F489177

General Info

Members Datasets Scaffolds Average Seq Length
1056 374 1047 109

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100079646|Ga0068853_1000796464
Length 126
Sequence MKNPRFAVRQHTLPTIPAMSYFERHIFFCLNKRDKGEECCADQGAQAGFDHCKSRVKAERLAGPGGVRVNKSGCLDRCAGGPVAVVYPEAVWYTYVDKNDIDEIVDSHLRGGRVVERLLLPPDVGR

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2738541300 Massilia sp. GV016 Isolate Unclassified
6 2738543013 Variovorax sp. BT01 Isolate Unclassified
7 2738543018 Massilia sp. GV045 Isolate Unclassified
8 2738543030 Massilia sp. GV097 Isolate Unclassified
9 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
224 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
229 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
330 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
331 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
332 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
333 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
334 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
335 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
336 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
353 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
356 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
357 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
358 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
359 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
362 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
365 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
366 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
369 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
370 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
371 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
372 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
373 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
374 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.09
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.93
Nodule 0
Rhizoplane 2.94
Rhizosphere 79.36
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019594 3300001979 Bacteria 2379
2 JGI25153J46596_10006137 3300003215 Bacteria 6160
3 Ga0065712_10517541 3300005290 Bacteria 638
4 Ga0070658_10274738 3300005327 Bacteria 1434
5 Ga0070658_10933212 3300005327 Bacteria 755
6 Ga0070676_10002478 3300005328 Bacteria 9462
7 Ga0070676_10031932 3300005328 Bacteria 3014
8 Ga0070683_101351563 3300005329 Bacteria 685
9 Ga0070690_100102793 3300005330 Bacteria 1897
10 Ga0070690_101045909 3300005330 Bacteria 645
11 Ga0070670_100000775 3300005331 Bacteria 24812
12 Ga0070670_100019018 3300005331 Bacteria 5891
13 Ga0070670_100067838 3300005331 Bacteria 3060
14 Ga0070670_100127781 3300005331 Bacteria 2194
15 Ga0070670_100134480 3300005331 Bacteria 2136
16 Ga0070670_100223566 3300005331 Bacteria 1638
17 Ga0070670_100282417 3300005331 Bacteria 1449
18 Ga0070670_100307717 3300005331 Bacteria 1387
19 Ga0070670_100363089 3300005331 Bacteria 1274
20 Ga0070670_101042747 3300005331 Bacteria 744
21 Ga0070677_10004477 3300005333 Bacteria 4566
22 Ga0070677_10024937 3300005333 Bacteria 2228
23 Ga0070677_10032776 3300005333 Bacteria 1996
24 Ga0070677_10039794 3300005333 Bacteria 1847
25 Ga0070677_10055466 3300005333 Bacteria 1618
26 Ga0070677_10247812 3300005333 Bacteria 883
27 Ga0070677_10549853 3300005333 Bacteria 633
28 Ga0068869_100001648 3300005334 Bacteria 13321
29 Ga0068869_100024199 3300005334 Bacteria 4205
30 Ga0068869_100177501 3300005334 Bacteria 1668
31 Ga0068869_100575017 3300005334 Bacteria 949
32 Ga0070666_10002795 3300005335 Bacteria 10542
33 Ga0070666_10045779 3300005335 Bacteria 2933
34 Ga0070666_10070708 3300005335 Bacteria 2374
35 Ga0070666_10155665 3300005335 Bacteria 1596
36 Ga0070666_10756903 3300005335 Bacteria 714
37 Ga0070666_11097180 3300005335 Bacteria 592
38 Ga0070682_100965057 3300005337 Bacteria 705
39 Ga0068868_100035720 3300005338 Bacteria 3843
40 Ga0068868_100108975 3300005338 Bacteria 2248
41 Ga0068868_100164549 3300005338 Bacteria 1834
42 Ga0068868_100169169 3300005338 Bacteria 1809
43 Ga0068868_100532513 3300005338 Bacteria 1033
44 Ga0068868_100634143 3300005338 Bacteria 950
45 Ga0068868_100760915 3300005338 Bacteria 871
46 Ga0068868_100774899 3300005338 Bacteria 863
47 Ga0070660_100878335 3300005339 Bacteria 755
48 Ga0070660_101828726 3300005339 Bacteria 518
49 Ga0070689_101117843 3300005340 Bacteria 705
50 Ga0070687_100311939 3300005343 Bacteria 1002
51 Ga0070661_100748476 3300005344 Bacteria 799
52 Ga0070661_101018060 3300005344 Bacteria 688
53 Ga0070668_100013107 3300005347 Bacteria 6178
54 Ga0070668_100188821 3300005347 Bacteria 1687
55 Ga0070668_100546617 3300005347 Bacteria 1008
56 Ga0070668_101437646 3300005347 Bacteria 629
57 Ga0070669_100005859 3300005353 Bacteria 8865
58 Ga0070669_100013170 3300005353 Bacteria 5878
59 Ga0070669_100045646 3300005353 Bacteria 3193
60 Ga0070669_101004781 3300005353 Bacteria 716
61 Ga0070669_101005154 3300005353 Bacteria 716
62 Ga0070675_100001482 3300005354 Bacteria 17319
63 Ga0070675_100020379 3300005354 Bacteria 5292
64 Ga0070675_100024332 3300005354 Bacteria 4849
65 Ga0070675_100092713 3300005354 Bacteria 2532
66 Ga0070675_100198527 3300005354 Bacteria 1740
67 Ga0070675_100214868 3300005354 Bacteria 1673
68 Ga0070675_100218486 3300005354 Bacteria 1659
69 Ga0070675_100658978 3300005354 Bacteria 952
70 Ga0070675_101250616 3300005354 Bacteria 684
71 Ga0070675_101548308 3300005354 Bacteria 612
72 Ga0070671_100005666 3300005355 Bacteria 9939
73 Ga0070671_100030454 3300005355 Bacteria 4453
74 Ga0070671_100074874 3300005355 Bacteria 2828
75 Ga0070671_100076135 3300005355 Bacteria 2803
76 Ga0070671_100089324 3300005355 Bacteria 2580
77 Ga0070674_100005009 3300005356 Bacteria 7604
78 Ga0070674_100009279 3300005356 Bacteria 5889
79 Ga0070674_100177682 3300005356 Bacteria 1628
80 Ga0070674_101338292 3300005356 Bacteria 640
81 Ga0070674_101607414 3300005356 Bacteria 586
82 Ga0070674_101809086 3300005356 Bacteria 554
83 Ga0070673_100003372 3300005364 Bacteria 9941
84 Ga0070673_100029454 3300005364 Bacteria 4094
85 Ga0070673_100035511 3300005364 Bacteria 3781
86 Ga0070673_100069367 3300005364 Bacteria 2825
87 Ga0070673_100161601 3300005364 Bacteria 1905
88 Ga0070673_100223986 3300005364 Bacteria 1629
89 Ga0070673_100417265 3300005364 Bacteria 1203
90 Ga0070673_100520427 3300005364 Bacteria 1078
91 Ga0070673_101952480 3300005364 Bacteria 557
92 Ga0070688_100053688 3300005365 Bacteria 2522
93 Ga0070688_100096372 3300005365 Bacteria 1943
94 Ga0070659_100170105 3300005366 Bacteria 1784
95 Ga0070659_100276123 3300005366 Bacteria 1397
96 Ga0070659_100978184 3300005366 Bacteria 742
97 Ga0070667_100001504 3300005367 Bacteria 20851
98 Ga0070667_100120197 3300005367 Bacteria 2285
99 Ga0070667_100279507 3300005367 Bacteria 1499
100 Ga0070667_100376399 3300005367 Bacteria 1289
101 Ga0070667_100599779 3300005367 Bacteria 1015
102 Ga0070667_100788205 3300005367 Bacteria 882
103 Ga0070667_101197729 3300005367 Bacteria 711
104 Ga0070667_101465799 3300005367 Bacteria 641
105 Ga0070713_100000031 3300005436 Bacteria 88727
106 Ga0070701_10486249 3300005438 Bacteria 799
107 Ga0070700_100073191 3300005441 Bacteria 2193
108 Ga0070700_100734653 3300005441 Bacteria 788
109 Ga0070700_100754424 3300005441 Bacteria 779
110 Ga0070708_100710240 3300005445 Bacteria 946
111 Ga0070663_100032448 3300005455 Bacteria 3600
112 Ga0070663_100265425 3300005455 Bacteria 1363
113 Ga0070663_100273859 3300005455 Bacteria 1343
114 Ga0070678_100017348 3300005456 Bacteria 4632
115 Ga0070678_100076806 3300005456 Bacteria 2517
116 Ga0070678_100077397 3300005456 Bacteria 2509
117 Ga0070678_100107750 3300005456 Bacteria 2174
118 Ga0070678_100108943 3300005456 Bacteria 2163
119 Ga0070678_100267040 3300005456 Bacteria 1441
120 Ga0070678_100337227 3300005456 Bacteria 1292
121 Ga0070678_100353662 3300005456 Bacteria 1264
122 Ga0070678_100437635 3300005456 Bacteria 1143
123 Ga0070678_100677488 3300005456 Bacteria 927
124 Ga0070678_100738649 3300005456 Bacteria 889
125 Ga0070678_100778852 3300005456 Bacteria 867
126 Ga0070678_101272963 3300005456 Bacteria 684
127 Ga0070678_101488809 3300005456 Bacteria 634
128 Ga0070678_101563137 3300005456 Bacteria 619
129 Ga0070678_102261053 3300005456 Bacteria 516
130 Ga0070662_100013829 3300005457 Bacteria 5376
131 Ga0070662_100076193 3300005457 Bacteria 2486
132 Ga0070662_100356970 3300005457 Bacteria 1199
133 Ga0070662_100427554 3300005457 Bacteria 1097
134 Ga0070662_100970130 3300005457 Bacteria 727
135 Ga0070681_10197743 3300005458 Bacteria 1929
136 Ga0068867_100002317 3300005459 Bacteria 13397
137 Ga0068867_100005331 3300005459 Bacteria 9088
138 Ga0068867_100006908 3300005459 Bacteria 8032
139 Ga0068867_100055304 3300005459 Bacteria 2934
140 Ga0068867_100056848 3300005459 Bacteria 2896
141 Ga0068867_100077545 3300005459 Bacteria 2497
142 Ga0068867_100147428 3300005459 Bacteria 1846
143 Ga0068867_100233881 3300005459 Bacteria 1487
144 Ga0068867_100241274 3300005459 Bacteria 1466
145 Ga0068867_100477329 3300005459 Bacteria 1068
146 Ga0068867_100574557 3300005459 Bacteria 979
147 Ga0068867_100654761 3300005459 Bacteria 922
148 Ga0068867_101268806 3300005459 Bacteria 679
149 Ga0070685_10412280 3300005466 Bacteria 938
150 Ga0070685_10667608 3300005466 Bacteria 755
151 Ga0070706_100000367 3300005467 Bacteria 54314
152 Ga0070707_100054004 3300005468 Bacteria 3852
153 Ga0070707_100686286 3300005468 Bacteria 987
154 Ga0070698_100327392 3300005471 Bacteria 1463
155 Ga0070699_100030764 3300005518 Bacteria 4634
156 Ga0070679_100055562 3300005530 Bacteria 3942
157 Ga0070679_101016454 3300005530 Bacteria 773
158 Ga0070684_100159016 3300005535 Bacteria 2049
159 Ga0068853_100079646 3300005539 Bacteria 2865
160 Ga0068853_100917267 3300005539 Bacteria 842
161 Ga0068853_101735799 3300005539 Bacteria 605
162 Ga0070672_100000485 3300005543 Bacteria 23134
163 Ga0070672_100016669 3300005543 Bacteria 5267
164 Ga0070672_100030860 3300005543 Bacteria 4030
165 Ga0070672_100074313 3300005543 Bacteria 2711
166 Ga0070672_100118478 3300005543 Bacteria 2165
167 Ga0070672_100129179 3300005543 Bacteria 2075
168 Ga0070672_100133758 3300005543 Bacteria 2040
169 Ga0070672_100255897 3300005543 Bacteria 1475
170 Ga0070672_100339769 3300005543 Bacteria 1278
171 Ga0070672_101240598 3300005543 Bacteria 665
172 Ga0070672_101248646 3300005543 Bacteria 662
173 Ga0070686_100323357 3300005544 Bacteria 1151
174 Ga0070686_101675827 3300005544 Bacteria 539
175 Ga0070665_100028038 3300005548 Bacteria 5672
176 Ga0070665_100335794 3300005548 Bacteria 1516
177 Ga0070665_100338241 3300005548 Bacteria 1510
178 Ga0070665_100546975 3300005548 Bacteria 1170
179 Ga0070665_100753413 3300005548 Bacteria 987
180 Ga0070665_101524301 3300005548 Bacteria 677
181 Ga0070664_100012848 3300005564 Bacteria 6812
182 Ga0070664_100113896 3300005564 Bacteria 2362
183 Ga0070664_100377425 3300005564 Bacteria 1293
184 Ga0070664_100534554 3300005564 Bacteria 1083
185 Ga0070664_101180664 3300005564 Bacteria 722
186 Ga0070664_101223881 3300005564 Bacteria 708
187 Ga0068857_100095028 3300005577 Bacteria 2669
188 Ga0068857_100447095 3300005577 Bacteria 1208
189 Ga0068857_101461259 3300005577 Bacteria 666
190 Ga0068854_100090840 3300005578 Bacteria 2272
191 Ga0068854_100113081 3300005578 Bacteria 2050
192 Ga0068854_100156755 3300005578 Bacteria 1760
193 Ga0068854_100223915 3300005578 Bacteria 1489
194 Ga0068854_101458403 3300005578 Bacteria 620
195 Ga0068856_100205955 3300005614 Bacteria 1982
196 Ga0068856_101302221 3300005614 Bacteria 742
197 Ga0070702_101758564 3300005615 Bacteria 517
198 Ga0068852_100092155 3300005616 Bacteria 2713
199 Ga0068852_100194266 3300005616 Bacteria 1917
200 Ga0068852_100206199 3300005616 Bacteria 1862
201 Ga0068852_100320799 3300005616 Bacteria 1504
202 Ga0068852_100607949 3300005616 Bacteria 1098
203 Ga0068852_101336581 3300005616 Bacteria 738
204 Ga0068852_102027063 3300005616 Bacteria 597
205 Ga0068859_100070277 3300005617 Bacteria 3536
206 Ga0068859_100136538 3300005617 Bacteria 2525
207 Ga0068859_100986015 3300005617 Bacteria 925
208 Ga0068864_100006073 3300005618 Bacteria 9912
209 Ga0068864_100076573 3300005618 Bacteria 2924
210 Ga0068864_100118711 3300005618 Bacteria 2362
211 Ga0068864_100195683 3300005618 Bacteria 1855
212 Ga0068864_100449106 3300005618 Bacteria 1233
213 Ga0068864_100845441 3300005618 Bacteria 901
214 Ga0068866_10005941 3300005718 Bacteria 5074
215 Ga0068866_10498545 3300005718 Bacteria 805
216 Ga0068861_100007796 3300005719 Bacteria 7358
217 Ga0068861_100010477 3300005719 Bacteria 6434
218 Ga0068861_100059399 3300005719 Bacteria 2928
219 Ga0068861_101539259 3300005719 Bacteria 653
220 Ga0068851_10054329 3300005834 Bacteria 2040
221 Ga0068851_10134243 3300005834 Bacteria 1341
222 Ga0068851_10192843 3300005834 Bacteria 1133
223 Ga0068851_10207691 3300005834 Bacteria 1095
224 Ga0068851_10326610 3300005834 Bacteria 887
225 Ga0068870_10104166 3300005840 Bacteria 1609
226 Ga0068870_10162280 3300005840 Bacteria 1326
227 Ga0068870_10353722 3300005840 Bacteria 943
228 Ga0068863_100006580 3300005841 Bacteria 11405
229 Ga0068863_100010999 3300005841 Bacteria 8776
230 Ga0068863_100056110 3300005841 Bacteria 3729
231 Ga0068863_100094986 3300005841 Bacteria 2830
232 Ga0068863_100251725 3300005841 Bacteria 1706
233 Ga0068863_100464831 3300005841 Bacteria 1243
234 Ga0068863_101062392 3300005841 Bacteria 813
235 Ga0068863_101239218 3300005841 Bacteria 752
236 Ga0068858_100004441 3300005842 Bacteria 13757
237 Ga0068858_100055279 3300005842 Bacteria 3669
238 Ga0068858_101420961 3300005842 Bacteria 684
239 Ga0068860_100006168 3300005843 Bacteria 12055
240 Ga0068860_100122793 3300005843 Bacteria 2488
241 Ga0068860_100306129 3300005843 Bacteria 1558
242 Ga0068860_100579483 3300005843 Bacteria 1126
243 Ga0068862_100011734 3300005844 Bacteria 7230
244 Ga0068862_100086216 3300005844 Bacteria 2729
245 Ga0068862_100178666 3300005844 Bacteria 1904
246 Ga0068862_100216042 3300005844 Bacteria 1734
247 Ga0068862_101949855 3300005844 Bacteria 598
248 Ga0070717_10888792 3300006028 Bacteria 811
249 Ga0075365_10314835 3300006038 Bacteria 1102
250 Ga0075368_10003231 3300006042 Bacteria 5425
251 Ga0075368_10005709 3300006042 Bacteria 4300
252 Ga0075368_10527534 3300006042 Bacteria 529
253 Ga0075363_100000145 3300006048 Bacteria 17501
254 Ga0075363_100012536 3300006048 Bacteria 4091
255 Ga0075363_100295166 3300006048 Bacteria 940
256 Ga0075363_100454751 3300006048 Bacteria 757
257 Ga0075363_100485893 3300006048 Bacteria 732
258 Ga0075363_100539762 3300006048 Bacteria 695
259 Ga0075364_10013229 3300006051 Bacteria 5065
260 Ga0075364_10264221 3300006051 Bacteria 1170
261 Ga0070716_100131326 3300006173 Bacteria 1583
262 Ga0070712_100203974 3300006175 Bacteria 1555
263 Ga0075362_10000580 3300006177 Bacteria 10685
264 Ga0075362_10003899 3300006177 Bacteria 5296
265 Ga0075362_10009196 3300006177 Bacteria 3810
266 Ga0075362_10059103 3300006177 Bacteria 1731
267 Ga0075362_10171464 3300006177 Bacteria 1049
268 Ga0075362_10292023 3300006177 Bacteria 808
269 Ga0075362_10297218 3300006177 Bacteria 801
270 Ga0075362_10557038 3300006177 Bacteria 590
271 Ga0075367_10002249 3300006178 Bacteria 8731
272 Ga0075367_10004330 3300006178 Bacteria 6910
273 Ga0075367_10021570 3300006178 Bacteria 3601
274 Ga0075367_10026303 3300006178 Bacteria 3299
275 Ga0075367_10154559 3300006178 Bacteria 1425
276 Ga0075367_10513061 3300006178 Bacteria 761
277 Ga0075369_10003203 3300006186 Bacteria 5939
278 Ga0075369_10339395 3300006186 Bacteria 704
279 Ga0075366_10000582 3300006195 Bacteria 17130
280 Ga0075366_10009057 3300006195 Bacteria 5551
281 Ga0075366_10009118 3300006195 Bacteria 5533
282 Ga0075366_10010938 3300006195 Bacteria 5107
283 Ga0075366_10012436 3300006195 Bacteria 4827
284 Ga0075366_10064499 3300006195 Bacteria 2178
285 Ga0075366_10117119 3300006195 Bacteria 1604
286 Ga0075366_10226494 3300006195 Bacteria 1139
287 Ga0075366_10547006 3300006195 Bacteria 717
288 Ga0075366_10549934 3300006195 Bacteria 715
289 Ga0075366_10577617 3300006195 Bacteria 696
290 Ga0097621_100025465 3300006237 Bacteria 4630
291 Ga0097621_100147122 3300006237 Bacteria 2018
292 Ga0075370_10000854 3300006353 Bacteria 12360
293 Ga0075370_10002800 3300006353 Bacteria 8175
294 Ga0075370_10003383 3300006353 Bacteria 7579
295 Ga0075370_10045133 3300006353 Bacteria 2492
296 Ga0075370_10097322 3300006353 Bacteria 1701
297 Ga0075370_10133920 3300006353 Bacteria 1447
298 Ga0075370_10211259 3300006353 Bacteria 1146
299 Ga0075370_10278882 3300006353 Bacteria 993
300 Ga0075370_10382760 3300006353 Bacteria 843
301 Ga0068871_100040253 3300006358 Bacteria 3743
302 Ga0068871_100124281 3300006358 Bacteria 2182
303 Ga0068871_100222012 3300006358 Bacteria 1637
304 Ga0068871_100691793 3300006358 Bacteria 934
305 Ga0068871_100873779 3300006358 Bacteria 832
306 Ga0068871_100887637 3300006358 Bacteria 826
307 Ga0075430_100045709 3300006846 Bacteria 3698
308 Ga0068865_100023882 3300006881 Bacteria 4008
309 Ga0068865_100074584 3300006881 Bacteria 2416
310 Ga0068865_101233065 3300006881 Bacteria 663
311 Ga0068865_101692914 3300006881 Bacteria 570
312 Ga0097620_100070277 3300006931 Bacteria 3536
313 Ga0097620_100136542 3300006931 Bacteria 2525
314 Ga0097620_100986196 3300006931 Bacteria 925
315 Ga0105250_10091014 3300009092 Bacteria 1241
316 Ga0105240_10018949 3300009093 Bacteria 9215
317 Ga0105240_10081673 3300009093 Bacteria 3971
318 Ga0111539_10132095 3300009094 Bacteria 2923
319 Ga0111539_11926734 3300009094 Bacteria 685
320 Ga0111539_12012739 3300009094 Bacteria 670
321 Ga0105245_10048172 3300009098 Bacteria 3812
322 Ga0105245_10822413 3300009098 Bacteria 968
323 Ga0105245_11098617 3300009098 Bacteria 841
324 Ga0114129_10078156 3300009147 Bacteria 4603
325 Ga0105243_10000649 3300009148 Bacteria 34418
326 Ga0105243_10018605 3300009148 Bacteria 5264
327 Ga0105243_10035667 3300009148 Bacteria 3856
328 Ga0105243_10219249 3300009148 Bacteria 1680
329 Ga0105243_10718625 3300009148 Bacteria 976
330 Ga0105241_10277484 3300009174 Bacteria 1430
331 Ga0105241_10981838 3300009174 Bacteria 789
332 Ga0105242_10147470 3300009176 Bacteria 2048
333 Ga0105242_10764653 3300009176 Bacteria 953
334 Ga0105248_10033310 3300009177 Bacteria 5755
335 Ga0105248_10044143 3300009177 Bacteria 4999
336 Ga0105248_10134398 3300009177 Bacteria 2791
337 Ga0105248_10194699 3300009177 Bacteria 2284
338 Ga0105248_11059248 3300009177 Bacteria 916
339 Ga0105248_11615637 3300009177 Bacteria 734
340 Ga0105248_13039546 3300009177 Bacteria 534
341 Ga0105237_10001988 3300009545 Bacteria 26016
342 Ga0105237_10881549 3300009545 Bacteria 902
343 Ga0105238_10014640 3300009551 Bacteria 7932
344 Ga0105238_11637287 3300009551 Bacteria 674
345 Ga0105249_10009613 3300009553 Bacteria 8474
346 Ga0105249_10128897 3300009553 Bacteria 2413
347 Ga0105249_10767916 3300009553 Bacteria 1027
348 Ga0105249_10797317 3300009553 Bacteria 1008
349 Ga0105249_11514723 3300009553 Bacteria 743
350 Ga0105249_12548904 3300009553 Bacteria 584
351 Ga0105249_13231722 3300009553 Bacteria 524
352 Ga0105249_13258103 3300009553 Bacteria 522
353 Ga0105239_10004146 3300010375 Bacteria 17401
354 Ga0105239_10050251 3300010375 Bacteria 4574
355 Ga0105246_10219053 3300011119 Bacteria 1491
356 Ga0105246_10969817 3300011119 Bacteria 767
357 Ga0105246_12048846 3300011119 Bacteria 553
358 Ga0157373_10448390 3300013100 Bacteria 928
359 Ga0157371_10579855 3300013102 Bacteria 833
360 Ga0157370_11057125 3300013104 Bacteria 734
361 Ga0157369_10483949 3300013105 Bacteria 1281
362 Ga0157374_10084889 3300013296 Bacteria 3010
363 Ga0157374_10208548 3300013296 Bacteria 1915
364 Ga0157378_10137192 3300013297 Bacteria 2268
365 Ga0157378_10461686 3300013297 Bacteria 1262
366 Ga0157378_10566919 3300013297 Bacteria 1143
367 Ga0157378_10627283 3300013297 Bacteria 1089
368 Ga0157378_10661483 3300013297 Bacteria 1061
369 Ga0157378_12555060 3300013297 Bacteria 563
370 Ga0163162_10011522 3300013306 Bacteria 8623
371 Ga0163162_10161373 3300013306 Bacteria 2363
372 Ga0163162_10721023 3300013306 Bacteria 1118
373 Ga0163162_10934355 3300013306 Bacteria 979
374 Ga0163162_12373692 3300013306 Bacteria 610
375 Ga0157372_10604790 3300013307 Bacteria 1278
376 Ga0157375_10076831 3300013308 Bacteria 3367
377 Ga0157375_10085627 3300013308 Bacteria 3201
378 Ga0157375_10293371 3300013308 Bacteria 1789
379 Ga0157375_10457810 3300013308 Bacteria 1441
380 Ga0157375_11068663 3300013308 Bacteria 944
381 Ga0163163_10011394 3300014325 Bacteria 8062
382 Ga0163163_10775432 3300014325 Bacteria 1022
383 Ga0163163_10881802 3300014325 Bacteria 958
384 Ga0163163_11524831 3300014325 Bacteria 730
385 Ga0157380_10006323 3300014326 Bacteria 8324
386 Ga0157380_10797607 3300014326 Bacteria 961
387 Ga0157380_10882670 3300014326 Bacteria 919
388 Ga0157380_12683823 3300014326 Bacteria 565
389 Ga0157380_13119147 3300014326 Bacteria 529
390 Ga0157377_10000006 3300014745 Bacteria 419853
391 Ga0157377_10359191 3300014745 Bacteria 980
392 Ga0157377_11662769 3300014745 Bacteria 514
393 Ga0157379_10015125 3300014968 Bacteria 6768
394 Ga0157379_10016325 3300014968 Bacteria 6531
395 Ga0157379_10021583 3300014968 Bacteria 5701
396 Ga0157379_11054654 3300014968 Bacteria 777
397 Ga0157379_11594545 3300014968 Bacteria 637
398 Ga0157379_12419342 3300014968 Bacteria 524
399 Ga0157376_10079207 3300014969 Bacteria 2816
400 Ga0157376_10288786 3300014969 Bacteria 1548
401 Ga0157376_10450520 3300014969 Bacteria 1255
402 Ga0157376_11887229 3300014969 Bacteria 634
403 Ga0157376_12068523 3300014969 Bacteria 607
404 Ga0157376_12388383 3300014969 Bacteria 568
405 Ga0183362_10004 3300015683 Bacteria 569303
406 Ga0163161_10009633 3300017792 Bacteria 6682
407 Ga0163161_10045002 3300017792 Bacteria 3181
408 Ga0163161_10231198 3300017792 Bacteria 1435
409 Ga0163161_10389612 3300017792 Bacteria 1115
410 Ga0163161_10816384 3300017792 Bacteria 785
411 Ga0163161_11142281 3300017792 Bacteria 671
412 Ga0163161_11332321 3300017792 Bacteria 625
413 Ga0206353_11452919 3300020082 Bacteria 531
414 Ga0213872_10000155 3300021361 Bacteria 62940
415 Ga0213872_10157498 3300021361 Bacteria 989
416 Ga0209673_1005560 3300025273 Bacteria 6304
417 Ga0209758_1000769 3300025297 Bacteria 46067
418 Ga0207697_10020852 3300025315 Bacteria 2683
419 Ga0207697_10025463 3300025315 Bacteria 2418
420 Ga0207697_10069111 3300025315 Bacteria 1478
421 Ga0207656_10036342 3300025321 Bacteria 2067
422 Ga0207656_10072974 3300025321 Bacteria 1529
423 Ga0207682_10009442 3300025893 Bacteria 3850
424 Ga0207682_10010609 3300025893 Bacteria 3607
425 Ga0207682_10021298 3300025893 Bacteria 2550
426 Ga0207682_10052694 3300025893 Bacteria 1686
427 Ga0207682_10060390 3300025893 Bacteria 1585
428 Ga0207682_10335808 3300025893 Bacteria 711
429 Ga0207642_10231839 3300025899 Bacteria 1038
430 Ga0207642_10456802 3300025899 Bacteria 775
431 Ga0207688_10038491 3300025901 Bacteria 2654
432 Ga0207688_10325346 3300025901 Bacteria 944
433 Ga0207680_10040979 3300025903 Bacteria 2699
434 Ga0207680_10052240 3300025903 Bacteria 2448
435 Ga0207680_10189659 3300025903 Bacteria 1395
436 Ga0207680_10271428 3300025903 Bacteria 1176
437 Ga0207680_10589399 3300025903 Bacteria 795
438 Ga0207647_10391251 3300025904 Bacteria 784
439 Ga0207645_10009868 3300025907 Bacteria 6581
440 Ga0207645_10030778 3300025907 Bacteria 3458
441 Ga0207645_10038838 3300025907 Bacteria 3051
442 Ga0207643_10023918 3300025908 Bacteria 3370
443 Ga0207643_10085762 3300025908 Bacteria 1829
444 Ga0207643_10343902 3300025908 Bacteria 935
445 Ga0207643_10447133 3300025908 Bacteria 822
446 Ga0207705_10257093 3300025909 Bacteria 1333
447 Ga0207705_11402711 3300025909 Bacteria 531
448 Ga0207684_10008798 3300025910 Bacteria 8962
449 Ga0207707_10101940 3300025912 Bacteria 2509
450 Ga0207695_10138322 3300025913 Bacteria 2387
451 Ga0207695_10199733 3300025913 Bacteria 1914
452 Ga0207671_10002519 3300025914 Bacteria 19541
453 Ga0207671_10685381 3300025914 Bacteria 815
454 Ga0207693_10463920 3300025915 Bacteria 989
455 Ga0207663_10613812 3300025916 Bacteria 856
456 Ga0207660_10025648 3300025917 Bacteria 4004
457 Ga0207662_10020118 3300025918 Bacteria 3807
458 Ga0207657_10055458 3300025919 Bacteria 3423
459 Ga0207649_10405692 3300025920 Bacteria 1021
460 Ga0207652_10008831 3300025921 Bacteria 8117
461 Ga0207646_10067500 3300025922 Bacteria 3193
462 Ga0207646_11465963 3300025922 Bacteria 592
463 Ga0207646_11797157 3300025922 Bacteria 524
464 Ga0207681_10001432 3300025923 Bacteria 15375
465 Ga0207681_10004120 3300025923 Bacteria 9011
466 Ga0207681_10510064 3300025923 Bacteria 986
467 Ga0207681_10822179 3300025923 Bacteria 776
468 Ga0207681_11408044 3300025923 Bacteria 585
469 Ga0207694_10615943 3300025924 Bacteria 913
470 Ga0207694_10694490 3300025924 Bacteria 858
471 Ga0207650_10000275 3300025925 Bacteria 53824
472 Ga0207650_10003921 3300025925 Bacteria 10179
473 Ga0207650_10133334 3300025925 Bacteria 1946
474 Ga0207650_10138977 3300025925 Bacteria 1908
475 Ga0207650_10328804 3300025925 Bacteria 1253
476 Ga0207650_10485089 3300025925 Bacteria 1032
477 Ga0207650_11205008 3300025925 Bacteria 645
478 Ga0207659_10000418 3300025926 Bacteria 25657
479 Ga0207659_10050329 3300025926 Bacteria 2959
480 Ga0207659_10162669 3300025926 Bacteria 1754
481 Ga0207659_10165106 3300025926 Bacteria 1742
482 Ga0207659_10223288 3300025926 Bacteria 1516
483 Ga0207659_10297181 3300025926 Bacteria 1325
484 Ga0207659_10395497 3300025926 Bacteria 1155
485 Ga0207659_10702554 3300025926 Bacteria 866
486 Ga0207687_10074870 3300025927 Bacteria 2428
487 Ga0207700_10012392 3300025928 Bacteria 5497
488 Ga0207644_10000391 3300025931 Bacteria 28488
489 Ga0207644_10014706 3300025931 Bacteria 5244
490 Ga0207644_10016461 3300025931 Bacteria 4975
491 Ga0207644_10045088 3300025931 Bacteria 3135
492 Ga0207644_10077054 3300025931 Bacteria 2454
493 Ga0207644_10095589 3300025931 Bacteria 2222
494 Ga0207644_10203851 3300025931 Bacteria 1561
495 Ga0207644_10455672 3300025931 Bacteria 1051
496 Ga0207690_10191676 3300025932 Bacteria 1546
497 Ga0207690_10925860 3300025932 Bacteria 723
498 Ga0207690_11172189 3300025932 Bacteria 641
499 Ga0207706_10020545 3300025933 Bacteria 5935
500 Ga0207706_10076989 3300025933 Bacteria 2934
501 Ga0207706_10092441 3300025933 Bacteria 2660
502 Ga0207706_10151073 3300025933 Bacteria 2042
503 Ga0207706_10312047 3300025933 Bacteria 1369
504 Ga0207706_10619713 3300025933 Bacteria 928
505 Ga0207706_10743301 3300025933 Bacteria 836
506 Ga0207706_11040293 3300025933 Bacteria 686
507 Ga0207686_10051491 3300025934 Bacteria 2565
508 Ga0207709_10001139 3300025935 Bacteria 19377
509 Ga0207709_10038669 3300025935 Bacteria 2844
510 Ga0207709_10156862 3300025935 Bacteria 1583
511 Ga0207709_10167640 3300025935 Bacteria 1538
512 Ga0207709_10187336 3300025935 Bacteria 1467
513 Ga0207709_10190764 3300025935 Bacteria 1455
514 Ga0207670_10607228 3300025936 Bacteria 899
515 Ga0207670_10864801 3300025936 Bacteria 756
516 Ga0207670_10930038 3300025936 Bacteria 729
517 Ga0207669_10001031 3300025937 Bacteria 11905
518 Ga0207669_10037849 3300025937 Bacteria 2772
519 Ga0207669_10342495 3300025937 Bacteria 1152
520 Ga0207669_10347604 3300025937 Bacteria 1144
521 Ga0207669_11080222 3300025937 Bacteria 677
522 Ga0207669_11292715 3300025937 Bacteria 619
523 Ga0207704_10002411 3300025938 Bacteria 8409
524 Ga0207704_10046121 3300025938 Bacteria 2595
525 Ga0207704_10053687 3300025938 Bacteria 2452
526 Ga0207704_10845688 3300025938 Bacteria 767
527 Ga0207665_10040480 3300025939 Bacteria 3109
528 Ga0207691_10001335 3300025940 Bacteria 24610
529 Ga0207691_10041584 3300025940 Bacteria 4242
530 Ga0207691_10055504 3300025940 Bacteria 3610
531 Ga0207691_10092874 3300025940 Bacteria 2702
532 Ga0207691_10103023 3300025940 Bacteria 2545
533 Ga0207691_10126606 3300025940 Bacteria 2260
534 Ga0207691_10166503 3300025940 Bacteria 1931
535 Ga0207691_10185111 3300025940 Bacteria 1818
536 Ga0207691_10196453 3300025940 Bacteria 1757
537 Ga0207691_10424365 3300025940 Bacteria 1133
538 Ga0207691_10923689 3300025940 Bacteria 730
539 Ga0207711_10033637 3300025941 Bacteria 4339
540 Ga0207711_10040559 3300025941 Bacteria 3961
541 Ga0207711_10081075 3300025941 Bacteria 2835
542 Ga0207711_10431707 3300025941 Bacteria 1226
543 Ga0207711_10554146 3300025941 Bacteria 1072
544 Ga0207689_10013440 3300025942 Bacteria 6990
545 Ga0207689_10024935 3300025942 Bacteria 5013
546 Ga0207689_10051233 3300025942 Bacteria 3403
547 Ga0207689_10183308 3300025942 Bacteria 1726
548 Ga0207679_10467880 3300025945 Bacteria 1120
549 Ga0207679_10486146 3300025945 Bacteria 1100
550 Ga0207679_11545652 3300025945 Bacteria 608
551 Ga0207679_11795853 3300025945 Bacteria 560
552 Ga0207679_11919821 3300025945 Bacteria 540
553 Ga0207651_10007014 3300025960 Bacteria 5969
554 Ga0207651_10015270 3300025960 Bacteria 4458
555 Ga0207651_10016846 3300025960 Bacteria 4297
556 Ga0207651_10028855 3300025960 Bacteria 3507
557 Ga0207651_10062806 3300025960 Bacteria 2590
558 Ga0207651_10125560 3300025960 Bacteria 1954
559 Ga0207651_10699355 3300025960 Bacteria 893
560 Ga0207651_10734155 3300025960 Bacteria 872
561 Ga0207651_10799990 3300025960 Bacteria 836
562 Ga0207651_10991920 3300025960 Bacteria 750
563 Ga0207712_10601774 3300025961 Bacteria 951
564 Ga0207712_10727672 3300025961 Bacteria 868
565 Ga0207712_11214133 3300025961 Bacteria 673
566 Ga0207668_10021137 3300025972 Bacteria 4148
567 Ga0207668_10341957 3300025972 Bacteria 1248
568 Ga0207668_10962970 3300025972 Bacteria 761
569 Ga0207640_10105092 3300025981 Bacteria 1989
570 Ga0207640_10148648 3300025981 Bacteria 1718
571 Ga0207658_10007334 3300025986 Bacteria 7517
572 Ga0207658_10041765 3300025986 Bacteria 3323
573 Ga0207658_10091681 3300025986 Bacteria 2358
574 Ga0207658_10126880 3300025986 Bacteria 2044
575 Ga0207658_10127968 3300025986 Bacteria 2035
576 Ga0207658_10715849 3300025986 Bacteria 905
577 Ga0207658_10730551 3300025986 Bacteria 896
578 Ga0207658_11120673 3300025986 Bacteria 719
579 Ga0207677_10015892 3300026023 Bacteria 4443
580 Ga0207677_10021624 3300026023 Bacteria 3935
581 Ga0207677_10072057 3300026023 Bacteria 2441
582 Ga0207677_10144850 3300026023 Bacteria 1824
583 Ga0207677_10157790 3300026023 Bacteria 1759
584 Ga0207677_10189242 3300026023 Bacteria 1626
585 Ga0207677_10515405 3300026023 Bacteria 1036
586 Ga0207677_11042481 3300026023 Bacteria 743
587 Ga0207677_11840639 3300026023 Bacteria 562
588 Ga0207703_10087205 3300026035 Bacteria 2616
589 Ga0207703_10105129 3300026035 Bacteria 2399
590 Ga0207703_11008853 3300026035 Bacteria 799
591 Ga0207703_11822644 3300026035 Bacteria 585
592 Ga0207639_10041469 3300026041 Bacteria 3444
593 Ga0207639_10613085 3300026041 Bacteria 1004
594 Ga0207639_10878009 3300026041 Bacteria 838
595 Ga0207639_11654294 3300026041 Bacteria 600
596 Ga0207678_10005281 3300026067 Bacteria 11568
597 Ga0207678_10058082 3300026067 Bacteria 3329
598 Ga0207678_10183557 3300026067 Bacteria 1787
599 Ga0207678_10205257 3300026067 Bacteria 1686
600 Ga0207678_10207929 3300026067 Bacteria 1674
601 Ga0207678_10482559 3300026067 Bacteria 1079
602 Ga0207678_10499662 3300026067 Bacteria 1060
603 Ga0207678_10958979 3300026067 Bacteria 757
604 Ga0207708_10121206 3300026075 Bacteria 2038
605 Ga0207708_10779827 3300026075 Bacteria 822
606 Ga0207641_10003042 3300026088 Bacteria 15111
607 Ga0207641_10010456 3300026088 Bacteria 7626
608 Ga0207641_10016486 3300026088 Bacteria 6051
609 Ga0207641_10094164 3300026088 Bacteria 2626
610 Ga0207641_10157115 3300026088 Bacteria 2064
611 Ga0207641_10221469 3300026088 Bacteria 1755
612 Ga0207641_10223313 3300026088 Bacteria 1748
613 Ga0207641_10658583 3300026088 Bacteria 1029
614 Ga0207648_10000254 3300026089 Bacteria 57696
615 Ga0207648_10011874 3300026089 Bacteria 8185
616 Ga0207648_10012495 3300026089 Bacteria 7950
617 Ga0207648_10024822 3300026089 Bacteria 5347
618 Ga0207648_10026116 3300026089 Bacteria 5193
619 Ga0207648_10027411 3300026089 Bacteria 5056
620 Ga0207648_10047044 3300026089 Bacteria 3782
621 Ga0207648_10079214 3300026089 Bacteria 2866
622 Ga0207648_10178201 3300026089 Bacteria 1880
623 Ga0207648_10279993 3300026089 Bacteria 1491
624 Ga0207648_10338752 3300026089 Bacteria 1354
625 Ga0207648_10408765 3300026089 Bacteria 1231
626 Ga0207648_10521432 3300026089 Bacteria 1089
627 Ga0207648_10616807 3300026089 Bacteria 1001
628 Ga0207648_10648523 3300026089 Bacteria 976
629 Ga0207648_10938210 3300026089 Bacteria 809
630 Ga0207648_11363671 3300026089 Bacteria 666
631 Ga0207676_10028858 3300026095 Bacteria 4149
632 Ga0207676_10038596 3300026095 Bacteria 3647
633 Ga0207676_10084895 3300026095 Bacteria 2582
634 Ga0207676_10242910 3300026095 Bacteria 1616
635 Ga0207676_10269247 3300026095 Bacteria 1542
636 Ga0207676_10722831 3300026095 Bacteria 966
637 Ga0207674_10066692 3300026116 Bacteria 3624
638 Ga0207674_10457960 3300026116 Bacteria 1233
639 Ga0207674_10802411 3300026116 Bacteria 908
640 Ga0207674_11158821 3300026116 Bacteria 742
641 Ga0207674_11483297 3300026116 Bacteria 647
642 Ga0207675_100012087 3300026118 Bacteria 8066
643 Ga0207675_100055408 3300026118 Bacteria 3699
644 Ga0207675_100270136 3300026118 Bacteria 1650
645 Ga0207675_100685789 3300026118 Bacteria 1032
646 Ga0207675_101177667 3300026118 Bacteria 787
647 Ga0207683_10002658 3300026121 Bacteria 15609
648 Ga0207683_10024382 3300026121 Bacteria 5210
649 Ga0207683_10106353 3300026121 Bacteria 2509
650 Ga0207683_10197116 3300026121 Bacteria 1830
651 Ga0207683_10494706 3300026121 Bacteria 1129
652 Ga0207683_10519610 3300026121 Bacteria 1100
653 Ga0207683_10694932 3300026121 Bacteria 943
654 Ga0207683_10980081 3300026121 Bacteria 785
655 Ga0207683_11065038 3300026121 Bacteria 750
656 Ga0207698_10004407 3300026142 Bacteria 8577
657 Ga0207698_10011597 3300026142 Bacteria 5722
658 Ga0207698_10372073 3300026142 Bacteria 1357
659 Ga0207698_10385757 3300026142 Bacteria 1334
660 Ga0207698_10632760 3300026142 Bacteria 1058
661 Ga0207698_10951748 3300026142 Bacteria 868
662 Ga0207698_11199941 3300026142 Bacteria 773
663 Ga0207698_12325852 3300026142 Bacteria 548
664 Ga0209813_10025988 3300027866 Bacteria 1689
665 Ga0209974_10108363 3300027876 Bacteria 976
666 Ga0207428_10208745 3300027907 Bacteria 1468
667 Ga0268266_10021143 3300028379 Bacteria 5544
668 Ga0268266_10310709 3300028379 Bacteria 1473
669 Ga0268266_10336655 3300028379 Bacteria 1416
670 Ga0268266_10750313 3300028379 Bacteria 942
671 Ga0268266_10772781 3300028379 Bacteria 927
672 Ga0268266_12152924 3300028379 Bacteria 530
673 Ga0268266_12366112 3300028379 Bacteria 502
674 Ga0268265_10009051 3300028380 Bacteria 6733
675 Ga0268265_10069137 3300028380 Bacteria 2741
676 Ga0268265_10254183 3300028380 Bacteria 1558
677 Ga0268264_10081809 3300028381 Bacteria 2761
678 Ga0268264_10117511 3300028381 Bacteria 2339
679 Ga0268264_10166217 3300028381 Bacteria 1992
680 Ga0268264_10240598 3300028381 Bacteria 1676
681 Ga0268264_11175629 3300028381 Bacteria 776
682 Ga0307517_10004486 3300028786 Bacteria 21426
683 Ga0307517_10143293 3300028786 Bacteria 1668
684 Ga0307517_10345304 3300028786 Bacteria 811
685 Ga0307517_10380696 3300028786 Bacteria 754
686 Ga0307515_10011753 3300028794 Bacteria 16566
687 Ga0307515_10093089 3300028794 Bacteria 3742
688 Ga0307515_10419442 3300028794 Bacteria 959
689 Ga0307512_10049162 3300030522 Bacteria 3404
690 Ga0307512_10364039 3300030522 Bacteria 629
691 Ga0307512_10432363 3300030522 Bacteria 539
692 Ga0307513_10218243 3300031456 Bacteria 1731
693 Ga0307513_10269145 3300031456 Bacteria 1488
694 Ga0307513_10321275 3300031456 Bacteria 1306
695 Ga0307509_10000405 3300031507 Bacteria 72472
696 Ga0307509_10012044 3300031507 Bacteria 10379
697 Ga0307509_10015076 3300031507 Bacteria 9049
698 Ga0307509_10169723 3300031507 Bacteria 2063
699 Ga0307509_10193952 3300031507 Bacteria 1878
700 Ga0307509_10196996 3300031507 Bacteria 1857
701 Ga0307509_10234529 3300031507 Bacteria 1634
702 Ga0307509_10304116 3300031507 Bacteria 1341
703 Ga0307408_100001878 3300031548 Bacteria 15299
704 Ga0307408_100969204 3300031548 Bacteria 782
705 Ga0307408_101491191 3300031548 Bacteria 639
706 Ga0307508_10004752 3300031616 Bacteria 13130
707 Ga0307508_10123561 3300031616 Bacteria 2191
708 Ga0307508_10232954 3300031616 Bacteria 1439
709 Ga0307508_10283804 3300031616 Bacteria 1249
710 Ga0307508_10660378 3300031616 Bacteria 651
711 Ga0307514_10561509 3300031649 Bacteria 523
712 Ga0307516_10001028 3300031730 Bacteria 38713
713 Ga0307516_10001642 3300031730 Bacteria 30785
714 Ga0307516_10048713 3300031730 Bacteria 4169
715 Ga0307516_10286548 3300031730 Bacteria 1327
716 Ga0307516_10403535 3300031730 Bacteria 1026
717 Ga0307516_10450040 3300031730 Bacteria 944
718 Ga0307516_10489815 3300031730 Bacteria 884
719 Ga0307516_10544084 3300031730 Bacteria 815
720 Ga0307405_10223750 3300031731 Bacteria 1382
721 Ga0307405_10836870 3300031731 Bacteria 774
722 Ga0307413_10030664 3300031824 Bacteria 3023
723 Ga0307413_10080463 3300031824 Bacteria 2086
724 Ga0307413_10728086 3300031824 Bacteria 827
725 Ga0307410_10029244 3300031852 Bacteria 3507
726 Ga0307410_10199727 3300031852 Bacteria 1526
727 Ga0307410_10598432 3300031852 Bacteria 919
728 Ga0307410_10602599 3300031852 Bacteria 916
729 Ga0307406_10041914 3300031901 Bacteria 2855
730 Ga0307406_10101387 3300031901 Bacteria 1962
731 Ga0307406_10983346 3300031901 Bacteria 723
732 Ga0307407_10057120 3300031903 Bacteria 2263
733 Ga0307412_10095495 3300031911 Bacteria 2090
734 Ga0307412_10212572 3300031911 Bacteria 1477
735 Ga0307412_10353583 3300031911 Bacteria 1180
736 Ga0307412_10470367 3300031911 Bacteria 1040
737 Ga0307409_100067396 3300031995 Bacteria 2826
738 Ga0307409_100604516 3300031995 Bacteria 1084
739 Ga0307409_101037350 3300031995 Bacteria 839
740 Ga0307416_100039492 3300032002 Bacteria 3655
741 Ga0307416_100043918 3300032002 Bacteria 3505
742 Ga0307416_100134299 3300032002 Bacteria 2235
743 Ga0307416_100238961 3300032002 Bacteria 1758
744 Ga0307416_101459125 3300032002 Bacteria 790
745 Ga0307414_10159719 3300032004 Bacteria 1789
746 Ga0307414_10160768 3300032004 Bacteria 1784
747 Ga0307411_10001013 3300032005 Bacteria 10853
748 Ga0307411_10295538 3300032005 Bacteria 1296
749 Ga0307411_10461735 3300032005 Bacteria 1065
750 Ga0307411_10518349 3300032005 Bacteria 1011
751 Ga0307411_10561000 3300032005 Bacteria 976
752 Ga0307411_11453152 3300032005 Bacteria 629
753 Ga0307507_10125384 3300033179 Bacteria 2034
754 Ga0307507_10425208 3300033179 Bacteria 744
755 Ga0307510_10003419 3300033180 Bacteria 18519
756 Ga0307510_10016969 3300033180 Bacteria 8587
757 Ga0307510_10027695 3300033180 Bacteria 6486
758 Ga0307510_10063734 3300033180 Bacteria 3750
759 Ga0307510_10144662 3300033180 Bacteria 2012
760 Ga0307510_10346113 3300033180 Bacteria 937
761 Ga0373928_0033341 3300035084 Bacteria 1152
762 Ga0373949_0076740 3300035090 Bacteria 884
763 Ga0373946_0188725 3300035171 Bacteria 982
764 Ga0373962_0281805 3300035242 Bacteria 585
765 Ga0373931_0007514 3300035691 Bacteria 5133
766 Ga0373947_0691068 3300035725 Bacteria 696
767 Ga0373937_0181250 3300036401 Bacteria 1978
768 Ga0373925_0260936 3300037068 Bacteria 1392
769 Ga0373925_0306696 3300037068 Bacteria 1283
770 Ga0395905_0018518 3300037471 Bacteria 6610
771 Ga0395905_0115051 3300037471 Bacteria 2527
772 Ga0395905_0211446 3300037471 Bacteria 1817
773 Ga0395905_0795054 3300037471 Bacteria 849
774 Ga0436361_0098091 3300039447 Bacteria 3975
775 Ga0436361_0813098 3300039447 Bacteria 136133
776 Ga0436363_0192400 3300039450 Bacteria 693
777 Ga0439465_0335315 3300041413 Bacteria 570
778 Ga0451787_398756 3300041441 Bacteria 723
779 Ga0451789_0762797 3300041443 Bacteria 570
780 Ga0451789_1294840 3300041443 Bacteria 549
781 Ga0451793_0718359 3300041452 Bacteria 600
782 Ga0451797_1495146 3300041453 Bacteria 552
783 Ga0451795_0388746 3300041456 Bacteria 537
784 Ga0451800_0517538 3300041459 Bacteria 1166
785 Ga0451800_0691594 3300041459 Bacteria 631
786 Ga0451802_0547687 3300041460 Bacteria 3814
787 Ga0451807_0151166 3300041486 Bacteria 656
788 Ga0451807_2629084 3300041486 Bacteria 714
789 Ga0451833_0828330 3300041491 Bacteria 903
790 Ga0451833_1322048 3300041491 Bacteria 574
791 Ga0451835_0876415 3300041492 Bacteria 725
792 Ga0451849_0798363 3300041505 Bacteria 553
793 Ga0451851_0809976 3300041507 Bacteria 508
794 Ga0451853_0687148 3300041512 Bacteria 1011
795 Ga0451853_2072669 3300041512 Bacteria 617
796 Ga0451853_3655248 3300041512 Bacteria 886
797 Ga0439441_049695 3300042001 Bacteria 861
798 Ga0439448_0180170 3300042005 Bacteria 738
799 Ga0439455_0021077 3300042012 Bacteria 1551
800 Ga0439455_0157156 3300042012 Bacteria 649
801 Ga0439446_0092475 3300042156 Bacteria 948
802 Ga0439464_0002359 3300042439 Bacteria 4640
803 Ga0439460_0379642 3300042461 Bacteria 500
804 Ga0451577_0004943 3300042876 Bacteria 13870
805 Ga0451577_0063786 3300042876 Bacteria 3286
806 Ga0466969_0000860 3300044656 Bacteria 16459
807 Ga0466972_0206460 3300044658 Bacteria 920
808 Ga0453683_0744322 3300044673 Bacteria 644
809 Ga0466965_0029302 3300044683 Bacteria 2678
810 Ga0466965_0199774 3300044683 Bacteria 1060
811 Ga0466966_0311232 3300044684 Bacteria 946
812 Ga0466961_0010705 3300044693 Bacteria 5859
813 Ga0453684_0029228 3300044712 Bacteria 7838
814 Ga0453684_0144657 3300044712 Bacteria 2834
815 Ga0453684_0922518 3300044712 Bacteria 934
816 Ga0466970_0170156 3300044765 Bacteria 1207
817 Ga0466960_0176729 3300044901 Bacteria 1155
818 Ga0466959_0267976 3300045049 Bacteria 1174
819 Ga0451576_0479912 3300045051 Bacteria 1306
820 Ga0495617_055008 3300046452 Bacteria 1320
821 Ga0495592_0000528 3300046454 Bacteria 27565
822 Ga0495592_0246343 3300046454 Bacteria 1183
823 Ga0495590_0018281 3300046457 Bacteria 2510
824 Ga0495629_0211042 3300046459 Bacteria 1341
825 Ga0495638_0004523 3300046460 Bacteria 10535
826 Ga0495580_0107207 3300046472 Bacteria 1940
827 Ga0495605_0004232 3300046474 Bacteria 8451
828 Ga0495584_0001867 3300046491 Bacteria 12189
829 Ga0495584_0068955 3300046491 Bacteria 1776
830 Ga0495585_0074940 3300046492 Bacteria 1840
831 Ga0495594_0575797 3300046499 Bacteria 639
832 Ga0495607_0040080 3300046501 Bacteria 2791
833 Ga0495607_0066876 3300046501 Bacteria 2020
834 Ga0495607_0175587 3300046501 Bacteria 1078
835 Ga0495583_0001555 3300046506 Bacteria 22720
836 Ga0495583_0143968 3300046506 Bacteria 991
837 Ga0495606_0007799 3300046507 Bacteria 9473
838 Ga0495606_0117924 3300046507 Bacteria 1592
839 Ga0495606_0164460 3300046507 Bacteria 1292
840 Ga0495606_0341593 3300046507 Bacteria 797
841 Ga0495608_0724432 3300046511 Bacteria 591
842 Ga0495616_0004741 3300046513 Bacteria 8526
843 Ga0495616_0052594 3300046513 Bacteria 2027
844 Ga0495620_0232947 3300046515 Bacteria 704
845 Ga0495620_0281191 3300046515 Bacteria 633
846 Ga0495630_0122940 3300046517 Bacteria 1969
847 Ga0495632_0023035 3300046519 Bacteria 3330
848 Ga0495632_0116379 3300046519 Bacteria 1252
849 Ga0495632_0192975 3300046519 Bacteria 930
850 Ga0495632_0280547 3300046519 Bacteria 742
851 Ga0495632_0334097 3300046519 Bacteria 668
852 Ga0495644_0002361 3300046523 Bacteria 7521
853 Ga0495648_0003454 3300046524 Bacteria 13901
854 Ga0495648_0351288 3300046524 Bacteria 673
855 Ga0495666_0151471 3300046526 Bacteria 1078
856 Ga0495642_0322436 3300046528 Bacteria 678
857 Ga0495654_0008873 3300046530 Bacteria 5527
858 Ga0495598_0062228 3300046537 Bacteria 1154
859 Ga0495609_0001862 3300046538 Bacteria 13482
860 Ga0495609_0050493 3300046538 Bacteria 1854
861 Ga0495621_0122910 3300046539 Bacteria 1004
862 Ga0495621_0526240 3300046539 Bacteria 512
863 Ga0495597_0010750 3300046542 Bacteria 4460
864 Ga0495597_0022118 3300046542 Bacteria 2951
865 Ga0495597_0070235 3300046542 Bacteria 1510
866 Ga0495622_0073490 3300046557 Bacteria 1577
867 Ga0495622_0128267 3300046557 Bacteria 1156
868 Ga0495633_0017117 3300046558 Bacteria 3715
869 Ga0495633_0025217 3300046558 Bacteria 2928
870 Ga0495633_0205740 3300046558 Bacteria 903
871 Ga0495633_0366106 3300046558 Bacteria 653
872 Ga0495656_0199628 3300046615 Bacteria 992
873 Ga0495656_0721720 3300046615 Bacteria 537
874 Ga0495668_0035434 3300046616 Bacteria 2798
875 Ga0495668_0234797 3300046616 Bacteria 1004
876 Ga0495668_0560540 3300046616 Bacteria 631
877 Ga0495611_0002648 3300046648 Bacteria 8097
878 Ga0495625_0007078 3300046660 Bacteria 9859
879 Ga0495625_0007549 3300046660 Bacteria 9441
880 Ga0495625_0023081 3300046660 Bacteria 4757
881 Ga0495625_0339089 3300046660 Bacteria 953
882 Ga0495625_0734200 3300046660 Bacteria 580
883 Ga0495625_0870058 3300046660 Bacteria 519
884 Ga0495659_0000345 3300046664 Bacteria 18182
885 Ga0495659_0000524 3300046664 Bacteria 14141
886 Ga0495661_0274167 3300046665 Bacteria 852
887 Ga0495646_0339154 3300046680 Bacteria 789
888 Ga0495658_0043155 3300046683 Bacteria 2521
889 Ga0495658_0245873 3300046683 Bacteria 1124
890 Ga0495658_0339260 3300046683 Bacteria 954
891 Ga0495658_0429785 3300046683 Bacteria 843
892 Ga0495613_0280342 3300046689 Bacteria 1158
893 Ga0495670_0002602 3300046691 Bacteria 8915
894 Ga0495670_0089367 3300046691 Bacteria 1575
895 Ga0495670_0221475 3300046691 Bacteria 1005
896 Ga0495671_0001130 3300046692 Bacteria 18376
897 Ga0495671_0027894 3300046692 Bacteria 2911
898 Ga0495671_0099900 3300046692 Bacteria 1419
899 Ga0495649_0003993 3300046694 Bacteria 9723
900 Ga0495649_0334166 3300046694 Bacteria 767
901 Ga0495649_0493811 3300046694 Bacteria 609
902 Ga0495589_0091284 3300046794 Bacteria 1479
903 Ga0495589_0199789 3300046794 Bacteria 944
904 Ga0495660_0002065 3300046810 Bacteria 13039
905 Ga0495660_0037919 3300046810 Bacteria 2683
906 Ga0495636_0000487 3300047318 Bacteria 14598
907 Ga0495636_0143061 3300047318 Bacteria 1069
908 Ga0495672_0000859 3300047320 Bacteria 32082
909 Ga0495672_0008878 3300047320 Bacteria 7350
910 Ga0495672_0020386 3300047320 Bacteria 4347
911 Ga0495676_0019792 3300047321 Bacteria 5917
912 Ga0495683_0003705 3300047323 Bacteria 8849
913 Ga0495687_001797 3300047443 Bacteria 18906
914 Ga0495687_005076 3300047443 Bacteria 8543
915 Ga0495687_007155 3300047443 Bacteria 6646
916 Ga0495677_0002310 3300047445 Bacteria 7517
917 Ga0495685_000157 3300047447 Bacteria 23115
918 Ga0495673_0009315 3300047469 Bacteria 5441
919 Ga0495673_0234209 3300047469 Bacteria 675
920 Ga0495686_0022949 3300047472 Bacteria 4122
921 Ga0495686_0138968 3300047472 Bacteria 1434
922 Ga0495686_0280092 3300047472 Bacteria 927
923 Ga0495686_0600943 3300047472 Bacteria 570
924 Ga0495593_0088879 3300047673 Bacteria 1592
925 Ga0495626_0028432 3300048091 Bacteria 2711
926 Ga0495626_0124891 3300048091 Bacteria 1103
927 Ga0496100_0089918 3300048903 Bacteria 2093
928 Ga0496100_1027182 3300048903 Bacteria 649
929 Ga0496101_0255575 3300048904 Bacteria 1366
930 Ga0496102_0018789 3300048905 Bacteria 6080
931 Ga0496104_0043886 3300048907 Bacteria 4200
932 Ga0496104_0077218 3300048907 Bacteria 3173
933 Ga0496105_0061054 3300048908 Bacteria 3110
934 Ga0496105_0147542 3300048908 Bacteria 1934
935 Ga0496106_0007832 3300048909 Bacteria 7908
936 Ga0496106_0385977 3300048909 Bacteria 1125
937 Ga0496107_0482624 3300048910 Bacteria 920
938 Ga0496108_0144096 3300048911 Bacteria 2053
939 Ga0496108_0252797 3300048911 Bacteria 1533
940 Ga0496108_0789342 3300048911 Bacteria 820
941 Ga0496109_0874340 3300048912 Bacteria 837
942 Ga0496110_0280909 3300048913 Bacteria 1516
943 Ga0496112_0074682 3300048915 Bacteria 3352
944 Ga0496113_0383216 3300048916 Bacteria 1128
945 Ga0496114_0062845 3300048917 Bacteria 3108
946 Ga0496114_0436284 3300048917 Bacteria 1160
947 Ga0496125_0687232 3300048928 Bacteria 545
948 Ga0495678_002154 3300049459 Bacteria 13912
949 Ga0495682_0001880 3300049460 Bacteria 10462
950 Ga0495682_0002150 3300049460 Bacteria 9565
951 Ga0501292_068260 3300049515 Bacteria 657
952 Ga0501034_0461977 3300049571 Bacteria 1186
953 Ga0501037_0225616 3300049573 Bacteria 1317
954 Ga0501039_0785637 3300049575 Bacteria 743
955 Ga0501043_0000277 3300049579 Bacteria 46284
956 Ga0501046_0000345 3300049580 Bacteria 46730
957 Ga0501047_0000395 3300049581 Bacteria 48969
958 Ga0501048_0000111 3300049582 Bacteria 46009
959 Ga0501198_000023 3300049649 Bacteria 69100
960 Ga0501201_038908 3300049651 Bacteria 566
961 Ga0501206_009613 3300049653 Bacteria 1288
962 Ga0501222_000031 3300049662 Bacteria 56867
963 Ga0501222_014492 3300049662 Bacteria 1040
964 Ga0501262_011227 3300049759 Bacteria 1131
965 Ga0501263_064676 3300049760 Bacteria 580
966 Ga0501265_000558 3300049762 Bacteria 3981
967 Ga0501283_021568 3300049779 Bacteria 1034
968 Ga0501044_0423434 3300049823 Bacteria 1241
969 nmdc:mga03683_127196_c1 3300050489 Bacteria 1137
970 nmdc:mga03683_13510_c1 3300050489 Bacteria 3007
971 nmdc:mga03683_13639_c1 3300050489 Bacteria 2995
972 nmdc:mga03683_452130_c1 3300050489 Bacteria 618
973 nmdc:mga03683_48065_c1 3300050489 Bacteria 1772
974 nmdc:mga03n38_184761_c1 3300050490 Bacteria 1070
975 nmdc:mga03n38_75773_c1 3300050490 Bacteria 1568
976 nmdc:mga00v17_263901_c1 3300050491 Bacteria 1117
977 nmdc:mga00v17_65035_c1 3300050491 Bacteria 2249
978 nmdc:mga0yw44_56212_c1 3300050492 Bacteria 2396
979 nmdc:mga0k408_129748_c1 3300050493 Bacteria 556
980 nmdc:mga0k408_203701_c1 3300050493 Bacteria 1181
981 nmdc:mga0k408_214788_c1 3300050493 Bacteria 1149
982 nmdc:mga0k408_284702_c1 3300050493 Bacteria 987
983 nmdc:mga0k408_28979_c1 3300050493 Bacteria 3150
984 nmdc:mga0k408_31847_c1 3300050493 Bacteria 3013
985 nmdc:mga0k408_339950_c1 3300050493 Bacteria 895
986 nmdc:mga0k408_37631_c1 3300050493 Bacteria 2778
987 nmdc:mga0k408_38083_c1 3300050493 Bacteria 2761
988 nmdc:mga0k408_382402_c1 3300050493 Bacteria 838
989 nmdc:mga0k408_4980_c1 3300050493 Bacteria 7039
990 nmdc:mga0k408_5321_c1 3300050493 Bacteria 6838
991 nmdc:mga0k408_5383_c1 3300050493 Bacteria 6807
992 nmdc:mga0k408_75494_c1 3300050493 Bacteria 1970
993 nmdc:mga0k408_9031_c1 3300050493 Bacteria 5365
994 nmdc:mga06z11_10035_c1 3300050494 Bacteria 4016
995 nmdc:mga06z11_13948_c1 3300050494 Bacteria 3544
996 nmdc:mga06z11_16145_c1 3300050494 Bacteria 3355
997 nmdc:mga06z11_44839_c1 3300050494 Bacteria 2232
998 nmdc:mga06z11_452992_c1 3300050494 Bacteria 775
999 nmdc:mga04h51_277511_c1 3300050495 Bacteria 678
1000 nmdc:mga07m45_13934_c1 3300050496 Bacteria 4274
1001 nmdc:mga07m45_1876_c1 3300050496 Bacteria 9712
1002 nmdc:mga07m45_2290_c1 3300050496 Bacteria 8955
1003 nmdc:mga07m45_23091_c1 3300050496 Bacteria 3399
1004 nmdc:mga07m45_30797_c1 3300050496 Bacteria 2973
1005 nmdc:mga07m45_34263_c1 3300050496 Bacteria 2822
1006 nmdc:mga07m45_444839_c1 3300050496 Bacteria 752
1007 nmdc:mga07m45_4610_c1 3300050496 Bacteria 6757
1008 nmdc:mga07m45_580003_c1 3300050496 Bacteria 648
1009 nmdc:mga07m45_8408_c1 3300050496 Bacteria 5304
1010 nmdc:mga07m45_921045_c1 3300050496 Bacteria 500
1011 nmdc:mga05p37_66948_c1 3300050507 Bacteria 4418
1012 nmdc:mga09592_9369_c1 3300050508 Bacteria 7965
1013 nmdc:mga0qj67_41652_c1 3300050509 Bacteria 3613
1014 nmdc:mga0sz30_165268_c1 3300050516 Bacteria 981
1015 nmdc:mga0sz30_52667_c1 3300050516 Bacteria 1728
1016 nmdc:mga0sz30_543115_c1 3300050516 Bacteria 524
1017 nmdc:mga0sz30_9319_c1 3300050516 Bacteria 3732
1018 Ga0495612_0198813 3300053078 Bacteria 884
1019 Ga0500578_0037855 3300053086 Bacteria 3098
1020 Ga0500578_0759735 3300053086 Bacteria 516
1021 Ga0500646_0038237 3300053090 Bacteria 1343
1022 Ga0500583_0503473 3300053092 Bacteria 568
1023 Ga0500651_0045454 3300053093 Bacteria 2762
1024 Ga0500651_0096277 3300053093 Bacteria 1819
1025 Ga0500651_0170159 3300053093 Bacteria 1299
1026 Ga0500650_0139340 3300053098 Bacteria 1125
1027 Ga0500607_046582 3300053121 Bacteria 2324
1028 Ga0500652_006725 3300053131 Bacteria 3721
1029 Ga0500655_017681 3300053133 Bacteria 1320
1030 Ga0500658_0006265 3300053134 Bacteria 4423
1031 Ga0500559_0000265 3300053136 Bacteria 40939
1032 Ga0500559_0564832 3300053136 Bacteria 518
1033 Ga0500561_0181695 3300053137 Bacteria 662
1034 Ga0500564_133917 3300053138 Bacteria 1070
1035 Ga0500568_0011911 3300053139 Bacteria 4014
1036 Ga0500568_0045866 3300053139 Bacteria 1738
1037 Ga0500590_232170 3300053148 Bacteria 750
1038 Ga0500619_000116 3300053154 Bacteria 21263
1039 Ga0500620_258650 3300053155 Bacteria 577
1040 Ga0500622_0002039 3300053156 Bacteria 15066
1041 Ga0500627_0380069 3300053158 Bacteria 605
1042 Ga0500633_0306625 3300053160 Bacteria 583
1043 Ga0500636_0053627 3300053177 Bacteria 2366
1044 Ga0500649_123212 3300053722 Bacteria 984
1045 Ga0500645_003124 3300053730 Bacteria 6902
1046 Ga0500587_030467 3300053739 Bacteria 738
1047 Ga0590071_002620 3300059421 Bacteria 4521

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0922518 Ga0453684_0922518_115_423 100
2 3300045051 Ga0451576_0479912 Ga0451576_0479912_827_1135 100
3 3300005436 Ga0070713_100000031 Ga0070713_10000003162 102
4 3300006175 Ga0070712_100203974 Ga0070712_1002039742 102
5 3300025915 Ga0207693_10463920 Ga0207693_104639202 102
6 3300025928 Ga0207700_10012392 Ga0207700_100123925 102
7 3300025936 Ga0207670_10607228 Ga0207670_106072282 102
8 3300031548 Ga0307408_100001878 Ga0307408_1000018788 102
9 3300044658 Ga0466972_0206460 Ga0466972_0206460_327_647 102
10 3300044683 Ga0466965_0029302 Ga0466965_0029302_848_1168 102
11 3300044901 Ga0466960_0176729 Ga0466960_0176729_644_964 102
12 3300046452 Ga0495617_055008 Ga0495617_055008_939_1256 102
13 3300046457 Ga0495590_0018281 Ga0495590_0018281_327_644 102
14 3300046460 Ga0495638_0004523 Ga0495638_0004523_3560_3877 102
15 3300046474 Ga0495605_0004232 Ga0495605_0004232_1483_1800 102
16 3300046491 Ga0495584_0001867 Ga0495584_0001867_8854_9171 102
17 3300046491 Ga0495584_0068955 Ga0495584_0068955_1205_1522 102
18 3300046492 Ga0495585_0074940 Ga0495585_0074940_1169_1486 102
19 3300046501 Ga0495607_0040080 Ga0495607_0040080_367_684 102
20 3300046501 Ga0495607_0066876 Ga0495607_0066876_1654_1971 102
21 3300046501 Ga0495607_0175587 Ga0495607_0175587_548_868 102
22 3300046506 Ga0495583_0001555 Ga0495583_0001555_6556_6873 102
23 3300046507 Ga0495606_0007799 Ga0495606_0007799_6483_6803 102
24 3300046507 Ga0495606_0117924 Ga0495606_0117924_1175_1495 102
25 3300046507 Ga0495606_0341593 Ga0495606_0341593_380_700 102
26 3300046513 Ga0495616_0004741 Ga0495616_0004741_7455_7772 102
27 3300046513 Ga0495616_0052594 Ga0495616_0052594_1309_1626 102
28 3300046519 Ga0495632_0116379 Ga0495632_0116379_302_619 102
29 3300046523 Ga0495644_0002361 Ga0495644_0002361_4335_4652 102
30 3300046524 Ga0495648_0003454 Ga0495648_0003454_7031_7348 102
31 3300046530 Ga0495654_0008873 Ga0495654_0008873_4391_4711 102
32 3300046538 Ga0495609_0001862 Ga0495609_0001862_10650_10967 102
33 3300046538 Ga0495609_0050493 Ga0495609_0050493_622_942 102
34 3300046542 Ga0495597_0022118 Ga0495597_0022118_1835_2155 102
35 3300046557 Ga0495622_0128267 Ga0495622_0128267_575_892 102
36 3300046558 Ga0495633_0017117 Ga0495633_0017117_2659_2976 102
37 3300046558 Ga0495633_0025217 Ga0495633_0025217_2308_2625 102
38 3300046648 Ga0495611_0002648 Ga0495611_0002648_7081_7398 102
39 3300046660 Ga0495625_0007078 Ga0495625_0007078_1878_2198 102
40 3300046660 Ga0495625_0007549 Ga0495625_0007549_3583_3900 102
41 3300046660 Ga0495625_0734200 Ga0495625_0734200_184_504 102
42 3300046664 Ga0495659_0000345 Ga0495659_0000345_11017_11337 102
43 3300046664 Ga0495659_0000524 Ga0495659_0000524_2396_2713 102
44 3300046665 Ga0495661_0274167 Ga0495661_0274167_349_666 102
45 3300046691 Ga0495670_0002602 Ga0495670_0002602_5740_6057 102
46 3300046691 Ga0495670_0089367 Ga0495670_0089367_57_374 102
47 3300046692 Ga0495671_0001130 Ga0495671_0001130_6977_7297 102
48 3300046692 Ga0495671_0027894 Ga0495671_0027894_2013_2330 102
49 3300046694 Ga0495649_0493811 Ga0495649_0493811_93_413 102
50 3300046794 Ga0495589_0091284 Ga0495589_0091284_450_770 102
51 3300046794 Ga0495589_0199789 Ga0495589_0199789_594_911 102
52 3300046810 Ga0495660_0002065 Ga0495660_0002065_6563_6883 102
53 3300047318 Ga0495636_0000487 Ga0495636_0000487_3114_3431 102
54 3300047320 Ga0495672_0000859 Ga0495672_0000859_24916_25236 102
55 3300047320 Ga0495672_0008878 Ga0495672_0008878_5670_5987 102
56 3300047320 Ga0495672_0020386 Ga0495672_0020386_934_1251 102
57 3300047323 Ga0495683_0003705 Ga0495683_0003705_1989_2306 102
58 3300047443 Ga0495687_005076 Ga0495687_005076_1664_1981 102
59 3300047445 Ga0495677_0002310 Ga0495677_0002310_5999_6316 102
60 3300047447 Ga0495685_000157 Ga0495685_000157_16236_16553 102
61 3300047469 Ga0495673_0009315 Ga0495673_0009315_1242_1559 102
62 3300047469 Ga0495673_0234209 Ga0495673_0234209_298_615 102
63 3300047472 Ga0495686_0022949 Ga0495686_0022949_190_510 102
64 3300047472 Ga0495686_0280092 Ga0495686_0280092_383_700 102
65 3300049459 Ga0495678_002154 Ga0495678_002154_7033_7350 102
66 3300049460 Ga0495682_0001880 Ga0495682_0001880_3583_3900 102
67 3300049460 Ga0495682_0002150 Ga0495682_0002150_7822_8139 102
68 iso_pu_bacteria 2643221645 2644251728 102
69 iso_pu_bacteria 2643221664 2644356084 102
70 iso_pu_bacteria 2738541280 2738742644 102
71 iso_pu_bacteria 2738541300 2738842342 102
72 iso_pu_bacteria 2738543018 2739273096 102
73 iso_pu_bacteria 2738543030 2739342140 102
74 3300037471 Ga0395905_0795054 Ga0395905_0795054_274_627 104
75 iso_pu_bacteria 2643221654 2644303493 104
76 iso_pu_bacteria 2928115317 2928118931 105
77 3300005331 Ga0070670_100019018 Ga0070670_1000190186 107
78 3300005333 Ga0070677_10039794 Ga0070677_100397942 107
79 3300005334 Ga0068869_100177501 Ga0068869_1001775013 107
80 3300005335 Ga0070666_10756903 Ga0070666_107569032 107
81 3300005338 Ga0068868_100108975 Ga0068868_1001089753 107
82 3300005338 Ga0068868_100760915 Ga0068868_1007609152 107
83 3300005353 Ga0070669_101004781 Ga0070669_1010047811 107
84 3300005354 Ga0070675_100218486 Ga0070675_1002184862 107
85 3300005355 Ga0070671_100089324 Ga0070671_1000893243 107
86 3300005364 Ga0070673_100003372 Ga0070673_1000033725 107
87 3300005367 Ga0070667_100376399 Ga0070667_1003763993 107
88 3300005367 Ga0070667_100788205 Ga0070667_1007882052 107
89 3300005455 Ga0070663_100032448 Ga0070663_1000324483 107
90 3300005456 Ga0070678_100778852 Ga0070678_1007788522 107
91 3300005457 Ga0070662_100076193 Ga0070662_1000761933 107
92 3300005457 Ga0070662_100970130 Ga0070662_1009701302 107
93 3300005459 Ga0068867_100006908 Ga0068867_1000069084 107
94 3300005467 Ga0070706_100000367 Ga0070706_10000036719 107
95 3300005468 Ga0070707_100054004 Ga0070707_1000540044 107
96 3300005471 Ga0070698_100327392 Ga0070698_1003273922 107
97 3300005518 Ga0070699_100030764 Ga0070699_1000307643 107
98 3300005539 Ga0068853_101735799 Ga0068853_1017357992 107
99 3300005543 Ga0070672_100133758 Ga0070672_1001337582 107
100 3300005548 Ga0070665_100335794 Ga0070665_1003357942 107
101 3300005577 Ga0068857_100095028 Ga0068857_1000950283 107
102 3300005577 Ga0068857_100447095 Ga0068857_1004470952 107
103 3300005577 Ga0068857_101461259 Ga0068857_1014612591 107
104 3300005578 Ga0068854_100156755 Ga0068854_1001567552 107
105 3300005616 Ga0068852_100607949 Ga0068852_1006079492 107
106 3300005617 Ga0068859_100986015 Ga0068859_1009860152 107
107 3300005618 Ga0068864_100118711 Ga0068864_1001187111 107
108 3300005840 Ga0068870_10104166 Ga0068870_101041662 107
109 3300005840 Ga0068870_10353722 Ga0068870_103537222 107
110 3300005841 Ga0068863_100094986 Ga0068863_1000949863 107
111 3300006038 Ga0075365_10314835 Ga0075365_103148352 107
112 3300006042 Ga0075368_10003231 Ga0075368_100032312 107
113 3300006042 Ga0075368_10005709 Ga0075368_100057092 107
114 3300006048 Ga0075363_100000145 Ga0075363_10000014514 107
115 3300006048 Ga0075363_100012536 Ga0075363_1000125364 107
116 3300006048 Ga0075363_100454751 Ga0075363_1004547512 107
117 3300006048 Ga0075363_100539762 Ga0075363_1005397622 107
118 3300006051 Ga0075364_10013229 Ga0075364_100132294 107
119 3300006051 Ga0075364_10264221 Ga0075364_102642212 107
120 3300006177 Ga0075362_10000580 Ga0075362_100005807 107
121 3300006177 Ga0075362_10003899 Ga0075362_100038997 107
122 3300006177 Ga0075362_10292023 Ga0075362_102920232 107
123 3300006178 Ga0075367_10002249 Ga0075367_100022492 107
124 3300006178 Ga0075367_10004330 Ga0075367_100043307 107
125 3300006178 Ga0075367_10021570 Ga0075367_100215703 107
126 3300006178 Ga0075367_10026303 Ga0075367_100263032 107
127 3300006178 Ga0075367_10513061 Ga0075367_105130612 107
128 3300006186 Ga0075369_10003203 Ga0075369_100032034 107
129 3300006195 Ga0075366_10000582 Ga0075366_1000058218 107
130 3300006195 Ga0075366_10009057 Ga0075366_100090575 107
131 3300006195 Ga0075366_10010938 Ga0075366_100109383 107
132 3300006195 Ga0075366_10117119 Ga0075366_101171192 107
133 3300006195 Ga0075366_10547006 Ga0075366_105470062 107
134 3300006195 Ga0075366_10577617 Ga0075366_105776172 107
135 3300006353 Ga0075370_10000854 Ga0075370_1000085412 107
136 3300006353 Ga0075370_10002800 Ga0075370_1000280010 107
137 3300006353 Ga0075370_10003383 Ga0075370_100033833 107
138 3300006353 Ga0075370_10045133 Ga0075370_100451333 107
139 3300006881 Ga0068865_101692914 Ga0068865_1016929142 107
140 3300006931 Ga0097620_100986196 Ga0097620_1009861962 107
141 3300009092 Ga0105250_10091014 Ga0105250_100910142 107
142 3300009093 Ga0105240_10081673 Ga0105240_100816734 107
143 3300009148 Ga0105243_10035667 Ga0105243_100356672 107
144 3300009148 Ga0105243_10718625 Ga0105243_107186252 107
145 3300009174 Ga0105241_10277484 Ga0105241_102774843 107
146 3300009177 Ga0105248_10044143 Ga0105248_100441433 107
147 3300009177 Ga0105248_11059248 Ga0105248_110592482 107
148 3300009553 Ga0105249_11514723 Ga0105249_115147232 107
149 3300010375 Ga0105239_10050251 Ga0105239_100502515 107
150 3300011119 Ga0105246_10219053 Ga0105246_102190532 107
151 3300011119 Ga0105246_10969817 Ga0105246_109698172 107
152 3300014325 Ga0163163_10775432 Ga0163163_107754322 107
153 3300025893 Ga0207682_10021298 Ga0207682_100212983 107
154 3300025893 Ga0207682_10335808 Ga0207682_103358082 107
155 3300025903 Ga0207680_10189659 Ga0207680_101896592 107
156 3300025907 Ga0207645_10038838 Ga0207645_100388384 107
157 3300025908 Ga0207643_10447133 Ga0207643_104471332 107
158 3300025910 Ga0207684_10008798 Ga0207684_100087986 107
159 3300025913 Ga0207695_10199733 Ga0207695_101997332 107
160 3300025922 Ga0207646_10067500 Ga0207646_100675002 107
161 3300025923 Ga0207681_10510064 Ga0207681_105100642 107
162 3300025925 Ga0207650_10328804 Ga0207650_103288042 107
163 3300025926 Ga0207659_10395497 Ga0207659_103954972 107
164 3300025931 Ga0207644_10016461 Ga0207644_100164614 107
165 3300025931 Ga0207644_10045088 Ga0207644_100450883 107
166 3300025933 Ga0207706_10020545 Ga0207706_100205453 107
167 3300025933 Ga0207706_10092441 Ga0207706_100924413 107
168 3300025935 Ga0207709_10038669 Ga0207709_100386693 107
169 3300025935 Ga0207709_10190764 Ga0207709_101907643 107
170 3300025938 Ga0207704_10046121 Ga0207704_100461214 107
171 3300025940 Ga0207691_10041584 Ga0207691_100415844 107
172 3300025942 Ga0207689_10051233 Ga0207689_100512332 107
173 3300025942 Ga0207689_10183308 Ga0207689_101833083 107
174 3300025945 Ga0207679_11795853 Ga0207679_117958531 107
175 3300025960 Ga0207651_10007014 Ga0207651_100070145 107
176 3300025981 Ga0207640_10148648 Ga0207640_101486483 107
177 3300025986 Ga0207658_10126880 Ga0207658_101268802 107
178 3300025986 Ga0207658_11120673 Ga0207658_111206731 107
179 3300026023 Ga0207677_10144850 Ga0207677_101448502 107
180 3300026041 Ga0207639_10041469 Ga0207639_100414692 107
181 3300026041 Ga0207639_10613085 Ga0207639_106130851 107
182 3300026067 Ga0207678_10058082 Ga0207678_100580823 107
183 3300026067 Ga0207678_10958979 Ga0207678_109589791 107
184 3300026088 Ga0207641_10221469 Ga0207641_102214692 107
185 3300026089 Ga0207648_10011874 Ga0207648_100118744 107
186 3300026089 Ga0207648_10338752 Ga0207648_103387523 107
187 3300026095 Ga0207676_10269247 Ga0207676_102692473 107
188 3300026116 Ga0207674_10066692 Ga0207674_100666923 107
189 3300026116 Ga0207674_10457960 Ga0207674_104579602 107
190 3300026116 Ga0207674_11483297 Ga0207674_114832972 107
191 3300026118 Ga0207675_101177667 Ga0207675_1011776672 107
192 3300026121 Ga0207683_10519610 Ga0207683_105196102 107
193 3300026142 Ga0207698_10372073 Ga0207698_103720732 107
194 3300027866 Ga0209813_10025988 Ga0209813_100259883 107
195 3300028379 Ga0268266_10750313 Ga0268266_107503132 107
196 3300028786 Ga0307517_10380696 Ga0307517_103806962 107
197 3300028794 Ga0307515_10419442 Ga0307515_104194422 107
198 3300030522 Ga0307512_10364039 Ga0307512_103640392 107
199 3300031548 Ga0307408_100969204 Ga0307408_1009692042 107
200 3300031616 Ga0307508_10123561 Ga0307508_101235611 107
201 3300031730 Ga0307516_10048713 Ga0307516_100487133 107
202 3300031730 Ga0307516_10489815 Ga0307516_104898152 107
203 3300031852 Ga0307410_10598432 Ga0307410_105984321 107
204 3300031911 Ga0307412_10095495 Ga0307412_100954953 107
205 3300032002 Ga0307416_100043918 Ga0307416_1000439184 107
206 3300032005 Ga0307411_10518349 Ga0307411_105183492 107
207 3300033180 Ga0307510_10063734 Ga0307510_100637342 107
208 3300041413 Ga0439465_0335315 Ga0439465_0335315_87_410 107
209 3300041443 Ga0451789_1294840 Ga0451789_1294840_94_417 107
210 3300041456 Ga0451795_0388746 Ga0451795_0388746_179_502 107
211 3300041505 Ga0451849_0798363 Ga0451849_0798363_23_346 107
212 3300046506 Ga0495583_0143968 Ga0495583_0143968_650_973 107
213 3300046519 Ga0495632_0023035 Ga0495632_0023035_1497_1820 107
214 3300046519 Ga0495632_0280547 Ga0495632_0280547_269_592 107
215 3300046524 Ga0495648_0351288 Ga0495648_0351288_232_555 107
216 3300046542 Ga0495597_0010750 Ga0495597_0010750_3621_3944 107
217 3300046542 Ga0495597_0070235 Ga0495597_0070235_868_1191 107
218 3300046616 Ga0495668_0234797 Ga0495668_0234797_429_752 107
219 3300046660 Ga0495625_0023081 Ga0495625_0023081_3360_3683 107
220 3300046660 Ga0495625_0339089 Ga0495625_0339089_312_635 107
221 3300046694 Ga0495649_0003993 Ga0495649_0003993_5189_5512 107
222 3300046694 Ga0495649_0334166 Ga0495649_0334166_39_362 107
223 3300046810 Ga0495660_0037919 Ga0495660_0037919_1823_2146 107
224 3300047443 Ga0495687_001797 Ga0495687_001797_9197_9520 107
225 3300047443 Ga0495687_007155 Ga0495687_007155_2526_2849 107
226 3300048091 Ga0495626_0028432 Ga0495626_0028432_1897_2220 107
227 3300048091 Ga0495626_0124891 Ga0495626_0124891_223_546 107
228 3300048903 Ga0496100_0089918 Ga0496100_0089918_1426_1749 107
229 3300048904 Ga0496101_0255575 Ga0496101_0255575_156_479 107
230 3300048907 Ga0496104_0077218 Ga0496104_0077218_715_1038 107
231 3300048908 Ga0496105_0147542 Ga0496105_0147542_964_1287 107
232 3300048911 Ga0496108_0252797 Ga0496108_0252797_920_1243 107
233 3300048915 Ga0496112_0074682 Ga0496112_0074682_229_552 107
234 3300048916 Ga0496113_0383216 Ga0496113_0383216_353_676 107
235 3300049515 Ga0501292_068260 Ga0501292_068260_191_520 107
236 3300049651 Ga0501201_038908 Ga0501201_038908_92_424 107
237 3300050489 nmdc:mga03683_13510_c1 nmdc:mga03683_13510_c1_1713_2036 107
238 3300050490 nmdc:mga03n38_75773_c1 nmdc:mga03n38_75773_c1_822_1145 107
239 3300050491 nmdc:mga00v17_65035_c1 nmdc:mga00v17_65035_c1_601_924 107
240 3300050492 nmdc:mga0yw44_56212_c1 nmdc:mga0yw44_56212_c1_1608_1931 107
241 3300050493 nmdc:mga0k408_129748_c1 nmdc:mga0k408_129748_c1_218_541 107
242 3300050493 nmdc:mga0k408_203701_c1 nmdc:mga0k408_203701_c1_842_1165 107
243 3300050493 nmdc:mga0k408_284702_c1 nmdc:mga0k408_284702_c1_381_704 107
244 3300050493 nmdc:mga0k408_28979_c1 nmdc:mga0k408_28979_c1_279_602 107
245 3300050493 nmdc:mga0k408_38083_c1 nmdc:mga0k408_38083_c1_1378_1701 107
246 3300050493 nmdc:mga0k408_382402_c1 nmdc:mga0k408_382402_c1_463_786 107
247 3300050493 nmdc:mga0k408_4980_c1 nmdc:mga0k408_4980_c1_1255_1578 107
248 3300050493 nmdc:mga0k408_5321_c1 nmdc:mga0k408_5321_c1_4296_4619 107
249 3300050493 nmdc:mga0k408_5383_c1 nmdc:mga0k408_5383_c1_5340_5678 107
250 3300050493 nmdc:mga0k408_9031_c1 nmdc:mga0k408_9031_c1_2635_2958 107
251 3300050494 nmdc:mga06z11_10035_c1 nmdc:mga06z11_10035_c1_3189_3527 107
252 3300050494 nmdc:mga06z11_13948_c1 nmdc:mga06z11_13948_c1_2966_3289 107
253 3300050494 nmdc:mga06z11_16145_c1 nmdc:mga06z11_16145_c1_2358_2681 107
254 3300050494 nmdc:mga06z11_44839_c1 nmdc:mga06z11_44839_c1_1357_1680 107
255 3300050495 nmdc:mga04h51_277511_c1 nmdc:mga04h51_277511_c1_229_567 107
256 3300050496 nmdc:mga07m45_1876_c1 nmdc:mga07m45_1876_c1_7271_7594 107
257 3300050496 nmdc:mga07m45_2290_c1 nmdc:mga07m45_2290_c1_35_358 107
258 3300050496 nmdc:mga07m45_23091_c1 nmdc:mga07m45_23091_c1_781_1119 107
259 3300050496 nmdc:mga07m45_30797_c1 nmdc:mga07m45_30797_c1_2372_2695 107
260 3300050496 nmdc:mga07m45_444839_c1 nmdc:mga07m45_444839_c1_72_395 107
261 3300050496 nmdc:mga07m45_4610_c1 nmdc:mga07m45_4610_c1_4204_4527 107
262 3300050496 nmdc:mga07m45_8408_c1 nmdc:mga07m45_8408_c1_2275_2598 107
263 3300050516 nmdc:mga0sz30_165268_c1 nmdc:mga0sz30_165268_c1_411_734 107
264 3300050516 nmdc:mga0sz30_52667_c1 nmdc:mga0sz30_52667_c1_614_937 107
265 3300050516 nmdc:mga0sz30_9319_c1 nmdc:mga0sz30_9319_c1_2352_2675 107
266 3300053086 Ga0500578_0759735 Ga0500578_0759735_115_438 107
267 3300053093 Ga0500651_0096277 Ga0500651_0096277_1051_1374 107
268 3300053134 Ga0500658_0006265 Ga0500658_0006265_930_1253 107
269 3300053139 Ga0500568_0011911 Ga0500568_0011911_3543_3866 107
270 3300053160 Ga0500633_0306625 Ga0500633_0306625_92_415 107
271 3300001979 JGI24740J21852_10019594 JGI24740J21852_100195943 108
272 3300003215 JGI25153J46596_10006137 JGI25153J46596_100061377 108
273 3300005290 Ga0065712_10517541 Ga0065712_105175411 108
274 3300005327 Ga0070658_10274738 Ga0070658_102747383 108
275 3300005327 Ga0070658_10933212 Ga0070658_109332122 108
276 3300005328 Ga0070676_10002478 Ga0070676_100024783 108
277 3300005328 Ga0070676_10031932 Ga0070676_100319322 108
278 3300005329 Ga0070683_101351563 Ga0070683_1013515631 108
279 3300005330 Ga0070690_100102793 Ga0070690_1001027933 108
280 3300005330 Ga0070690_101045909 Ga0070690_1010459092 108
281 3300005331 Ga0070670_100000775 Ga0070670_1000007759 108
282 3300005331 Ga0070670_100067838 Ga0070670_1000678381 108
283 3300005331 Ga0070670_100127781 Ga0070670_1001277813 108
284 3300005331 Ga0070670_100134480 Ga0070670_1001344802 108
285 3300005331 Ga0070670_100223566 Ga0070670_1002235662 108
286 3300005331 Ga0070670_100282417 Ga0070670_1002824173 108
287 3300005331 Ga0070670_100307717 Ga0070670_1003077171 108
288 3300005331 Ga0070670_100363089 Ga0070670_1003630892 108
289 3300005331 Ga0070670_101042747 Ga0070670_1010427471 108
290 3300005333 Ga0070677_10004477 Ga0070677_100044774 108
291 3300005333 Ga0070677_10024937 Ga0070677_100249372 108
292 3300005333 Ga0070677_10032776 Ga0070677_100327763 108
293 3300005333 Ga0070677_10055466 Ga0070677_100554661 108
294 3300005333 Ga0070677_10247812 Ga0070677_102478122 108
295 3300005333 Ga0070677_10549853 Ga0070677_105498532 108
296 3300005334 Ga0068869_100001648 Ga0068869_10000164815 108
297 3300005334 Ga0068869_100024199 Ga0068869_1000241993 108
298 3300005334 Ga0068869_100575017 Ga0068869_1005750172 108
299 3300005335 Ga0070666_10002795 Ga0070666_100027955 108
300 3300005335 Ga0070666_10045779 Ga0070666_100457795 108
301 3300005335 Ga0070666_10070708 Ga0070666_100707082 108
302 3300005335 Ga0070666_10155665 Ga0070666_101556652 108
303 3300005335 Ga0070666_11097180 Ga0070666_110971801 108
304 3300005337 Ga0070682_100965057 Ga0070682_1009650572 108
305 3300005338 Ga0068868_100035720 Ga0068868_1000357205 108
306 3300005338 Ga0068868_100164549 Ga0068868_1001645492 108
307 3300005338 Ga0068868_100169169 Ga0068868_1001691693 108
308 3300005338 Ga0068868_100532513 Ga0068868_1005325131 108
309 3300005338 Ga0068868_100634143 Ga0068868_1006341432 108
310 3300005338 Ga0068868_100774899 Ga0068868_1007748992 108
311 3300005339 Ga0070660_100878335 Ga0070660_1008783352 108
312 3300005339 Ga0070660_101828726 Ga0070660_1018287261 108
313 3300005340 Ga0070689_101117843 Ga0070689_1011178432 108
314 3300005343 Ga0070687_100311939 Ga0070687_1003119392 108
315 3300005344 Ga0070661_100748476 Ga0070661_1007484762 108
316 3300005344 Ga0070661_101018060 Ga0070661_1010180601 108
317 3300005347 Ga0070668_100013107 Ga0070668_1000131074 108
318 3300005347 Ga0070668_100188821 Ga0070668_1001888212 108
319 3300005347 Ga0070668_100546617 Ga0070668_1005466172 108
320 3300005347 Ga0070668_101437646 Ga0070668_1014376462 108
321 3300005353 Ga0070669_100005859 Ga0070669_1000058593 108
322 3300005353 Ga0070669_100013170 Ga0070669_1000131705 108
323 3300005353 Ga0070669_100045646 Ga0070669_1000456463 108
324 3300005353 Ga0070669_101005154 Ga0070669_1010051541 108
325 3300005354 Ga0070675_100001482 Ga0070675_10000148220 108
326 3300005354 Ga0070675_100020379 Ga0070675_1000203793 108
327 3300005354 Ga0070675_100024332 Ga0070675_1000243323 108
328 3300005354 Ga0070675_100092713 Ga0070675_1000927134 108
329 3300005354 Ga0070675_100198527 Ga0070675_1001985273 108
330 3300005354 Ga0070675_100214868 Ga0070675_1002148681 108
331 3300005354 Ga0070675_100658978 Ga0070675_1006589782 108
332 3300005354 Ga0070675_101250616 Ga0070675_1012506162 108
333 3300005354 Ga0070675_101548308 Ga0070675_1015483081 108
334 3300005355 Ga0070671_100005666 Ga0070671_1000056663 108
335 3300005355 Ga0070671_100030454 Ga0070671_1000304545 108
336 3300005355 Ga0070671_100074874 Ga0070671_1000748744 108
337 3300005355 Ga0070671_100076135 Ga0070671_1000761353 108
338 3300005356 Ga0070674_100005009 Ga0070674_1000050098 108
339 3300005356 Ga0070674_100009279 Ga0070674_1000092793 108
340 3300005356 Ga0070674_100177682 Ga0070674_1001776822 108
341 3300005356 Ga0070674_101338292 Ga0070674_1013382922 108
342 3300005356 Ga0070674_101607414 Ga0070674_1016074141 108
343 3300005356 Ga0070674_101809086 Ga0070674_1018090861 108
344 3300005364 Ga0070673_100029454 Ga0070673_1000294544 108
345 3300005364 Ga0070673_100035511 Ga0070673_1000355114 108
346 3300005364 Ga0070673_100069367 Ga0070673_1000693673 108
347 3300005364 Ga0070673_100161601 Ga0070673_1001616013 108
348 3300005364 Ga0070673_100223986 Ga0070673_1002239862 108
349 3300005364 Ga0070673_100417265 Ga0070673_1004172653 108
350 3300005364 Ga0070673_100520427 Ga0070673_1005204272 108
351 3300005364 Ga0070673_101952480 Ga0070673_1019524802 108
352 3300005365 Ga0070688_100053688 Ga0070688_1000536883 108
353 3300005365 Ga0070688_100096372 Ga0070688_1000963723 108
354 3300005366 Ga0070659_100170105 Ga0070659_1001701051 108
355 3300005366 Ga0070659_100276123 Ga0070659_1002761232 108
356 3300005366 Ga0070659_100978184 Ga0070659_1009781842 108
357 3300005367 Ga0070667_100001504 Ga0070667_10000150412 108
358 3300005367 Ga0070667_100120197 Ga0070667_1001201973 108
359 3300005367 Ga0070667_100279507 Ga0070667_1002795073 108
360 3300005367 Ga0070667_100599779 Ga0070667_1005997791 108
361 3300005367 Ga0070667_101197729 Ga0070667_1011977291 108
362 3300005367 Ga0070667_101465799 Ga0070667_1014657992 108
363 3300005438 Ga0070701_10486249 Ga0070701_104862492 108
364 3300005441 Ga0070700_100073191 Ga0070700_1000731912 108
365 3300005441 Ga0070700_100734653 Ga0070700_1007346532 108
366 3300005441 Ga0070700_100754424 Ga0070700_1007544242 108
367 3300005445 Ga0070708_100710240 Ga0070708_1007102402 108
368 3300005455 Ga0070663_100265425 Ga0070663_1002654252 108
369 3300005455 Ga0070663_100273859 Ga0070663_1002738592 108
370 3300005456 Ga0070678_100017348 Ga0070678_1000173484 108
371 3300005456 Ga0070678_100076806 Ga0070678_1000768063 108
372 3300005456 Ga0070678_100077397 Ga0070678_1000773973 108
373 3300005456 Ga0070678_100107750 Ga0070678_1001077503 108
374 3300005456 Ga0070678_100108943 Ga0070678_1001089433 108
375 3300005456 Ga0070678_100267040 Ga0070678_1002670402 108
376 3300005456 Ga0070678_100337227 Ga0070678_1003372273 108
377 3300005456 Ga0070678_100353662 Ga0070678_1003536622 108
378 3300005456 Ga0070678_100437635 Ga0070678_1004376352 108
379 3300005456 Ga0070678_100677488 Ga0070678_1006774882 108
380 3300005456 Ga0070678_100738649 Ga0070678_1007386492 108
381 3300005456 Ga0070678_101272963 Ga0070678_1012729632 108
382 3300005456 Ga0070678_101488809 Ga0070678_1014888092 108
383 3300005456 Ga0070678_101563137 Ga0070678_1015631372 108
384 3300005456 Ga0070678_102261053 Ga0070678_1022610531 108
385 3300005457 Ga0070662_100013829 Ga0070662_1000138293 108
386 3300005457 Ga0070662_100356970 Ga0070662_1003569703 108
387 3300005457 Ga0070662_100427554 Ga0070662_1004275542 108
388 3300005458 Ga0070681_10197743 Ga0070681_101977431 108
389 3300005459 Ga0068867_100002317 Ga0068867_1000023174 108
390 3300005459 Ga0068867_100005331 Ga0068867_1000053317 108
391 3300005459 Ga0068867_100055304 Ga0068867_1000553042 108
392 3300005459 Ga0068867_100056848 Ga0068867_1000568483 108
393 3300005459 Ga0068867_100077545 Ga0068867_1000775452 108
394 3300005459 Ga0068867_100147428 Ga0068867_1001474282 108
395 3300005459 Ga0068867_100233881 Ga0068867_1002338812 108
396 3300005459 Ga0068867_100241274 Ga0068867_1002412742 108
397 3300005459 Ga0068867_100477329 Ga0068867_1004773291 108
398 3300005459 Ga0068867_100574557 Ga0068867_1005745572 108
399 3300005459 Ga0068867_100654761 Ga0068867_1006547612 108
400 3300005459 Ga0068867_101268806 Ga0068867_1012688062 108
401 3300005466 Ga0070685_10412280 Ga0070685_104122801 108
402 3300005466 Ga0070685_10667608 Ga0070685_106676082 108
403 3300005468 Ga0070707_100686286 Ga0070707_1006862861 108
404 3300005530 Ga0070679_100055562 Ga0070679_1000555623 108
405 3300005530 Ga0070679_101016454 Ga0070679_1010164542 108
406 3300005535 Ga0070684_100159016 Ga0070684_1001590163 108
407 3300005539 Ga0068853_100079646 Ga0068853_1000796464 108
408 3300005539 Ga0068853_100917267 Ga0068853_1009172671 108
409 3300005543 Ga0070672_100000485 Ga0070672_1000004859 108
410 3300005543 Ga0070672_100016669 Ga0070672_1000166694 108
411 3300005543 Ga0070672_100030860 Ga0070672_1000308603 108
412 3300005543 Ga0070672_100074313 Ga0070672_1000743133 108
413 3300005543 Ga0070672_100118478 Ga0070672_1001184782 108
414 3300005543 Ga0070672_100129179 Ga0070672_1001291793 108
415 3300005543 Ga0070672_100255897 Ga0070672_1002558972 108
416 3300005543 Ga0070672_100339769 Ga0070672_1003397691 108
417 3300005543 Ga0070672_101240598 Ga0070672_1012405982 108
418 3300005543 Ga0070672_101248646 Ga0070672_1012486461 108
419 3300005544 Ga0070686_100323357 Ga0070686_1003233573 108
420 3300005544 Ga0070686_101675827 Ga0070686_1016758272 108
421 3300005548 Ga0070665_100028038 Ga0070665_1000280385 108
422 3300005548 Ga0070665_100338241 Ga0070665_1003382413 108
423 3300005548 Ga0070665_100546975 Ga0070665_1005469752 108
424 3300005548 Ga0070665_100753413 Ga0070665_1007534131 108
425 3300005548 Ga0070665_101524301 Ga0070665_1015243012 108
426 3300005564 Ga0070664_100012848 Ga0070664_1000128482 108
427 3300005564 Ga0070664_100113896 Ga0070664_1001138964 108
428 3300005564 Ga0070664_100377425 Ga0070664_1003774253 108
429 3300005564 Ga0070664_100534554 Ga0070664_1005345542 108
430 3300005564 Ga0070664_101180664 Ga0070664_1011806642 108
431 3300005564 Ga0070664_101223881 Ga0070664_1012238811 108
432 3300005578 Ga0068854_100090840 Ga0068854_1000908402 108
433 3300005578 Ga0068854_100113081 Ga0068854_1001130813 108
434 3300005578 Ga0068854_100223915 Ga0068854_1002239152 108
435 3300005578 Ga0068854_101458403 Ga0068854_1014584031 108
436 3300005614 Ga0068856_100205955 Ga0068856_1002059551 108
437 3300005614 Ga0068856_101302221 Ga0068856_1013022212 108
438 3300005615 Ga0070702_101758564 Ga0070702_1017585641 108
439 3300005616 Ga0068852_100092155 Ga0068852_1000921552 108
440 3300005616 Ga0068852_100194266 Ga0068852_1001942663 108
441 3300005616 Ga0068852_100206199 Ga0068852_1002061992 108
442 3300005616 Ga0068852_100320799 Ga0068852_1003207993 108
443 3300005616 Ga0068852_101336581 Ga0068852_1013365812 108
444 3300005616 Ga0068852_102027063 Ga0068852_1020270631 108
445 3300005617 Ga0068859_100070277 Ga0068859_1000702773 108
446 3300005617 Ga0068859_100136538 Ga0068859_1001365383 108
447 3300005618 Ga0068864_100006073 Ga0068864_1000060732 108
448 3300005618 Ga0068864_100076573 Ga0068864_1000765733 108
449 3300005618 Ga0068864_100195683 Ga0068864_1001956833 108
450 3300005618 Ga0068864_100449106 Ga0068864_1004491063 108
451 3300005618 Ga0068864_100845441 Ga0068864_1008454411 108
452 3300005718 Ga0068866_10005941 Ga0068866_100059417 108
453 3300005718 Ga0068866_10498545 Ga0068866_104985452 108
454 3300005719 Ga0068861_100007796 Ga0068861_1000077963 108
455 3300005719 Ga0068861_100010477 Ga0068861_1000104774 108
456 3300005719 Ga0068861_100059399 Ga0068861_1000593994 108
457 3300005719 Ga0068861_101539259 Ga0068861_1015392592 108
458 3300005834 Ga0068851_10054329 Ga0068851_100543293 108
459 3300005834 Ga0068851_10134243 Ga0068851_101342433 108
460 3300005834 Ga0068851_10192843 Ga0068851_101928432 108
461 3300005834 Ga0068851_10207691 Ga0068851_102076912 108
462 3300005834 Ga0068851_10326610 Ga0068851_103266102 108
463 3300005840 Ga0068870_10162280 Ga0068870_101622803 108
464 3300005841 Ga0068863_100006580 Ga0068863_1000065804 108
465 3300005841 Ga0068863_100010999 Ga0068863_1000109999 108
466 3300005841 Ga0068863_100056110 Ga0068863_1000561102 108
467 3300005841 Ga0068863_100251725 Ga0068863_1002517253 108
468 3300005841 Ga0068863_100464831 Ga0068863_1004648313 108
469 3300005841 Ga0068863_101062392 Ga0068863_1010623922 108
470 3300005841 Ga0068863_101239218 Ga0068863_1012392182 108
471 3300005842 Ga0068858_100004441 Ga0068858_1000044417 108
472 3300005842 Ga0068858_100055279 Ga0068858_1000552794 108
473 3300005842 Ga0068858_101420961 Ga0068858_1014209611 108
474 3300005843 Ga0068860_100006168 Ga0068860_10000616812 108
475 3300005843 Ga0068860_100122793 Ga0068860_1001227932 108
476 3300005843 Ga0068860_100306129 Ga0068860_1003061293 108
477 3300005843 Ga0068860_100579483 Ga0068860_1005794832 108
478 3300005844 Ga0068862_100011734 Ga0068862_1000117349 108
479 3300005844 Ga0068862_100086216 Ga0068862_1000862162 108
480 3300005844 Ga0068862_100178666 Ga0068862_1001786663 108
481 3300005844 Ga0068862_100216042 Ga0068862_1002160423 108
482 3300005844 Ga0068862_101949855 Ga0068862_1019498552 108
483 3300006028 Ga0070717_10888792 Ga0070717_108887922 108
484 3300006042 Ga0075368_10527534 Ga0075368_105275341 108
485 3300006048 Ga0075363_100295166 Ga0075363_1002951662 108
486 3300006048 Ga0075363_100485893 Ga0075363_1004858932 108
487 3300006173 Ga0070716_100131326 Ga0070716_1001313263 108
488 3300006177 Ga0075362_10009196 Ga0075362_100091962 108
489 3300006177 Ga0075362_10059103 Ga0075362_100591032 108
490 3300006177 Ga0075362_10171464 Ga0075362_101714642 108
491 3300006177 Ga0075362_10297218 Ga0075362_102972182 108
492 3300006177 Ga0075362_10557038 Ga0075362_105570381 108
493 3300006178 Ga0075367_10154559 Ga0075367_101545593 108
494 3300006186 Ga0075369_10339395 Ga0075369_103393952 108
495 3300006195 Ga0075366_10009118 Ga0075366_100091187 108
496 3300006195 Ga0075366_10012436 Ga0075366_100124366 108
497 3300006195 Ga0075366_10064499 Ga0075366_100644992 108
498 3300006195 Ga0075366_10226494 Ga0075366_102264942 108
499 3300006195 Ga0075366_10549934 Ga0075366_105499342 108
500 3300006237 Ga0097621_100025465 Ga0097621_1000254654 108
501 3300006237 Ga0097621_100147122 Ga0097621_1001471223 108
502 3300006353 Ga0075370_10097322 Ga0075370_100973222 108
503 3300006353 Ga0075370_10133920 Ga0075370_101339202 108
504 3300006353 Ga0075370_10211259 Ga0075370_102112592 108
505 3300006353 Ga0075370_10278882 Ga0075370_102788822 108
506 3300006353 Ga0075370_10382760 Ga0075370_103827602 108
507 3300006358 Ga0068871_100040253 Ga0068871_1000402532 108
508 3300006358 Ga0068871_100124281 Ga0068871_1001242813 108
509 3300006358 Ga0068871_100222012 Ga0068871_1002220123 108
510 3300006358 Ga0068871_100691793 Ga0068871_1006917932 108
511 3300006358 Ga0068871_100873779 Ga0068871_1008737792 108
512 3300006358 Ga0068871_100887637 Ga0068871_1008876371 108
513 3300006846 Ga0075430_100045709 Ga0075430_1000457092 108
514 3300006881 Ga0068865_100023882 Ga0068865_1000238823 108
515 3300006881 Ga0068865_100074584 Ga0068865_1000745842 108
516 3300006881 Ga0068865_101233065 Ga0068865_1012330652 108
517 3300006931 Ga0097620_100070277 Ga0097620_1000702773 108
518 3300006931 Ga0097620_100136542 Ga0097620_1001365423 108
519 3300009093 Ga0105240_10018949 Ga0105240_100189497 108
520 3300009094 Ga0111539_10132095 Ga0111539_101320953 108
521 3300009094 Ga0111539_11926734 Ga0111539_119267341 108
522 3300009094 Ga0111539_12012739 Ga0111539_120127392 108
523 3300009098 Ga0105245_10048172 Ga0105245_100481724 108
524 3300009098 Ga0105245_10822413 Ga0105245_108224132 108
525 3300009098 Ga0105245_11098617 Ga0105245_110986172 108
526 3300009147 Ga0114129_10078156 Ga0114129_100781563 108
527 3300009148 Ga0105243_10000649 Ga0105243_100006497 108
528 3300009148 Ga0105243_10018605 Ga0105243_100186054 108
529 3300009148 Ga0105243_10219249 Ga0105243_102192493 108
530 3300009174 Ga0105241_10981838 Ga0105241_109818381 108
531 3300009176 Ga0105242_10147470 Ga0105242_101474703 108
532 3300009176 Ga0105242_10764653 Ga0105242_107646531 108
533 3300009177 Ga0105248_10033310 Ga0105248_100333107 108
534 3300009177 Ga0105248_10134398 Ga0105248_101343983 108
535 3300009177 Ga0105248_10194699 Ga0105248_101946992 108
536 3300009177 Ga0105248_11615637 Ga0105248_116156372 108
537 3300009177 Ga0105248_13039546 Ga0105248_130395462 108
538 3300009545 Ga0105237_10001988 Ga0105237_1000198816 108
539 3300009545 Ga0105237_10881549 Ga0105237_108815492 108
540 3300009551 Ga0105238_10014640 Ga0105238_100146407 108
541 3300009551 Ga0105238_11637287 Ga0105238_116372872 108
542 3300009553 Ga0105249_10009613 Ga0105249_100096137 108
543 3300009553 Ga0105249_10128897 Ga0105249_101288973 108
544 3300009553 Ga0105249_10767916 Ga0105249_107679162 108
545 3300009553 Ga0105249_10797317 Ga0105249_107973172 108
546 3300009553 Ga0105249_12548904 Ga0105249_125489041 108
547 3300009553 Ga0105249_13231722 Ga0105249_132317221 108
548 3300009553 Ga0105249_13258103 Ga0105249_132581032 108
549 3300010375 Ga0105239_10004146 Ga0105239_1000414615 108
550 3300011119 Ga0105246_12048846 Ga0105246_120488461 108
551 3300013100 Ga0157373_10448390 Ga0157373_104483902 108
552 3300013102 Ga0157371_10579855 Ga0157371_105798552 108
553 3300013104 Ga0157370_11057125 Ga0157370_110571252 108
554 3300013105 Ga0157369_10483949 Ga0157369_104839492 108
555 3300013296 Ga0157374_10084889 Ga0157374_100848894 108
556 3300013296 Ga0157374_10208548 Ga0157374_102085483 108
557 3300013297 Ga0157378_10137192 Ga0157378_101371922 108
558 3300013297 Ga0157378_10461686 Ga0157378_104616862 108
559 3300013297 Ga0157378_10566919 Ga0157378_105669192 108
560 3300013297 Ga0157378_10627283 Ga0157378_106272832 108
561 3300013297 Ga0157378_10661483 Ga0157378_106614832 108
562 3300013297 Ga0157378_12555060 Ga0157378_125550602 108
563 3300013306 Ga0163162_10011522 Ga0163162_100115225 108
564 3300013306 Ga0163162_10161373 Ga0163162_101613733 108
565 3300013306 Ga0163162_10721023 Ga0163162_107210232 108
566 3300013306 Ga0163162_10934355 Ga0163162_109343552 108
567 3300013306 Ga0163162_12373692 Ga0163162_123736921 108
568 3300013307 Ga0157372_10604790 Ga0157372_106047902 108
569 3300013308 Ga0157375_10076831 Ga0157375_100768313 108
570 3300013308 Ga0157375_10085627 Ga0157375_100856274 108
571 3300013308 Ga0157375_10293371 Ga0157375_102933712 108
572 3300013308 Ga0157375_10457810 Ga0157375_104578103 108
573 3300013308 Ga0157375_11068663 Ga0157375_110686632 108
574 3300014325 Ga0163163_10011394 Ga0163163_100113947 108
575 3300014325 Ga0163163_10881802 Ga0163163_108818021 108
576 3300014325 Ga0163163_11524831 Ga0163163_115248311 108
577 3300014326 Ga0157380_10006323 Ga0157380_100063232 108
578 3300014326 Ga0157380_10797607 Ga0157380_107976072 108
579 3300014326 Ga0157380_10882670 Ga0157380_108826702 108
580 3300014326 Ga0157380_12683823 Ga0157380_126838232 108
581 3300014326 Ga0157380_13119147 Ga0157380_131191471 108
582 3300014745 Ga0157377_10000006 Ga0157377_10000006403 108
583 3300014745 Ga0157377_10359191 Ga0157377_103591912 108
584 3300014745 Ga0157377_11662769 Ga0157377_116627691 108
585 3300014968 Ga0157379_10015125 Ga0157379_100151257 108
586 3300014968 Ga0157379_10016325 Ga0157379_100163257 108
587 3300014968 Ga0157379_10021583 Ga0157379_100215835 108
588 3300014968 Ga0157379_11054654 Ga0157379_110546542 108
589 3300014968 Ga0157379_11594545 Ga0157379_115945451 108
590 3300014968 Ga0157379_12419342 Ga0157379_124193421 108
591 3300014969 Ga0157376_10079207 Ga0157376_100792071 108
592 3300014969 Ga0157376_10288786 Ga0157376_102887861 108
593 3300014969 Ga0157376_10450520 Ga0157376_104505202 108
594 3300014969 Ga0157376_11887229 Ga0157376_118872292 108
595 3300014969 Ga0157376_12068523 Ga0157376_120685232 108
596 3300014969 Ga0157376_12388383 Ga0157376_123883832 108
597 3300015683 Ga0183362_10004 Ga0183362_10004542 108
598 3300017792 Ga0163161_10009633 Ga0163161_100096337 108
599 3300017792 Ga0163161_10045002 Ga0163161_100450022 108
600 3300017792 Ga0163161_10231198 Ga0163161_102311982 108
601 3300017792 Ga0163161_10389612 Ga0163161_103896122 108
602 3300017792 Ga0163161_10816384 Ga0163161_108163842 108
603 3300017792 Ga0163161_11142281 Ga0163161_111422812 108
604 3300017792 Ga0163161_11332321 Ga0163161_113323212 108
605 3300020082 Ga0206353_11452919 Ga0206353_114529191 108
606 3300021361 Ga0213872_10000155 Ga0213872_1000015551 108
607 3300021361 Ga0213872_10157498 Ga0213872_101574982 108
608 3300025273 Ga0209673_1005560 Ga0209673_10055604 108
609 3300025297 Ga0209758_1000769 Ga0209758_100076935 108
610 3300025315 Ga0207697_10020852 Ga0207697_100208521 108
611 3300025315 Ga0207697_10025463 Ga0207697_100254633 108
612 3300025315 Ga0207697_10069111 Ga0207697_100691112 108
613 3300025321 Ga0207656_10036342 Ga0207656_100363423 108
614 3300025321 Ga0207656_10072974 Ga0207656_100729742 108
615 3300025893 Ga0207682_10009442 Ga0207682_100094423 108
616 3300025893 Ga0207682_10010609 Ga0207682_100106095 108
617 3300025893 Ga0207682_10052694 Ga0207682_100526942 108
618 3300025893 Ga0207682_10060390 Ga0207682_100603903 108
619 3300025899 Ga0207642_10231839 Ga0207642_102318392 108
620 3300025899 Ga0207642_10456802 Ga0207642_104568022 108
621 3300025901 Ga0207688_10038491 Ga0207688_100384914 108
622 3300025901 Ga0207688_10325346 Ga0207688_103253462 108
623 3300025903 Ga0207680_10040979 Ga0207680_100409792 108
624 3300025903 Ga0207680_10052240 Ga0207680_100522403 108
625 3300025903 Ga0207680_10271428 Ga0207680_102714282 108
626 3300025903 Ga0207680_10589399 Ga0207680_105893992 108
627 3300025904 Ga0207647_10391251 Ga0207647_103912512 108
628 3300025907 Ga0207645_10009868 Ga0207645_100098684 108
629 3300025907 Ga0207645_10030778 Ga0207645_100307782 108
630 3300025908 Ga0207643_10023918 Ga0207643_100239182 108
631 3300025908 Ga0207643_10085762 Ga0207643_100857623 108
632 3300025908 Ga0207643_10343902 Ga0207643_103439022 108
633 3300025909 Ga0207705_10257093 Ga0207705_102570933 108
634 3300025909 Ga0207705_11402711 Ga0207705_114027112 108
635 3300025912 Ga0207707_10101940 Ga0207707_101019404 108
636 3300025913 Ga0207695_10138322 Ga0207695_101383222 108
637 3300025914 Ga0207671_10002519 Ga0207671_100025199 108
638 3300025914 Ga0207671_10685381 Ga0207671_106853812 108
639 3300025916 Ga0207663_10613812 Ga0207663_106138122 108
640 3300025917 Ga0207660_10025648 Ga0207660_100256483 108
641 3300025918 Ga0207662_10020118 Ga0207662_100201182 108
642 3300025919 Ga0207657_10055458 Ga0207657_100554583 108
643 3300025920 Ga0207649_10405692 Ga0207649_104056922 108
644 3300025921 Ga0207652_10008831 Ga0207652_1000883110 108
645 3300025922 Ga0207646_11465963 Ga0207646_114659631 108
646 3300025922 Ga0207646_11797157 Ga0207646_117971572 108
647 3300025923 Ga0207681_10001432 Ga0207681_100014325 108
648 3300025923 Ga0207681_10004120 Ga0207681_100041208 108
649 3300025923 Ga0207681_10822179 Ga0207681_108221792 108
650 3300025923 Ga0207681_11408044 Ga0207681_114080442 108
651 3300025924 Ga0207694_10615943 Ga0207694_106159432 108
652 3300025924 Ga0207694_10694490 Ga0207694_106944902 108
653 3300025925 Ga0207650_10000275 Ga0207650_1000027542 108
654 3300025925 Ga0207650_10003921 Ga0207650_100039212 108
655 3300025925 Ga0207650_10133334 Ga0207650_101333343 108
656 3300025925 Ga0207650_10138977 Ga0207650_101389773 108
657 3300025925 Ga0207650_10485089 Ga0207650_104850892 108
658 3300025925 Ga0207650_11205008 Ga0207650_112050081 108
659 3300025926 Ga0207659_10000418 Ga0207659_1000041827 108
660 3300025926 Ga0207659_10050329 Ga0207659_100503293 108
661 3300025926 Ga0207659_10162669 Ga0207659_101626693 108
662 3300025926 Ga0207659_10165106 Ga0207659_101651063 108
663 3300025926 Ga0207659_10223288 Ga0207659_102232883 108
664 3300025926 Ga0207659_10297181 Ga0207659_102971812 108
665 3300025926 Ga0207659_10702554 Ga0207659_107025542 108
666 3300025927 Ga0207687_10074870 Ga0207687_100748702 108
667 3300025931 Ga0207644_10000391 Ga0207644_1000039127 108
668 3300025931 Ga0207644_10014706 Ga0207644_100147065 108
669 3300025931 Ga0207644_10077054 Ga0207644_100770543 108
670 3300025931 Ga0207644_10095589 Ga0207644_100955893 108
671 3300025931 Ga0207644_10203851 Ga0207644_102038512 108
672 3300025931 Ga0207644_10455672 Ga0207644_104556722 108
673 3300025932 Ga0207690_10191676 Ga0207690_101916763 108
674 3300025932 Ga0207690_10925860 Ga0207690_109258601 108
675 3300025932 Ga0207690_11172189 Ga0207690_111721892 108
676 3300025933 Ga0207706_10076989 Ga0207706_100769893 108
677 3300025933 Ga0207706_10151073 Ga0207706_101510732 108
678 3300025933 Ga0207706_10312047 Ga0207706_103120473 108
679 3300025933 Ga0207706_10619713 Ga0207706_106197132 108
680 3300025933 Ga0207706_10743301 Ga0207706_107433011 108
681 3300025933 Ga0207706_11040293 Ga0207706_110402932 108
682 3300025934 Ga0207686_10051491 Ga0207686_100514913 108
683 3300025935 Ga0207709_10001139 Ga0207709_100011397 108
684 3300025935 Ga0207709_10156862 Ga0207709_101568623 108
685 3300025935 Ga0207709_10167640 Ga0207709_101676402 108
686 3300025935 Ga0207709_10187336 Ga0207709_101873363 108
687 3300025936 Ga0207670_10864801 Ga0207670_108648012 108
688 3300025936 Ga0207670_10930038 Ga0207670_109300382 108
689 3300025937 Ga0207669_10001031 Ga0207669_100010315 108
690 3300025937 Ga0207669_10037849 Ga0207669_100378492 108
691 3300025937 Ga0207669_10342495 Ga0207669_103424952 108
692 3300025937 Ga0207669_10347604 Ga0207669_103476042 108
693 3300025937 Ga0207669_11080222 Ga0207669_110802222 108
694 3300025937 Ga0207669_11292715 Ga0207669_112927152 108
695 3300025938 Ga0207704_10002411 Ga0207704_100024114 108
696 3300025938 Ga0207704_10053687 Ga0207704_100536872 108
697 3300025938 Ga0207704_10845688 Ga0207704_108456882 108
698 3300025939 Ga0207665_10040480 Ga0207665_100404803 108
699 3300025940 Ga0207691_10001335 Ga0207691_1000133517 108
700 3300025940 Ga0207691_10055504 Ga0207691_100555042 108
701 3300025940 Ga0207691_10092874 Ga0207691_100928743 108
702 3300025940 Ga0207691_10103023 Ga0207691_101030232 108
703 3300025940 Ga0207691_10126606 Ga0207691_101266063 108
704 3300025940 Ga0207691_10166503 Ga0207691_101665032 108
705 3300025940 Ga0207691_10185111 Ga0207691_101851112 108
706 3300025940 Ga0207691_10196453 Ga0207691_101964532 108
707 3300025940 Ga0207691_10424365 Ga0207691_104243653 108
708 3300025940 Ga0207691_10923689 Ga0207691_109236891 108
709 3300025941 Ga0207711_10033637 Ga0207711_100336372 108
710 3300025941 Ga0207711_10040559 Ga0207711_100405593 108
711 3300025941 Ga0207711_10081075 Ga0207711_100810753 108
712 3300025941 Ga0207711_10431707 Ga0207711_104317073 108
713 3300025941 Ga0207711_10554146 Ga0207711_105541463 108
714 3300025942 Ga0207689_10013440 Ga0207689_100134405 108
715 3300025942 Ga0207689_10024935 Ga0207689_100249353 108
716 3300025945 Ga0207679_10467880 Ga0207679_104678802 108
717 3300025945 Ga0207679_10486146 Ga0207679_104861462 108
718 3300025945 Ga0207679_11545652 Ga0207679_115456522 108
719 3300025945 Ga0207679_11919821 Ga0207679_119198211 108
720 3300025960 Ga0207651_10015270 Ga0207651_100152705 108
721 3300025960 Ga0207651_10016846 Ga0207651_100168462 108
722 3300025960 Ga0207651_10028855 Ga0207651_100288553 108
723 3300025960 Ga0207651_10062806 Ga0207651_100628064 108
724 3300025960 Ga0207651_10125560 Ga0207651_101255603 108
725 3300025960 Ga0207651_10699355 Ga0207651_106993552 108
726 3300025960 Ga0207651_10734155 Ga0207651_107341551 108
727 3300025960 Ga0207651_10799990 Ga0207651_107999902 108
728 3300025960 Ga0207651_10991920 Ga0207651_109919202 108
729 3300025961 Ga0207712_10601774 Ga0207712_106017742 108
730 3300025961 Ga0207712_10727672 Ga0207712_107276722 108
731 3300025961 Ga0207712_11214133 Ga0207712_112141332 108
732 3300025972 Ga0207668_10021137 Ga0207668_100211372 108
733 3300025972 Ga0207668_10341957 Ga0207668_103419572 108
734 3300025972 Ga0207668_10962970 Ga0207668_109629702 108
735 3300025981 Ga0207640_10105092 Ga0207640_101050921 108
736 3300025986 Ga0207658_10007334 Ga0207658_100073342 108
737 3300025986 Ga0207658_10041765 Ga0207658_100417653 108
738 3300025986 Ga0207658_10091681 Ga0207658_100916812 108
739 3300025986 Ga0207658_10127968 Ga0207658_101279683 108
740 3300025986 Ga0207658_10715849 Ga0207658_107158492 108
741 3300025986 Ga0207658_10730551 Ga0207658_107305511 108
742 3300026023 Ga0207677_10015892 Ga0207677_100158924 108
743 3300026023 Ga0207677_10021624 Ga0207677_100216242 108
744 3300026023 Ga0207677_10072057 Ga0207677_100720573 108
745 3300026023 Ga0207677_10157790 Ga0207677_101577902 108
746 3300026023 Ga0207677_10189242 Ga0207677_101892423 108
747 3300026023 Ga0207677_10515405 Ga0207677_105154051 108
748 3300026023 Ga0207677_11042481 Ga0207677_110424812 108
749 3300026023 Ga0207677_11840639 Ga0207677_118406392 108
750 3300026035 Ga0207703_10087205 Ga0207703_100872053 108
751 3300026035 Ga0207703_10105129 Ga0207703_101051291 108
752 3300026035 Ga0207703_11008853 Ga0207703_110088531 108
753 3300026035 Ga0207703_11822644 Ga0207703_118226441 108
754 3300026041 Ga0207639_10878009 Ga0207639_108780092 108
755 3300026041 Ga0207639_11654294 Ga0207639_116542942 108
756 3300026067 Ga0207678_10005281 Ga0207678_100052812 108
757 3300026067 Ga0207678_10183557 Ga0207678_101835571 108
758 3300026067 Ga0207678_10205257 Ga0207678_102052572 108
759 3300026067 Ga0207678_10207929 Ga0207678_102079292 108
760 3300026067 Ga0207678_10482559 Ga0207678_104825592 108
761 3300026067 Ga0207678_10499662 Ga0207678_104996621 108
762 3300026075 Ga0207708_10121206 Ga0207708_101212061 108
763 3300026075 Ga0207708_10779827 Ga0207708_107798272 108
764 3300026088 Ga0207641_10003042 Ga0207641_1000304210 108
765 3300026088 Ga0207641_10010456 Ga0207641_100104563 108
766 3300026088 Ga0207641_10016486 Ga0207641_100164863 108
767 3300026088 Ga0207641_10094164 Ga0207641_100941642 108
768 3300026088 Ga0207641_10157115 Ga0207641_101571153 108
769 3300026088 Ga0207641_10223313 Ga0207641_102233132 108
770 3300026088 Ga0207641_10658583 Ga0207641_106585832 108
771 3300026089 Ga0207648_10000254 Ga0207648_1000025451 108
772 3300026089 Ga0207648_10012495 Ga0207648_100124955 108
773 3300026089 Ga0207648_10024822 Ga0207648_100248227 108
774 3300026089 Ga0207648_10026116 Ga0207648_100261165 108
775 3300026089 Ga0207648_10027411 Ga0207648_100274112 108
776 3300026089 Ga0207648_10047044 Ga0207648_100470443 108
777 3300026089 Ga0207648_10079214 Ga0207648_100792142 108
778 3300026089 Ga0207648_10178201 Ga0207648_101782013 108
779 3300026089 Ga0207648_10279993 Ga0207648_102799933 108
780 3300026089 Ga0207648_10408765 Ga0207648_104087651 108
781 3300026089 Ga0207648_10521432 Ga0207648_105214322 108
782 3300026089 Ga0207648_10616807 Ga0207648_106168072 108
783 3300026089 Ga0207648_10648523 Ga0207648_106485232 108
784 3300026089 Ga0207648_10938210 Ga0207648_109382101 108
785 3300026089 Ga0207648_11363671 Ga0207648_113636711 108
786 3300026095 Ga0207676_10028858 Ga0207676_100288582 108
787 3300026095 Ga0207676_10038596 Ga0207676_100385962 108
788 3300026095 Ga0207676_10084895 Ga0207676_100848951 108
789 3300026095 Ga0207676_10242910 Ga0207676_102429103 108
790 3300026095 Ga0207676_10722831 Ga0207676_107228312 108
791 3300026116 Ga0207674_10802411 Ga0207674_108024112 108
792 3300026116 Ga0207674_11158821 Ga0207674_111588212 108
793 3300026118 Ga0207675_100012087 Ga0207675_1000120877 108
794 3300026118 Ga0207675_100055408 Ga0207675_1000554083 108
795 3300026118 Ga0207675_100270136 Ga0207675_1002701362 108
796 3300026118 Ga0207675_100685789 Ga0207675_1006857892 108
797 3300026121 Ga0207683_10002658 Ga0207683_100026583 108
798 3300026121 Ga0207683_10024382 Ga0207683_100243823 108
799 3300026121 Ga0207683_10106353 Ga0207683_101063532 108
800 3300026121 Ga0207683_10197116 Ga0207683_101971162 108
801 3300026121 Ga0207683_10494706 Ga0207683_104947062 108
802 3300026121 Ga0207683_10694932 Ga0207683_106949322 108
803 3300026121 Ga0207683_10980081 Ga0207683_109800812 108
804 3300026121 Ga0207683_11065038 Ga0207683_110650382 108
805 3300026142 Ga0207698_10004407 Ga0207698_1000440710 108
806 3300026142 Ga0207698_10011597 Ga0207698_100115973 108
807 3300026142 Ga0207698_10385757 Ga0207698_103857572 108
808 3300026142 Ga0207698_10632760 Ga0207698_106327602 108
809 3300026142 Ga0207698_10951748 Ga0207698_109517481 108
810 3300026142 Ga0207698_11199941 Ga0207698_111999412 108
811 3300026142 Ga0207698_12325852 Ga0207698_123258521 108
812 3300027876 Ga0209974_10108363 Ga0209974_101083632 108
813 3300027907 Ga0207428_10208745 Ga0207428_102087453 108
814 3300028379 Ga0268266_10021143 Ga0268266_100211433 108
815 3300028379 Ga0268266_10310709 Ga0268266_103107092 108
816 3300028379 Ga0268266_10336655 Ga0268266_103366553 108
817 3300028379 Ga0268266_10772781 Ga0268266_107727812 108
818 3300028379 Ga0268266_12152924 Ga0268266_121529242 108
819 3300028379 Ga0268266_12366112 Ga0268266_123661121 108
820 3300028380 Ga0268265_10009051 Ga0268265_100090512 108
821 3300028380 Ga0268265_10069137 Ga0268265_100691372 108
822 3300028380 Ga0268265_10254183 Ga0268265_102541832 108
823 3300028381 Ga0268264_10081809 Ga0268264_100818092 108
824 3300028381 Ga0268264_10117511 Ga0268264_101175112 108
825 3300028381 Ga0268264_10166217 Ga0268264_101662172 108
826 3300028381 Ga0268264_10240598 Ga0268264_102405982 108
827 3300028381 Ga0268264_11175629 Ga0268264_111756291 108
828 3300028786 Ga0307517_10004486 Ga0307517_1000448618 108
829 3300028786 Ga0307517_10143293 Ga0307517_101432932 108
830 3300028786 Ga0307517_10345304 Ga0307517_103453042 108
831 3300028794 Ga0307515_10011753 Ga0307515_1001175313 108
832 3300028794 Ga0307515_10093089 Ga0307515_100930893 108
833 3300030522 Ga0307512_10049162 Ga0307512_100491624 108
834 3300030522 Ga0307512_10432363 Ga0307512_104323631 108
835 3300031456 Ga0307513_10218243 Ga0307513_102182432 108
836 3300031456 Ga0307513_10269145 Ga0307513_102691453 108
837 3300031456 Ga0307513_10321275 Ga0307513_103212753 108
838 3300031507 Ga0307509_10000405 Ga0307509_1000040562 108
839 3300031507 Ga0307509_10012044 Ga0307509_100120449 108
840 3300031507 Ga0307509_10015076 Ga0307509_100150765 108
841 3300031507 Ga0307509_10169723 Ga0307509_101697232 108
842 3300031507 Ga0307509_10193952 Ga0307509_101939523 108
843 3300031507 Ga0307509_10196996 Ga0307509_101969963 108
844 3300031507 Ga0307509_10234529 Ga0307509_102345292 108
845 3300031507 Ga0307509_10304116 Ga0307509_103041162 108
846 3300031548 Ga0307408_101491191 Ga0307408_1014911912 108
847 3300031616 Ga0307508_10004752 Ga0307508_100047529 108
848 3300031616 Ga0307508_10232954 Ga0307508_102329543 108
849 3300031616 Ga0307508_10283804 Ga0307508_102838042 108
850 3300031616 Ga0307508_10660378 Ga0307508_106603782 108
851 3300031649 Ga0307514_10561509 Ga0307514_105615092 108
852 3300031730 Ga0307516_10001028 Ga0307516_1000102818 108
853 3300031730 Ga0307516_10001642 Ga0307516_1000164224 108
854 3300031730 Ga0307516_10286548 Ga0307516_102865483 108
855 3300031730 Ga0307516_10403535 Ga0307516_104035352 108
856 3300031730 Ga0307516_10450040 Ga0307516_104500402 108
857 3300031730 Ga0307516_10544084 Ga0307516_105440842 108
858 3300031731 Ga0307405_10223750 Ga0307405_102237502 108
859 3300031731 Ga0307405_10836870 Ga0307405_108368701 108
860 3300031824 Ga0307413_10030664 Ga0307413_100306644 108
861 3300031824 Ga0307413_10080463 Ga0307413_100804632 108
862 3300031824 Ga0307413_10728086 Ga0307413_107280862 108
863 3300031852 Ga0307410_10029244 Ga0307410_100292443 108
864 3300031852 Ga0307410_10199727 Ga0307410_101997271 108
865 3300031852 Ga0307410_10602599 Ga0307410_106025992 108
866 3300031901 Ga0307406_10041914 Ga0307406_100419142 108
867 3300031901 Ga0307406_10101387 Ga0307406_101013872 108
868 3300031901 Ga0307406_10983346 Ga0307406_109833462 108
869 3300031903 Ga0307407_10057120 Ga0307407_100571202 108
870 3300031911 Ga0307412_10212572 Ga0307412_102125723 108
871 3300031911 Ga0307412_10353583 Ga0307412_103535832 108
872 3300031911 Ga0307412_10470367 Ga0307412_104703672 108
873 3300031995 Ga0307409_100067396 Ga0307409_1000673963 108
874 3300031995 Ga0307409_100604516 Ga0307409_1006045162 108
875 3300031995 Ga0307409_101037350 Ga0307409_1010373502 108
876 3300032002 Ga0307416_100039492 Ga0307416_1000394922 108
877 3300032002 Ga0307416_100134299 Ga0307416_1001342992 108
878 3300032002 Ga0307416_100238961 Ga0307416_1002389612 108
879 3300032002 Ga0307416_101459125 Ga0307416_1014591251 108
880 3300032004 Ga0307414_10159719 Ga0307414_101597193 108
881 3300032004 Ga0307414_10160768 Ga0307414_101607681 108
882 3300032005 Ga0307411_10001013 Ga0307411_100010132 108
883 3300032005 Ga0307411_10295538 Ga0307411_102955382 108
884 3300032005 Ga0307411_10461735 Ga0307411_104617352 108
885 3300032005 Ga0307411_10561000 Ga0307411_105610002 108
886 3300032005 Ga0307411_11453152 Ga0307411_114531521 108
887 3300033179 Ga0307507_10125384 Ga0307507_101253842 108
888 3300033179 Ga0307507_10425208 Ga0307507_104252082 108
889 3300033180 Ga0307510_10003419 Ga0307510_100034195 108
890 3300033180 Ga0307510_10016969 Ga0307510_100169694 108
891 3300033180 Ga0307510_10027695 Ga0307510_100276952 108
892 3300033180 Ga0307510_10144662 Ga0307510_101446623 108
893 3300033180 Ga0307510_10346113 Ga0307510_103461132 108
894 3300035084 Ga0373928_0033341 Ga0373928_0033341_157_486 108
895 3300035090 Ga0373949_0076740 Ga0373949_0076740_481_807 108
896 3300035171 Ga0373946_0188725 Ga0373946_0188725_604_939 108
897 3300035242 Ga0373962_0281805 Ga0373962_0281805_182_508 108
898 3300035691 Ga0373931_0007514 Ga0373931_0007514_129_455 108
899 3300035725 Ga0373947_0691068 Ga0373947_0691068_53_388 108
900 3300036401 Ga0373937_0181250 Ga0373937_0181250_276_602 108
901 3300037068 Ga0373925_0260936 Ga0373925_0260936_563_889 108
902 3300037068 Ga0373925_0306696 Ga0373925_0306696_218_553 108
903 3300037471 Ga0395905_0018518 Ga0395905_0018518_74_406 108
904 3300037471 Ga0395905_0115051 Ga0395905_0115051_2165_2491 108
905 3300037471 Ga0395905_0211446 Ga0395905_0211446_1291_1617 108
906 3300039447 Ga0436361_0098091 Ga0436361_0098091_637_963 108
907 3300039447 Ga0436361_0813098 Ga0436361_0813098_13137_13463 108
908 3300039450 Ga0436363_0192400 Ga0436363_0192400_213_539 108
909 3300041441 Ga0451787_398756 Ga0451787_398756_22_348 108
910 3300041443 Ga0451789_0762797 Ga0451789_0762797_177_509 108
911 3300041452 Ga0451793_0718359 Ga0451793_0718359_102_428 108
912 3300041453 Ga0451797_1495146 Ga0451797_1495146_10_342 108
913 3300041459 Ga0451800_0517538 Ga0451800_0517538_50_376 108
914 3300041459 Ga0451800_0691594 Ga0451800_0691594_282_608 108
915 3300041460 Ga0451802_0547687 Ga0451802_0547687_103_429 108
916 3300041486 Ga0451807_0151166 Ga0451807_0151166_229_561 108
917 3300041486 Ga0451807_2629084 Ga0451807_2629084_242_568 108
918 3300041491 Ga0451833_0828330 Ga0451833_0828330_336_662 108
919 3300041491 Ga0451833_1322048 Ga0451833_1322048_117_449 108
920 3300041492 Ga0451835_0876415 Ga0451835_0876415_78_410 108
921 3300041507 Ga0451851_0809976 Ga0451851_0809976_89_415 108
922 3300041512 Ga0451853_0687148 Ga0451853_0687148_460_786 108
923 3300041512 Ga0451853_2072669 Ga0451853_2072669_191_523 108
924 3300041512 Ga0451853_3655248 Ga0451853_3655248_100_426 108
925 3300042001 Ga0439441_049695 Ga0439441_049695_385_717 108
926 3300042005 Ga0439448_0180170 Ga0439448_0180170_248_574 108
927 3300042012 Ga0439455_0021077 Ga0439455_0021077_723_1055 108
928 3300042012 Ga0439455_0157156 Ga0439455_0157156_245_571 108
929 3300042156 Ga0439446_0092475 Ga0439446_0092475_397_741 108
930 3300042439 Ga0439464_0002359 Ga0439464_0002359_56_388 108
931 3300042461 Ga0439460_0379642 Ga0439460_0379642_89_421 108
932 3300042876 Ga0451577_0004943 Ga0451577_0004943_1330_1659 108
933 3300042876 Ga0451577_0063786 Ga0451577_0063786_2405_2731 108
934 3300044656 Ga0466969_0000860 Ga0466969_0000860_8251_8577 108
935 3300044673 Ga0453683_0744322 Ga0453683_0744322_271_597 108
936 3300044683 Ga0466965_0199774 Ga0466965_0199774_494_820 108
937 3300044684 Ga0466966_0311232 Ga0466966_0311232_198_524 108
938 3300044693 Ga0466961_0010705 Ga0466961_0010705_4973_5299 108
939 3300044712 Ga0453684_0029228 Ga0453684_0029228_470_796 108
940 3300044712 Ga0453684_0144657 Ga0453684_0144657_1588_1917 108
941 3300044765 Ga0466970_0170156 Ga0466970_0170156_166_492 108
942 3300045049 Ga0466959_0267976 Ga0466959_0267976_223_549 108
943 3300046454 Ga0495592_0000528 Ga0495592_0000528_14953_15279 108
944 3300046454 Ga0495592_0246343 Ga0495592_0246343_24_353 108
945 3300046459 Ga0495629_0211042 Ga0495629_0211042_227_553 108
946 3300046472 Ga0495580_0107207 Ga0495580_0107207_192_527 108
947 3300046499 Ga0495594_0575797 Ga0495594_0575797_26_358 108
948 3300046507 Ga0495606_0164460 Ga0495606_0164460_941_1267 108
949 3300046511 Ga0495608_0724432 Ga0495608_0724432_35_361 108
950 3300046515 Ga0495620_0232947 Ga0495620_0232947_259_591 108
951 3300046515 Ga0495620_0281191 Ga0495620_0281191_256_582 108
952 3300046517 Ga0495630_0122940 Ga0495630_0122940_1350_1676 108
953 3300046519 Ga0495632_0192975 Ga0495632_0192975_46_372 108
954 3300046519 Ga0495632_0334097 Ga0495632_0334097_240_566 108
955 3300046526 Ga0495666_0151471 Ga0495666_0151471_209_535 108
956 3300046528 Ga0495642_0322436 Ga0495642_0322436_153_479 108
957 3300046537 Ga0495598_0062228 Ga0495598_0062228_733_1068 108
958 3300046539 Ga0495621_0122910 Ga0495621_0122910_494_826 108
959 3300046539 Ga0495621_0526240 Ga0495621_0526240_71_403 108
960 3300046557 Ga0495622_0073490 Ga0495622_0073490_104_430 108
961 3300046558 Ga0495633_0205740 Ga0495633_0205740_102_434 108
962 3300046558 Ga0495633_0366106 Ga0495633_0366106_209_535 108
963 3300046615 Ga0495656_0199628 Ga0495656_0199628_536_868 108
964 3300046615 Ga0495656_0721720 Ga0495656_0721720_134_469 108
965 3300046616 Ga0495668_0035434 Ga0495668_0035434_1360_1686 108
966 3300046616 Ga0495668_0560540 Ga0495668_0560540_21_347 108
967 3300046660 Ga0495625_0870058 Ga0495625_0870058_38_364 108
968 3300046680 Ga0495646_0339154 Ga0495646_0339154_203_529 108
969 3300046683 Ga0495658_0043155 Ga0495658_0043155_1373_1705 108
970 3300046683 Ga0495658_0245873 Ga0495658_0245873_253_579 108
971 3300046683 Ga0495658_0339260 Ga0495658_0339260_136_471 108
972 3300046683 Ga0495658_0429785 Ga0495658_0429785_124_450 108
973 3300046689 Ga0495613_0280342 Ga0495613_0280342_427_759 108
974 3300046691 Ga0495670_0221475 Ga0495670_0221475_574_906 108
975 3300046692 Ga0495671_0099900 Ga0495671_0099900_237_563 108
976 3300047318 Ga0495636_0143061 Ga0495636_0143061_355_690 108
977 3300047321 Ga0495676_0019792 Ga0495676_0019792_4287_4613 108
978 3300047472 Ga0495686_0138968 Ga0495686_0138968_466_792 108
979 3300047472 Ga0495686_0600943 Ga0495686_0600943_34_360 108
980 3300047673 Ga0495593_0088879 Ga0495593_0088879_870_1196 108
981 3300048903 Ga0496100_1027182 Ga0496100_1027182_97_423 108
982 3300048905 Ga0496102_0018789 Ga0496102_0018789_3129_3455 108
983 3300048907 Ga0496104_0043886 Ga0496104_0043886_1607_1942 108
984 3300048908 Ga0496105_0061054 Ga0496105_0061054_1619_1954 108
985 3300048909 Ga0496106_0007832 Ga0496106_0007832_5313_5639 108
986 3300048909 Ga0496106_0385977 Ga0496106_0385977_753_1079 108
987 3300048910 Ga0496107_0482624 Ga0496107_0482624_313_645 108
988 3300048911 Ga0496108_0144096 Ga0496108_0144096_1085_1420 108
989 3300048911 Ga0496108_0789342 Ga0496108_0789342_170_523 108
990 3300048912 Ga0496109_0874340 Ga0496109_0874340_479_811 108
991 3300048913 Ga0496110_0280909 Ga0496110_0280909_500_835 108
992 3300048917 Ga0496114_0062845 Ga0496114_0062845_1655_1990 108
993 3300048917 Ga0496114_0436284 Ga0496114_0436284_158_514 108
994 3300048928 Ga0496125_0687232 Ga0496125_0687232_18_398 108
995 3300049571 Ga0501034_0461977 Ga0501034_0461977_450_776 108
996 3300049573 Ga0501037_0225616 Ga0501037_0225616_465_803 108
997 3300049575 Ga0501039_0785637 Ga0501039_0785637_260_586 108
998 3300049579 Ga0501043_0000277 Ga0501043_0000277_31597_31926 108
999 3300049580 Ga0501046_0000345 Ga0501046_0000345_14805_15134 108
1000 3300049581 Ga0501047_0000395 Ga0501047_0000395_31597_31926 108
1001 3300049582 Ga0501048_0000111 Ga0501048_0000111_31547_31876 108
1002 3300049649 Ga0501198_000023 Ga0501198_000023_59744_60073 108
1003 3300049653 Ga0501206_009613 Ga0501206_009613_861_1190 108
1004 3300049662 Ga0501222_000031 Ga0501222_000031_9044_9373 108
1005 3300049662 Ga0501222_014492 Ga0501222_014492_81_407 108
1006 3300049759 Ga0501262_011227 Ga0501262_011227_663_992 108
1007 3300049760 Ga0501263_064676 Ga0501263_064676_209_541 108
1008 3300049762 Ga0501265_000558 Ga0501265_000558_1098_1427 108
1009 3300049779 Ga0501283_021568 Ga0501283_021568_113_442 108
1010 3300049823 Ga0501044_0423434 Ga0501044_0423434_737_1066 108
1011 3300050489 nmdc:mga03683_127196_c1 nmdc:mga03683_127196_c1_389_715 108
1012 3300050489 nmdc:mga03683_13639_c1 nmdc:mga03683_13639_c1_1765_2091 108
1013 3300050489 nmdc:mga03683_452130_c1 nmdc:mga03683_452130_c1_25_351 108
1014 3300050489 nmdc:mga03683_48065_c1 nmdc:mga03683_48065_c1_951_1304 108
1015 3300050490 nmdc:mga03n38_184761_c1 nmdc:mga03n38_184761_c1_146_472 108
1016 3300050491 nmdc:mga00v17_263901_c1 nmdc:mga00v17_263901_c1_522_872 108
1017 3300050493 nmdc:mga0k408_214788_c1 nmdc:mga0k408_214788_c1_273_599 108
1018 3300050493 nmdc:mga0k408_31847_c1 nmdc:mga0k408_31847_c1_210_563 108
1019 3300050493 nmdc:mga0k408_339950_c1 nmdc:mga0k408_339950_c1_448_777 108
1020 3300050493 nmdc:mga0k408_37631_c1 nmdc:mga0k408_37631_c1_65_391 108
1021 3300050493 nmdc:mga0k408_75494_c1 nmdc:mga0k408_75494_c1_1553_1879 108
1022 3300050494 nmdc:mga06z11_452992_c1 nmdc:mga06z11_452992_c1_261_614 108
1023 3300050496 nmdc:mga07m45_13934_c1 nmdc:mga07m45_13934_c1_2651_3004 108
1024 3300050496 nmdc:mga07m45_34263_c1 nmdc:mga07m45_34263_c1_2292_2618 108
1025 3300050496 nmdc:mga07m45_580003_c1 nmdc:mga07m45_580003_c1_54_380 108
1026 3300050496 nmdc:mga07m45_921045_c1 nmdc:mga07m45_921045_c1_40_366 108
1027 3300050507 nmdc:mga05p37_66948_c1 nmdc:mga05p37_66948_c1_1447_1773 108
1028 3300050508 nmdc:mga09592_9369_c1 nmdc:mga09592_9369_c1_3716_4045 108
1029 3300050509 nmdc:mga0qj67_41652_c1 nmdc:mga0qj67_41652_c1_261_590 108
1030 3300050516 nmdc:mga0sz30_543115_c1 nmdc:mga0sz30_543115_c1_146_472 108
1031 3300053078 Ga0495612_0198813 Ga0495612_0198813_104_436 108
1032 3300053086 Ga0500578_0037855 Ga0500578_0037855_206_532 108
1033 3300053090 Ga0500646_0038237 Ga0500646_0038237_971_1297 108
1034 3300053092 Ga0500583_0503473 Ga0500583_0503473_59_385 108
1035 3300053093 Ga0500651_0045454 Ga0500651_0045454_2379_2705 108
1036 3300053093 Ga0500651_0170159 Ga0500651_0170159_32_358 108
1037 3300053098 Ga0500650_0139340 Ga0500650_0139340_171_497 108
1038 3300053121 Ga0500607_046582 Ga0500607_046582_79_405 108
1039 3300053131 Ga0500652_006725 Ga0500652_006725_27_353 108
1040 3300053133 Ga0500655_017681 Ga0500655_017681_970_1296 108
1041 3300053136 Ga0500559_0000265 Ga0500559_0000265_24840_25166 108
1042 3300053136 Ga0500559_0564832 Ga0500559_0564832_36_362 108
1043 3300053137 Ga0500561_0181695 Ga0500561_0181695_86_412 108
1044 3300053138 Ga0500564_133917 Ga0500564_133917_75_401 108
1045 3300053139 Ga0500568_0045866 Ga0500568_0045866_747_1073 108
1046 3300053148 Ga0500590_232170 Ga0500590_232170_21_350 108
1047 3300053154 Ga0500619_000116 Ga0500619_000116_18276_18602 108
1048 3300053155 Ga0500620_258650 Ga0500620_258650_162_488 108
1049 3300053156 Ga0500622_0002039 Ga0500622_0002039_5891_6217 108
1050 3300053158 Ga0500627_0380069 Ga0500627_0380069_86_412 108
1051 3300053177 Ga0500636_0053627 Ga0500636_0053627_589_915 108
1052 3300053722 Ga0500649_123212 Ga0500649_123212_465_791 108
1053 3300053730 Ga0500645_003124 Ga0500645_003124_4120_4446 108
1054 3300053739 Ga0500587_030467 Ga0500587_030467_58_384 108
1055 3300059421 Ga0590071_002620 Ga0590071_002620_3445_3780 108
1056 iso_pu_bacteria 2738543013 2739247323 108

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.9154 6 104
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.9076 6 104
5abr-assembly1.cif.gz_B structure of fesi protein from azotobacter vinelandii 0.8897 6 106
1f37-assembly1.cif.gz_B structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.8746 6 103
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.8742 6 108
ID Description Score Start End Superfamily
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8897 6 106 3.40.30.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.858 6 106 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8507 6 104 3.40.30.10
af_Q55BP2_216_308_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8357 6 103 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8274 6 104 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A258LFT3-F1-model_v4 2Fe-2S ferredoxin 0.9821 1 54
AF-W7WE07-F1-model_v4 2FeCpFd 0.976 1 108
AF-B1XYQ0-F1-model_v4 Ferredoxin-like protein 0.9759 1 108
AF-A0A2D0AM71-F1-model_v4 2Fe-2S ferredoxin 0.9748 1 108
AF-A0A1Q3R477-F1-model_v4 2Fe-2S ferredoxin 0.974 1 108

Feature Viewer

pLDDT pTM Quality
91.35 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map