
| 102 | 3300005577 | Ga0068857_100447095 | Ga0068857_1004470952 | 107 |
| 103 | 3300005577 | Ga0068857_101461259 | Ga0068857_1014612591 | 107 |
| 104 | 3300005578 | Ga0068854_100156755 | Ga0068854_1001567552 | 107 |
| 105 | 3300005616 | Ga0068852_100607949 | Ga0068852_1006079492 | 107 |
| 106 | 3300005617 | Ga0068859_100986015 | Ga0068859_1009860152 | 107 |
| 107 | 3300005618 | Ga0068864_100118711 | Ga0068864_1001187111 | 107 |
| 108 | 3300005840 | Ga0068870_10104166 | Ga0068870_101041662 | 107 |
| 109 | 3300005840 | Ga0068870_10353722 | Ga0068870_103537222 | 107 |
| 110 | 3300005841 | Ga0068863_100094986 | Ga0068863_1000949863 | 107 |
| 111 | 3300006038 | Ga0075365_10314835 | Ga0075365_103148352 | 107 |
| 112 | 3300006042 | Ga0075368_10003231 | Ga0075368_100032312 | 107 |
| 113 | 3300006042 | Ga0075368_10005709 | Ga0075368_100057092 | 107 |
| 114 | 3300006048 | Ga0075363_100000145 | Ga0075363_10000014514 | 107 |
| 115 | 3300006048 | Ga0075363_100012536 | Ga0075363_1000125364 | 107 |
| 116 | 3300006048 | Ga0075363_100454751 | Ga0075363_1004547512 | 107 |
| 117 | 3300006048 | Ga0075363_100539762 | Ga0075363_1005397622 | 107 |
| 118 | 3300006051 | Ga0075364_10013229 | Ga0075364_100132294 | 107 |
| 119 | 3300006051 | Ga0075364_10264221 | Ga0075364_102642212 | 107 |
| 120 | 3300006177 | Ga0075362_10000580 | Ga0075362_100005807 | 107 |
| 121 | 3300006177 | Ga0075362_10003899 | Ga0075362_100038997 | 107 |
| 122 | 3300006177 | Ga0075362_10292023 | Ga0075362_102920232 | 107 |
| 123 | 3300006178 | Ga0075367_10002249 | Ga0075367_100022492 | 107 |
| 124 | 3300006178 | Ga0075367_10004330 | Ga0075367_100043307 | 107 |
| 125 | 3300006178 | Ga0075367_10021570 | Ga0075367_100215703 | 107 |
| 126 | 3300006178 | Ga0075367_10026303 | Ga0075367_100263032 | 107 |
| 127 | 3300006178 | Ga0075367_10513061 | Ga0075367_105130612 | 107 |
| 128 | 3300006186 | Ga0075369_10003203 | Ga0075369_100032034 | 107 |
| 129 | 3300006195 | Ga0075366_10000582 | Ga0075366_1000058218 | 107 |
| 130 | 3300006195 | Ga0075366_10009057 | Ga0075366_100090575 | 107 |
| 131 | 3300006195 | Ga0075366_10010938 | Ga0075366_100109383 | 107 |
| 132 | 3300006195 | Ga0075366_10117119 | Ga0075366_101171192 | 107 |
| 133 | 3300006195 | Ga0075366_10547006 | Ga0075366_105470062 | 107 |
| 134 | 3300006195 | Ga0075366_10577617 | Ga0075366_105776172 | 107 |
| 135 | 3300006353 | Ga0075370_10000854 | Ga0075370_1000085412 | 107 |
| 136 | 3300006353 | Ga0075370_10002800 | Ga0075370_1000280010 | 107 |
| 137 | 3300006353 | Ga0075370_10003383 | Ga0075370_100033833 | 107 |
| 138 | 3300006353 | Ga0075370_10045133 | Ga0075370_100451333 | 107 |
| 139 | 3300006881 | Ga0068865_101692914 | Ga0068865_1016929142 | 107 |
| 140 | 3300006931 | Ga0097620_100986196 | Ga0097620_1009861962 | 107 |
| 141 | 3300009092 | Ga0105250_10091014 | Ga0105250_100910142 | 107 |
| 142 | 3300009093 | Ga0105240_10081673 | Ga0105240_100816734 | 107 |
| 143 | 3300009148 | Ga0105243_10035667 | Ga0105243_100356672 | 107 |
| 144 | 3300009148 | Ga0105243_10718625 | Ga0105243_107186252 | 107 |
| 145 | 3300009174 | Ga0105241_10277484 | Ga0105241_102774843 | 107 |
| 146 | 3300009177 | Ga0105248_10044143 | Ga0105248_100441433 | 107 |
| 147 | 3300009177 | Ga0105248_11059248 | Ga0105248_110592482 | 107 |
| 148 | 3300009553 | Ga0105249_11514723 | Ga0105249_115147232 | 107 |
| 149 | 3300010375 | Ga0105239_10050251 | Ga0105239_100502515 | 107 |
| 150 | 3300011119 | Ga0105246_10219053 | Ga0105246_102190532 | 107 |
| 151 | 3300011119 | Ga0105246_10969817 | Ga0105246_109698172 | 107 |
| 152 | 3300014325 | Ga0163163_10775432 | Ga0163163_107754322 | 107 |
| 153 | 3300025893 | Ga0207682_10021298 | Ga0207682_100212983 | 107 |
| 154 | 3300025893 | Ga0207682_10335808 | Ga0207682_103358082 | 107 |
| 155 | 3300025903 | Ga0207680_10189659 | Ga0207680_101896592 | 107 |
| 156 | 3300025907 | Ga0207645_10038838 | Ga0207645_100388384 | 107 |
| 157 | 3300025908 | Ga0207643_10447133 | Ga0207643_104471332 | 107 |
| 158 | 3300025910 | Ga0207684_10008798 | Ga0207684_100087986 | 107 |
| 159 | 3300025913 | Ga0207695_10199733 | Ga0207695_101997332 | 107 |
| 160 | 3300025922 | Ga0207646_10067500 | Ga0207646_100675002 | 107 |
| 161 | 3300025923 | Ga0207681_10510064 | Ga0207681_105100642 | 107 |
| 162 | 3300025925 | Ga0207650_10328804 | Ga0207650_103288042 | 107 |
| 163 | 3300025926 | Ga0207659_10395497 | Ga0207659_103954972 | 107 |
| 164 | 3300025931 | Ga0207644_10016461 | Ga0207644_100164614 | 107 |
| 165 | 3300025931 | Ga0207644_10045088 | Ga0207644_100450883 | 107 |
| 166 | 3300025933 | Ga0207706_10020545 | Ga0207706_100205453 | 107 |
| 167 | 3300025933 | Ga0207706_10092441 | Ga0207706_100924413 | 107 |
| 168 | 3300025935 | Ga0207709_10038669 | Ga0207709_100386693 | 107 |
| 169 | 3300025935 | Ga0207709_10190764 | Ga0207709_101907643 | 107 |
| 170 | 3300025938 | Ga0207704_10046121 | Ga0207704_100461214 | 107 |
| 171 | 3300025940 | Ga0207691_10041584 | Ga0207691_100415844 | 107 |
| 172 | 3300025942 | Ga0207689_10051233 | Ga0207689_100512332 | 107 |
| 173 | 3300025942 | Ga0207689_10183308 | Ga0207689_101833083 | 107 |
| 174 | 3300025945 | Ga0207679_11795853 | Ga0207679_117958531 | 107 |
| 175 | 3300025960 | Ga0207651_10007014 | Ga0207651_100070145 | 107 |
| 176 | 3300025981 | Ga0207640_10148648 | Ga0207640_101486483 | 107 |
| 177 | 3300025986 | Ga0207658_10126880 | Ga0207658_101268802 | 107 |
| 178 | 3300025986 | Ga0207658_11120673 | Ga0207658_111206731 | 107 |
| 179 | 3300026023 | Ga0207677_10144850 | Ga0207677_101448502 | 107 |
| 180 | 3300026041 | Ga0207639_10041469 | Ga0207639_100414692 | 107 |
| 181 | 3300026041 | Ga0207639_10613085 | Ga0207639_106130851 | 107 |
| 182 | 3300026067 | Ga0207678_10058082 | Ga0207678_100580823 | 107 |
| 183 | 3300026067 | Ga0207678_10958979 | Ga0207678_109589791 | 107 |
| 184 | 3300026088 | Ga0207641_10221469 | Ga0207641_102214692 | 107 |
| 185 | 3300026089 | Ga0207648_10011874 | Ga0207648_100118744 | 107 |
| 186 | 3300026089 | Ga0207648_10338752 | Ga0207648_103387523 | 107 |
| 187 | 3300026095 | Ga0207676_10269247 | Ga0207676_102692473 | 107 |
| 188 | 3300026116 | Ga0207674_10066692 | Ga0207674_100666923 | 107 |
| 189 | 3300026116 | Ga0207674_10457960 | Ga0207674_104579602 | 107 |
| 190 | 3300026116 | Ga0207674_11483297 | Ga0207674_114832972 | 107 |
| 191 | 3300026118 | Ga0207675_101177667 | Ga0207675_1011776672 | 107 |
| 192 | 3300026121 | Ga0207683_10519610 | Ga0207683_105196102 | 107 |
| 193 | 3300026142 | Ga0207698_10372073 | Ga0207698_103720732 | 107 |
| 194 | 3300027866 | Ga0209813_10025988 | Ga0209813_100259883 | 107 |
| 195 | 3300028379 | Ga0268266_10750313 | Ga0268266_107503132 | 107 |
| 196 | 3300028786 | Ga0307517_10380696 | Ga0307517_103806962 | 107 |
| 197 | 3300028794 | Ga0307515_10419442 | Ga0307515_104194422 | 107 |
| 198 | 3300030522 | Ga0307512_10364039 | Ga0307512_103640392 | 107 |
| 199 | 3300031548 | Ga0307408_100969204 | Ga0307408_1009692042 | 107 |
| 200 | 3300031616 | Ga0307508_10123561 | Ga0307508_101235611 | 107 |
| 201 | 3300031730 | Ga0307516_10048713 | Ga0307516_100487133 | 107 |
| 202 | 3300031730 | Ga0307516_10489815 | Ga0307516_104898152 | 107 |
| 203 | 3300031852 | Ga0307410_10598432 | Ga0307410_105984321 | 107 |
| 204 | 3300031911 | Ga0307412_10095495 | Ga0307412_100954953 | 107 |
| 205 | 3300032002 | Ga0307416_100043918 | Ga0307416_1000439184 | 107 |
| 206 | 3300032005 | Ga0307411_10518349 | Ga0307411_105183492 | 107 |
| 207 | 3300033180 | Ga0307510_10063734 | Ga0307510_100637342 | 107 |
| 208 | 3300041413 | Ga0439465_0335315 | Ga0439465_0335315_87_410 | 107 |
| 209 | 3300041443 | Ga0451789_1294840 | Ga0451789_1294840_94_417 | 107 |
| 210 | 3300041456 | Ga0451795_0388746 | Ga0451795_0388746_179_502 | 107 |
| 211 | 3300041505 | Ga0451849_0798363 | Ga0451849_0798363_23_346 | 107 |
| 212 | 3300046506 | Ga0495583_0143968 | Ga0495583_0143968_650_973 | 107 |
| 213 | 3300046519 | Ga0495632_0023035 | Ga0495632_0023035_1497_1820 | 107 |
| 214 | 3300046519 | Ga0495632_0280547 | Ga0495632_0280547_269_592 | 107 |
| 215 | 3300046524 | Ga0495648_0351288 | Ga0495648_0351288_232_555 | 107 |
| 216 | 3300046542 | Ga0495597_0010750 | Ga0495597_0010750_3621_3944 | 107 |
| 217 | 3300046542 | Ga0495597_0070235 | Ga0495597_0070235_868_1191 | 107 |
| 218 | 3300046616 | Ga0495668_0234797 | Ga0495668_0234797_429_752 | 107 |
| 219 | 3300046660 | Ga0495625_0023081 | Ga0495625_0023081_3360_3683 | 107 |
| 220 | 3300046660 | Ga0495625_0339089 | Ga0495625_0339089_312_635 | 107 |
| 221 | 3300046694 | Ga0495649_0003993 | Ga0495649_0003993_5189_5512 | 107 |
| 222 | 3300046694 | Ga0495649_0334166 | Ga0495649_0334166_39_362 | 107 |
| 223 | 3300046810 | Ga0495660_0037919 | Ga0495660_0037919_1823_2146 | 107 |
| 224 | 3300047443 | Ga0495687_001797 | Ga0495687_001797_9197_9520 | 107 |
| 225 | 3300047443 | Ga0495687_007155 | Ga0495687_007155_2526_2849 | 107 |
| 226 | 3300048091 | Ga0495626_0028432 | Ga0495626_0028432_1897_2220 | 107 |
| 227 | 3300048091 | Ga0495626_0124891 | Ga0495626_0124891_223_546 | 107 |
| 228 | 3300048903 | Ga0496100_0089918 | Ga0496100_0089918_1426_1749 | 107 |
| 229 | 3300048904 | Ga0496101_0255575 | Ga0496101_0255575_156_479 | 107 |
| 230 | 3300048907 | Ga0496104_0077218 | Ga0496104_0077218_715_1038 | 107 |
| 231 | 3300048908 | Ga0496105_0147542 | Ga0496105_0147542_964_1287 | 107 |
| 232 | 3300048911 | Ga0496108_0252797 | Ga0496108_0252797_920_1243 | 107 |
| 233 | 3300048915 | Ga0496112_0074682 | Ga0496112_0074682_229_552 | 107 |
| 234 | 3300048916 | Ga0496113_0383216 | Ga0496113_0383216_353_676 | 107 |
| 235 | 3300049515 | Ga0501292_068260 | Ga0501292_068260_191_520 | 107 |
| 236 | 3300049651 | Ga0501201_038908 | Ga0501201_038908_92_424 | 107 |
| 237 | 3300050489 | nmdc:mga03683_13510_c1 | nmdc:mga03683_13510_c1_1713_2036 | 107 |
| 238 | 3300050490 | nmdc:mga03n38_75773_c1 | nmdc:mga03n38_75773_c1_822_1145 | 107 |
| 239 | 3300050491 | nmdc:mga00v17_65035_c1 | nmdc:mga00v17_65035_c1_601_924 | 107 |
| 240 | 3300050492 | nmdc:mga0yw44_56212_c1 | nmdc:mga0yw44_56212_c1_1608_1931 | 107 |
| 241 | 3300050493 | nmdc:mga0k408_129748_c1 | nmdc:mga0k408_129748_c1_218_541 | 107 |
| 242 | 3300050493 | nmdc:mga0k408_203701_c1 | nmdc:mga0k408_203701_c1_842_1165 | 107 |
| 243 | 3300050493 | nmdc:mga0k408_284702_c1 | nmdc:mga0k408_284702_c1_381_704 | 107 |
| 244 | 3300050493 | nmdc:mga0k408_28979_c1 | nmdc:mga0k408_28979_c1_279_602 | 107 |
| 245 | 3300050493 | nmdc:mga0k408_38083_c1 | nmdc:mga0k408_38083_c1_1378_1701 | 107 |
| 246 | 3300050493 | nmdc:mga0k408_382402_c1 | nmdc:mga0k408_382402_c1_463_786 | 107 |
| 247 | 3300050493 | nmdc:mga0k408_4980_c1 | nmdc:mga0k408_4980_c1_1255_1578 | 107 |
| 248 | 3300050493 | nmdc:mga0k408_5321_c1 | nmdc:mga0k408_5321_c1_4296_4619 | 107 |
| 249 | 3300050493 | nmdc:mga0k408_5383_c1 | nmdc:mga0k408_5383_c1_5340_5678 | 107 |
| 250 | 3300050493 | nmdc:mga0k408_9031_c1 | nmdc:mga0k408_9031_c1_2635_2958 | 107 |
| 251 | 3300050494 | nmdc:mga06z11_10035_c1 | nmdc:mga06z11_10035_c1_3189_3527 | 107 |
| 252 | 3300050494 | nmdc:mga06z11_13948_c1 | nmdc:mga06z11_13948_c1_2966_3289 | 107 |
| 253 | 3300050494 | nmdc:mga06z11_16145_c1 | nmdc:mga06z11_16145_c1_2358_2681 | 107 |
| 254 | 3300050494 | nmdc:mga06z11_44839_c1 | nmdc:mga06z11_44839_c1_1357_1680 | 107 |
| 255 | 3300050495 | nmdc:mga04h51_277511_c1 | nmdc:mga04h51_277511_c1_229_567 | 107 |
| 256 | 3300050496 | nmdc:mga07m45_1876_c1 | nmdc:mga07m45_1876_c1_7271_7594 | 107 |
| 257 | 3300050496 | nmdc:mga07m45_2290_c1 | nmdc:mga07m45_2290_c1_35_358 | 107 |
| 258 | 3300050496 | nmdc:mga07m45_23091_c1 | nmdc:mga07m45_23091_c1_781_1119 | 107 |
| 259 | 3300050496 | nmdc:mga07m45_30797_c1 | nmdc:mga07m45_30797_c1_2372_2695 | 107 |
| 260 | 3300050496 | nmdc:mga07m45_444839_c1 | nmdc:mga07m45_444839_c1_72_395 | 107 |
| 261 | 3300050496 | nmdc:mga07m45_4610_c1 | nmdc:mga07m45_4610_c1_4204_4527 | 107 |
| 262 | 3300050496 | nmdc:mga07m45_8408_c1 | nmdc:mga07m45_8408_c1_2275_2598 | 107 |
| 263 | 3300050516 | nmdc:mga0sz30_165268_c1 | nmdc:mga0sz30_165268_c1_411_734 | 107 |
| 264 | 3300050516 | nmdc:mga0sz30_52667_c1 | nmdc:mga0sz30_52667_c1_614_937 | 107 |
| 265 | 3300050516 | nmdc:mga0sz30_9319_c1 | nmdc:mga0sz30_9319_c1_2352_2675 | 107 |
| 266 | 3300053086 | Ga0500578_0759735 | Ga0500578_0759735_115_438 | 107 |
| 267 | 3300053093 | Ga0500651_0096277 | Ga0500651_0096277_1051_1374 | 107 |
| 268 | 3300053134 | Ga0500658_0006265 | Ga0500658_0006265_930_1253 | 107 |
| 269 | 3300053139 | Ga0500568_0011911 | Ga0500568_0011911_3543_3866 | 107 |
| 270 | 3300053160 | Ga0500633_0306625 | Ga0500633_0306625_92_415 | 107 |
| 271 | 3300001979 | JGI24740J21852_10019594 | JGI24740J21852_100195943 | 108 |
| 272 | 3300003215 | JGI25153J46596_10006137 | JGI25153J46596_100061377 | 108 |
| 273 | 3300005290 | Ga0065712_10517541 | Ga0065712_105175411 | 108 |
| 274 | 3300005327 | Ga0070658_10274738 | Ga0070658_102747383 | 108 |
| 275 | 3300005327 | Ga0070658_10933212 | Ga0070658_109332122 | 108 |
| 276 | 3300005328 | Ga0070676_10002478 | Ga0070676_100024783 | 108 |
| 277 | 3300005328 | Ga0070676_10031932 | Ga0070676_100319322 | 108 |
| 278 | 3300005329 | Ga0070683_101351563 | Ga0070683_1013515631 | 108 |
| 279 | 3300005330 | Ga0070690_100102793 | Ga0070690_1001027933 | 108 |
| 280 | 3300005330 | Ga0070690_101045909 | Ga0070690_1010459092 | 108 |
| 281 | 3300005331 | Ga0070670_100000775 | Ga0070670_1000007759 | 108 |
| 282 | 3300005331 | Ga0070670_100067838 | Ga0070670_1000678381 | 108 |
| 283 | 3300005331 | Ga0070670_100127781 | Ga0070670_1001277813 | 108 |
| 284 | 3300005331 | Ga0070670_100134480 | Ga0070670_1001344802 | 108 |
| 285 | 3300005331 | Ga0070670_100223566 | Ga0070670_1002235662 | 108 |
| 286 | 3300005331 | Ga0070670_100282417 | Ga0070670_1002824173 | 108 |
| 287 | 3300005331 | Ga0070670_100307717 | Ga0070670_1003077171 | 108 |
| 288 | 3300005331 | Ga0070670_100363089 | Ga0070670_1003630892 | 108 |
| 289 | 3300005331 | Ga0070670_101042747 | Ga0070670_1010427471 | 108 |
| 290 | 3300005333 | Ga0070677_10004477 | Ga0070677_100044774 | 108 |
| 291 | 3300005333 | Ga0070677_10024937 | Ga0070677_100249372 | 108 |
| 292 | 3300005333 | Ga0070677_10032776 | Ga0070677_100327763 | 108 |
| 293 | 3300005333 | Ga0070677_10055466 | Ga0070677_100554661 | 108 |
| 294 | 3300005333 | Ga0070677_10247812 | Ga0070677_102478122 | 108 |
| 295 | 3300005333 | Ga0070677_10549853 | Ga0070677_105498532 | 108 |
| 296 | 3300005334 | Ga0068869_100001648 | Ga0068869_10000164815 | 108 |
| 297 | 3300005334 | Ga0068869_100024199 | Ga0068869_1000241993 | 108 |
| 298 | 3300005334 | Ga0068869_100575017 | Ga0068869_1005750172 | 108 |
| 299 | 3300005335 | Ga0070666_10002795 | Ga0070666_100027955 | 108 |
| 300 | 3300005335 | Ga0070666_10045779 | Ga0070666_100457795 | 108 |
| 301 | 3300005335 | Ga0070666_10070708 | Ga0070666_100707082 | 108 |
| 302 | 3300005335 | Ga0070666_10155665 | Ga0070666_101556652 | 108 |
| 303 | 3300005335 | Ga0070666_11097180 | Ga0070666_110971801 | 108 |
| 304 | 3300005337 | Ga0070682_100965057 | Ga0070682_1009650572 | 108 |
| 305 | 3300005338 | Ga0068868_100035720 | Ga0068868_1000357205 | 108 |
| 306 | 3300005338 | Ga0068868_100164549 | Ga0068868_1001645492 | 108 |
| 307 | 3300005338 | Ga0068868_100169169 | Ga0068868_1001691693 | 108 |
| 308 | 3300005338 | Ga0068868_100532513 | Ga0068868_1005325131 | 108 |
| 309 | 3300005338 | Ga0068868_100634143 | Ga0068868_1006341432 | 108 |
| 310 | 3300005338 | Ga0068868_100774899 | Ga0068868_1007748992 | 108 |
| 311 | 3300005339 | Ga0070660_100878335 | Ga0070660_1008783352 | 108 |
| 312 | 3300005339 | Ga0070660_101828726 | Ga0070660_1018287261 | 108 |
| 313 | 3300005340 | Ga0070689_101117843 | Ga0070689_1011178432 | 108 |
| 314 | 3300005343 | Ga0070687_100311939 | Ga0070687_1003119392 | 108 |
| 315 | 3300005344 | Ga0070661_100748476 | Ga0070661_1007484762 | 108 |
| 316 | 3300005344 | Ga0070661_101018060 | Ga0070661_1010180601 | 108 |
| 317 | 3300005347 | Ga0070668_100013107 | Ga0070668_1000131074 | 108 |
| 318 | 3300005347 | Ga0070668_100188821 | Ga0070668_1001888212 | 108 |
| 319 | 3300005347 | Ga0070668_100546617 | Ga0070668_1005466172 | 108 |
| 320 | 3300005347 | Ga0070668_101437646 | Ga0070668_1014376462 | 108 |
| 321 | 3300005353 | Ga0070669_100005859 | Ga0070669_1000058593 | 108 |
| 322 | 3300005353 | Ga0070669_100013170 | Ga0070669_1000131705 | 108 |
| 323 | 3300005353 | Ga0070669_100045646 | Ga0070669_1000456463 | 108 |
| 324 | 3300005353 | Ga0070669_101005154 | Ga0070669_1010051541 | 108 |
| 325 | 3300005354 | Ga0070675_100001482 | Ga0070675_10000148220 | 108 |
| 326 | 3300005354 | Ga0070675_100020379 | Ga0070675_1000203793 | 108 |
| 327 | 3300005354 | Ga0070675_100024332 | Ga0070675_1000243323 | 108 |
| 328 | 3300005354 | Ga0070675_100092713 | Ga0070675_1000927134 | 108 |
| 329 | 3300005354 | Ga0070675_100198527 | Ga0070675_1001985273 | 108 |
| 330 | 3300005354 | Ga0070675_100214868 | Ga0070675_1002148681 | 108 |
| 331 | 3300005354 | Ga0070675_100658978 | Ga0070675_1006589782 | 108 |
| 332 | 3300005354 | Ga0070675_101250616 | Ga0070675_1012506162 | 108 |
| 333 | 3300005354 | Ga0070675_101548308 | Ga0070675_1015483081 | 108 |
| 334 | 3300005355 | Ga0070671_100005666 | Ga0070671_1000056663 | 108 |
| 335 | 3300005355 | Ga0070671_100030454 | Ga0070671_1000304545 | 108 |
| 336 | 3300005355 | Ga0070671_100074874 | Ga0070671_1000748744 | 108 |
| 337 | 3300005355 | Ga0070671_100076135 | Ga0070671_1000761353 | 108 |
| 338 | 3300005356 | Ga0070674_100005009 | Ga0070674_1000050098 | 108 |
| 339 | 3300005356 | Ga0070674_100009279 | Ga0070674_1000092793 | 108 |
| 340 | 3300005356 | Ga0070674_100177682 | Ga0070674_1001776822 | 108 |
| 341 | 3300005356 | Ga0070674_101338292 | Ga0070674_1013382922 | 108 |
| 342 | 3300005356 | Ga0070674_101607414 | Ga0070674_1016074141 | 108 |
| 343 | 3300005356 | Ga0070674_101809086 | Ga0070674_1018090861 | 108 |
| 344 | 3300005364 | Ga0070673_100029454 | Ga0070673_1000294544 | 108 |
| 345 | 3300005364 | Ga0070673_100035511 | Ga0070673_1000355114 | 108 |
| 346 | 3300005364 | Ga0070673_100069367 | Ga0070673_1000693673 | 108 |
| 347 | 3300005364 | Ga0070673_100161601 | Ga0070673_1001616013 | 108 |
| 348 | 3300005364 | Ga0070673_100223986 | Ga0070673_1002239862 | 108 |
| 349 | 3300005364 | Ga0070673_100417265 | Ga0070673_1004172653 | 108 |
| 350 | 3300005364 | Ga0070673_100520427 | Ga0070673_1005204272 | 108 |
| 351 | 3300005364 | Ga0070673_101952480 | Ga0070673_1019524802 | 108 |
| 352 | 3300005365 | Ga0070688_100053688 | Ga0070688_1000536883 | 108 |
| 353 | 3300005365 | Ga0070688_100096372 | Ga0070688_1000963723 | 108 |
| 354 | 3300005366 | Ga0070659_100170105 | Ga0070659_1001701051 | 108 |
| 355 | 3300005366 | Ga0070659_100276123 | Ga0070659_1002761232 | 108 |
| 356 | 3300005366 | Ga0070659_100978184 | Ga0070659_1009781842 | 108 |
| 357 | 3300005367 | Ga0070667_100001504 | Ga0070667_10000150412 | 108 |
| 358 | 3300005367 | Ga0070667_100120197 | Ga0070667_1001201973 | 108 |
| 359 | 3300005367 | Ga0070667_100279507 | Ga0070667_1002795073 | 108 |
| 360 | 3300005367 | Ga0070667_100599779 | Ga0070667_1005997791 | 108 |
| 361 | 3300005367 | Ga0070667_101197729 | Ga0070667_1011977291 | 108 |
| 362 | 3300005367 | Ga0070667_101465799 | Ga0070667_1014657992 | 108 |
| 363 | 3300005438 | Ga0070701_10486249 | Ga0070701_104862492 | 108 |
| 364 | 3300005441 | Ga0070700_100073191 | Ga0070700_1000731912 | 108 |
| 365 | 3300005441 | Ga0070700_100734653 | Ga0070700_1007346532 | 108 |
| 366 | 3300005441 | Ga0070700_100754424 | Ga0070700_1007544242 | 108 |
| 367 | 3300005445 | Ga0070708_100710240 | Ga0070708_1007102402 | 108 |
| 368 | 3300005455 | Ga0070663_100265425 | Ga0070663_1002654252 | 108 |
| 369 | 3300005455 | Ga0070663_100273859 | Ga0070663_1002738592 | 108 |
| 370 | 3300005456 | Ga0070678_100017348 | Ga0070678_1000173484 | 108 |
| 371 | 3300005456 | Ga0070678_100076806 | Ga0070678_1000768063 | 108 |
| 372 | 3300005456 | Ga0070678_100077397 | Ga0070678_1000773973 | 108 |
| 373 | 3300005456 | Ga0070678_100107750 | Ga0070678_1001077503 | 108 |
| 374 | 3300005456 | Ga0070678_100108943 | Ga0070678_1001089433 | 108 |
| 375 | 3300005456 | Ga0070678_100267040 | Ga0070678_1002670402 | 108 |
| 376 | 3300005456 | Ga0070678_100337227 | Ga0070678_1003372273 | 108 |
| 377 | 3300005456 | Ga0070678_100353662 | Ga0070678_1003536622 | 108 |
| 378 | 3300005456 | Ga0070678_100437635 | Ga0070678_1004376352 | 108 |
| 379 | 3300005456 | Ga0070678_100677488 | Ga0070678_1006774882 | 108 |
| 380 | 3300005456 | Ga0070678_100738649 | Ga0070678_1007386492 | 108 |
| 381 | 3300005456 | Ga0070678_101272963 | Ga0070678_1012729632 | 108 |
| 382 | 3300005456 | Ga0070678_101488809 | Ga0070678_1014888092 | 108 |
| 383 | 3300005456 | Ga0070678_101563137 | Ga0070678_1015631372 | 108 |
| 384 | 3300005456 | Ga0070678_102261053 | Ga0070678_1022610531 | 108 |
| 385 | 3300005457 | Ga0070662_100013829 | Ga0070662_1000138293 | 108 |
| 386 | 3300005457 | Ga0070662_100356970 | Ga0070662_1003569703 | 108 |
| 387 | 3300005457 | Ga0070662_100427554 | Ga0070662_1004275542 | 108 |
| 388 | 3300005458 | Ga0070681_10197743 | Ga0070681_101977431 | 108 |
| 389 | 3300005459 | Ga0068867_100002317 | Ga0068867_1000023174 | 108 |
| 390 | 3300005459 | Ga0068867_100005331 | Ga0068867_1000053317 | 108 |
| 391 | 3300005459 | Ga0068867_100055304 | Ga0068867_1000553042 | 108 |
| 392 | 3300005459 | Ga0068867_100056848 | Ga0068867_1000568483 | 108 |
| 393 | 3300005459 | Ga0068867_100077545 | Ga0068867_1000775452 | 108 |
| 394 | 3300005459 | Ga0068867_100147428 | Ga0068867_1001474282 | 108 |
| 395 | 3300005459 | Ga0068867_100233881 | Ga0068867_1002338812 | 108 |
| 396 | 3300005459 | Ga0068867_100241274 | Ga0068867_1002412742 | 108 |
| 397 | 3300005459 | Ga0068867_100477329 | Ga0068867_1004773291 | 108 |
| 398 | 3300005459 | Ga0068867_100574557 | Ga0068867_1005745572 | 108 |
| 399 | 3300005459 | Ga0068867_100654761 | Ga0068867_1006547612 | 108 |
| 400 | 3300005459 | Ga0068867_101268806 | Ga0068867_1012688062 | 108 |
| 401 | 3300005466 | Ga0070685_10412280 | Ga0070685_104122801 | 108 |
| 402 | 3300005466 | Ga0070685_10667608 | Ga0070685_106676082 | 108 |
| 403 | 3300005468 | Ga0070707_100686286 | Ga0070707_1006862861 | 108 |
| 404 | 3300005530 | Ga0070679_100055562 | Ga0070679_1000555623 | 108 |
| 405 | 3300005530 | Ga0070679_101016454 | Ga0070679_1010164542 | 108 |
| 406 | 3300005535 | Ga0070684_100159016 | Ga0070684_1001590163 | 108 |
| 407 | 3300005539 | Ga0068853_100079646 | Ga0068853_1000796464 | 108 |
| 408 | 3300005539 | Ga0068853_100917267 | Ga0068853_1009172671 | 108 |
| 409 | 3300005543 | Ga0070672_100000485 | Ga0070672_1000004859 | 108 |
| 410 | 3300005543 | Ga0070672_100016669 | Ga0070672_1000166694 | 108 |
| 411 | 3300005543 | Ga0070672_100030860 | Ga0070672_1000308603 | 108 |
| 412 | 3300005543 | Ga0070672_100074313 | Ga0070672_1000743133 | 108 |
| 413 | 3300005543 | Ga0070672_100118478 | Ga0070672_1001184782 | 108 |
| 414 | 3300005543 | Ga0070672_100129179 | Ga0070672_1001291793 | 108 |
| 415 | 3300005543 | Ga0070672_100255897 | Ga0070672_1002558972 | 108 |
| 416 | 3300005543 | Ga0070672_100339769 | Ga0070672_1003397691 | 108 |
| 417 | 3300005543 | Ga0070672_101240598 | Ga0070672_1012405982 | 108 |
| 418 | 3300005543 | Ga0070672_101248646 | Ga0070672_1012486461 | 108 |
| 419 | 3300005544 | Ga0070686_100323357 | Ga0070686_1003233573 | 108 |
| 420 | 3300005544 | Ga0070686_101675827 | Ga0070686_1016758272 | 108 |
| 421 | 3300005548 | Ga0070665_100028038 | Ga0070665_1000280385 | 108 |
| 422 | 3300005548 | Ga0070665_100338241 | Ga0070665_1003382413 | 108 |
| 423 | 3300005548 | Ga0070665_100546975 | Ga0070665_1005469752 | 108 |
| 424 | 3300005548 | Ga0070665_100753413 | Ga0070665_1007534131 | 108 |
| 425 | 3300005548 | Ga0070665_101524301 | Ga0070665_1015243012 | 108 |
| 426 | 3300005564 | Ga0070664_100012848 | Ga0070664_1000128482 | 108 |
| 427 | 3300005564 | Ga0070664_100113896 | Ga0070664_1001138964 | 108 |
| 428 | 3300005564 | Ga0070664_100377425 | Ga0070664_1003774253 | 108 |
| 429 | 3300005564 | Ga0070664_100534554 | Ga0070664_1005345542 | 108 |
| 430 | 3300005564 | Ga0070664_101180664 | Ga0070664_1011806642 | 108 |
| 431 | 3300005564 | Ga0070664_101223881 | Ga0070664_1012238811 | 108 |
| 432 | 3300005578 | Ga0068854_100090840 | Ga0068854_1000908402 | 108 |
| 433 | 3300005578 | Ga0068854_100113081 | Ga0068854_1001130813 | 108 |
| 434 | 3300005578 | Ga0068854_100223915 | Ga0068854_1002239152 | 108 |
| 435 | 3300005578 | Ga0068854_101458403 | Ga0068854_1014584031 | 108 |
| 436 | 3300005614 | Ga0068856_100205955 | Ga0068856_1002059551 | 108 |
| 437 | 3300005614 | Ga0068856_101302221 | Ga0068856_1013022212 | 108 |
| 438 | 3300005615 | Ga0070702_101758564 | Ga0070702_1017585641 | 108 |
| 439 | 3300005616 | Ga0068852_100092155 | Ga0068852_1000921552 | 108 |
| 440 | 3300005616 | Ga0068852_100194266 | Ga0068852_1001942663 | 108 |
| 441 | 3300005616 | Ga0068852_100206199 | Ga0068852_1002061992 | 108 |
| 442 | 3300005616 | Ga0068852_100320799 | Ga0068852_1003207993 | 108 |
| 443 | 3300005616 | Ga0068852_101336581 | Ga0068852_1013365812 | 108 |
| 444 | 3300005616 | Ga0068852_102027063 | Ga0068852_1020270631 | 108 |
| 445 | 3300005617 | Ga0068859_100070277 | Ga0068859_1000702773 | 108 |
| 446 | 3300005617 | Ga0068859_100136538 | Ga0068859_1001365383 | 108 |
| 447 | 3300005618 | Ga0068864_100006073 | Ga0068864_1000060732 | 108 |
| 448 | 3300005618 | Ga0068864_100076573 | Ga0068864_1000765733 | 108 |
| 449 | 3300005618 | Ga0068864_100195683 | Ga0068864_1001956833 | 108 |
| 450 | 3300005618 | Ga0068864_100449106 | Ga0068864_1004491063 | 108 |
| 451 | 3300005618 | Ga0068864_100845441 | Ga0068864_1008454411 | 108 |
| 452 | 3300005718 | Ga0068866_10005941 | Ga0068866_100059417 | 108 |
| 453 | 3300005718 | Ga0068866_10498545 | Ga0068866_104985452 | 108 |
| 454 | 3300005719 | Ga0068861_100007796 | Ga0068861_1000077963 | 108 |
| 455 | 3300005719 | Ga0068861_100010477 | Ga0068861_1000104774 | 108 |
| 456 | 3300005719 | Ga0068861_100059399 | Ga0068861_1000593994 | 108 |
| 457 | 3300005719 | Ga0068861_101539259 | Ga0068861_1015392592 | 108 |
| 458 | 3300005834 | Ga0068851_10054329 | Ga0068851_100543293 | 108 |
| 459 | 3300005834 | Ga0068851_10134243 | Ga0068851_101342433 | 108 |
| 460 | 3300005834 | Ga0068851_10192843 | Ga0068851_101928432 | 108 |
| 461 | 3300005834 | Ga0068851_10207691 | Ga0068851_102076912 | 108 |
| 462 | 3300005834 | Ga0068851_10326610 | Ga0068851_103266102 | 108 |
| 463 | 3300005840 | Ga0068870_10162280 | Ga0068870_101622803 | 108 |
| 464 | 3300005841 | Ga0068863_100006580 | Ga0068863_1000065804 | 108 |
| 465 | 3300005841 | Ga0068863_100010999 | Ga0068863_1000109999 | 108 |
| 466 | 3300005841 | Ga0068863_100056110 | Ga0068863_1000561102 | 108 |
| 467 | 3300005841 | Ga0068863_100251725 | Ga0068863_1002517253 | 108 |
| 468 | 3300005841 | Ga0068863_100464831 | Ga0068863_1004648313 | 108 |
| 469 | 3300005841 | Ga0068863_101062392 | Ga0068863_1010623922 | 108 |
| 470 | 3300005841 | Ga0068863_101239218 | Ga0068863_1012392182 | 108 |
| 471 | 3300005842 | Ga0068858_100004441 | Ga0068858_1000044417 | 108 |
| 472 | 3300005842 | Ga0068858_100055279 | Ga0068858_1000552794 | 108 |
| 473 | 3300005842 | Ga0068858_101420961 | Ga0068858_1014209611 | 108 |
| 474 | 3300005843 | Ga0068860_100006168 | Ga0068860_10000616812 | 108 |
| 475 | 3300005843 | Ga0068860_100122793 | Ga0068860_1001227932 | 108 |
| 476 | 3300005843 | Ga0068860_100306129 | Ga0068860_1003061293 | 108 |
| 477 | 3300005843 | Ga0068860_100579483 | Ga0068860_1005794832 | 108 |
| 478 | 3300005844 | Ga0068862_100011734 | Ga0068862_1000117349 | 108 |
| 479 | 3300005844 | Ga0068862_100086216 | Ga0068862_1000862162 | 108 |
| 480 | 3300005844 | Ga0068862_100178666 | Ga0068862_1001786663 | 108 |
| 481 | 3300005844 | Ga0068862_100216042 | Ga0068862_1002160423 | 108 |
| 482 | 3300005844 | Ga0068862_101949855 | Ga0068862_1019498552 | 108 |
| 483 | 3300006028 | Ga0070717_10888792 | Ga0070717_108887922 | 108 |
| 484 | 3300006042 | Ga0075368_10527534 | Ga0075368_105275341 | 108 |
| 485 | 3300006048 | Ga0075363_100295166 | Ga0075363_1002951662 | 108 |
| 486 | 3300006048 | Ga0075363_100485893 | Ga0075363_1004858932 | 108 |
| 487 | 3300006173 | Ga0070716_100131326 | Ga0070716_1001313263 | 108 |
| 488 | 3300006177 | Ga0075362_10009196 | Ga0075362_100091962 | 108 |
| 489 | 3300006177 | Ga0075362_10059103 | Ga0075362_100591032 | 108 |
| 490 | 3300006177 | Ga0075362_10171464 | Ga0075362_101714642 | 108 |
| 491 | 3300006177 | Ga0075362_10297218 | Ga0075362_102972182 | 108 |
| 492 | 3300006177 | Ga0075362_10557038 | Ga0075362_105570381 | 108 |
| 493 | 3300006178 | Ga0075367_10154559 | Ga0075367_101545593 | 108 |
| 494 | 3300006186 | Ga0075369_10339395 | Ga0075369_103393952 | 108 |
| 495 | 3300006195 | Ga0075366_10009118 | Ga0075366_100091187 | 108 |
| 496 | 3300006195 | Ga0075366_10012436 | Ga0075366_100124366 | 108 |
| 497 | 3300006195 | Ga0075366_10064499 | Ga0075366_100644992 | 108 |
| 498 | 3300006195 | Ga0075366_10226494 | Ga0075366_102264942 | 108 |
| 499 | 3300006195 | Ga0075366_10549934 | Ga0075366_105499342 | 108 |
| 500 | 3300006237 | Ga0097621_100025465 | Ga0097621_1000254654 | 108 |
| 501 | 3300006237 | Ga0097621_100147122 | Ga0097621_1001471223 | 108 |
| 502 | 3300006353 | Ga0075370_10097322 | Ga0075370_100973222 | 108 |
| 503 | 3300006353 | Ga0075370_10133920 | Ga0075370_101339202 | 108 |
| 504 | 3300006353 | Ga0075370_10211259 | Ga0075370_102112592 | 108 |
| 505 | 3300006353 | Ga0075370_10278882 | Ga0075370_102788822 | 108 |
| 506 | 3300006353 | Ga0075370_10382760 | Ga0075370_103827602 | 108 |
| 507 | 3300006358 | Ga0068871_100040253 | Ga0068871_1000402532 | 108 |
| 508 | 3300006358 | Ga0068871_100124281 | Ga0068871_1001242813 | 108 |
| 509 | 3300006358 | Ga0068871_100222012 | Ga0068871_1002220123 | 108 |
| 510 | 3300006358 | Ga0068871_100691793 | Ga0068871_1006917932 | 108 |
| 511 | 3300006358 | Ga0068871_100873779 | Ga0068871_1008737792 | 108 |
| 512 | 3300006358 | Ga0068871_100887637 | Ga0068871_1008876371 | 108 |
| 513 | 3300006846 | Ga0075430_100045709 | Ga0075430_1000457092 | 108 |
| 514 | 3300006881 | Ga0068865_100023882 | Ga0068865_1000238823 | 108 |
| 515 | 3300006881 | Ga0068865_100074584 | Ga0068865_1000745842 | 108 |
| 516 | 3300006881 | Ga0068865_101233065 | Ga0068865_1012330652 | 108 |
| 517 | 3300006931 | Ga0097620_100070277 | Ga0097620_1000702773 | 108 |
| 518 | 3300006931 | Ga0097620_100136542 | Ga0097620_1001365423 | 108 |
| 519 | 3300009093 | Ga0105240_10018949 | Ga0105240_100189497 | 108 |
| 520 | 3300009094 | Ga0111539_10132095 | Ga0111539_101320953 | 108 |
| 521 | 3300009094 | Ga0111539_11926734 | Ga0111539_119267341 | 108 |
| 522 | 3300009094 | Ga0111539_12012739 | Ga0111539_120127392 | 108 |
| 523 | 3300009098 | Ga0105245_10048172 | Ga0105245_100481724 | 108 |
| 524 | 3300009098 | Ga0105245_10822413 | Ga0105245_108224132 | 108 |
| 525 | 3300009098 | Ga0105245_11098617 | Ga0105245_110986172 | 108 |
| 526 | 3300009147 | Ga0114129_10078156 | Ga0114129_100781563 | 108 |
| 527 | 3300009148 | Ga0105243_10000649 | Ga0105243_100006497 | 108 |
| 528 | 3300009148 | Ga0105243_10018605 | Ga0105243_100186054 | 108 |
| 529 | 3300009148 | Ga0105243_10219249 | Ga0105243_102192493 | 108 |
| 530 | 3300009174 | Ga0105241_10981838 | Ga0105241_109818381 | 108 |
| 531 | 3300009176 | Ga0105242_10147470 | Ga0105242_101474703 | 108 |
| 532 | 3300009176 | Ga0105242_10764653 | Ga0105242_107646531 | 108 |
| 533 | 3300009177 | Ga0105248_10033310 | Ga0105248_100333107 | 108 |
| 534 | 3300009177 | Ga0105248_10134398 | Ga0105248_101343983 | 108 |
| 535 | 3300009177 | Ga0105248_10194699 | Ga0105248_101946992 | 108 |
| 536 | 3300009177 | Ga0105248_11615637 | Ga0105248_116156372 | 108 |
| 537 | 3300009177 | Ga0105248_13039546 | Ga0105248_130395462 | 108 |
| 538 | 3300009545 | Ga0105237_10001988 | Ga0105237_1000198816 | 108 |
| 539 | 3300009545 | Ga0105237_10881549 | Ga0105237_108815492 | 108 |
| 540 | 3300009551 | Ga0105238_10014640 | Ga0105238_100146407 | 108 |
| 541 | 3300009551 | Ga0105238_11637287 | Ga0105238_116372872 | 108 |
| 542 | 3300009553 | Ga0105249_10009613 | Ga0105249_100096137 | 108 |
| 543 | 3300009553 | Ga0105249_10128897 | Ga0105249_101288973 | 108 |
| 544 | 3300009553 | Ga0105249_10767916 | Ga0105249_107679162 | 108 |
| 545 | 3300009553 | Ga0105249_10797317 | Ga0105249_107973172 | 108 |
| 546 | 3300009553 | Ga0105249_12548904 | Ga0105249_125489041 | 108 |
| 547 | 3300009553 | Ga0105249_13231722 | Ga0105249_132317221 | 108 |
| 548 | 3300009553 | Ga0105249_13258103 | Ga0105249_132581032 | 108 |
| 549 | 3300010375 | Ga0105239_10004146 | Ga0105239_1000414615 | 108 |
| 550 | 3300011119 | Ga0105246_12048846 | Ga0105246_120488461 | 108 |
| 551 | 3300013100 | Ga0157373_10448390 | Ga0157373_104483902 | 108 |
| 552 | 3300013102 | Ga0157371_10579855 | Ga0157371_105798552 | 108 |
| 553 | 3300013104 | Ga0157370_11057125 | Ga0157370_110571252 | 108 |
| 554 | 3300013105 | Ga0157369_10483949 | Ga0157369_104839492 | 108 |
| 555 | 3300013296 | Ga0157374_10084889 | Ga0157374_100848894 | 108 |
| 556 | 3300013296 | Ga0157374_10208548 | Ga0157374_102085483 | 108 |
| 557 | 3300013297 | Ga0157378_10137192 | Ga0157378_101371922 | 108 |
| 558 | 3300013297 | Ga0157378_10461686 | Ga0157378_104616862 | 108 |
| 559 | 3300013297 | Ga0157378_10566919 | Ga0157378_105669192 | 108 |
| 560 | 3300013297 | Ga0157378_10627283 | Ga0157378_106272832 | 108 |
| 561 | 3300013297 | Ga0157378_10661483 | Ga0157378_106614832 | 108 |
| 562 | 3300013297 | Ga0157378_12555060 | Ga0157378_125550602 | 108 |
| 563 | 3300013306 | Ga0163162_10011522 | Ga0163162_100115225 | 108 |
| 564 | 3300013306 | Ga0163162_10161373 | Ga0163162_101613733 | 108 |
| 565 | 3300013306 | Ga0163162_10721023 | Ga0163162_107210232 | 108 |
| 566 | 3300013306 | Ga0163162_10934355 | Ga0163162_109343552 | 108 |
| 567 | 3300013306 | Ga0163162_12373692 | Ga0163162_123736921 | 108 |
| 568 | 3300013307 | Ga0157372_10604790 | Ga0157372_106047902 | 108 |
| 569 | 3300013308 | Ga0157375_10076831 | Ga0157375_100768313 | 108 |
| 570 | 3300013308 | Ga0157375_10085627 | Ga0157375_100856274 | 108 |
| 571 | 3300013308 | Ga0157375_10293371 | Ga0157375_102933712 | 108 |
| 572 | 3300013308 | Ga0157375_10457810 | Ga0157375_104578103 | 108 |
| 573 | 3300013308 | Ga0157375_11068663 | Ga0157375_110686632 | 108 |
| 574 | 3300014325 | Ga0163163_10011394 | Ga0163163_100113947 | 108 |
| 575 | 3300014325 | Ga0163163_10881802 | Ga0163163_108818021 | 108 |
| 576 | 3300014325 | Ga0163163_11524831 | Ga0163163_115248311 | 108 |
| 577 | 3300014326 | Ga0157380_10006323 | Ga0157380_100063232 | 108 |
| 578 | 3300014326 | Ga0157380_10797607 | Ga0157380_107976072 | 108 |
| 579 | 3300014326 | Ga0157380_10882670 | Ga0157380_108826702 | 108 |
| 580 | 3300014326 | Ga0157380_12683823 | Ga0157380_126838232 | 108 |
| 581 | 3300014326 | Ga0157380_13119147 | Ga0157380_131191471 | 108 |
| 582 | 3300014745 | Ga0157377_10000006 | Ga0157377_10000006403 | 108 |
| 583 | 3300014745 | Ga0157377_10359191 | Ga0157377_103591912 | 108 |
| 584 | 3300014745 | Ga0157377_11662769 | Ga0157377_116627691 | 108 |
| 585 | 3300014968 | Ga0157379_10015125 | Ga0157379_100151257 | 108 |
| 586 | 3300014968 | Ga0157379_10016325 | Ga0157379_100163257 | 108 |
| 587 | 3300014968 | Ga0157379_10021583 | Ga0157379_100215835 | 108 |
| 588 | 3300014968 | Ga0157379_11054654 | Ga0157379_110546542 | 108 |
| 589 | 3300014968 | Ga0157379_11594545 | Ga0157379_115945451 | 108 |
| 590 | 3300014968 | Ga0157379_12419342 | Ga0157379_124193421 | 108 |
| 591 | 3300014969 | Ga0157376_10079207 | Ga0157376_100792071 | 108 |
| 592 | 3300014969 | Ga0157376_10288786 | Ga0157376_102887861 | 108 |
| 593 | 3300014969 | Ga0157376_10450520 | Ga0157376_104505202 | 108 |
| 594 | 3300014969 | Ga0157376_11887229 | Ga0157376_118872292 | 108 |
| 595 | 3300014969 | Ga0157376_12068523 | Ga0157376_120685232 | 108 |
| 596 | 3300014969 | Ga0157376_12388383 | Ga0157376_123883832 | 108 |
| 597 | 3300015683 | Ga0183362_10004 | Ga0183362_10004542 | 108 |
| 598 | 3300017792 | Ga0163161_10009633 | Ga0163161_100096337 | 108 |
| 599 | 3300017792 | Ga0163161_10045002 | Ga0163161_100450022 | 108 |
| 600 | 3300017792 | Ga0163161_10231198 | Ga0163161_102311982 | 108 |
| 601 | 3300017792 | Ga0163161_10389612 | Ga0163161_103896122 | 108 |
| 602 | 3300017792 | Ga0163161_10816384 | Ga0163161_108163842 | 108 |
| 603 | 3300017792 | Ga0163161_11142281 | Ga0163161_111422812 | 108 |
| 604 | 3300017792 | Ga0163161_11332321 | Ga0163161_113323212 | 108 |
| 605 | 3300020082 | Ga0206353_11452919 | Ga0206353_114529191 | 108 |
| 606 | 3300021361 | Ga0213872_10000155 | Ga0213872_1000015551 | 108 |
| 607 | 3300021361 | Ga0213872_10157498 | Ga0213872_101574982 | 108 |
| 608 | 3300025273 | Ga0209673_1005560 | Ga0209673_10055604 | 108 |
| 609 | 3300025297 | Ga0209758_1000769 | Ga0209758_100076935 | 108 |
| 610 | 3300025315 | Ga0207697_10020852 | Ga0207697_100208521 | 108 |
| 611 | 3300025315 | Ga0207697_10025463 | Ga0207697_100254633 | 108 |
| 612 | 3300025315 | Ga0207697_10069111 | Ga0207697_100691112 | 108 |
| 613 | 3300025321 | Ga0207656_10036342 | Ga0207656_100363423 | 108 |
| 614 | 3300025321 | Ga0207656_10072974 | Ga0207656_100729742 | 108 |
| 615 | 3300025893 | Ga0207682_10009442 | Ga0207682_100094423 | 108 |
| 616 | 3300025893 | Ga0207682_10010609 | Ga0207682_100106095 | 108 |
| 617 | 3300025893 | Ga0207682_10052694 | Ga0207682_100526942 | 108 |
| 618 | 3300025893 | Ga0207682_10060390 | Ga0207682_100603903 | 108 |
| 619 | 3300025899 | Ga0207642_10231839 | Ga0207642_102318392 | 108 |
| 620 | 3300025899 | Ga0207642_10456802 | Ga0207642_104568022 | 108 |
| 621 | 3300025901 | Ga0207688_10038491 | Ga0207688_100384914 | 108 |
| 622 | 3300025901 | Ga0207688_10325346 | Ga0207688_103253462 | 108 |
| 623 | 3300025903 | Ga0207680_10040979 | Ga0207680_100409792 | 108 |
| 624 | 3300025903 | Ga0207680_10052240 | Ga0207680_100522403 | 108 |
| 625 | 3300025903 | Ga0207680_10271428 | Ga0207680_102714282 | 108 |
| 626 | 3300025903 | Ga0207680_10589399 | Ga0207680_105893992 | 108 |
| 627 | 3300025904 | Ga0207647_10391251 | Ga0207647_103912512 | 108 |
| 628 | 3300025907 | Ga0207645_10009868 | Ga0207645_100098684 | 108 |
| 629 | 3300025907 | Ga0207645_10030778 | Ga0207645_100307782 | 108 |
| 630 | 3300025908 | Ga0207643_10023918 | Ga0207643_100239182 | 108 |
| 631 | 3300025908 | Ga0207643_10085762 | Ga0207643_100857623 | 108 |
| 632 | 3300025908 | Ga0207643_10343902 | Ga0207643_103439022 | 108 |
| 633 | 3300025909 | Ga0207705_10257093 | Ga0207705_102570933 | 108 |
| 634 | 3300025909 | Ga0207705_11402711 | Ga0207705_114027112 | 108 |
| 635 | 3300025912 | Ga0207707_10101940 | Ga0207707_101019404 | 108 |
| 636 | 3300025913 | Ga0207695_10138322 | Ga0207695_101383222 | 108 |
| 637 | 3300025914 | Ga0207671_10002519 | Ga0207671_100025199 | 108 |
| 638 | 3300025914 | Ga0207671_10685381 | Ga0207671_106853812 | 108 |
| 639 | 3300025916 | Ga0207663_10613812 | Ga0207663_106138122 | 108 |
| 640 | 3300025917 | Ga0207660_10025648 | Ga0207660_100256483 | 108 |
| 641 | 3300025918 | Ga0207662_10020118 | Ga0207662_100201182 | 108 |
| 642 | 3300025919 | Ga0207657_10055458 | Ga0207657_100554583 | 108 |
| 643 | 3300025920 | Ga0207649_10405692 | Ga0207649_104056922 | 108 |
| 644 | 3300025921 | Ga0207652_10008831 | Ga0207652_1000883110 | 108 |
| 645 | 3300025922 | Ga0207646_11465963 | Ga0207646_114659631 | 108 |
| 646 | 3300025922 | Ga0207646_11797157 | Ga0207646_117971572 | 108 |
| 647 | 3300025923 | Ga0207681_10001432 | Ga0207681_100014325 | 108 |
| 648 | 3300025923 | Ga0207681_10004120 | Ga0207681_100041208 | 108 |
| 649 | 3300025923 | Ga0207681_10822179 | Ga0207681_108221792 | 108 |
| 650 | 3300025923 | Ga0207681_11408044 | Ga0207681_114080442 | 108 |
| 651 | 3300025924 | Ga0207694_10615943 | Ga0207694_106159432 | 108 |
| 652 | 3300025924 | Ga0207694_10694490 | Ga0207694_106944902 | 108 |
| 653 | 3300025925 | Ga0207650_10000275 | Ga0207650_1000027542 | 108 |
| 654 | 3300025925 | Ga0207650_10003921 | Ga0207650_100039212 | 108 |
| 655 | 3300025925 | Ga0207650_10133334 | Ga0207650_101333343 | 108 |
| 656 | 3300025925 | Ga0207650_10138977 | Ga0207650_101389773 | 108 |
| 657 | 3300025925 | Ga0207650_10485089 | Ga0207650_104850892 | 108 |
| 658 | 3300025925 | Ga0207650_11205008 | Ga0207650_112050081 | 108 |
| 659 | 3300025926 | Ga0207659_10000418 | Ga0207659_1000041827 | 108 |
| 660 | 3300025926 | Ga0207659_10050329 | Ga0207659_100503293 | 108 |
| 661 | 3300025926 | Ga0207659_10162669 | Ga0207659_101626693 | 108 |
| 662 | 3300025926 | Ga0207659_10165106 | Ga0207659_101651063 | 108 |
| 663 | 3300025926 | Ga0207659_10223288 | Ga0207659_102232883 | 108 |
| 664 | 3300025926 | Ga0207659_10297181 | Ga0207659_102971812 | 108 |
| 665 | 3300025926 | Ga0207659_10702554 | Ga0207659_107025542 | 108 |
| 666 | 3300025927 | Ga0207687_10074870 | Ga0207687_100748702 | 108 |
| 667 | 3300025931 | Ga0207644_10000391 | Ga0207644_1000039127 | 108 |
| 668 | 3300025931 | Ga0207644_10014706 | Ga0207644_100147065 | 108 |
| 669 | 3300025931 | Ga0207644_10077054 | Ga0207644_100770543 | 108 |
| 670 | 3300025931 | Ga0207644_10095589 | Ga0207644_100955893 | 108 |
| 671 | 3300025931 | Ga0207644_10203851 | Ga0207644_102038512 | 108 |
| 672 | 3300025931 | Ga0207644_10455672 | Ga0207644_104556722 | 108 |
| 673 | 3300025932 | Ga0207690_10191676 | Ga0207690_101916763 | 108 |
| 674 | 3300025932 | Ga0207690_10925860 | Ga0207690_109258601 | 108 |
| 675 | 3300025932 | Ga0207690_11172189 | Ga0207690_111721892 | 108 |
| 676 | 3300025933 | Ga0207706_10076989 | Ga0207706_100769893 | 108 |
| 677 | 3300025933 | Ga0207706_10151073 | Ga0207706_101510732 | 108 |
| 678 | 3300025933 | Ga0207706_10312047 | Ga0207706_103120473 | 108 |
| 679 | 3300025933 | Ga0207706_10619713 | Ga0207706_106197132 | 108 |
| 680 | 3300025933 | Ga0207706_10743301 | Ga0207706_107433011 | 108 |
| 681 | 3300025933 | Ga0207706_11040293 | Ga0207706_110402932 | 108 |
| 682 | 3300025934 | Ga0207686_10051491 | Ga0207686_100514913 | 108 |
| 683 | 3300025935 | Ga0207709_10001139 | Ga0207709_100011397 | 108 |
| 684 | 3300025935 | Ga0207709_10156862 | Ga0207709_101568623 | 108 |
| 685 | 3300025935 | Ga0207709_10167640 | Ga0207709_101676402 | 108 |
| 686 | 3300025935 | Ga0207709_10187336 | Ga0207709_101873363 | 108 |
| 687 | 3300025936 | Ga0207670_10864801 | Ga0207670_108648012 | 108 |
| 688 | 3300025936 | Ga0207670_10930038 | Ga0207670_109300382 | 108 |
| 689 | 3300025937 | Ga0207669_10001031 | Ga0207669_100010315 | 108 |
| 690 | 3300025937 | Ga0207669_10037849 | Ga0207669_100378492 | 108 |
| 691 | 3300025937 | Ga0207669_10342495 | Ga0207669_103424952 | 108 |
| 692 | 3300025937 | Ga0207669_10347604 | Ga0207669_103476042 | 108 |
| 693 | 3300025937 | Ga0207669_11080222 | Ga0207669_110802222 | 108 |
| 694 | 3300025937 | Ga0207669_11292715 | Ga0207669_112927152 | 108 |
| 695 | 3300025938 | Ga0207704_10002411 | Ga0207704_100024114 | 108 |
| 696 | 3300025938 | Ga0207704_10053687 | Ga0207704_100536872 | 108 |
| 697 | 3300025938 | Ga0207704_10845688 | Ga0207704_108456882 | 108 |
| 698 | 3300025939 | Ga0207665_10040480 | Ga0207665_100404803 | 108 |
| 699 | 3300025940 | Ga0207691_10001335 | Ga0207691_1000133517 | 108 |
| 700 | 3300025940 | Ga0207691_10055504 | Ga0207691_100555042 | 108 |
| 701 | 3300025940 | Ga0207691_10092874 | Ga0207691_100928743 | 108 |
| 702 | 3300025940 | Ga0207691_10103023 | Ga0207691_101030232 | 108 |
| 703 | 3300025940 | Ga0207691_10126606 | Ga0207691_101266063 | 108 |
| 704 | 3300025940 | Ga0207691_10166503 | Ga0207691_101665032 | 108 |
| 705 | 3300025940 | Ga0207691_10185111 | Ga0207691_101851112 | 108 |
| 706 | 3300025940 | Ga0207691_10196453 | Ga0207691_101964532 | 108 |
| 707 | 3300025940 | Ga0207691_10424365 | Ga0207691_104243653 | 108 |
| 708 | 3300025940 | Ga0207691_10923689 | Ga0207691_109236891 | 108 |
| 709 | 3300025941 | Ga0207711_10033637 | Ga0207711_100336372 | 108 |
| 710 | 3300025941 | Ga0207711_10040559 | Ga0207711_100405593 | 108 |
| 711 | 3300025941 | Ga0207711_10081075 | Ga0207711_100810753 | 108 |
| 712 | 3300025941 | Ga0207711_10431707 | Ga0207711_104317073 | 108 |
| 713 | 3300025941 | Ga0207711_10554146 | Ga0207711_105541463 | 108 |
| 714 | 3300025942 | Ga0207689_10013440 | Ga0207689_100134405 | 108 |
| 715 | 3300025942 | Ga0207689_10024935 | Ga0207689_100249353 | 108 |
| 716 | 3300025945 | Ga0207679_10467880 | Ga0207679_104678802 | 108 |
| 717 | 3300025945 | Ga0207679_10486146 | Ga0207679_104861462 | 108 |
| 718 | 3300025945 | Ga0207679_11545652 | Ga0207679_115456522 | 108 |
| 719 | 3300025945 | Ga0207679_11919821 | Ga0207679_119198211 | 108 |
| 720 | 3300025960 | Ga0207651_10015270 | Ga0207651_100152705 | 108 |
| 721 | 3300025960 | Ga0207651_10016846 | Ga0207651_100168462 | 108 |
| 722 | 3300025960 | Ga0207651_10028855 | Ga0207651_100288553 | 108 |
| 723 | 3300025960 | Ga0207651_10062806 | Ga0207651_100628064 | 108 |
| 724 | 3300025960 | Ga0207651_10125560 | Ga0207651_101255603 | 108 |
| 725 | 3300025960 | Ga0207651_10699355 | Ga0207651_106993552 | 108 |
| 726 | 3300025960 | Ga0207651_10734155 | Ga0207651_107341551 | 108 |
| 727 | 3300025960 | Ga0207651_10799990 | Ga0207651_107999902 | 108 |
| 728 | 3300025960 | Ga0207651_10991920 | Ga0207651_109919202 | 108 |
| 729 | 3300025961 | Ga0207712_10601774 | Ga0207712_106017742 | 108 |
| 730 | 3300025961 | Ga0207712_10727672 | Ga0207712_107276722 | 108 |
| 731 | 3300025961 | Ga0207712_11214133 | Ga0207712_112141332 | 108 |
| 732 | 3300025972 | Ga0207668_10021137 | Ga0207668_100211372 | 108 |
| 733 | 3300025972 | Ga0207668_10341957 | Ga0207668_103419572 | 108 |
| 734 | 3300025972 | Ga0207668_10962970 | Ga0207668_109629702 | 108 |
| 735 | 3300025981 | Ga0207640_10105092 | Ga0207640_101050921 | 108 |
| 736 | 3300025986 | Ga0207658_10007334 | Ga0207658_100073342 | 108 |
| 737 | 3300025986 | Ga0207658_10041765 | Ga0207658_100417653 | 108 |
| 738 | 3300025986 | Ga0207658_10091681 | Ga0207658_100916812 | 108 |
| 739 | 3300025986 | Ga0207658_10127968 | Ga0207658_101279683 | 108 |
| 740 | 3300025986 | Ga0207658_10715849 | Ga0207658_107158492 | 108 |
| 741 | 3300025986 | Ga0207658_10730551 | Ga0207658_107305511 | 108 |
| 742 | 3300026023 | Ga0207677_10015892 | Ga0207677_100158924 | 108 |
| 743 | 3300026023 | Ga0207677_10021624 | Ga0207677_100216242 | 108 |
| 744 | 3300026023 | Ga0207677_10072057 | Ga0207677_100720573 | 108 |
| 745 | 3300026023 | Ga0207677_10157790 | Ga0207677_101577902 | 108 |
| 746 | 3300026023 | Ga0207677_10189242 | Ga0207677_101892423 | 108 |
| 747 | 3300026023 | Ga0207677_10515405 | Ga0207677_105154051 | 108 |
| 748 | 3300026023 | Ga0207677_11042481 | Ga0207677_110424812 | 108 |
| 749 | 3300026023 | Ga0207677_11840639 | Ga0207677_118406392 | 108 |
| 750 | 3300026035 | Ga0207703_10087205 | Ga0207703_100872053 | 108 |
| 751 | 3300026035 | Ga0207703_10105129 | Ga0207703_101051291 | 108 |
| 752 | 3300026035 | Ga0207703_11008853 | Ga0207703_110088531 | 108 |
| 753 | 3300026035 | Ga0207703_11822644 | Ga0207703_118226441 | 108 |
| 754 | 3300026041 | Ga0207639_10878009 | Ga0207639_108780092 | 108 |
| 755 | 3300026041 | Ga0207639_11654294 | Ga0207639_116542942 | 108 |
| 756 | 3300026067 | Ga0207678_10005281 | Ga0207678_100052812 | 108 |
| 757 | 3300026067 | Ga0207678_10183557 | Ga0207678_101835571 | 108 |
| 758 | 3300026067 | Ga0207678_10205257 | Ga0207678_102052572 | 108 |
| 759 | 3300026067 | Ga0207678_10207929 | Ga0207678_102079292 | 108 |
| 760 | 3300026067 | Ga0207678_10482559 | Ga0207678_104825592 | 108 |
| 761 | 3300026067 | Ga0207678_10499662 | Ga0207678_104996621 | 108 |
| 762 | 3300026075 | Ga0207708_10121206 | Ga0207708_101212061 | 108 |
| 763 | 3300026075 | Ga0207708_10779827 | Ga0207708_107798272 | 108 |
| 764 | 3300026088 | Ga0207641_10003042 | Ga0207641_1000304210 | 108 |
| 765 | 3300026088 | Ga0207641_10010456 | Ga0207641_100104563 | 108 |
| 766 | 3300026088 | Ga0207641_10016486 | Ga0207641_100164863 | 108 |
| 767 | 3300026088 | Ga0207641_10094164 | Ga0207641_100941642 | 108 |
| 768 | 3300026088 | Ga0207641_10157115 | Ga0207641_101571153 | 108 |
| 769 | 3300026088 | Ga0207641_10223313 | Ga0207641_102233132 | 108 |
| 770 | 3300026088 | Ga0207641_10658583 | Ga0207641_106585832 | 108 |
| 771 | 3300026089 | Ga0207648_10000254 | Ga0207648_1000025451 | 108 |
| 772 | 3300026089 | Ga0207648_10012495 | Ga0207648_100124955 | 108 |
| 773 | 3300026089 | Ga0207648_10024822 | Ga0207648_100248227 | 108 |
| 774 | 3300026089 | Ga0207648_10026116 | Ga0207648_100261165 | 108 |
| 775 | 3300026089 | Ga0207648_10027411 | Ga0207648_100274112 | 108 |
| 776 | 3300026089 | Ga0207648_10047044 | Ga0207648_100470443 | 108 |
| 777 | 3300026089 | Ga0207648_10079214 | Ga0207648_100792142 | 108 |
| 778 | 3300026089 | Ga0207648_10178201 | Ga0207648_101782013 | 108 |
| 779 | 3300026089 | Ga0207648_10279993 | Ga0207648_102799933 | 108 |
| 780 | 3300026089 | Ga0207648_10408765 | Ga0207648_104087651 | 108 |
| 781 | 3300026089 | Ga0207648_10521432 | Ga0207648_105214322 | 108 |
| 782 | 3300026089 | Ga0207648_10616807 | Ga0207648_106168072 | 108 |
| 783 | 3300026089 | Ga0207648_10648523 | Ga0207648_106485232 | 108 |
| 784 | 3300026089 | Ga0207648_10938210 | Ga0207648_109382101 | 108 |
| 785 | 3300026089 | Ga0207648_11363671 | Ga0207648_113636711 | 108 |
| 786 | 3300026095 | Ga0207676_10028858 | Ga0207676_100288582 | 108 |
| 787 | 3300026095 | Ga0207676_10038596 | Ga0207676_100385962 | 108 |
| 788 | 3300026095 | Ga0207676_10084895 | Ga0207676_100848951 | 108 |
| 789 | 3300026095 | Ga0207676_10242910 | Ga0207676_102429103 | 108 |
| 790 | 3300026095 | Ga0207676_10722831 | Ga0207676_107228312 | 108 |
| 791 | 3300026116 | Ga0207674_10802411 | Ga0207674_108024112 | 108 |
| 792 | 3300026116 | Ga0207674_11158821 | Ga0207674_111588212 | 108 |
| 793 | 3300026118 | Ga0207675_100012087 | Ga0207675_1000120877 | 108 |
| 794 | 3300026118 | Ga0207675_100055408 | Ga0207675_1000554083 | 108 |
| 795 | 3300026118 | Ga0207675_100270136 | Ga0207675_1002701362 | 108 |
| 796 | 3300026118 | Ga0207675_100685789 | Ga0207675_1006857892 | 108 |
| 797 | 3300026121 | Ga0207683_10002658 | Ga0207683_100026583 | 108 |
| 798 | 3300026121 | Ga0207683_10024382 | Ga0207683_100243823 | 108 |
| 799 | 3300026121 | Ga0207683_10106353 | Ga0207683_101063532 | 108 |
| 800 | 3300026121 | Ga0207683_10197116 | Ga0207683_101971162 | 108 |
| 801 | 3300026121 | Ga0207683_10494706 | Ga0207683_104947062 | 108 |
| 802 | 3300026121 | Ga0207683_10694932 | Ga0207683_106949322 | 108 |
| 803 | 3300026121 | Ga0207683_10980081 | Ga0207683_109800812 | 108 |
| 804 | 3300026121 | Ga0207683_11065038 | Ga0207683_110650382 | 108 |
| 805 | 3300026142 | Ga0207698_10004407 | Ga0207698_1000440710 | 108 |
| 806 | 3300026142 | Ga0207698_10011597 | Ga0207698_100115973 | 108 |
| 807 | 3300026142 | Ga0207698_10385757 | Ga0207698_103857572 | 108 |
| 808 | 3300026142 | Ga0207698_10632760 | Ga0207698_106327602 | 108 |
| 809 | 3300026142 | Ga0207698_10951748 | Ga0207698_109517481 | 108 |
| 810 | 3300026142 | Ga0207698_11199941 | Ga0207698_111999412 | 108 |
| 811 | 3300026142 | Ga0207698_12325852 | Ga0207698_123258521 | 108 |
| 812 | 3300027876 | Ga0209974_10108363 | Ga0209974_101083632 | 108 |
| 813 | 3300027907 | Ga0207428_10208745 | Ga0207428_102087453 | 108 |
| 814 | 3300028379 | Ga0268266_10021143 | Ga0268266_100211433 | 108 |
| 815 | 3300028379 | Ga0268266_10310709 | Ga0268266_103107092 | 108 |
| 816 | 3300028379 | Ga0268266_10336655 | Ga0268266_103366553 | 108 |
| 817 | 3300028379 | Ga0268266_10772781 | Ga0268266_107727812 | 108 |
| 818 | 3300028379 | Ga0268266_12152924 | Ga0268266_121529242 | 108 |
| 819 | 3300028379 | Ga0268266_12366112 | Ga0268266_123661121 | 108 |
| 820 | 3300028380 | Ga0268265_10009051 | Ga0268265_100090512 | 108 |
| 821 | 3300028380 | Ga0268265_10069137 | Ga0268265_100691372 | 108 |
| 822 | 3300028380 | Ga0268265_10254183 | Ga0268265_102541832 | 108 |
| 823 | 3300028381 | Ga0268264_10081809 | Ga0268264_100818092 | 108 |
| 824 | 3300028381 | Ga0268264_10117511 | Ga0268264_101175112 | 108 |
| 825 | 3300028381 | Ga0268264_10166217 | Ga0268264_101662172 | 108 |
| 826 | 3300028381 | Ga0268264_10240598 | Ga0268264_102405982 | 108 |
| 827 | 3300028381 | Ga0268264_11175629 | Ga0268264_111756291 | 108 |
| 828 | 3300028786 | Ga0307517_10004486 | Ga0307517_1000448618 | 108 |
| 829 | 3300028786 | Ga0307517_10143293 | Ga0307517_101432932 | 108 |
| 830 | 3300028786 | Ga0307517_10345304 | Ga0307517_103453042 | 108 |
| 831 | 3300028794 | Ga0307515_10011753 | Ga0307515_1001175313 | 108 |
| 832 | 3300028794 | Ga0307515_10093089 | Ga0307515_100930893 | 108 |
| 833 | 3300030522 | Ga0307512_10049162 | Ga0307512_100491624 | 108 |
| 834 | 3300030522 | Ga0307512_10432363 | Ga0307512_104323631 | 108 |
| 835 | 3300031456 | Ga0307513_10218243 | Ga0307513_102182432 | 108 |
| 836 | 3300031456 | Ga0307513_10269145 | Ga0307513_102691453 | 108 |
| 837 | 3300031456 | Ga0307513_10321275 | Ga0307513_103212753 | 108 |
| 838 | 3300031507 | Ga0307509_10000405 | Ga0307509_1000040562 | 108 |
| 839 | 3300031507 | Ga0307509_10012044 | Ga0307509_100120449 | 108 |
| 840 | 3300031507 | Ga0307509_10015076 | Ga0307509_100150765 | 108 |
| 841 | 3300031507 | Ga0307509_10169723 | Ga0307509_101697232 | 108 |
| 842 | 3300031507 | Ga0307509_10193952 | Ga0307509_101939523 | 108 |
| 843 | 3300031507 | Ga0307509_10196996 | Ga0307509_101969963 | 108 |
| 844 | 3300031507 | Ga0307509_10234529 | Ga0307509_102345292 | 108 |
| 845 | 3300031507 | Ga0307509_10304116 | Ga0307509_103041162 | 108 |
| 846 | 3300031548 | Ga0307408_101491191 | Ga0307408_1014911912 | 108 |
| 847 | 3300031616 | Ga0307508_10004752 | Ga0307508_100047529 | 108 |
| 848 | 3300031616 | Ga0307508_10232954 | Ga0307508_102329543 | 108 |
| 849 | 3300031616 | Ga0307508_10283804 | Ga0307508_102838042 | 108 |
| 850 | 3300031616 | Ga0307508_10660378 | Ga0307508_106603782 | 108 |
| 851 | 3300031649 | Ga0307514_10561509 | Ga0307514_105615092 | 108 |
| 852 | 3300031730 | Ga0307516_10001028 | Ga0307516_1000102818 | 108 |
| 853 | 3300031730 | Ga0307516_10001642 | Ga0307516_1000164224 | 108 |
| 854 | 3300031730 | Ga0307516_10286548 | Ga0307516_102865483 | 108 |
| 855 | 3300031730 | Ga0307516_10403535 | Ga0307516_104035352 | 108 |
| 856 | 3300031730 | Ga0307516_10450040 | Ga0307516_104500402 | 108 |
| 857 | 3300031730 | Ga0307516_10544084 | Ga0307516_105440842 | 108 |
| 858 | 3300031731 | Ga0307405_10223750 | Ga0307405_102237502 | 108 |
| 859 | 3300031731 | Ga0307405_10836870 | Ga0307405_108368701 | 108 |
| 860 | 3300031824 | Ga0307413_10030664 | Ga0307413_100306644 | 108 |
| 861 | 3300031824 | Ga0307413_10080463 | Ga0307413_100804632 | 108 |
| 862 | 3300031824 | Ga0307413_10728086 | Ga0307413_107280862 | 108 |
| 863 | 3300031852 | Ga0307410_10029244 | Ga0307410_100292443 | 108 |
| 864 | 3300031852 | Ga0307410_10199727 | Ga0307410_101997271 | 108 |
| 865 | 3300031852 | Ga0307410_10602599 | Ga0307410_106025992 | 108 |
| 866 | 3300031901 | Ga0307406_10041914 | Ga0307406_100419142 | 108 |
| 867 | 3300031901 | Ga0307406_10101387 | Ga0307406_101013872 | 108 |
| 868 | 3300031901 | Ga0307406_10983346 | Ga0307406_109833462 | 108 |
| 869 | 3300031903 | Ga0307407_10057120 | Ga0307407_100571202 | 108 |
| 870 | 3300031911 | Ga0307412_10212572 | Ga0307412_102125723 | 108 |
| 871 | 3300031911 | Ga0307412_10353583 | Ga0307412_103535832 | 108 |
| 872 | 3300031911 | Ga0307412_10470367 | Ga0307412_104703672 | 108 |
| 873 | 3300031995 | Ga0307409_100067396 | Ga0307409_1000673963 | 108 |
| 874 | 3300031995 | Ga0307409_100604516 | Ga0307409_1006045162 | 108 |
| 875 | 3300031995 | Ga0307409_101037350 | Ga0307409_1010373502 | 108 |
| 876 | 3300032002 | Ga0307416_100039492 | Ga0307416_1000394922 | 108 |
| 877 | 3300032002 | Ga0307416_100134299 | Ga0307416_1001342992 | 108 |
| 878 | 3300032002 | Ga0307416_100238961 | Ga0307416_1002389612 | 108 |
| 879 | 3300032002 | Ga0307416_101459125 | Ga0307416_1014591251 | 108 |
| 880 | 3300032004 | Ga0307414_10159719 | Ga0307414_101597193 | 108 |
| 881 | 3300032004 | Ga0307414_10160768 | Ga0307414_101607681 | 108 |
| 882 | 3300032005 | Ga0307411_10001013 | Ga0307411_100010132 | 108 |
| 883 | 3300032005 | Ga0307411_10295538 | Ga0307411_102955382 | 108 |
| 884 | 3300032005 | Ga0307411_10461735 | Ga0307411_104617352 | 108 |
| 885 | 3300032005 | Ga0307411_10561000 | Ga0307411_105610002 | 108 |
| 886 | 3300032005 | Ga0307411_11453152 | Ga0307411_114531521 | 108 |
| 887 | 3300033179 | Ga0307507_10125384 | Ga0307507_101253842 | 108 |
| 888 | 3300033179 | Ga0307507_10425208 | Ga0307507_104252082 | 108 |
| 889 | 3300033180 | Ga0307510_10003419 | Ga0307510_100034195 | 108 |
| 890 | 3300033180 | Ga0307510_10016969 | Ga0307510_100169694 | 108 |
| 891 | 3300033180 | Ga0307510_10027695 | Ga0307510_100276952 | 108 |
| 892 | 3300033180 | Ga0307510_10144662 | Ga0307510_101446623 | 108 |
| 893 | 3300033180 | Ga0307510_10346113 | Ga0307510_103461132 | 108 |
| 894 | 3300035084 | Ga0373928_0033341 | Ga0373928_0033341_157_486 | 108 |
| 895 | 3300035090 | Ga0373949_0076740 | Ga0373949_0076740_481_807 | 108 |
| 896 | 3300035171 | Ga0373946_0188725 | Ga0373946_0188725_604_939 | 108 |
| 897 | 3300035242 | Ga0373962_0281805 | Ga0373962_0281805_182_508 | 108 |
| 898 | 3300035691 | Ga0373931_0007514 | Ga0373931_0007514_129_455 | 108 |
| 899 | 3300035725 | Ga0373947_0691068 | Ga0373947_0691068_53_388 | 108 |
| 900 | 3300036401 | Ga0373937_0181250 | Ga0373937_0181250_276_602 | 108 |
| 901 | 3300037068 | Ga0373925_0260936 | Ga0373925_0260936_563_889 | 108 |
| 902 | 3300037068 | Ga0373925_0306696 | Ga0373925_0306696_218_553 | 108 |
| 903 | 3300037471 | Ga0395905_0018518 | Ga0395905_0018518_74_406 | 108 |
| 904 | 3300037471 | Ga0395905_0115051 | Ga0395905_0115051_2165_2491 | 108 |
| 905 | 3300037471 | Ga0395905_0211446 | Ga0395905_0211446_1291_1617 | 108 |
| 906 | 3300039447 | Ga0436361_0098091 | Ga0436361_0098091_637_963 | 108 |
| 907 | 3300039447 | Ga0436361_0813098 | Ga0436361_0813098_13137_13463 | 108 |
| 908 | 3300039450 | Ga0436363_0192400 | Ga0436363_0192400_213_539 | 108 |
| 909 | 3300041441 | Ga0451787_398756 | Ga0451787_398756_22_348 | 108 |
| 910 | 3300041443 | Ga0451789_0762797 | Ga0451789_0762797_177_509 | 108 |
| 911 | 3300041452 | Ga0451793_0718359 | Ga0451793_0718359_102_428 | 108 |
| 912 | 3300041453 | Ga0451797_1495146 | Ga0451797_1495146_10_342 | 108 |
| 913 | 3300041459 | Ga0451800_0517538 | Ga0451800_0517538_50_376 | 108 |
| 914 | 3300041459 | Ga0451800_0691594 | Ga0451800_0691594_282_608 | 108 |
| 915 | 3300041460 | Ga0451802_0547687 | Ga0451802_0547687_103_429 | 108 |
| 916 | 3300041486 | Ga0451807_0151166 | Ga0451807_0151166_229_561 | 108 |
| 917 | 3300041486 | Ga0451807_2629084 | Ga0451807_2629084_242_568 | 108 |
| 918 | 3300041491 | Ga0451833_0828330 | Ga0451833_0828330_336_662 | 108 |
| 919 | 3300041491 | Ga0451833_1322048 | Ga0451833_1322048_117_449 | 108 |
| 920 | 3300041492 | Ga0451835_0876415 | Ga0451835_0876415_78_410 | 108 |
| 921 | 3300041507 | Ga0451851_0809976 | Ga0451851_0809976_89_415 | 108 |
| 922 | 3300041512 | Ga0451853_0687148 | Ga0451853_0687148_460_786 | 108 |
| 923 | 3300041512 | Ga0451853_2072669 | Ga0451853_2072669_191_523 | 108 |
| 924 | 3300041512 | Ga0451853_3655248 | Ga0451853_3655248_100_426 | 108 |
| 925 | 3300042001 | Ga0439441_049695 | Ga0439441_049695_385_717 | 108 |
| 926 | 3300042005 | Ga0439448_0180170 | Ga0439448_0180170_248_574 | 108 |
| 927 | 3300042012 | Ga0439455_0021077 | Ga0439455_0021077_723_1055 | 108 |
| 928 | 3300042012 | Ga0439455_0157156 | Ga0439455_0157156_245_571 | 108 |
| 929 | 3300042156 | Ga0439446_0092475 | Ga0439446_0092475_397_741 | 108 |
| 930 | 3300042439 | Ga0439464_0002359 | Ga0439464_0002359_56_388 | 108 |
| 931 | 3300042461 | Ga0439460_0379642 | Ga0439460_0379642_89_421 | 108 |
| 932 | 3300042876 | Ga0451577_0004943 | Ga0451577_0004943_1330_1659 | 108 |
| 933 | 3300042876 | Ga0451577_0063786 | Ga0451577_0063786_2405_2731 | 108 |
| 934 | 3300044656 | Ga0466969_0000860 | Ga0466969_0000860_8251_8577 | 108 |
| 935 | 3300044673 | Ga0453683_0744322 | Ga0453683_0744322_271_597 | 108 |
| 936 | 3300044683 | Ga0466965_0199774 | Ga0466965_0199774_494_820 | 108 |
| 937 | 3300044684 | Ga0466966_0311232 | Ga0466966_0311232_198_524 | 108 |
| 938 | 3300044693 | Ga0466961_0010705 | Ga0466961_0010705_4973_5299 | 108 |
| 939 | 3300044712 | Ga0453684_0029228 | Ga0453684_0029228_470_796 | 108 |
| 940 | 3300044712 | Ga0453684_0144657 | Ga0453684_0144657_1588_1917 | 108 |
| 941 | 3300044765 | Ga0466970_0170156 | Ga0466970_0170156_166_492 | 108 |
| 942 | 3300045049 | Ga0466959_0267976 | Ga0466959_0267976_223_549 | 108 |
| 943 | 3300046454 | Ga0495592_0000528 | Ga0495592_0000528_14953_15279 | 108 |
| 944 | 3300046454 | Ga0495592_0246343 | Ga0495592_0246343_24_353 | 108 |
| 945 | 3300046459 | Ga0495629_0211042 | Ga0495629_0211042_227_553 | 108 |
| 946 | 3300046472 | Ga0495580_0107207 | Ga0495580_0107207_192_527 | 108 |
| 947 | 3300046499 | Ga0495594_0575797 | Ga0495594_0575797_26_358 | 108 |
| 948 | 3300046507 | Ga0495606_0164460 | Ga0495606_0164460_941_1267 | 108 |
| 949 | 3300046511 | Ga0495608_0724432 | Ga0495608_0724432_35_361 | 108 |
| 950 | 3300046515 | Ga0495620_0232947 | Ga0495620_0232947_259_591 | 108 |
| 951 | 3300046515 | Ga0495620_0281191 | Ga0495620_0281191_256_582 | 108 |
| 952 | 3300046517 | Ga0495630_0122940 | Ga0495630_0122940_1350_1676 | 108 |
| 953 | 3300046519 | Ga0495632_0192975 | Ga0495632_0192975_46_372 | 108 |
| 954 | 3300046519 | Ga0495632_0334097 | Ga0495632_0334097_240_566 | 108 |
| 955 | 3300046526 | Ga0495666_0151471 | Ga0495666_0151471_209_535 | 108 |
| 956 | 3300046528 | Ga0495642_0322436 | Ga0495642_0322436_153_479 | 108 |
| 957 | 3300046537 | Ga0495598_0062228 | Ga0495598_0062228_733_1068 | 108 |
| 958 | 3300046539 | Ga0495621_0122910 | Ga0495621_0122910_494_826 | 108 |
| 959 | 3300046539 | Ga0495621_0526240 | Ga0495621_0526240_71_403 | 108 |
| 960 | 3300046557 | Ga0495622_0073490 | Ga0495622_0073490_104_430 | 108 |
| 961 | 3300046558 | Ga0495633_0205740 | Ga0495633_0205740_102_434 | 108 |
| 962 | 3300046558 | Ga0495633_0366106 | Ga0495633_0366106_209_535 | 108 |
| 963 | 3300046615 | Ga0495656_0199628 | Ga0495656_0199628_536_868 | 108 |
| 964 | 3300046615 | Ga0495656_0721720 | Ga0495656_0721720_134_469 | 108 |
| 965 | 3300046616 | Ga0495668_0035434 | Ga0495668_0035434_1360_1686 | 108 |
| 966 | 3300046616 | Ga0495668_0560540 | Ga0495668_0560540_21_347 | 108 |
| 967 | 3300046660 | Ga0495625_0870058 | Ga0495625_0870058_38_364 | 108 |
| 968 | 3300046680 | Ga0495646_0339154 | Ga0495646_0339154_203_529 | 108 |
| 969 | 3300046683 | Ga0495658_0043155 | Ga0495658_0043155_1373_1705 | 108 |
| 970 | 3300046683 | Ga0495658_0245873 | Ga0495658_0245873_253_579 | 108 |
| 971 | 3300046683 | Ga0495658_0339260 | Ga0495658_0339260_136_471 | 108 |
| 972 | 3300046683 | Ga0495658_0429785 | Ga0495658_0429785_124_450 | 108 |
| 973 | 3300046689 | Ga0495613_0280342 | Ga0495613_0280342_427_759 | 108 |
| 974 | 3300046691 | Ga0495670_0221475 | Ga0495670_0221475_574_906 | 108 |
| 975 | 3300046692 | Ga0495671_0099900 | Ga0495671_0099900_237_563 | 108 |
| 976 | 3300047318 | Ga0495636_0143061 | Ga0495636_0143061_355_690 | 108 |
| 977 | 3300047321 | Ga0495676_0019792 | Ga0495676_0019792_4287_4613 | 108 |
| 978 | 3300047472 | Ga0495686_0138968 | Ga0495686_0138968_466_792 | 108 |
| 979 | 3300047472 | Ga0495686_0600943 | Ga0495686_0600943_34_360 | 108 |
| 980 | 3300047673 | Ga0495593_0088879 | Ga0495593_0088879_870_1196 | 108 |
| 981 | 3300048903 | Ga0496100_1027182 | Ga0496100_1027182_97_423 | 108 |
| 982 | 3300048905 | Ga0496102_0018789 | Ga0496102_0018789_3129_3455 | 108 |
| 983 | 3300048907 | Ga0496104_0043886 | Ga0496104_0043886_1607_1942 | 108 |
| 984 | 3300048908 | Ga0496105_0061054 | Ga0496105_0061054_1619_1954 | 108 |
| 985 | 3300048909 | Ga0496106_0007832 | Ga0496106_0007832_5313_5639 | 108 |
| 986 | 3300048909 | Ga0496106_0385977 | Ga0496106_0385977_753_1079 | 108 |
| 987 | 3300048910 | Ga0496107_0482624 | Ga0496107_0482624_313_645 | 108 |
| 988 | 3300048911 | Ga0496108_0144096 | Ga0496108_0144096_1085_1420 | 108 |
| 989 | 3300048911 | Ga0496108_0789342 | Ga0496108_0789342_170_523 | 108 |
| 990 | 3300048912 | Ga0496109_0874340 | Ga0496109_0874340_479_811 | 108 |
| 991 | 3300048913 | Ga0496110_0280909 | Ga0496110_0280909_500_835 | 108 |
| 992 | 3300048917 | Ga0496114_0062845 | Ga0496114_0062845_1655_1990 | 108 |
| 993 | 3300048917 | Ga0496114_0436284 | Ga0496114_0436284_158_514 | 108 |
| 994 | 3300048928 | Ga0496125_0687232 | Ga0496125_0687232_18_398 | 108 |
| 995 | 3300049571 | Ga0501034_0461977 | Ga0501034_0461977_450_776 | 108 |
| 996 | 3300049573 | Ga0501037_0225616 | Ga0501037_0225616_465_803 | 108 |
| 997 | 3300049575 | Ga0501039_0785637 | Ga0501039_0785637_260_586 | 108 |
| 998 | 3300049579 | Ga0501043_0000277 | Ga0501043_0000277_31597_31926 | 108 |
| 999 | 3300049580 | Ga0501046_0000345 | Ga0501046_0000345_14805_15134 | 108 |
| 1000 | 3300049581 | Ga0501047_0000395 | Ga0501047_0000395_31597_31926 | 108 |
| 1001 | 3300049582 | Ga0501048_0000111 | Ga0501048_0000111_31547_31876 | 108 |
| 1002 | 3300049649 | Ga0501198_000023 | Ga0501198_000023_59744_60073 | 108 |
| 1003 | 3300049653 | Ga0501206_009613 | Ga0501206_009613_861_1190 | 108 |
| 1004 | 3300049662 | Ga0501222_000031 | Ga0501222_000031_9044_9373 | 108 |
| 1005 | 3300049662 | Ga0501222_014492 | Ga0501222_014492_81_407 | 108 |
| 1006 | 3300049759 | Ga0501262_011227 | Ga0501262_011227_663_992 | 108 |
| 1007 | 3300049760 | Ga0501263_064676 | Ga0501263_064676_209_541 | 108 |
| 1008 | 3300049762 | Ga0501265_000558 | Ga0501265_000558_1098_1427 | 108 |
| 1009 | 3300049779 | Ga0501283_021568 | Ga0501283_021568_113_442 | 108 |
| 1010 | 3300049823 | Ga0501044_0423434 | Ga0501044_0423434_737_1066 | 108 |
| 1011 | 3300050489 | nmdc:mga03683_127196_c1 | nmdc:mga03683_127196_c1_389_715 | 108 |
| 1012 | 3300050489 | nmdc:mga03683_13639_c1 | nmdc:mga03683_13639_c1_1765_2091 | 108 |
| 1013 | 3300050489 | nmdc:mga03683_452130_c1 | nmdc:mga03683_452130_c1_25_351 | 108 |
| 1014 | 3300050489 | nmdc:mga03683_48065_c1 | nmdc:mga03683_48065_c1_951_1304 | 108 |
| 1015 | 3300050490 | nmdc:mga03n38_184761_c1 | nmdc:mga03n38_184761_c1_146_472 | 108 |
| 1016 | 3300050491 | nmdc:mga00v17_263901_c1 | nmdc:mga00v17_263901_c1_522_872 | 108 |
| 1017 | 3300050493 | nmdc:mga0k408_214788_c1 | nmdc:mga0k408_214788_c1_273_599 | 108 |
| 1018 | 3300050493 | nmdc:mga0k408_31847_c1 | nmdc:mga0k408_31847_c1_210_563 | 108 |
| 1019 | 3300050493 | nmdc:mga0k408_339950_c1 | nmdc:mga0k408_339950_c1_448_777 | 108 |
| 1020 | 3300050493 | nmdc:mga0k408_37631_c1 | nmdc:mga0k408_37631_c1_65_391 | 108 |
| 1021 | 3300050493 | nmdc:mga0k408_75494_c1 | nmdc:mga0k408_75494_c1_1553_1879 | 108 |
| 1022 | 3300050494 | nmdc:mga06z11_452992_c1 | nmdc:mga06z11_452992_c1_261_614 | 108 |
| 1023 | 3300050496 | nmdc:mga07m45_13934_c1 | nmdc:mga07m45_13934_c1_2651_3004 | 108 |
| 1024 | 3300050496 | nmdc:mga07m45_34263_c1 | nmdc:mga07m45_34263_c1_2292_2618 | 108 |
| 1025 | 3300050496 | nmdc:mga07m45_580003_c1 | nmdc:mga07m45_580003_c1_54_380 | 108 |
| 1026 | 3300050496 | nmdc:mga07m45_921045_c1 | nmdc:mga07m45_921045_c1_40_366 | 108 |
| 1027 | 3300050507 | nmdc:mga05p37_66948_c1 | nmdc:mga05p37_66948_c1_1447_1773 | 108 |
| 1028 | 3300050508 | nmdc:mga09592_9369_c1 | nmdc:mga09592_9369_c1_3716_4045 | 108 |
| 1029 | 3300050509 | nmdc:mga0qj67_41652_c1 | nmdc:mga0qj67_41652_c1_261_590 | 108 |
| 1030 | 3300050516 | nmdc:mga0sz30_543115_c1 | nmdc:mga0sz30_543115_c1_146_472 | 108 |
| 1031 | 3300053078 | Ga0495612_0198813 | Ga0495612_0198813_104_436 | 108 |
| 1032 | 3300053086 | Ga0500578_0037855 | Ga0500578_0037855_206_532 | 108 |
| 1033 | 3300053090 | Ga0500646_0038237 | Ga0500646_0038237_971_1297 | 108 |
| 1034 | 3300053092 | Ga0500583_0503473 | Ga0500583_0503473_59_385 | 108 |
| 1035 | 3300053093 | Ga0500651_0045454 | Ga0500651_0045454_2379_2705 | 108 |
| 1036 | 3300053093 | Ga0500651_0170159 | Ga0500651_0170159_32_358 | 108 |
| 1037 | 3300053098 | Ga0500650_0139340 | Ga0500650_0139340_171_497 | 108 |
| 1038 | 3300053121 | Ga0500607_046582 | Ga0500607_046582_79_405 | 108 |
| 1039 | 3300053131 | Ga0500652_006725 | Ga0500652_006725_27_353 | 108 |
| 1040 | 3300053133 | Ga0500655_017681 | Ga0500655_017681_970_1296 | 108 |
| 1041 | 3300053136 | Ga0500559_0000265 | Ga0500559_0000265_24840_25166 | 108 |
| 1042 | 3300053136 | Ga0500559_0564832 | Ga0500559_0564832_36_362 | 108 |
| 1043 | 3300053137 | Ga0500561_0181695 | Ga0500561_0181695_86_412 | 108 |
| 1044 | 3300053138 | Ga0500564_133917 | Ga0500564_133917_75_401 | 108 |
| 1045 | 3300053139 | Ga0500568_0045866 | Ga0500568_0045866_747_1073 | 108 |
| 1046 | 3300053148 | Ga0500590_232170 | Ga0500590_232170_21_350 | 108 |
| 1047 | 3300053154 | Ga0500619_000116 | Ga0500619_000116_18276_18602 | 108 |
| 1048 | 3300053155 | Ga0500620_258650 | Ga0500620_258650_162_488 | 108 |
| 1049 | 3300053156 | Ga0500622_0002039 | Ga0500622_0002039_5891_6217 | 108 |
| 1050 | 3300053158 | Ga0500627_0380069 | Ga0500627_0380069_86_412 | 108 |
| 1051 | 3300053177 | Ga0500636_0053627 | Ga0500636_0053627_589_915 | 108 |
| 1052 | 3300053722 | Ga0500649_123212 | Ga0500649_123212_465_791 | 108 |
| 1053 | 3300053730 | Ga0500645_003124 | Ga0500645_003124_4120_4446 | 108 |
| 1054 | 3300053739 | Ga0500587_030467 | Ga0500587_030467_58_384 | 108 |
| 1055 | 3300059421 | Ga0590071_002620 | Ga0590071_002620_3445_3780 | 108 |
| 1056 | iso_pu_bacteria | 2738543013 | 2739247323 | 108 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p8n-assembly1.cif.gz_B | tmhydabc- t. maritima hydrogenase with bridge closed | 0.9154 | 6 | 104 |
| 7p5h-assembly1.cif.gz_b | tmhydabc- d2 map | 0.9076 | 6 | 104 |
| 5abr-assembly1.cif.gz_B | structure of fesi protein from azotobacter vinelandii | 0.8897 | 6 | 106 |
| 1f37-assembly1.cif.gz_B | structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.8746 | 6 | 103 |
| 7p92-assembly1.cif.gz_B | tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up | 0.8742 | 6 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5abrB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8897 | 6 | 106 | 3.40.30.10 |
| 5abrB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.858 | 6 | 106 | 3.40.30.10 |
| 1m2dB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8507 | 6 | 104 | 3.40.30.10 |
| af_Q55BP2_216_308_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8357 | 6 | 103 | 3.40.30.10 |
| 1m2dB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8274 | 6 | 104 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258LFT3-F1-model_v4 | 2Fe-2S ferredoxin | 0.9821 | 1 | 54 |
|
| AF-W7WE07-F1-model_v4 | 2FeCpFd | 0.976 | 1 | 108 |
|
| AF-B1XYQ0-F1-model_v4 | Ferredoxin-like protein | 0.9759 | 1 | 108 |
|
| AF-A0A2D0AM71-F1-model_v4 | 2Fe-2S ferredoxin | 0.9748 | 1 | 108 |
|
| AF-A0A1Q3R477-F1-model_v4 | 2Fe-2S ferredoxin | 0.974 | 1 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar