metagRoot

F489189

General Info

Members	Datasets	Scaffolds	Average Seq Length
1056	599	2112	342

Family's Representative Sequence

Representative Sequence	3300031995\|Ga0307409_100006258\|Ga0307409_1000062582
Length	414
Sequence	METPTFNGFEGPVWWAGGVPCSGVVMLNILTFEPEAQDFCSADPAAGCVCSWRPRITFCGVPAVTYVQRRPRLEAMKVLVTGGAGYIGSHTTLCLLEAGHEVVVLDNLMNSNPESLRRVEKLSGKKVDFRKVDLLDAASVDRLFEEGTFDAVIHFAGLKAVGESVAKPLWYYQNNVVGTLNLLHSMERAGVRRLVFSSSATVYGASEEVPLIEKAPLDATNPYGRTKEQIEDILSDLGAADPSWSIALLRYFNPVGAHESGLIGEDPVGVPNNLLPFVAQVAVGRREKVMVFGDDYPTADGTGVRDYIHVMDLAAGHLAALGYLQDKAGVYRWNLGTGRGSSVLEVIEAFSKAAGAPVPYEIAPRRPGDAAVSYSDPSAALADLGWSARRDLATMCEDHWRWQSRNPSGYEESV

Samples

	Sample ID	Description	Type	Environment
1	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
2	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
3	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
4	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
5	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
6	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
7	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
8	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
9	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
10	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
11	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
12	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
13	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
14	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
15	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
16	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
17	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
18	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
19	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
20	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
21	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
22	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
23	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
24	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
25	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
26	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
27	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
28	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
29	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
30	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
31	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
32	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
33	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
34	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
35	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
36	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
37	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
38	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
39	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
40	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
41	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
42	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
43	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
44	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
45	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
46	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
47	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
48	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
49	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
50	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
51	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
52	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
53	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
54	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
55	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
56	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
57	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
58	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
59	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
60	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
61	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
62	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
63	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
64	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
65	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
66	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
67	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
68	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
69	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
70	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
71	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
72	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
73	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
74	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
75	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
76	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
77	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
78	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
79	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
80	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
81	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
82	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
83	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
84	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
85	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
86	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
87	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
88	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
89	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
90	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
91	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
92	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
94	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
95	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
96	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
97	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
98	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
99	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
100	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
101	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
102	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
103	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
104	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
105	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
106	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
107	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
108	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
109	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
110	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
111	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
112	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
113	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
114	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
115	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
116	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
117	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
118	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
119	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
120	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
121	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
122	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
123	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
124	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
125	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
126	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
127	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
128	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
129	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
130	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
131	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
132	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
133	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
134	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
135	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
136	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
137	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
138	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
139	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
151	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
152	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
154	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
156	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
158	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
159	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
160	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
161	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
162	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
163	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
165	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
212	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
213	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
214	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
215	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
216	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
220	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
221	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
222	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
223	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
224	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
225	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
226	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
227	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
228	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
229	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
230	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
231	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
232	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
233	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
234	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
235	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
236	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
237	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
238	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
239	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
240	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
241	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
242	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
243	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
244	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
245	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
246	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
247	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
248	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
249	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
250	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
251	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
252	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
253	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
254	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
255	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
256	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
257	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
258	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
259	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
260	3300044659	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E	Metagenome	Unclassified
261	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
262	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
263	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
264	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
265	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
266	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
267	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
268	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
269	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
270	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
271	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
272	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
273	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
274	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
275	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
276	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
277	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
278	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
279	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
280	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
281	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
282	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
283	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
284	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
285	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
286	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
287	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
288	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
289	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
290	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
291	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
292	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
293	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
294	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
295	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
296	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
297	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
298	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
299	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
300	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
301	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
302	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
303	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
304	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
305	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
306	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
307	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
308	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
309	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
310	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
311	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
312	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
313	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
314	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
315	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
316	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
317	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
318	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
319	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
320	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
321	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
322	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
323	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
324	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
325	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
326	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
327	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
328	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
329	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
330	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
331	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
332	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
333	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
334	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
335	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
336	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
337	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
338	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
339	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
340	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
341	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
342	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
343	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
344	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
345	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
346	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
347	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
348	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
349	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
350	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
351	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
352	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
353	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
354	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
355	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
356	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
357	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
358	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
359	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
360	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
361	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
362	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
363	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
364	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
365	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
366	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
367	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
368	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
369	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
370	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
371	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
372	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
373	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
374	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
375	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
376	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
377	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
378	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
379	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
380	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
381	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
382	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
383	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
384	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
385	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
386	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
387	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
388	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
389	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
390	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
391	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
392	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
393	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
394	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
395	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
396	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
397	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
398	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
399	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
400	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
401	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
402	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
403	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
404	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
405	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
406	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
407	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
408	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
409	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
410	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
411	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
412	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
413	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
414	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
415	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
416	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
417	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
418	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
419	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
420	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
421	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
422	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
423	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
424	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
425	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
426	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
427	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
428	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
429	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
430	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
431	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
432	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
433	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
434	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
435	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
436	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
437	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
438	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
439	3300059660	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
440	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
441	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
442	2501025501	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
443	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
444	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
445	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
446	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
447	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
448	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
449	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
450	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
451	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
452	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
453	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
454	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
455	2513237082	Paraburkholderia mimosarum STM3621	Isolate	Nodule
456	2513237083	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
457	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
458	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
459	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
460	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
461	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
462	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
463	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
464	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
465	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
466	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
467	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
468	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
469	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
470	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
471	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
472	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
473	2534681786	Brucella suis 92/29	Isolate	Unclassified
474	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
475	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
476	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
477	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
478	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
479	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
480	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
481	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
482	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
483	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
484	2643221542	Microbacterium sp. Root1433D1	Isolate	Unclassified
485	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
486	2643221630	Microbacterium sp. Root322	Isolate	Unclassified
487	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
488	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
489	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
490	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
491	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
492	2721755763	Pandoraea thiooxydans ATSB16	Isolate	Rhizosphere
493	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
494	2738541277	Variovorax sp. GV051	Isolate	Unclassified
495	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
496	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
497	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
498	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
499	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
500	2738543019	Variovorax sp. GV040	Isolate	Unclassified
501	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
502	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
503	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
504	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
505	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
506	2775507177	Bacillus sp. AFS055030	Isolate	Unclassified
507	2791355199
508	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
509	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
510	2808606371	Arthrobacter sp. SLBN-53	Isolate	Unclassified
511	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
512	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
513	2818991450	Burkholderia sp. 604	Isolate	Unclassified
514	2821131069	Duganella sp. 1224	Isolate	Unclassified
515	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
516	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
517	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
518	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
519	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
520	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
521	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
522	2854911287	Brucella lupini LUP21	Isolate	Unclassified
523	2857357740	Paraburkholderia tropica BE15	Isolate	Rhizosphere
524	2857564685	Duganella sp. R-74599	Isolate	Unclassified
525	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
526	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
527	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
528	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
529	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
530	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
531	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
532	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
533	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
534	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
535	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
536	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
537	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
538	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
539	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
540	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
541	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
542	2904456579	Variovorax sp. 2002	Isolate	Unclassified
543	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
544	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
545	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
546	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
547	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
548	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
549	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
550	2904699407
551	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
552	2906610324
553	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
554	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
555	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
556	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
557	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
558	2919391150	Arthrobacter ipis 2973	Isolate	Unclassified
559	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
560	2919493220	Aeromonas salmonicida salmonicida 3466	Isolate	Unclassified
561	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
562	2919543075	Aeromonas salmonicida masoucida 4076	Isolate	Unclassified
563	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
564	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
565	2923525760	Aeromonas caviae SLBN-129	Isolate	Rhizosphere
566	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
567	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
568	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
569	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
570	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
571	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
572	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
573	2939577877	Serratia sp. 509	Isolate	Rhizosphere
574	2945916053	Arthrobacter ulcerisalmonis W1I2	Isolate	Rhizosphere
575	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
576	2945956166	Arthrobacter globiformus W2I3	Isolate	Rhizosphere
577	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
578	2946037020	Arthrobacter sp. W4I7	Isolate	Rhizosphere
579	2953998280	Pseudarthrobacter sp. W1I19	Isolate	Rhizosphere
580	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
581	3001267043	Bacillus sp. FJAT-49870	Isolate	Rhizosphere
582	3001272096	Lederbergia citrisecunda FJAT-49732	Isolate	Rhizosphere
583	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
584	3006984091	Lederbergia citrea FJAT-49754	Isolate	Rhizosphere
585	3006988479	Bacillus sp. FJAT-49711	Isolate	Rhizosphere
586	640753048	Serratia proteamaculans 568	Isolate	Endosphere
587	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
588	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
589	8003955200	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
590	8004021418	Arthrobacter sp. SDTb3-6	Isolate	Rhizosphere
591	8004025490	Arthrobacter wenxiniae AETb3-4	Isolate	Rhizosphere
592	8004592986	Serratia sp. S119	Isolate	Unclassified
593	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
594	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
595	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
596	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
597	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
598	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule
599	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	84.05
Metatranscriptomes	0.76
Isolates	15.19

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.87
Nodule	4.92
Rhizoplane	4.26
Rhizosphere	62.97
Stem	0
Stem Tuber	0
Unclassified	0.28

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0307409_100006258	3300031995	Bacteria	6974
2	LJQas_1008444	3300000549	Bacteria	1252
3	JGI24740J21852_10002056	3300001979	Bacteria	9201
4	JGI24739J22299_10003515	3300001989	Bacteria	5981
5	JGI24739J22299_10021682	3300001989	Bacteria	2285
6	JGI24735J21928_10003656	3300002067	Bacteria	5213
7	JGI24735J21928_10010195	3300002067	Bacteria	3002
8	JGI24738J21930_10010003	3300002075	Bacteria	2121
9	JGI25156J39149_1000178	3300002705	Bacteria	46629
10	JGI25156J39149_1000226	3300002705	Bacteria	38895
11	JGI25156J39149_1000337	3300002705	Bacteria	30825
12	JGI25156J39149_1007431	3300002705	Bacteria	2879
13	JGI25159J45721_1000145	3300002987	Bacteria	32623
14	JGI25151J46595_10001061	3300003187	Bacteria	20487
15	JGI25151J46595_10004161	3300003187	Bacteria	7724
16	JGI25165J46597_1001162	3300003214	Bacteria	16252
17	rootH2_10299511	3300003320	Bacteria	2719
18	rootH1_10007027	3300003323	Bacteria	4599
19	JGI25160J50197_1000327	3300003354	Bacteria	32616
20	JGI25161J50226_1000245	3300003374	Bacteria	32623
21	Ga0007409J51694_1005204	3300003575	Bacteria	9118
22	Ga0007416J51690_1004145	3300003577	Bacteria	9118
23	Ga0032354_1011833	3300003693	Bacteria	9107
24	Ga0055538_1000002	3300003751	Bacteria	999437
25	Ga0055539_1000002	3300003752	Bacteria	999437
26	Ga0055533_1000004	3300003756	Bacteria	999437
27	Ga0055533_1000124	3300003756	Bacteria	87900
28	Ga0055533_1000563	3300003756	Bacteria	13037
29	Ga0055532_1000001	3300003758	Bacteria	1119836
30	Ga0055525_1000002	3300003759	Bacteria	999437
31	Ga0055527_1000014	3300003760	Bacteria	289449
32	Ga0055535_1000001	3300003761	Bacteria	1119836
33	Ga0055542_1000001	3300003762	Bacteria	1119836
34	Ga0055529_1000001	3300003763	Bacteria	826680
35	Ga0055529_1000100	3300003763	Bacteria	131049
36	Ga0055526_1013866	3300003771	Bacteria	3368
37	Ga0055537_1000229	3300003773	Bacteria	41052
38	Ga0055536_1002843	3300003781	Bacteria	9535
39	Ga0055534_1000081	3300003784	Bacteria	75591
40	Ga0055528_1000107	3300003790	Bacteria	67056
41	Ga0055540_1000641	3300003792	Bacteria	24815
42	Ga0055531_10003438	3300003794	Bacteria	10102
43	Ga0055541_1000002	3300003841	Bacteria	896405
44	Ga0055543_1000325	3300004625	Bacteria	32876
45	Ga0055543_1002357	3300004625	Bacteria	6319
46	Ga0065165_1000120	3300005262	Bacteria	134211
47	Ga0065165_1001062	3300005262	Bacteria	32876
48	Ga0065165_1002142	3300005262	Bacteria	17905
49	Ga0065704_10081616	3300005289	Bacteria	3729
50	Ga0070658_10000023	3300005327	Bacteria	185522
51	Ga0070658_10002509	3300005327	Bacteria	15336
52	Ga0068869_100003661	3300005334	Bacteria	9444
53	Ga0070666_10034313	3300005335	Bacteria	3363
54	Ga0068868_100080764	3300005338	Bacteria	2606
55	Ga0070660_100067618	3300005339	Bacteria	2784
56	Ga0070687_100008147	3300005343	Bacteria	4419
57	Ga0070692_10048994	3300005345	Bacteria	2190
58	Ga0070669_100052901	3300005353	Bacteria	2971
59	Ga0070671_100122145	3300005355	Bacteria	2192
60	Ga0070674_100031273	3300005356	Bacteria	3526
61	Ga0070674_100116630	3300005356	Bacteria	1970
62	Ga0070674_100253909	3300005356	Bacteria	1382
63	Ga0070673_100000226	3300005364	Bacteria	28311
64	Ga0070659_100202824	3300005366	Bacteria	1633
65	Ga0070659_100247619	3300005366	Bacteria	1476
66	Ga0070667_100229459	3300005367	Bacteria	1655
67	Ga0070713_100000597	3300005436	Bacteria	22955
68	Ga0070710_10160650	3300005437	Bacteria	1393
69	Ga0070705_100014971	3300005440	Bacteria	4002
70	Ga0070700_100009577	3300005441	Bacteria	5322
71	Ga0070694_100053561	3300005444	Bacteria	2731
72	Ga0070663_100034260	3300005455	Bacteria	3516
73	Ga0070663_100083409	3300005455	Bacteria	2353
74	Ga0070678_100000633	3300005456	Bacteria	17225
75	Ga0070678_100070874	3300005456	Bacteria	2608
76	Ga0070681_10014815	3300005458	Bacteria	7755
77	Ga0070681_10034876	3300005458	Bacteria	5053
78	Ga0070681_10185792	3300005458	Bacteria	1999
79	Ga0068867_100004040	3300005459	Bacteria	10322
80	Ga0068867_100012498	3300005459	Bacteria	6009
81	Ga0070685_10045066	3300005466	Unclassified	2527
82	Ga0070679_100099164	3300005530	Bacteria	2900
83	Ga0070684_100035112	3300005535	Bacteria	4290
84	Ga0070697_100037403	3300005536	Bacteria	3921
85	Ga0068853_100044527	3300005539	Bacteria	3799
86	Ga0068853_100045570	3300005539	Bacteria	3757
87	Ga0068853_100228122	3300005539	Bacteria	1703
88	Ga0070672_100002363	3300005543	Bacteria	11939
89	Ga0070672_100097588	3300005543	Bacteria	2379
90	Ga0070686_100000404	3300005544	Bacteria	27098
91	Ga0070695_100007120	3300005545	Bacteria	6629
92	Ga0070696_100004953	3300005546	Bacteria	8891
93	Ga0070665_100001295	3300005548	Bacteria	29936
94	Ga0070665_100066937	3300005548	Bacteria	3603
95	Ga0070665_100137102	3300005548	Bacteria	2450
96	Ga0070665_100213471	3300005548	Bacteria	1931
97	Ga0070665_100260884	3300005548	Bacteria	1734
98	Ga0070665_100320649	3300005548	Bacteria	1554
99	Ga0068855_100014208	3300005563	Bacteria	9591
100	Ga0068855_100026819	3300005563	Bacteria	6893
101	Ga0068855_100074389	3300005563	Bacteria	3946
102	Ga0068855_100365544	3300005563	Bacteria	1587
103	Ga0068854_100006860	3300005578	Bacteria	7261
104	Ga0068854_100007052	3300005578	Bacteria	7171
105	Ga0068854_100048170	3300005578	Bacteria	3040
106	Ga0068854_100137278	3300005578	Bacteria	1873
107	Ga0068854_100244785	3300005578	Bacteria	1429
108	Ga0070702_100014379	3300005615	Bacteria	4015
109	Ga0068852_100046505	3300005616	Bacteria	3699
110	Ga0068859_100069877	3300005617	Bacteria	3547
111	Ga0068864_100022903	3300005618	Bacteria	5241
112	Ga0068866_10000265	3300005718	Bacteria	24733
113	Ga0068861_100000207	3300005719	Bacteria	31461
114	Ga0068851_10000255	3300005834	Bacteria	25249
115	Ga0068870_10025274	3300005840	Bacteria	2947
116	Ga0068858_100003094	3300005842	Bacteria	16643
117	Ga0068860_100024757	3300005843	Bacteria	5798
118	Ga0068862_100002710	3300005844	Bacteria	15551
119	Ga0081455_10018727	3300005937	Bacteria	6573
120	Ga0081540_1014084	3300005983	Bacteria	5151
121	Ga0081540_1014939	3300005983	Bacteria	4939
122	Ga0075365_10021610	3300006038	Bacteria	4017
123	Ga0075365_10176295	3300006038	Bacteria	1493
124	Ga0075363_100095788	3300006048	Bacteria	1638
125	Ga0075364_10000085	3300006051	Bacteria	37086
126	Ga0075364_10000342	3300006051	Bacteria	23182
127	Ga0075364_10031014	3300006051	Bacteria	3434
128	Ga0075364_10112207	3300006051	Bacteria	1820
129	Ga0075362_10002319	3300006177	Bacteria	6359
130	Ga0075362_10058467	3300006177	Bacteria	1739
131	Ga0075367_10005597	3300006178	Bacteria	6258
132	Ga0075367_10007757	3300006178	Bacteria	5520
133	Ga0075369_10006660	3300006186	Bacteria	4378
134	Ga0075369_10057272	3300006186	Bacteria	1695
135	Ga0075369_10094925	3300006186	Bacteria	1333
136	Ga0075369_10112983	3300006186	Bacteria	1225
137	Ga0075366_10000152	3300006195	Bacteria	29263
138	Ga0075366_10007229	3300006195	Bacteria	6118
139	Ga0075366_10011587	3300006195	Bacteria	4981
140	Ga0075366_10012147	3300006195	Bacteria	4879
141	Ga0075366_10020135	3300006195	Bacteria	3867
142	Ga0075366_10127546	3300006195	Bacteria	1535
143	Ga0075366_10128855	3300006195	Bacteria	1526
144	Ga0075366_10143559	3300006195	Bacteria	1444
145	Ga0097621_100010305	3300006237	Bacteria	6830
146	Ga0075370_10011056	3300006353	Bacteria	4733
147	Ga0075428_100012004	3300006844	Bacteria	9638
148	Ga0075430_100031742	3300006846	Bacteria	4483
149	Ga0068865_100019287	3300006881	Bacteria	4413
150	Ga0097620_100069877	3300006931	Bacteria	3547
151	Ga0099822_1024140	3300006943	Bacteria	5489
152	Ga0079104_1001448	3300006946	Bacteria	15868
153	Ga0079104_1001983	3300006946	Bacteria	12008
154	Ga0079104_1003315	3300006946	Bacteria	7632
155	Ga0079104_1008755	3300006946	Bacteria	3495
156	Ga0099826_10000087	3300006948	Bacteria	46364
157	Ga0099795_10000287	3300007788	Bacteria	9029
158	Ga0099795_10023436	3300007788	Bacteria	2049
159	Ga0105251_10000405	3300009011	Bacteria	42135
160	Ga0105251_10000869	3300009011	Bacteria	27105
161	Ga0105251_10001189	3300009011	Bacteria	22551
162	Ga0105251_10001416	3300009011	Bacteria	20666
163	Ga0105251_10006773	3300009011	Bacteria	7229
164	Ga0105251_10008305	3300009011	Bacteria	6269
165	Ga0105251_10042879	3300009011	Bacteria	2193
166	Ga0105251_10077891	3300009011	Bacteria	1536
167	Ga0105244_10000864	3300009036	Bacteria	25593
168	Ga0105244_10003298	3300009036	Bacteria	11622
169	Ga0105244_10030368	3300009036	Bacteria	2876
170	Ga0105250_10009703	3300009092	Bacteria	4045
171	Ga0105250_10075631	3300009092	Bacteria	1362
172	Ga0105240_10037364	3300009093	Bacteria	6242
173	Ga0105240_10043539	3300009093	Bacteria	5711
174	Ga0105240_10052645	3300009093	Bacteria	5115
175	Ga0105240_10112554	3300009093	Bacteria	3290
176	Ga0105240_10234108	3300009093	Bacteria	2133
177	Ga0105245_10000257	3300009098	Bacteria	50535
178	Ga0105245_10233232	3300009098	Bacteria	1781
179	Ga0105247_10000018	3300009101	Bacteria	259335
180	Ga0105247_10025401	3300009101	Bacteria	3573
181	Ga0105247_10141698	3300009101	Bacteria	1576
182	Ga0114129_10134216	3300009147	Bacteria	3397
183	Ga0105243_10002572	3300009148	Bacteria	15157
184	Ga0105243_10549837	3300009148	Bacteria	1103
185	Ga0105241_10000004	3300009174	Bacteria	803007
186	Ga0105241_10038817	3300009174	Bacteria	3590
187	Ga0105242_10000371	3300009176	Bacteria	35724
188	Ga0105242_10015952	3300009176	Bacteria	5838
189	Ga0105242_10293720	3300009176	Bacteria	1481
190	Ga0105248_10038127	3300009177	Bacteria	5377
191	Ga0105248_10067149	3300009177	Bacteria	4026
192	Ga0105248_10288123	3300009177	Bacteria	1849
193	Ga0105248_10587945	3300009177	Bacteria	1256
194	Ga0105237_10019838	3300009545	Bacteria	6940
195	Ga0105237_10059278	3300009545	Bacteria	3830
196	Ga0105238_10000038	3300009551	Bacteria	162920
197	Ga0105238_10088633	3300009551	Bacteria	3080
198	Ga0105238_10236725	3300009551	Bacteria	1803
199	Ga0105249_10000243	3300009553	Bacteria	60371
200	Ga0105249_10066635	3300009553	Bacteria	3315
201	Ga0105249_10117450	3300009553	Bacteria	2523
202	Ga0105249_10127223	3300009553	Bacteria	2428
203	Ga0105249_10508503	3300009553	Bacteria	1251
204	Ga0099796_10007059	3300010159	Bacteria	2915
205	Ga0105239_10000303	3300010375	Bacteria	72769
206	Ga0105239_10015338	3300010375	Bacteria	8490
207	Ga0157347_1003449	3300012502	Bacteria	1418
208	Ga0157373_10000633	3300013100	Bacteria	27561
209	Ga0157373_10000981	3300013100	Bacteria	22059
210	Ga0157373_10001613	3300013100	Bacteria	17234
211	Ga0157373_10009523	3300013100	Bacteria	7171
212	Ga0157371_10005108	3300013102	Bacteria	11195
213	Ga0157371_10013078	3300013102	Bacteria	6318
214	Ga0157370_10000485	3300013104	Bacteria	49509
215	Ga0157370_10000756	3300013104	Bacteria	40377
216	Ga0157370_10012877	3300013104	Bacteria	8647
217	Ga0157370_10013422	3300013104	Bacteria	8440
218	Ga0157369_10000138	3300013105	Bacteria	102776
219	Ga0157369_10000510	3300013105	Bacteria	51123
220	Ga0157369_10014085	3300013105	Bacteria	9037
221	Ga0157369_10024923	3300013105	Bacteria	6647
222	Ga0157369_10034798	3300013105	Bacteria	5526
223	Ga0157369_10035030	3300013105	Bacteria	5505
224	Ga0157369_10103667	3300013105	Bacteria	3030
225	Ga0157369_10118636	3300013105	Bacteria	2808
226	Ga0157374_10000056	3300013296	Bacteria	117163
227	Ga0157374_10064879	3300013296	Bacteria	3428
228	Ga0157374_10159705	3300013296	Bacteria	2195
229	Ga0157374_10268028	3300013296	Bacteria	1683
230	Ga0157378_10000651	3300013297	Bacteria	32716
231	Ga0157378_10005243	3300013297	Bacteria	11383
232	Ga0163162_10031705	3300013306	Bacteria	5243
233	Ga0163162_10144520	3300013306	Bacteria	2494
234	Ga0163162_10194891	3300013306	Bacteria	2154
235	Ga0163162_10355455	3300013306	Bacteria	1598
236	Ga0163162_10433579	3300013306	Bacteria	1446
237	Ga0163162_10518994	3300013306	Bacteria	1321
238	Ga0163162_10542389	3300013306	Bacteria	1292
239	Ga0157372_10018305	3300013307	Bacteria	7529
240	Ga0157372_10271228	3300013307	Bacteria	1972
241	Ga0157372_10435499	3300013307	Bacteria	1528
242	Ga0157375_10165333	3300013308	Bacteria	2357
243	Ga0157375_10221768	3300013308	Bacteria	2049
244	Ga0157375_10456583	3300013308	Bacteria	1443
245	Ga0157375_10473760	3300013308	Bacteria	1417
246	Ga0163163_10014066	3300014325	Bacteria	7346
247	Ga0157380_10004646	3300014326	Bacteria	9551
248	Ga0157380_10124899	3300014326	Bacteria	2185
249	Ga0182008_10000556	3300014497	Bacteria	27658
250	Ga0182008_10004707	3300014497	Bacteria	7915
251	Ga0182008_10028269	3300014497	Bacteria	2835
252	Ga0157379_10011772	3300014968	Bacteria	7641
253	Ga0157376_10000001	3300014969	Bacteria	842910
254	Ga0182006_1000118	3300015261	Bacteria	85805
255	Ga0182006_1000152	3300015261	Bacteria	74063
256	Ga0182006_1002843	3300015261	Bacteria	9220
257	Ga0182006_1008317	3300015261	Bacteria	4704
258	Ga0182006_1058423	3300015261	Bacteria	1463
259	Ga0182007_10002938	3300015262	Bacteria	8276
260	Ga0182005_1000005	3300015265	Bacteria	537378
261	Ga0183361_10018	3300016635	Bacteria	133279
262	Ga0163161_10000004	3300017792	Bacteria	333149
263	Ga0163161_10000738	3300017792	Bacteria	25670
264	Ga0163161_10037604	3300017792	Bacteria	3471
265	Ga0224712_10000040	3300022467	Bacteria	19652
266	Ga0224712_10058763	3300022467	Bacteria	1524
267	Ga0209436_100135	3300025208	Bacteria	36415
268	Ga0209784_100002	3300025224	Bacteria	1753105
269	Ga0209566_100003	3300025225	Bacteria	1753105
270	Ga0209674_100004	3300025226	Bacteria	1753105
271	Ga0209674_100005	3300025226	Bacteria	1708125
272	Ga0209674_100150	3300025226	Bacteria	96511
273	Ga0209672_100001	3300025228	Bacteria	2828210
274	Ga0209147_100001	3300025229	Bacteria	2384371
275	Ga0209563_100006	3300025230	Bacteria	1753105
276	Ga0209563_100794	3300025230	Bacteria	9503
277	Ga0207427_100394	3300025231	Bacteria	25938
278	Ga0209258_100001	3300025242	Bacteria	2384269
279	Ga0209677_100003	3300025253	Bacteria	1753105
280	Ga0209148_1000003	3300025254	Bacteria	2384288
281	Ga0209148_1000620	3300025254	Bacteria	31479
282	Ga0209759_1000228	3300025256	Bacteria	84202
283	Ga0209759_1000275	3300025256	Bacteria	72571
284	Ga0209759_1000543	3300025256	Bacteria	39344
285	Ga0209759_1001138	3300025256	Bacteria	17013
286	Ga0209129_1001909	3300025258	Bacteria	10989
287	Ga0209233_1000016	3300025261	Bacteria	907830
288	Ga0209565_1000150	3300025263	Bacteria	94073
289	Ga0209455_1000001	3300025272	Bacteria	2384278
290	Ga0209455_1000047	3300025272	Bacteria	379709
291	Ga0209673_1000114	3300025273	Bacteria	178557
292	Ga0209130_1000057	3300025284	Bacteria	210593
293	Ga0209130_1000574	3300025284	Bacteria	35904
294	Ga0209675_1000062	3300025291	Bacteria	178557
295	Ga0209676_1000164	3300025292	Bacteria	156826
296	Ga0209676_1000244	3300025292	Bacteria	116654
297	Ga0209676_1021981	3300025292	Bacteria	2125
298	Ga0209025_1000049	3300025294	Bacteria	333459
299	Ga0209025_1000191	3300025294	Bacteria	152552
300	Ga0209025_1000709	3300025294	Bacteria	56684
301	Ga0209564_1002709	3300025295	Bacteria	13379
302	Ga0209564_1004984	3300025295	Bacteria	7818
303	Ga0209050_1000904	3300025298	Bacteria	39210
304	Ga0207426_1000657	3300025302	Bacteria	42328
305	Ga0207426_1002801	3300025302	Bacteria	10455
306	Ga0207426_1006276	3300025302	Bacteria	5198
307	Ga0209051_1000208	3300025303	Bacteria	102967
308	Ga0209257_1004516	3300025304	Bacteria	10706
309	Ga0209257_1010985	3300025304	Bacteria	4449
310	Ga0207656_10001797	3300025321	Bacteria	7140
311	Ga0207696_1000001	3300025711	Bacteria	2579611
312	Ga0207655_1001151	3300025728	Bacteria	25725
313	Ga0207655_1003515	3300025728	Bacteria	11623
314	Ga0207713_1000093	3300025735	Bacteria	146199
315	Ga0207713_1000205	3300025735	Bacteria	80817
316	Ga0207713_1000699	3300025735	Bacteria	31392
317	Ga0207713_1001376	3300025735	Bacteria	19744
318	Ga0207713_1001567	3300025735	Bacteria	17940
319	Ga0207642_10022646	3300025899	Bacteria	2496
320	Ga0207710_10000016	3300025900	Bacteria	388568
321	Ga0207647_10000410	3300025904	Bacteria	35247
322	Ga0207647_10000430	3300025904	Bacteria	34390
323	Ga0207647_10011603	3300025904	Bacteria	6171
324	Ga0207647_10013337	3300025904	Bacteria	5703
325	Ga0207647_10013559	3300025904	Bacteria	5644
326	Ga0207645_10008061	3300025907	Bacteria	7388
327	Ga0207645_10019099	3300025907	Bacteria	4500
328	Ga0207705_10000129	3300025909	Bacteria	82827
329	Ga0207705_10005484	3300025909	Bacteria	9487
330	Ga0207654_10000006	3300025911	Bacteria	815027
331	Ga0207707_10046163	3300025912	Unclassified	3793
332	Ga0207707_10102181	3300025912	Bacteria	2506
333	Ga0207695_10012277	3300025913	Bacteria	10288
334	Ga0207695_10012751	3300025913	Bacteria	10063
335	Ga0207695_10063221	3300025913	Bacteria	3817
336	Ga0207671_10171065	3300025914	Bacteria	1687
337	Ga0207671_10187055	3300025914	Bacteria	1614
338	Ga0207693_10265151	3300025915	Bacteria	1346
339	Ga0207663_10206381	3300025916	Bacteria	1421
340	Ga0207660_10178590	3300025917	Bacteria	1647
341	Ga0207657_10013828	3300025919	Bacteria	7898
342	Ga0207652_10021290	3300025921	Bacteria	5351
343	Ga0207694_10000126	3300025924	Bacteria	79243
344	Ga0207694_10013637	3300025924	Bacteria	6125
345	Ga0207694_10279127	3300025924	Bacteria	1372
346	Ga0207687_10023025	3300025927	Bacteria	4149
347	Ga0207700_10004741	3300025928	Bacteria	8066
348	Ga0207690_10179013	3300025932	Bacteria	1595
349	Ga0207686_10003545	3300025934	Bacteria	8372
350	Ga0207686_10047434	3300025934	Bacteria	2656
351	Ga0207709_10003067	3300025935	Bacteria	10096
352	Ga0207669_10024658	3300025937	Bacteria	3237
353	Ga0207669_10045061	3300025937	Bacteria	2597
354	Ga0207669_10176018	3300025937	Bacteria	1528
355	Ga0207704_10005412	3300025938	Bacteria	5886
356	Ga0207691_10135597	3300025940	Bacteria	2171
357	Ga0207711_10026051	3300025941	Bacteria	4905
358	Ga0207711_10309015	3300025941	Bacteria	1459
359	Ga0207711_10444961	3300025941	Bacteria	1206
360	Ga0207689_10000465	3300025942	Bacteria	38002
361	Ga0207689_10129531	3300025942	Bacteria	2076
362	Ga0207667_10000427	3300025949	Bacteria	56780
363	Ga0207667_10028128	3300025949	Bacteria	6107
364	Ga0207667_10148183	3300025949	Bacteria	2415
365	Ga0207667_10319366	3300025949	Bacteria	1586
366	Ga0207651_10000125	3300025960	Bacteria	32722
367	Ga0207712_10000433	3300025961	Bacteria	35737
368	Ga0207712_10069123	3300025961	Bacteria	2533
369	Ga0207668_10099867	3300025972	Bacteria	2154
370	Ga0207640_10077107	3300025981	Bacteria	2264
371	Ga0207640_10236046	3300025981	Bacteria	1410
372	Ga0207658_10139733	3300025986	Bacteria	1958
373	Ga0207677_10023862	3300026023	Bacteria	3787
374	Ga0207703_10015850	3300026035	Bacteria	5880
375	Ga0207678_10106794	3300026067	Bacteria	2388
376	Ga0207678_10126657	3300026067	Bacteria	2178
377	Ga0207708_10000376	3300026075	Bacteria	34827
378	Ga0207702_10278497	3300026078	Bacteria	1580
379	Ga0207641_10129547	3300026088	Bacteria	2264
380	Ga0207648_10000092	3300026089	Bacteria	84700
381	Ga0207676_10041160	3300026095	Bacteria	3545
382	Ga0207674_10244418	3300026116	Bacteria	1742
383	Ga0207675_100000181	3300026118	Bacteria	56942
384	Ga0207675_100222708	3300026118	Bacteria	1818
385	Ga0207683_10001307	3300026121	Bacteria	22512
386	Ga0207683_10098198	3300026121	Bacteria	2613
387	Ga0209281_1001285	3300027111	Bacteria	16101
388	Ga0209281_1005294	3300027111	Bacteria	3616
389	Ga0209589_1000014	3300027357	Bacteria	227996
390	Ga0209489_100014	3300027361	Bacteria	227996
391	Ga0209700_100024	3300027363	Bacteria	227996
392	Ga0209282_1002130	3300027666	Bacteria	11281
393	Ga0268266_10000916	3300028379	Bacteria	37956
394	Ga0268266_10023525	3300028379	Bacteria	5244
395	Ga0268266_10218115	3300028379	Bacteria	1752
396	Ga0268266_10284684	3300028379	Bacteria	1538
397	Ga0268265_10006000	3300028380	Bacteria	8265
398	Ga0268264_10021329	3300028381	Bacteria	5289
399	Ga0265338_10049870	3300028800	Bacteria	3789
400	Ga0307511_10000109	3300030521	Bacteria	74186
401	Ga0316180_1141634	3300030736	Bacteria	3981
402	Ga0316181_1264586	3300030744	Bacteria	3840
403	Ga0265328_10000002	3300031239	Bacteria	275819
404	Ga0265328_10007645	3300031239	Bacteria	4495
405	Ga0265320_10100830	3300031240	Bacteria	1330
406	Ga0265331_10053560	3300031250	Bacteria	1924
407	Ga0265327_10005493	3300031251	Bacteria	10556
408	Ga0265316_10000511	3300031344	Bacteria	43817
409	Ga0307408_100001595	3300031548	Bacteria	16749
410	Ga0307408_100009230	3300031548	Bacteria	6501
411	Ga0307408_100030979	3300031548	Bacteria	3719
412	Ga0307408_100087687	3300031548	Bacteria	2342
413	Ga0316576_10004707	3300031727	Bacteria	8236
414	Ga0316578_10027905	3300031728	Bacteria	3193
415	Ga0307405_10026202	3300031731	Bacteria	3361
416	Ga0307405_10109589	3300031731	Bacteria	1868
417	Ga0316577_10202466	3300031733	Bacteria	1122
418	Ga0307413_10253810	3300031824	Bacteria	1306
419	Ga0307410_10010788	3300031852	Bacteria	5197
420	Ga0307407_10048464	3300031903	Bacteria	2418
421	Ga0307412_10000005	3300031911	Bacteria	526194
422	Ga0307412_10000069	3300031911	Bacteria	108218
423	Ga0307412_10009054	3300031911	Bacteria	5704
424	Ga0307412_10020542	3300031911	Bacteria	4021
425	Ga0307409_100364197	3300031995	Bacteria	1368
426	Ga0307416_100006168	3300032002	Bacteria	7474
427	Ga0307416_100008505	3300032002	Bacteria	6630
428	Ga0307416_100090969	3300032002	Bacteria	2619
429	Ga0307414_10100900	3300032004	Bacteria	2172
430	Ga0307510_10000948	3300033180	Bacteria	30647
431	Ga0315911_1000018	3300033442	Bacteria	152089
432	Ga0316574_0013130	3300035398	Bacteria	4756
433	Ga0316582_0276906	3300036647	Bacteria	1151
434	Ga0316584_0002399	3300036712	Bacteria	11842
435	Ga0316584_0014538	3300036712	Bacteria	5605
436	Ga0395899_0040683	3300037312	Bacteria	3476
437	Ga0395900_0052659	3300037418	Bacteria	4190
438	Ga0395900_0216701	3300037418	Bacteria	1931
439	Ga0395900_0233979	3300037418	Bacteria	1846
440	Ga0395898_0012898	3300037466	Bacteria	8622
441	Ga0395898_0073469	3300037466	Bacteria	3304
442	Ga0395898_0131666	3300037466	Bacteria	2395
443	Ga0395905_0000236	3300037471	Bacteria	83344
444	Ga0395905_0007181	3300037471	Bacteria	11123
445	Ga0395905_0007879	3300037471	Bacteria	10546
446	Ga0395905_0008311	3300037471	Bacteria	10241
447	Ga0395905_0015581	3300037471	Bacteria	7223
448	Ga0395905_0031654	3300037471	Bacteria	4978
449	Ga0395905_0036002	3300037471	Bacteria	4648
450	Ga0395905_0165040	3300037471	Bacteria	2081
451	Ga0395905_0275078	3300037471	Bacteria	1570
452	Ga0395905_0279247	3300037471	Bacteria	1556
453	Ga0395901_0000154	3300038443	Bacteria	89750
454	Ga0395901_0004377	3300038443	Bacteria	14249
455	Ga0395901_0031280	3300038443	Bacteria	5488
456	Ga0395901_0447378	3300038443	Bacteria	1322
457	Ga0439439_0010800	3300041406	Bacteria	2189
458	Ga0439466_0008698	3300041411	Bacteria	3825
459	Ga0451807_1151223	3300041486	Bacteria	2109
460	Ga0439449_0011594	3300042007	Bacteria	3315
461	Ga0439462_0005035	3300042015	Bacteria	3242
462	Ga0439463_004189	3300042016	Bacteria	3619
463	Ga0439446_0032084	3300042156	Bacteria	1522
464	Ga0450909_005168	3300042185	Bacteria	1878
465	Ga0451577_0008941	3300042876	Bacteria	9690
466	Ga0466969_0003919	3300044656	Bacteria	7901
467	Ga0466972_0055584	3300044658	Bacteria	1904
468	Ga0466973_0023612	3300044659	Bacteria	5893
469	Ga0466966_0000008	3300044684	Bacteria	155597
470	Ga0466966_0003154	3300044684	Bacteria	10855
471	Ga0466961_0007135	3300044693	Bacteria	7108
472	Ga0466961_0042890	3300044693	Bacteria	2898
473	Ga0466963_0003221	3300044694	Bacteria	9291
474	Ga0466963_0004171	3300044694	Bacteria	8366
475	Ga0466964_0005801	3300044706	Bacteria	4594
476	Ga0453684_0041659	3300044712	Bacteria	6206
477	Ga0453684_0094361	3300044712	Bacteria	3681
478	Ga0453684_0158893	3300044712	Bacteria	2676
479	Ga0466957_0032011	3300044842	Bacteria	3146
480	Ga0466957_0053462	3300044842	Bacteria	2462
481	Ga0466959_0000027	3300045049	Bacteria	114262
482	Ga0466967_0074519	3300045976	Bacteria	3049
483	Ga0495627_000038	3300046453	Bacteria	198316
484	Ga0495627_000231	3300046453	Bacteria	59148
485	Ga0495627_000396	3300046453	Bacteria	39486
486	Ga0495592_0008737	3300046454	Bacteria	7605
487	Ga0495603_0021997	3300046455	Bacteria	3861
488	Ga0495603_0055671	3300046455	Bacteria	2343
489	Ga0495603_0187281	3300046455	Bacteria	1197
490	Ga0495590_0000062	3300046457	Bacteria	82552
491	Ga0495590_0003467	3300046457	Bacteria	6435
492	Ga0495590_0019222	3300046457	Bacteria	2436
493	Ga0495591_001099	3300046458	Bacteria	18000
494	Ga0495629_0000054	3300046459	Bacteria	106374
495	Ga0495629_0000099	3300046459	Bacteria	75956
496	Ga0495629_0047453	3300046459	Bacteria	3012
497	Ga0495629_0067906	3300046459	Bacteria	2487
498	Ga0495638_0007214	3300046460	Bacteria	7992
499	Ga0495638_0007523	3300046460	Bacteria	7797
500	Ga0495638_0016585	3300046460	Bacteria	4930
501	Ga0495638_0035271	3300046460	Bacteria	3190
502	Ga0495638_0120959	3300046460	Bacteria	1547
503	Ga0495651_0036224	3300046462	Bacteria	3841
504	Ga0495651_0059265	3300046462	Bacteria	2936
505	Ga0495651_0070947	3300046462	Bacteria	2649
506	Ga0495653_0000099	3300046463	Bacteria	71802
507	Ga0495653_0013098	3300046463	Bacteria	6760
508	Ga0495650_0001143	3300046471	Bacteria	28780
509	Ga0495650_0002455	3300046471	Bacteria	14954
510	Ga0495650_0002504	3300046471	Bacteria	14727
511	Ga0495650_0018748	3300046471	Bacteria	3430
512	Ga0495580_0000082	3300046472	Bacteria	61156
513	Ga0495580_0000208	3300046472	Bacteria	45347
514	Ga0495580_0014112	3300046472	Bacteria	6073
515	Ga0495580_0015382	3300046472	Bacteria	5772
516	Ga0495580_0038009	3300046472	Bacteria	3451
517	Ga0495580_0048682	3300046472	Bacteria	2999
518	Ga0495580_0054404	3300046472	Bacteria	2823
519	Ga0495582_0008194	3300046473	Bacteria	5768
520	Ga0495582_0010405	3300046473	Bacteria	5117
521	Ga0495582_0015819	3300046473	Bacteria	4138
522	Ga0495582_0019610	3300046473	Bacteria	3699
523	Ga0495582_0052010	3300046473	Bacteria	2259
524	Ga0495605_0000250	3300046474	Bacteria	63615
525	Ga0495605_0002569	3300046474	Bacteria	11163
526	Ga0495605_0004126	3300046474	Bacteria	8564
527	Ga0495605_0009441	3300046474	Bacteria	5480
528	Ga0495664_0012257	3300046477	Bacteria	4854
529	Ga0495584_0000055	3300046491	Bacteria	81977
530	Ga0495596_0001254	3300046500	Bacteria	14780
531	Ga0495596_0015853	3300046500	Bacteria	3142
532	Ga0495607_0002944	3300046501	Bacteria	13378
533	Ga0495583_0003132	3300046506	Bacteria	13051
534	Ga0495583_0006321	3300046506	Bacteria	7777
535	Ga0495606_0000240	3300046507	Bacteria	96783
536	Ga0495606_0009476	3300046507	Bacteria	8232
537	Ga0495606_0015029	3300046507	Bacteria	5996
538	Ga0495606_0020115	3300046507	Bacteria	4935
539	Ga0495606_0040054	3300046507	Bacteria	3152
540	Ga0495606_0152876	3300046507	Bacteria	1353
541	Ga0495610_0001010	3300046512	Bacteria	25912
542	Ga0495610_0005858	3300046512	Bacteria	8629
543	Ga0495616_0000211	3300046513	Bacteria	48566
544	Ga0495618_0030599	3300046514	Bacteria	3362
545	Ga0495620_0000720	3300046515	Bacteria	20399
546	Ga0495620_0011883	3300046515	Bacteria	4524
547	Ga0495620_0016675	3300046515	Bacteria	3680
548	Ga0495628_0004119	3300046516	Bacteria	12931
549	Ga0495628_0017922	3300046516	Bacteria	5877
550	Ga0495628_0065029	3300046516	Bacteria	2854
551	Ga0495628_0065782	3300046516	Bacteria	2834
552	Ga0495628_0173768	3300046516	Bacteria	1632
553	Ga0495630_0003148	3300046517	Bacteria	11447
554	Ga0495630_0006005	3300046517	Bacteria	8589
555	Ga0495631_0000054	3300046518	Bacteria	70253
556	Ga0495631_0000932	3300046518	Bacteria	18216
557	Ga0495637_0012154	3300046520	Bacteria	4123
558	Ga0495643_0045249	3300046522	Bacteria	2390
559	Ga0495644_0045471	3300046523	Bacteria	1651
560	Ga0495648_0000971	3300046524	Bacteria	29603
561	Ga0495648_0003217	3300046524	Bacteria	14492
562	Ga0495648_0004756	3300046524	Bacteria	11492
563	Ga0495648_0052631	3300046524	Bacteria	2471
564	Ga0495648_0114174	3300046524	Bacteria	1463
565	Ga0495648_0149648	3300046524	Bacteria	1219
566	Ga0495666_0054900	3300046526	Bacteria	1910
567	Ga0495666_0064354	3300046526	Bacteria	1750
568	Ga0495666_0130873	3300046526	Bacteria	1172
569	Ga0495642_0000006	3300046528	Bacteria	172412
570	Ga0495652_0024230	3300046529	Bacteria	5373
571	Ga0495652_0047659	3300046529	Bacteria	3674
572	Ga0495654_0000424	3300046530	Bacteria	35763
573	Ga0495654_0006828	3300046530	Bacteria	6441
574	Ga0495654_0010213	3300046530	Bacteria	5116
575	Ga0495654_0045562	3300046530	Bacteria	2163
576	Ga0495654_0051889	3300046530	Bacteria	2000
577	Ga0495665_0006780	3300046531	Bacteria	6178
578	Ga0495665_0010499	3300046531	Bacteria	5013
579	Ga0495665_0012030	3300046531	Bacteria	4684
580	Ga0495665_0022519	3300046531	Bacteria	3387
581	Ga0495665_0048049	3300046531	Bacteria	2263
582	Ga0495640_0002986	3300046533	Bacteria	13619
583	Ga0495640_0006341	3300046533	Bacteria	9374
584	Ga0495640_0071184	3300046533	Bacteria	2334
585	Ga0495586_0030103	3300046535	Bacteria	2905
586	Ga0495586_0123042	3300046535	Bacteria	1450
587	Ga0495586_0195080	3300046535	Bacteria	1147
588	Ga0495587_0041837	3300046536	Bacteria	2733
589	Ga0495609_0000069	3300046538	Bacteria	128601
590	Ga0495609_0000357	3300046538	Bacteria	39838
591	Ga0495621_0001102	3300046539	Bacteria	6956
592	Ga0495621_0030015	3300046539	Bacteria	1856
593	Ga0495597_0007210	3300046542	Bacteria	5667
594	Ga0495645_0018667	3300046543	Bacteria	4984
595	Ga0495622_0000880	3300046557	Bacteria	16384
596	Ga0495633_0008364	3300046558	Bacteria	5838
597	Ga0495667_0004661	3300046559	Bacteria	9270
598	Ga0495668_0000064	3300046616	Bacteria	180583
599	Ga0495668_0000319	3300046616	Bacteria	66006
600	Ga0495668_0003544	3300046616	Bacteria	11604
601	Ga0495668_0025365	3300046616	Bacteria	3368
602	Ga0495634_0142422	3300046642	Bacteria	1521
603	Ga0495611_0017239	3300046648	Bacteria	3088
604	Ga0495611_0046716	3300046648	Bacteria	1942
605	Ga0495611_0117353	3300046648	Bacteria	1240
606	Ga0495625_0020529	3300046660	Bacteria	5098
607	Ga0495625_0049416	3300046660	Bacteria	3024
608	Ga0495625_0172162	3300046660	Bacteria	1445
609	Ga0495635_0029567	3300046663	Bacteria	3811
610	Ga0495661_0017617	3300046665	Bacteria	4715
611	Ga0495661_0020918	3300046665	Bacteria	4267
612	Ga0495661_0155273	3300046665	Bacteria	1233
613	Ga0495657_0021542	3300046675	Bacteria	4624
614	Ga0495657_0079614	3300046675	Bacteria	2122
615	Ga0495599_0019288	3300046678	Bacteria	4251
616	Ga0495623_0002988	3300046679	Bacteria	11120
617	Ga0495623_0034113	3300046679	Bacteria	3264
618	Ga0495623_0104159	3300046679	Bacteria	1725
619	Ga0495646_0001798	3300046680	Bacteria	12872
620	Ga0495646_0003633	3300046680	Bacteria	9626
621	Ga0495646_0048346	3300046680	Bacteria	2584
622	Ga0495669_0004952	3300046684	Bacteria	5535
623	Ga0495669_0008446	3300046684	Bacteria	4331
624	Ga0495613_0007126	3300046689	Bacteria	8323
625	Ga0495613_0109898	3300046689	Bacteria	1987
626	Ga0495624_0002851	3300046690	Bacteria	12937
627	Ga0495624_0014790	3300046690	Bacteria	5284
628	Ga0495624_0016562	3300046690	Bacteria	4961
629	Ga0495624_0018031	3300046690	Bacteria	4727
630	Ga0495624_0046239	3300046690	Bacteria	2768
631	Ga0495624_0051742	3300046690	Bacteria	2597
632	Ga0495670_0000603	3300046691	Bacteria	17150
633	Ga0495670_0002733	3300046691	Bacteria	8710
634	Ga0495671_0001569	3300046692	Bacteria	15147
635	Ga0495671_0020281	3300046692	Bacteria	3503
636	Ga0495671_0023174	3300046692	Bacteria	3245
637	Ga0495671_0045650	3300046692	Bacteria	2193
638	Ga0495671_0047884	3300046692	Bacteria	2134
639	Ga0495649_0000844	3300046694	Bacteria	24615
640	Ga0495649_0005939	3300046694	Bacteria	7655
641	Ga0495649_0055517	3300046694	Bacteria	2140
642	Ga0495649_0066462	3300046694	Bacteria	1935
643	Ga0495589_0000002	3300046794	Bacteria	758846
644	Ga0495589_0000928	3300046794	Bacteria	18001
645	Ga0495589_0025596	3300046794	Bacteria	2994
646	Ga0495600_0004096	3300046809	Bacteria	8676
647	Ga0495660_0000080	3300046810	Bacteria	103751
648	Ga0495660_0000177	3300046810	Bacteria	69130
649	Ga0495581_0014339	3300047315	Bacteria	4596
650	Ga0495604_0018563	3300047317	Bacteria	5572
651	Ga0495604_0020358	3300047317	Bacteria	5300
652	Ga0495604_0025620	3300047317	Bacteria	4697
653	Ga0495604_0080016	3300047317	Bacteria	2449
654	Ga0495674_0004220	3300047319	Bacteria	13838
655	Ga0495674_0007713	3300047319	Bacteria	10280
656	Ga0495674_0012326	3300047319	Bacteria	8053
657	Ga0495674_0057474	3300047319	Bacteria	3404
658	Ga0495674_0118705	3300047319	Bacteria	2236
659	Ga0495674_0149829	3300047319	Bacteria	1956
660	Ga0495674_0341658	3300047319	Bacteria	1216
661	Ga0495672_0000010	3300047320	Bacteria	545038
662	Ga0495672_0000158	3300047320	Bacteria	98531
663	Ga0495672_0004354	3300047320	Bacteria	11636
664	Ga0495672_0014192	3300047320	Bacteria	5465
665	Ga0495672_0121310	3300047320	Bacteria	1389
666	Ga0495676_0022045	3300047321	Bacteria	5551
667	Ga0495680_0023583	3300047322	Bacteria	5114
668	Ga0495680_0031745	3300047322	Bacteria	4295
669	Ga0495680_0069170	3300047322	Bacteria	2694
670	Ga0495680_0076445	3300047322	Bacteria	2538
671	Ga0495683_0002027	3300047323	Bacteria	12553
672	Ga0495683_0004646	3300047323	Bacteria	7738
673	Ga0495683_0015176	3300047323	Bacteria	4011
674	Ga0495683_0026041	3300047323	Bacteria	2995
675	Ga0495687_000104	3300047443	Bacteria	128704
676	Ga0495687_013575	3300047443	Bacteria	4241
677	Ga0495687_014501	3300047443	Bacteria	4054
678	Ga0495687_026210	3300047443	Bacteria	2748
679	Ga0495687_030850	3300047443	Bacteria	2465
680	Ga0495687_037021	3300047443	Bacteria	2177
681	Ga0495687_042575	3300047443	Bacteria	1983
682	Ga0495675_0001679	3300047444	Bacteria	13286
683	Ga0495675_0054579	3300047444	Bacteria	2535
684	Ga0495675_0072682	3300047444	Bacteria	2169
685	Ga0495679_000062	3300047446	Bacteria	107181
686	Ga0495679_000063	3300047446	Bacteria	103758
687	Ga0495679_001490	3300047446	Bacteria	13210
688	Ga0495679_002444	3300047446	Bacteria	9462
689	Ga0495679_013378	3300047446	Bacteria	3083
690	Ga0495673_0001271	3300047469	Bacteria	20784
691	Ga0495673_0019368	3300047469	Bacteria	3410
692	Ga0495673_0049331	3300047469	Bacteria	1853
693	Ga0495673_0050304	3300047469	Bacteria	1829
694	Ga0495673_0061242	3300047469	Bacteria	1612
695	Ga0495684_0138695	3300047471	Bacteria	1824
696	Ga0495686_0002575	3300047472	Bacteria	16881
697	Ga0495686_0028742	3300047472	Bacteria	3620
698	Ga0495686_0041236	3300047472	Bacteria	2939
699	Ga0495686_0043715	3300047472	Bacteria	2839
700	Ga0495593_0011480	3300047673	Bacteria	5086
701	Ga0495593_0019601	3300047673	Bacteria	3791
702	Ga0495593_0044331	3300047673	Bacteria	2380
703	Ga0495602_0000856	3300048088	Bacteria	29354
704	Ga0495602_0028550	3300048088	Bacteria	5336
705	Ga0495602_0081496	3300048088	Bacteria	2720
706	Ga0495614_0118602	3300048089	Bacteria	1165
707	Ga0496100_0063024	3300048903	Bacteria	2449
708	Ga0496100_0064098	3300048903	Bacteria	2430
709	Ga0496101_0001501	3300048904	Bacteria	13958
710	Ga0496101_0009824	3300048904	Bacteria	6303
711	Ga0496101_0076060	3300048904	Bacteria	2472
712	Ga0496101_0261609	3300048904	Bacteria	1350
713	Ga0496102_0004504	3300048905	Bacteria	11768
714	Ga0496102_0004959	3300048905	Bacteria	11276
715	Ga0496102_0005431	3300048905	Bacteria	10811
716	Ga0496102_0016284	3300048905	Bacteria	6494
717	Ga0496102_0042541	3300048905	Bacteria	4116
718	Ga0496102_0085628	3300048905	Bacteria	2910
719	Ga0496102_0151506	3300048905	Bacteria	2179
720	Ga0496102_0179263	3300048905	Bacteria	1996
721	Ga0496102_0192183	3300048905	Bacteria	1923
722	Ga0496102_0193752	3300048905	Bacteria	1915
723	Ga0496102_0311666	3300048905	Bacteria	1483
724	Ga0496102_0479345	3300048905	Bacteria	1165
725	Ga0496103_0001546	3300048906	Bacteria	15290
726	Ga0496103_0002245	3300048906	Bacteria	12238
727	Ga0496103_0004401	3300048906	Bacteria	8547
728	Ga0496103_0011170	3300048906	Bacteria	5317
729	Ga0496103_0098874	3300048906	Bacteria	1845
730	Ga0496104_0099819	3300048907	Bacteria	2779
731	Ga0496105_0018285	3300048908	Bacteria	5629
732	Ga0496106_0002122	3300048909	Bacteria	14837
733	Ga0496107_0025617	3300048910	Bacteria	4176
734	Ga0496107_0037012	3300048910	Bacteria	3502
735	Ga0496108_0334082	3300048911	Bacteria	1322
736	Ga0496109_0162694	3300048912	Bacteria	2091
737	Ga0496110_0005967	3300048913	Bacteria	9593
738	Ga0496110_0383698	3300048913	Bacteria	1280
739	Ga0496111_0031413	3300048914	Bacteria	3783
740	Ga0496112_0113275	3300048915	Bacteria	2683
741	Ga0496114_0065402	3300048917	Bacteria	3047
742	Ga0496116_0000031	3300048919	Bacteria	420043
743	Ga0496117_0001221	3300048920	Bacteria	38481
744	Ga0496117_0003334	3300048920	Bacteria	18760
745	Ga0496117_0012014	3300048920	Bacteria	7690
746	Ga0496117_0024611	3300048920	Bacteria	4755
747	Ga0496117_0117992	3300048920	Bacteria	1637
748	Ga0496117_0170475	3300048920	Bacteria	1264
749	Ga0496118_0001708	3300048921	Bacteria	32058
750	Ga0496118_0004252	3300048921	Bacteria	17141
751	Ga0496118_0016225	3300048921	Bacteria	6842
752	Ga0496118_0044336	3300048921	Bacteria	3484
753	Ga0496118_0072369	3300048921	Bacteria	2476
754	Ga0496119_0000468	3300048922	Bacteria	55018
755	Ga0496119_0033243	3300048922	Bacteria	3423
756	Ga0496120_0000137	3300048923	Bacteria	123518
757	Ga0496121_0000437	3300048924	Bacteria	82376
758	Ga0496121_0000573	3300048924	Bacteria	69111
759	Ga0496121_0006494	3300048924	Bacteria	14471
760	Ga0496121_0009566	3300048924	Bacteria	11105
761	Ga0496121_0014837	3300048924	Bacteria	8222
762	Ga0496121_0051729	3300048924	Bacteria	3457
763	Ga0496121_0161963	3300048924	Bacteria	1635
764	Ga0496122_0001630	3300048925	Bacteria	35015
765	Ga0496122_0002855	3300048925	Bacteria	23658
766	Ga0496122_0041369	3300048925	Bacteria	3645
767	Ga0496122_0072071	3300048925	Bacteria	2458
768	Ga0496123_0001111	3300048926	Bacteria	40321
769	Ga0496123_0003528	3300048926	Bacteria	17419
770	Ga0496123_0015546	3300048926	Bacteria	6236
771	Ga0496123_0048914	3300048926	Bacteria	2840
772	Ga0496124_0000017	3300048927	Bacteria	444389
773	Ga0496124_0000138	3300048927	Bacteria	150311
774	Ga0496124_0002733	3300048927	Bacteria	22485
775	Ga0496124_0205923	3300048927	Bacteria	1492
776	Ga0496125_0001586	3300048928	Bacteria	32273
777	Ga0496125_0007850	3300048928	Bacteria	11280
778	Ga0496125_0022722	3300048928	Bacteria	5814
779	Ga0496125_0046935	3300048928	Bacteria	3618
780	Ga0496125_0076609	3300048928	Bacteria	2582
781	Ga0496125_0118496	3300048928	Bacteria	1896
782	Ga0496126_0000034	3300048929	Bacteria	362440
783	Ga0496126_0000446	3300048929	Bacteria	82267
784	Ga0496126_0000882	3300048929	Bacteria	52767
785	Ga0496126_0006636	3300048929	Bacteria	12879
786	Ga0496126_0019981	3300048929	Bacteria	6581
787	Ga0496126_0034277	3300048929	Bacteria	4769
788	Ga0496126_0073429	3300048929	Bacteria	3041
789	Ga0496126_0092103	3300048929	Bacteria	2664
790	Ga0496126_0126700	3300048929	Bacteria	2210
791	Ga0496126_0162752	3300048929	Bacteria	1906
792	Ga0496126_0186025	3300048929	Bacteria	1761
793	Ga0495678_009436	3300049459	Bacteria	4828
794	Ga0495678_012518	3300049459	Bacteria	4019
795	Ga0495682_0025422	3300049460	Bacteria	2203
796	Ga0501033_0056048	3300049570	Bacteria	2914
797	Ga0501033_0173407	3300049570	Bacteria	1548
798	Ga0501034_0000042	3300049571	Bacteria	229124
799	Ga0501036_0165230	3300049572	Bacteria	1866
800	Ga0501038_0241156	3300049574	Bacteria	1435
801	Ga0501041_0047297	3300049577	Bacteria	2619
802	Ga0501042_0041141	3300049578	Bacteria	3286
803	Ga0501043_0117598	3300049579	Bacteria	2086
804	Ga0501046_0082618	3300049580	Bacteria	2481
805	Ga0501047_0024493	3300049581	Bacteria	5792
806	Ga0501047_0030160	3300049581	Bacteria	5229
807	Ga0501048_0215348	3300049582	Bacteria	1362
808	Ga0501071_0080338	3300049587	Bacteria	2384
809	Ga0501072_0029409	3300049588	Bacteria	4292
810	Ga0501075_0021514	3300049591	Bacteria	4704
811	Ga0501075_0084934	3300049591	Bacteria	2398
812	Ga0501077_0140931	3300049593	Bacteria	1529
813	Ga0501227_001375	3300049665	Bacteria	5456
814	Ga0501080_0029512	3300049742	Bacteria	5106
815	Ga0501081_0070143	3300049743	Bacteria	2442
816	Ga0501279_000660	3300049775	Bacteria	4548
817	Ga0501035_0026358	3300049822	Bacteria	5319
818	Ga0501035_0229014	3300049822	Bacteria	1584
819	Ga0501044_0000059	3300049823	Bacteria	134132
820	Ga0501044_0001443	3300049823	Bacteria	27936
821	Ga0501045_0049438	3300049824	Bacteria	3066
822	nmdc:mga03683_490_c1	3300050489	Bacteria	11307
823	nmdc:mga03n38_23536_c1	3300050490	Bacteria	2507
824	nmdc:mga03n38_32004_c1	3300050490	Bacteria	2224
825	nmdc:mga03n38_99544_c1	3300050490	Bacteria	1400
826	nmdc:mga00v17_157_c1	3300050491	Bacteria	40094
827	nmdc:mga00v17_253000_c1	3300050491	Bacteria	1142
828	nmdc:mga00v17_25948_c1	3300050491	Bacteria	3409
829	nmdc:mga00v17_3382_c1	3300050491	Bacteria	8234
830	nmdc:mga00v17_41288_c1	3300050491	Bacteria	2770
831	nmdc:mga0yw44_152651_c1	3300050492	Bacteria	1507
832	nmdc:mga0yw44_16617_c1	3300050492	Bacteria	3981
833	nmdc:mga0yw44_246638_c1	3300050492	Bacteria	1188
834	nmdc:mga0yw44_36855_c1	3300050492	Bacteria	2885
835	nmdc:mga0k408_103016_c1	3300050493	Bacteria	1684
836	nmdc:mga0k408_134985_c1	3300050493	Bacteria	1466
837	nmdc:mga0k408_15670_c1	3300050493	Bacteria	4196
838	nmdc:mga0k408_264_c1	3300050493	Bacteria	28733
839	nmdc:mga06z11_43335_c1	3300050494	Bacteria	2263
840	nmdc:mga07m45_101710_c1	3300050496	Bacteria	1650
841	nmdc:mga07m45_18103_c1	3300050496	Bacteria	3796
842	nmdc:mga07m45_33873_c1	3300050496	Bacteria	2838
843	nmdc:mga0qj67_26252_c1	3300050509	Bacteria	4508
844	Ga0495619_0027397	3300053085	Unclassified	3669
845	Ga0500643_005454	3300053087	Bacteria	5481
846	Ga0500581_047926	3300053089	Bacteria	2182
847	Ga0500647_0001969	3300053091	Bacteria	7413
848	Ga0500583_0080956	3300053092	Bacteria	1568
849	Ga0500651_0000011	3300053093	Bacteria	246573
850	Ga0500566_0002124	3300053094	Bacteria	11676
851	Ga0500556_0000058	3300053104	Bacteria	114257
852	Ga0500557_000056	3300053105	Bacteria	49363
853	Ga0500562_008953	3300053108	Bacteria	2529
854	Ga0500569_017661	3300053109	Bacteria	1828
855	Ga0500571_000008	3300053110	Bacteria	87309
856	Ga0500595_006780	3300053119	Bacteria	4823
857	Ga0500595_022855	3300053119	Bacteria	2205
858	Ga0500614_013147	3300053123	Bacteria	1815
859	Ga0500642_0000025	3300053130	Bacteria	130425
860	Ga0500642_0000295	3300053130	Bacteria	18073
861	Ga0500652_000007	3300053131	Bacteria	165913
862	Ga0500652_001122	3300053131	Bacteria	8613
863	Ga0500655_000511	3300053133	Bacteria	7830
864	Ga0500658_0000085	3300053134	Bacteria	43497
865	Ga0500658_0000181	3300053134	Bacteria	29974
866	Ga0500658_0017903	3300053134	Bacteria	2651
867	Ga0500658_0028537	3300053134	Bacteria	2166
868	Ga0500559_0005262	3300053136	Bacteria	5965
869	Ga0500559_0051010	3300053136	Bacteria	1826
870	Ga0500568_0000547	3300053139	Bacteria	27675
871	Ga0500568_0001205	3300053139	Bacteria	17266
872	Ga0500574_005440	3300053141	Bacteria	2481
873	Ga0500588_0003547	3300053146	Bacteria	3306
874	Ga0500600_0024281	3300053149	Bacteria	3613
875	Ga0500604_0011096	3300053151	Bacteria	2416
876	Ga0500620_035558	3300053155	Bacteria	1606
877	Ga0500622_0000112	3300053156	Bacteria	83558
878	Ga0500627_0019290	3300053158	Bacteria	2714
879	Ga0500634_0016121	3300053161	Bacteria	3983
880	Ga0500634_0034310	3300053161	Bacteria	2764
881	Ga0500634_0041670	3300053161	Bacteria	2493
882	Ga0500634_0048936	3300053161	Bacteria	2280
883	Ga0500638_062146	3300053162	Bacteria	1793
884	Ga0500636_0073472	3300053177	Bacteria	1980
885	Ga0500611_001649	3300053727	Bacteria	2514
886	Ga0590075_026072	3300059424	Bacteria	1471
887	Ga0587090_000446	3300059510	Bacteria	3416
888	Ga0587072_000808	3300059643	Bacteria	3495
889	Ga0587124_000762	3300059660	Bacteria	1893
890	Ga0501082_0020019	3300060353	Bacteria	5766
891	Ga0501082_0361104	3300060353	Bacteria	1267
892	Ga0466962_0006642	3300061719	Bacteria	5550
893	Ga0466962_0021693	3300061719	Bacteria	3082
894	2501071161	2501025501	Bacteria	7768574
895	2501078646	2501025502	Bacteria	9641094
896	2501414043	2501025504	Bacteria	8008976
897	2506577259	2506520007	Bacteria	5442880
898	2506582397	2506520008	Bacteria	5443009
899	2508851188	2508501071	Bacteria	5454741
900	2509127460	2508501125	Bacteria	7208311
901	2509153415	2508501128	Bacteria	8613869
902	2510250135	2510065045	Bacteria	7761063
903	2511089293	2510917013	Bacteria	9951648
904	2511094697	2510917014	Bacteria	8296963
905	2511104407	2510917015	Bacteria	7950052
906	2512347686	2512047030	Bacteria	9031815
907	2513555977	2513237082	Bacteria	8640282
908	2513565530	2513237083	Bacteria	8410967
909	2513658138	2513237096	Bacteria	8722461
910	2513675972	2513237098	Bacteria	9902361
911	2513678860	2513237098	Bacteria	9902361
912	2513723552	2513237104	Bacteria	10034502
913	2513860270	2513237137	Bacteria	9558895
914	2513889889	2513237141	Bacteria	8496279
915	2513920370	2513237145	Bacteria	8979722
916	2513962164	2513237151	Bacteria	6309801
917	2515679273	2515154122	Bacteria	8609520
918	2515688480	2515154123	Bacteria	6387382
919	2516017150	2515154189	Bacteria	9629850
920	2517105405	2517093001	Bacteria	9002274
921	2517889207	2517572143	Bacteria	9484767
922	2521560316	2521172590	Bacteria	5047645
923	2524467980	2524023210	Bacteria	9029266
924	2524541580	2524023228	Bacteria	10118060
925	2527076825	2526164713	Bacteria	6780608
926	2535484790	2534681786	Bacteria	3308809
927	2563062146	2562617112	Bacteria	10918404
928	2599396456	2599185167	Bacteria	6353609
929	2599453488	2599185179	Bacteria	6611171
930	2599514769	2599185190	Bacteria	6285678
931	2599517249	2599185191	Bacteria	6297582
932	2599893966	2599185290	Bacteria	6289611
933	2599904353	2599185292	Bacteria	6290804
934	2600005361	2599185313	Bacteria	6658188
935	2600072358	2599185324	Bacteria	6590677
936	2600812632	2600255067	Bacteria	6795583
937	2643734223	2643221542	Bacteria	3563959
938	2644161231	2643221628	Bacteria	5745828
939	2644170809	2643221630	Bacteria	3601215
940	2656277915	2654587920	Bacteria	5475511
941	2671118403	2667528175	Bacteria	7532676
942	2689443715	2687453601	Bacteria	5546041
943	2713478006	2711768613	Bacteria	11048459
944	2719639293	2718217991	Bacteria	7829542
945	2723877632	2721755763	Bacteria	4464185
946	2728749317	2728368998	Bacteria	8720350
947	2738717898	2738541277	Bacteria	7458140
948	2738819924	2738541296	Bacteria	7285013
949	2738832404	2738541298	Bacteria	7286732
950	2738873931	2738541306	Bacteria	7284992
951	2739185561	2738543002	Bacteria	7284546
952	2739220529	2738543008	Bacteria	7282815
953	2739278584	2738543019	Bacteria	7459457
954	2746092048	2744054900	Bacteria	8399525
955	2746093641	2744054901	Bacteria	8397047
956	2753357371	2751185800	Bacteria	5467370
957	2753359403	2751185800	Bacteria	5467370
958	2757572385	2757320392	Bacteria	3737298
959	2758641665	2758568016	Bacteria	5645291
960	2777762776	2775507177	Bacteria	4384303
961	2793078954
962	2807180513	2806310673	Bacteria	4801221
963	2808891892	2808606370	Bacteria	4942454
964	2808897002	2808606371	Bacteria	4251511
965	2819594832	2818991445	Bacteria	4955017
966	2819616678	2818991449	Bacteria	5518009
967	2819621039	2818991450	Bacteria	6962147
968	2821134442	2821131069	Bacteria	6108407
969	2824710736	2824704595	Bacteria	9667483
970	2824761312	2824753945	Bacteria	9787441
971	2824765916	2824763712	Bacteria	9792355
972	2842331167	2842324504	Bacteria	9364110
973	2842355506	2842348783	Bacteria	9002918
974	2842457895	2842454564	Bacteria	8730687
975	2842681162	2842677519	Bacteria	5615038
976	2854911970	2854911287	Bacteria	5582813
977	2857364653	2857357740	Bacteria	9937880
978	2857570104	2857564685	Bacteria	6290584
979	2869553114	2869551831	Bacteria	5474685
980	2874635542	2874628541	Bacteria	8630250
981	2876812528	2876808645	Bacteria	8824342
982	2879116171	2879110137	Bacteria	8907982
983	2883093841	2883087390	Bacteria	9532701
984	2885278402	2885270888	Bacteria	9831543
985	2885380165	2885374607	Bacteria	8927485
986	2885392379	2885383462	Bacteria	9473874
987	2888368166	2888366609	Bacteria	5155009
988	2888374221	2888373701	Bacteria	5098052
989	2888381744	2888378607	Bacteria	9652610
990	2900635452	2900634093	Bacteria	10263517
991	2900636050	2900634093	Bacteria	10263517
992	2902683285	2902682994	Bacteria	8951596
993	2903751239	2903748898	Bacteria	9972761
994	2903752196	2903748898	Bacteria	9972761
995	2903775544	2903768456	Bacteria	9749579
996	2904442555	2904439833	Bacteria	5931679
997	2904454136	2904449895	Bacteria	6927402
998	2904462007	2904456579	Bacteria	6819253
999	2904484146	2904483920	Bacteria	7545285
1000	2904535237	2904530477	Bacteria	5876334
1001	2904542026	2904541872	Bacteria	8915136
1002	2904589581	2904584206	Bacteria	6028872
1003	2904594488	2904589729	Bacteria	6113573
1004	2904606254	2904601388	Bacteria	5884906
1005	2904624589	2904615490	Bacteria	10047340
1006	2904706917
1007	2904715353	2904711408	Bacteria	9771557
1008	2906617002
1009	2906641336	2906635258	Bacteria	8601019
1010	2906668530	2906660503	Bacteria	8595048
1011	2915653891	2915650412	Bacteria	4288180
1012	2919076965	2919073203	Bacteria	6531949
1013	2919084203	2919079590	Bacteria	5946433
1014	2919391401	2919391150	Bacteria	4884741
1015	2919465264	2919462493	Bacteria	5817112
1016	2919497461	2919493220	Bacteria	4598500
1017	2919530088	2919527303	Bacteria	7718827
1018	2919546078	2919543075	Bacteria	4728703
1019	2921654750	2921643360	Bacteria	11448031
1020	2923514090	2923510766	Bacteria	5926163
1021	2923529636	2923525760	Bacteria	4472324
1022	2928084515	2928084124	Bacteria	7159212
1023	2928109842	2928108538	Bacteria	7360024
1024	2928136703	2928135762	Bacteria	7259641
1025	2928508917	2928503688	Bacteria	7268108
1026	2929167316	2929160207	Bacteria	9075316
1027	2931392655	2931390751	Bacteria	6273349
1028	2932408407	2932406140	Bacteria	5134491
1029	2939580068	2939577877	Bacteria	5132791
1030	2945918338	2945916053	Bacteria	4555517
1031	2945935711	2945934425	Bacteria	7444609
1032	2945959786	2945956166	Bacteria	5110334
1033	2945973934	2945972063	Bacteria	6086495
1034	2946037831	2946037020	Bacteria	4900426
1035	2953999660	2953998280	Bacteria	4812144
1036	2990710376	2990703756	Bacteria	7715990
1037	3001271538	3001267043	Bacteria	4823521
1038	3001272485	3001272096	Bacteria	4729684
1039	3005480733	3005474847	Bacteria	9259049
1040	3006987758	3006984091	Bacteria	4207523
1041	3006992270	3006988479	Bacteria	4767936
1042	640936761	640753048	Bacteria	5495657
1043	642594062	642555112	Bacteria	8676562
1044	642620476	642555113	Bacteria	8214658
1045	642621065	642555113	Bacteria	8214658
1046	8003961804	8003955200	Bacteria	8601927
1047	8004023410	8004021418	Bacteria	4313954
1048	8004026504	8004025490	Bacteria	4327753
1049	8004597540	8004592986	Bacteria	5122074
1050	8006934693	8006933436	Bacteria	10410654
1051	8006974661	8006973647	Bacteria	10679141
1052	8006985411	8006984368	Bacteria	9651211
1053	8019648932	8019648815	Bacteria	10014479
1054	8055266537	8055266321	Bacteria	7999742
1055	8055305064	8055301274	Bacteria	8587385
1056	8056684960	8056681323	Bacteria	8472857
1057	Ga0307409_100006258
1058	LJQas_1008444
1059	JGI24740J21852_10002056
1060	JGI24739J22299_10003515
1061	JGI24739J22299_10021682
1062	JGI24735J21928_10003656
1063	JGI24735J21928_10010195
1064	JGI24738J21930_10010003
1065	JGI25156J39149_1000178
1066	JGI25156J39149_1000226
1067	JGI25156J39149_1000337
1068	JGI25156J39149_1007431
1069	JGI25159J45721_1000145
1070	JGI25151J46595_10001061
1071	JGI25151J46595_10004161
1072	JGI25165J46597_1001162
1073	rootH2_10299511
1074	rootH1_10007027
1075	JGI25160J50197_1000327
1076	JGI25161J50226_1000245
1077	Ga0007409J51694_1005204
1078	Ga0007416J51690_1004145
1079	Ga0032354_1011833
1080	Ga0055538_1000002
1081	Ga0055539_1000002
1082	Ga0055533_1000004
1083	Ga0055533_1000124
1084	Ga0055533_1000563
1085	Ga0055532_1000001
1086	Ga0055525_1000002
1087	Ga0055527_1000014
1088	Ga0055535_1000001
1089	Ga0055542_1000001
1090	Ga0055529_1000001
1091	Ga0055529_1000100
1092	Ga0055526_1013866
1093	Ga0055537_1000229
1094	Ga0055536_1002843
1095	Ga0055534_1000081
1096	Ga0055528_1000107
1097	Ga0055540_1000641
1098	Ga0055531_10003438
1099	Ga0055541_1000002
1100	Ga0055543_1000325
1101	Ga0055543_1002357
1102	Ga0065165_1000120
1103	Ga0065165_1001062
1104	Ga0065165_1002142
1105	Ga0065704_10081616
1106	Ga0070658_10000023
1107	Ga0070658_10002509
1108	Ga0068869_100003661
1109	Ga0070666_10034313
1110	Ga0068868_100080764
1111	Ga0070660_100067618
1112	Ga0070687_100008147
1113	Ga0070692_10048994
1114	Ga0070669_100052901
1115	Ga0070671_100122145
1116	Ga0070674_100031273
1117	Ga0070674_100116630
1118	Ga0070674_100253909
1119	Ga0070673_100000226
1120	Ga0070659_100202824
1121	Ga0070659_100247619
1122	Ga0070667_100229459
1123	Ga0070713_100000597
1124	Ga0070710_10160650
1125	Ga0070705_100014971
1126	Ga0070700_100009577
1127	Ga0070694_100053561
1128	Ga0070663_100034260
1129	Ga0070663_100083409
1130	Ga0070678_100000633
1131	Ga0070678_100070874
1132	Ga0070681_10014815
1133	Ga0070681_10034876
1134	Ga0070681_10185792
1135	Ga0068867_100004040
1136	Ga0068867_100012498
1137	Ga0070685_10045066
1138	Ga0070679_100099164
1139	Ga0070684_100035112
1140	Ga0070697_100037403
1141	Ga0068853_100044527
1142	Ga0068853_100045570
1143	Ga0068853_100228122
1144	Ga0070672_100002363
1145	Ga0070672_100097588
1146	Ga0070686_100000404
1147	Ga0070695_100007120
1148	Ga0070696_100004953
1149	Ga0070665_100001295
1150	Ga0070665_100066937
1151	Ga0070665_100137102
1152	Ga0070665_100213471
1153	Ga0070665_100260884
1154	Ga0070665_100320649
1155	Ga0068855_100014208
1156	Ga0068855_100026819
1157	Ga0068855_100074389
1158	Ga0068855_100365544
1159	Ga0068854_100006860
1160	Ga0068854_100007052
1161	Ga0068854_100048170
1162	Ga0068854_100137278
1163	Ga0068854_100244785
1164	Ga0070702_100014379
1165	Ga0068852_100046505
1166	Ga0068859_100069877
1167	Ga0068864_100022903
1168	Ga0068866_10000265
1169	Ga0068861_100000207
1170	Ga0068851_10000255
1171	Ga0068870_10025274
1172	Ga0068858_100003094
1173	Ga0068860_100024757
1174	Ga0068862_100002710
1175	Ga0081455_10018727
1176	Ga0081540_1014084
1177	Ga0081540_1014939
1178	Ga0075365_10021610
1179	Ga0075365_10176295
1180	Ga0075363_100095788
1181	Ga0075364_10000085
1182	Ga0075364_10000342
1183	Ga0075364_10031014
1184	Ga0075364_10112207
1185	Ga0075362_10002319
1186	Ga0075362_10058467
1187	Ga0075367_10005597
1188	Ga0075367_10007757
1189	Ga0075369_10006660
1190	Ga0075369_10057272
1191	Ga0075369_10094925
1192	Ga0075369_10112983
1193	Ga0075366_10000152
1194	Ga0075366_10007229
1195	Ga0075366_10011587
1196	Ga0075366_10012147
1197	Ga0075366_10020135
1198	Ga0075366_10127546
1199	Ga0075366_10128855
1200	Ga0075366_10143559
1201	Ga0097621_100010305
1202	Ga0075370_10011056
1203	Ga0075428_100012004
1204	Ga0075430_100031742
1205	Ga0068865_100019287
1206	Ga0097620_100069877
1207	Ga0099822_1024140
1208	Ga0079104_1001448
1209	Ga0079104_1001983
1210	Ga0079104_1003315
1211	Ga0079104_1008755
1212	Ga0099826_10000087
1213	Ga0099795_10000287
1214	Ga0099795_10023436
1215	Ga0105251_10000405
1216	Ga0105251_10000869
1217	Ga0105251_10001189
1218	Ga0105251_10001416
1219	Ga0105251_10006773
1220	Ga0105251_10008305
1221	Ga0105251_10042879
1222	Ga0105251_10077891
1223	Ga0105244_10000864
1224	Ga0105244_10003298
1225	Ga0105244_10030368
1226	Ga0105250_10009703
1227	Ga0105250_10075631
1228	Ga0105240_10037364
1229	Ga0105240_10043539
1230	Ga0105240_10052645
1231	Ga0105240_10112554
1232	Ga0105240_10234108
1233	Ga0105245_10000257
1234	Ga0105245_10233232
1235	Ga0105247_10000018
1236	Ga0105247_10025401
1237	Ga0105247_10141698
1238	Ga0114129_10134216
1239	Ga0105243_10002572
1240	Ga0105243_10549837
1241	Ga0105241_10000004
1242	Ga0105241_10038817
1243	Ga0105242_10000371
1244	Ga0105242_10015952
1245	Ga0105242_10293720
1246	Ga0105248_10038127
1247	Ga0105248_10067149
1248	Ga0105248_10288123
1249	Ga0105248_10587945
1250	Ga0105237_10019838
1251	Ga0105237_10059278
1252	Ga0105238_10000038
1253	Ga0105238_10088633
1254	Ga0105238_10236725
1255	Ga0105249_10000243
1256	Ga0105249_10066635
1257	Ga0105249_10117450
1258	Ga0105249_10127223
1259	Ga0105249_10508503
1260	Ga0099796_10007059
1261	Ga0105239_10000303
1262	Ga0105239_10015338
1263	Ga0157347_1003449
1264	Ga0157373_10000633
1265	Ga0157373_10000981
1266	Ga0157373_10001613
1267	Ga0157373_10009523
1268	Ga0157371_10005108
1269	Ga0157371_10013078
1270	Ga0157370_10000485
1271	Ga0157370_10000756
1272	Ga0157370_10012877
1273	Ga0157370_10013422
1274	Ga0157369_10000138
1275	Ga0157369_10000510
1276	Ga0157369_10014085
1277	Ga0157369_10024923
1278	Ga0157369_10034798
1279	Ga0157369_10035030
1280	Ga0157369_10103667
1281	Ga0157369_10118636
1282	Ga0157374_10000056
1283	Ga0157374_10064879
1284	Ga0157374_10159705
1285	Ga0157374_10268028
1286	Ga0157378_10000651
1287	Ga0157378_10005243
1288	Ga0163162_10031705
1289	Ga0163162_10144520
1290	Ga0163162_10194891
1291	Ga0163162_10355455
1292	Ga0163162_10433579
1293	Ga0163162_10518994
1294	Ga0163162_10542389
1295	Ga0157372_10018305
1296	Ga0157372_10271228
1297	Ga0157372_10435499
1298	Ga0157375_10165333
1299	Ga0157375_10221768
1300	Ga0157375_10456583
1301	Ga0157375_10473760
1302	Ga0163163_10014066
1303	Ga0157380_10004646
1304	Ga0157380_10124899
1305	Ga0182008_10000556
1306	Ga0182008_10004707
1307	Ga0182008_10028269
1308	Ga0157379_10011772
1309	Ga0157376_10000001
1310	Ga0182006_1000118
1311	Ga0182006_1000152
1312	Ga0182006_1002843
1313	Ga0182006_1008317
1314	Ga0182006_1058423
1315	Ga0182007_10002938
1316	Ga0182005_1000005
1317	Ga0183361_10018
1318	Ga0163161_10000004
1319	Ga0163161_10000738
1320	Ga0163161_10037604
1321	Ga0224712_10000040
1322	Ga0224712_10058763
1323	Ga0209436_100135
1324	Ga0209784_100002
1325	Ga0209566_100003
1326	Ga0209674_100004
1327	Ga0209674_100005
1328	Ga0209674_100150
1329	Ga0209672_100001
1330	Ga0209147_100001
1331	Ga0209563_100006
1332	Ga0209563_100794
1333	Ga0207427_100394
1334	Ga0209258_100001
1335	Ga0209677_100003
1336	Ga0209148_1000003
1337	Ga0209148_1000620
1338	Ga0209759_1000228
1339	Ga0209759_1000275
1340	Ga0209759_1000543
1341	Ga0209759_1001138
1342	Ga0209129_1001909
1343	Ga0209233_1000016
1344	Ga0209565_1000150
1345	Ga0209455_1000001
1346	Ga0209455_1000047
1347	Ga0209673_1000114
1348	Ga0209130_1000057
1349	Ga0209130_1000574
1350	Ga0209675_1000062
1351	Ga0209676_1000164
1352	Ga0209676_1000244
1353	Ga0209676_1021981
1354	Ga0209025_1000049
1355	Ga0209025_1000191
1356	Ga0209025_1000709
1357	Ga0209564_1002709
1358	Ga0209564_1004984
1359	Ga0209050_1000904
1360	Ga0207426_1000657
1361	Ga0207426_1002801
1362	Ga0207426_1006276
1363	Ga0209051_1000208
1364	Ga0209257_1004516
1365	Ga0209257_1010985
1366	Ga0207656_10001797
1367	Ga0207696_1000001
1368	Ga0207655_1001151
1369	Ga0207655_1003515
1370	Ga0207713_1000093
1371	Ga0207713_1000205
1372	Ga0207713_1000699
1373	Ga0207713_1001376
1374	Ga0207713_1001567
1375	Ga0207642_10022646
1376	Ga0207710_10000016
1377	Ga0207647_10000410
1378	Ga0207647_10000430
1379	Ga0207647_10011603
1380	Ga0207647_10013337
1381	Ga0207647_10013559
1382	Ga0207645_10008061
1383	Ga0207645_10019099
1384	Ga0207705_10000129
1385	Ga0207705_10005484
1386	Ga0207654_10000006
1387	Ga0207707_10046163
1388	Ga0207707_10102181
1389	Ga0207695_10012277
1390	Ga0207695_10012751
1391	Ga0207695_10063221
1392	Ga0207671_10171065
1393	Ga0207671_10187055
1394	Ga0207693_10265151
1395	Ga0207663_10206381
1396	Ga0207660_10178590
1397	Ga0207657_10013828
1398	Ga0207652_10021290
1399	Ga0207694_10000126
1400	Ga0207694_10013637
1401	Ga0207694_10279127
1402	Ga0207687_10023025
1403	Ga0207700_10004741
1404	Ga0207690_10179013
1405	Ga0207686_10003545
1406	Ga0207686_10047434
1407	Ga0207709_10003067
1408	Ga0207669_10024658
1409	Ga0207669_10045061
1410	Ga0207669_10176018
1411	Ga0207704_10005412
1412	Ga0207691_10135597
1413	Ga0207711_10026051
1414	Ga0207711_10309015
1415	Ga0207711_10444961
1416	Ga0207689_10000465
1417	Ga0207689_10129531
1418	Ga0207667_10000427
1419	Ga0207667_10028128
1420	Ga0207667_10148183
1421	Ga0207667_10319366
1422	Ga0207651_10000125
1423	Ga0207712_10000433
1424	Ga0207712_10069123
1425	Ga0207668_10099867
1426	Ga0207640_10077107
1427	Ga0207640_10236046
1428	Ga0207658_10139733
1429	Ga0207677_10023862
1430	Ga0207703_10015850
1431	Ga0207678_10106794
1432	Ga0207678_10126657
1433	Ga0207708_10000376
1434	Ga0207702_10278497
1435	Ga0207641_10129547
1436	Ga0207648_10000092
1437	Ga0207676_10041160
1438	Ga0207674_10244418
1439	Ga0207675_100000181
1440	Ga0207675_100222708
1441	Ga0207683_10001307
1442	Ga0207683_10098198
1443	Ga0209281_1001285
1444	Ga0209281_1005294
1445	Ga0209589_1000014
1446	Ga0209489_100014
1447	Ga0209700_100024
1448	Ga0209282_1002130
1449	Ga0268266_10000916
1450	Ga0268266_10023525
1451	Ga0268266_10218115
1452	Ga0268266_10284684
1453	Ga0268265_10006000
1454	Ga0268264_10021329
1455	Ga0265338_10049870
1456	Ga0307511_10000109
1457	Ga0316180_1141634
1458	Ga0316181_1264586
1459	Ga0265328_10000002
1460	Ga0265328_10007645
1461	Ga0265320_10100830
1462	Ga0265331_10053560
1463	Ga0265327_10005493
1464	Ga0265316_10000511
1465	Ga0307408_100001595
1466	Ga0307408_100009230
1467	Ga0307408_100030979
1468	Ga0307408_100087687
1469	Ga0316576_10004707
1470	Ga0316578_10027905
1471	Ga0307405_10026202
1472	Ga0307405_10109589
1473	Ga0316577_10202466
1474	Ga0307413_10253810
1475	Ga0307410_10010788
1476	Ga0307407_10048464
1477	Ga0307412_10000005
1478	Ga0307412_10000069
1479	Ga0307412_10009054
1480	Ga0307412_10020542
1481	Ga0307409_100364197
1482	Ga0307416_100006168
1483	Ga0307416_100008505
1484	Ga0307416_100090969
1485	Ga0307414_10100900
1486	Ga0307510_10000948
1487	Ga0315911_1000018
1488	Ga0316574_0013130
1489	Ga0316582_0276906
1490	Ga0316584_0002399
1491	Ga0316584_0014538
1492	Ga0395899_0040683
1493	Ga0395900_0052659
1494	Ga0395900_0216701
1495	Ga0395900_0233979
1496	Ga0395898_0012898
1497	Ga0395898_0073469
1498	Ga0395898_0131666
1499	Ga0395905_0000236
1500	Ga0395905_0007181
1501	Ga0395905_0007879
1502	Ga0395905_0008311
1503	Ga0395905_0015581
1504	Ga0395905_0031654
1505	Ga0395905_0036002
1506	Ga0395905_0165040
1507	Ga0395905_0275078
1508	Ga0395905_0279247
1509	Ga0395901_0000154
1510	Ga0395901_0004377
1511	Ga0395901_0031280
1512	Ga0395901_0447378
1513	Ga0439439_0010800
1514	Ga0439466_0008698
1515	Ga0451807_1151223
1516	Ga0439449_0011594
1517	Ga0439462_0005035
1518	Ga0439463_004189
1519	Ga0439446_0032084
1520	Ga0450909_005168
1521	Ga0451577_0008941
1522	Ga0466969_0003919
1523	Ga0466972_0055584
1524	Ga0466973_0023612
1525	Ga0466966_0000008
1526	Ga0466966_0003154
1527	Ga0466961_0007135
1528	Ga0466961_0042890
1529	Ga0466963_0003221
1530	Ga0466963_0004171
1531	Ga0466964_0005801
1532	Ga0453684_0041659
1533	Ga0453684_0094361
1534	Ga0453684_0158893
1535	Ga0466957_0032011
1536	Ga0466957_0053462
1537	Ga0466959_0000027
1538	Ga0466967_0074519
1539	Ga0495627_000038
1540	Ga0495627_000231
1541	Ga0495627_000396
1542	Ga0495592_0008737
1543	Ga0495603_0021997
1544	Ga0495603_0055671
1545	Ga0495603_0187281
1546	Ga0495590_0000062
1547	Ga0495590_0003467
1548	Ga0495590_0019222
1549	Ga0495591_001099
1550	Ga0495629_0000054
1551	Ga0495629_0000099
1552	Ga0495629_0047453
1553	Ga0495629_0067906
1554	Ga0495638_0007214
1555	Ga0495638_0007523
1556	Ga0495638_0016585
1557	Ga0495638_0035271
1558	Ga0495638_0120959
1559	Ga0495651_0036224
1560	Ga0495651_0059265
1561	Ga0495651_0070947
1562	Ga0495653_0000099
1563	Ga0495653_0013098
1564	Ga0495650_0001143
1565	Ga0495650_0002455
1566	Ga0495650_0002504
1567	Ga0495650_0018748
1568	Ga0495580_0000082
1569	Ga0495580_0000208
1570	Ga0495580_0014112
1571	Ga0495580_0015382
1572	Ga0495580_0038009
1573	Ga0495580_0048682
1574	Ga0495580_0054404
1575	Ga0495582_0008194
1576	Ga0495582_0010405
1577	Ga0495582_0015819
1578	Ga0495582_0019610
1579	Ga0495582_0052010
1580	Ga0495605_0000250
1581	Ga0495605_0002569
1582	Ga0495605_0004126
1583	Ga0495605_0009441
1584	Ga0495664_0012257
1585	Ga0495584_0000055
1586	Ga0495596_0001254
1587	Ga0495596_0015853
1588	Ga0495607_0002944
1589	Ga0495583_0003132
1590	Ga0495583_0006321
1591	Ga0495606_0000240
1592	Ga0495606_0009476
1593	Ga0495606_0015029
1594	Ga0495606_0020115
1595	Ga0495606_0040054
1596	Ga0495606_0152876
1597	Ga0495610_0001010
1598	Ga0495610_0005858
1599	Ga0495616_0000211
1600	Ga0495618_0030599
1601	Ga0495620_0000720
1602	Ga0495620_0011883
1603	Ga0495620_0016675
1604	Ga0495628_0004119
1605	Ga0495628_0017922
1606	Ga0495628_0065029
1607	Ga0495628_0065782
1608	Ga0495628_0173768
1609	Ga0495630_0003148
1610	Ga0495630_0006005
1611	Ga0495631_0000054
1612	Ga0495631_0000932
1613	Ga0495637_0012154
1614	Ga0495643_0045249
1615	Ga0495644_0045471
1616	Ga0495648_0000971
1617	Ga0495648_0003217
1618	Ga0495648_0004756
1619	Ga0495648_0052631
1620	Ga0495648_0114174
1621	Ga0495648_0149648
1622	Ga0495666_0054900
1623	Ga0495666_0064354
1624	Ga0495666_0130873
1625	Ga0495642_0000006
1626	Ga0495652_0024230
1627	Ga0495652_0047659
1628	Ga0495654_0000424
1629	Ga0495654_0006828
1630	Ga0495654_0010213
1631	Ga0495654_0045562
1632	Ga0495654_0051889
1633	Ga0495665_0006780
1634	Ga0495665_0010499
1635	Ga0495665_0012030
1636	Ga0495665_0022519
1637	Ga0495665_0048049
1638	Ga0495640_0002986
1639	Ga0495640_0006341
1640	Ga0495640_0071184
1641	Ga0495586_0030103
1642	Ga0495586_0123042
1643	Ga0495586_0195080
1644	Ga0495587_0041837
1645	Ga0495609_0000069
1646	Ga0495609_0000357
1647	Ga0495621_0001102
1648	Ga0495621_0030015
1649	Ga0495597_0007210
1650	Ga0495645_0018667
1651	Ga0495622_0000880
1652	Ga0495633_0008364
1653	Ga0495667_0004661
1654	Ga0495668_0000064
1655	Ga0495668_0000319
1656	Ga0495668_0003544
1657	Ga0495668_0025365
1658	Ga0495634_0142422
1659	Ga0495611_0017239
1660	Ga0495611_0046716
1661	Ga0495611_0117353
1662	Ga0495625_0020529
1663	Ga0495625_0049416
1664	Ga0495625_0172162
1665	Ga0495635_0029567
1666	Ga0495661_0017617
1667	Ga0495661_0020918
1668	Ga0495661_0155273
1669	Ga0495657_0021542
1670	Ga0495657_0079614
1671	Ga0495599_0019288
1672	Ga0495623_0002988
1673	Ga0495623_0034113
1674	Ga0495623_0104159
1675	Ga0495646_0001798
1676	Ga0495646_0003633
1677	Ga0495646_0048346
1678	Ga0495669_0004952
1679	Ga0495669_0008446
1680	Ga0495613_0007126
1681	Ga0495613_0109898
1682	Ga0495624_0002851
1683	Ga0495624_0014790
1684	Ga0495624_0016562
1685	Ga0495624_0018031
1686	Ga0495624_0046239
1687	Ga0495624_0051742
1688	Ga0495670_0000603
1689	Ga0495670_0002733
1690	Ga0495671_0001569
1691	Ga0495671_0020281
1692	Ga0495671_0023174
1693	Ga0495671_0045650
1694	Ga0495671_0047884
1695	Ga0495649_0000844
1696	Ga0495649_0005939
1697	Ga0495649_0055517
1698	Ga0495649_0066462
1699	Ga0495589_0000002
1700	Ga0495589_0000928
1701	Ga0495589_0025596
1702	Ga0495600_0004096
1703	Ga0495660_0000080
1704	Ga0495660_0000177
1705	Ga0495581_0014339
1706	Ga0495604_0018563
1707	Ga0495604_0020358
1708	Ga0495604_0025620
1709	Ga0495604_0080016
1710	Ga0495674_0004220
1711	Ga0495674_0007713
1712	Ga0495674_0012326
1713	Ga0495674_0057474
1714	Ga0495674_0118705
1715	Ga0495674_0149829
1716	Ga0495674_0341658
1717	Ga0495672_0000010
1718	Ga0495672_0000158
1719	Ga0495672_0004354
1720	Ga0495672_0014192
1721	Ga0495672_0121310
1722	Ga0495676_0022045
1723	Ga0495680_0023583
1724	Ga0495680_0031745
1725	Ga0495680_0069170
1726	Ga0495680_0076445
1727	Ga0495683_0002027
1728	Ga0495683_0004646
1729	Ga0495683_0015176
1730	Ga0495683_0026041
1731	Ga0495687_000104
1732	Ga0495687_013575
1733	Ga0495687_014501
1734	Ga0495687_026210
1735	Ga0495687_030850
1736	Ga0495687_037021
1737	Ga0495687_042575
1738	Ga0495675_0001679
1739	Ga0495675_0054579
1740	Ga0495675_0072682
1741	Ga0495679_000062
1742	Ga0495679_000063
1743	Ga0495679_001490
1744	Ga0495679_002444
1745	Ga0495679_013378
1746	Ga0495673_0001271
1747	Ga0495673_0019368
1748	Ga0495673_0049331
1749	Ga0495673_0050304
1750	Ga0495673_0061242
1751	Ga0495684_0138695
1752	Ga0495686_0002575
1753	Ga0495686_0028742
1754	Ga0495686_0041236
1755	Ga0495686_0043715
1756	Ga0495593_0011480
1757	Ga0495593_0019601
1758	Ga0495593_0044331
1759	Ga0495602_0000856
1760	Ga0495602_0028550
1761	Ga0495602_0081496
1762	Ga0495614_0118602
1763	Ga0496100_0063024
1764	Ga0496100_0064098
1765	Ga0496101_0001501
1766	Ga0496101_0009824
1767	Ga0496101_0076060
1768	Ga0496101_0261609
1769	Ga0496102_0004504
1770	Ga0496102_0004959
1771	Ga0496102_0005431
1772	Ga0496102_0016284
1773	Ga0496102_0042541
1774	Ga0496102_0085628
1775	Ga0496102_0151506
1776	Ga0496102_0179263
1777	Ga0496102_0192183
1778	Ga0496102_0193752
1779	Ga0496102_0311666
1780	Ga0496102_0479345
1781	Ga0496103_0001546
1782	Ga0496103_0002245
1783	Ga0496103_0004401
1784	Ga0496103_0011170
1785	Ga0496103_0098874
1786	Ga0496104_0099819
1787	Ga0496105_0018285
1788	Ga0496106_0002122
1789	Ga0496107_0025617
1790	Ga0496107_0037012
1791	Ga0496108_0334082
1792	Ga0496109_0162694
1793	Ga0496110_0005967
1794	Ga0496110_0383698
1795	Ga0496111_0031413
1796	Ga0496112_0113275
1797	Ga0496114_0065402
1798	Ga0496116_0000031
1799	Ga0496117_0001221
1800	Ga0496117_0003334
1801	Ga0496117_0012014
1802	Ga0496117_0024611
1803	Ga0496117_0117992
1804	Ga0496117_0170475
1805	Ga0496118_0001708
1806	Ga0496118_0004252
1807	Ga0496118_0016225
1808	Ga0496118_0044336
1809	Ga0496118_0072369
1810	Ga0496119_0000468
1811	Ga0496119_0033243
1812	Ga0496120_0000137
1813	Ga0496121_0000437
1814	Ga0496121_0000573
1815	Ga0496121_0006494
1816	Ga0496121_0009566
1817	Ga0496121_0014837
1818	Ga0496121_0051729
1819	Ga0496121_0161963
1820	Ga0496122_0001630
1821	Ga0496122_0002855
1822	Ga0496122_0041369
1823	Ga0496122_0072071
1824	Ga0496123_0001111
1825	Ga0496123_0003528
1826	Ga0496123_0015546
1827	Ga0496123_0048914
1828	Ga0496124_0000017
1829	Ga0496124_0000138
1830	Ga0496124_0002733
1831	Ga0496124_0205923
1832	Ga0496125_0001586
1833	Ga0496125_0007850
1834	Ga0496125_0022722
1835	Ga0496125_0046935
1836	Ga0496125_0076609
1837	Ga0496125_0118496
1838	Ga0496126_0000034
1839	Ga0496126_0000446
1840	Ga0496126_0000882
1841	Ga0496126_0006636
1842	Ga0496126_0019981
1843	Ga0496126_0034277
1844	Ga0496126_0073429
1845	Ga0496126_0092103
1846	Ga0496126_0126700
1847	Ga0496126_0162752
1848	Ga0496126_0186025
1849	Ga0495678_009436
1850	Ga0495678_012518
1851	Ga0495682_0025422
1852	Ga0501033_0056048
1853	Ga0501033_0173407
1854	Ga0501034_0000042
1855	Ga0501036_0165230
1856	Ga0501038_0241156
1857	Ga0501041_0047297
1858	Ga0501042_0041141
1859	Ga0501043_0117598
1860	Ga0501046_0082618
1861	Ga0501047_0024493
1862	Ga0501047_0030160
1863	Ga0501048_0215348
1864	Ga0501071_0080338
1865	Ga0501072_0029409
1866	Ga0501075_0021514
1867	Ga0501075_0084934
1868	Ga0501077_0140931
1869	Ga0501227_001375
1870	Ga0501080_0029512
1871	Ga0501081_0070143
1872	Ga0501279_000660
1873	Ga0501035_0026358
1874	Ga0501035_0229014
1875	Ga0501044_0000059
1876	Ga0501044_0001443
1877	Ga0501045_0049438
1878	nmdc:mga03683_490_c1
1879	nmdc:mga03n38_23536_c1
1880	nmdc:mga03n38_32004_c1
1881	nmdc:mga03n38_99544_c1
1882	nmdc:mga00v17_157_c1
1883	nmdc:mga00v17_253000_c1
1884	nmdc:mga00v17_25948_c1
1885	nmdc:mga00v17_3382_c1
1886	nmdc:mga00v17_41288_c1
1887	nmdc:mga0yw44_152651_c1
1888	nmdc:mga0yw44_16617_c1
1889	nmdc:mga0yw44_246638_c1
1890	nmdc:mga0yw44_36855_c1
1891	nmdc:mga0k408_103016_c1
1892	nmdc:mga0k408_134985_c1
1893	nmdc:mga0k408_15670_c1
1894	nmdc:mga0k408_264_c1
1895	nmdc:mga06z11_43335_c1
1896	nmdc:mga07m45_101710_c1
1897	nmdc:mga07m45_18103_c1
1898	nmdc:mga07m45_33873_c1
1899	nmdc:mga0qj67_26252_c1
1900	Ga0495619_0027397
1901	Ga0500643_005454
1902	Ga0500581_047926
1903	Ga0500647_0001969
1904	Ga0500583_0080956
1905	Ga0500651_0000011
1906	Ga0500566_0002124
1907	Ga0500556_0000058
1908	Ga0500557_000056
1909	Ga0500562_008953
1910	Ga0500569_017661
1911	Ga0500571_000008
1912	Ga0500595_006780
1913	Ga0500595_022855
1914	Ga0500614_013147
1915	Ga0500642_0000025
1916	Ga0500642_0000295
1917	Ga0500652_000007
1918	Ga0500652_001122
1919	Ga0500655_000511
1920	Ga0500658_0000085
1921	Ga0500658_0000181
1922	Ga0500658_0017903
1923	Ga0500658_0028537
1924	Ga0500559_0005262
1925	Ga0500559_0051010
1926	Ga0500568_0000547
1927	Ga0500568_0001205
1928	Ga0500574_005440
1929	Ga0500588_0003547
1930	Ga0500600_0024281
1931	Ga0500604_0011096
1932	Ga0500620_035558
1933	Ga0500622_0000112
1934	Ga0500627_0019290
1935	Ga0500634_0016121
1936	Ga0500634_0034310
1937	Ga0500634_0041670
1938	Ga0500634_0048936
1939	Ga0500638_062146
1940	Ga0500636_0073472
1941	Ga0500611_001649
1942	Ga0590075_026072
1943	Ga0587090_000446
1944	Ga0587072_000808
1945	Ga0587124_000762
1946	Ga0501082_0020019
1947	Ga0501082_0361104
1948	Ga0466962_0006642
1949	Ga0466962_0021693
1950	2501071161
1951	2501078646
1952	2501414043
1953	2506577259
1954	2506582397
1955	2508851188
1956	2509127460
1957	2509153415
1958	2510250135
1959	2511089293
1960	2511094697
1961	2511104407
1962	2512347686
1963	2513555977
1964	2513565530
1965	2513658138
1966	2513675972
1967	2513678860
1968	2513723552
1969	2513860270
1970	2513889889
1971	2513920370
1972	2513962164
1973	2515679273
1974	2515688480
1975	2516017150
1976	2517105405
1977	2517889207
1978	2521560316
1979	2524467980
1980	2524541580
1981	2527076825
1982	2535484790
1983	2563062146
1984	2599396456
1985	2599453488
1986	2599514769
1987	2599517249
1988	2599893966
1989	2599904353
1990	2600005361
1991	2600072358
1992	2600812632
1993	2643734223
1994	2644161231
1995	2644170809
1996	2656277915
1997	2671118403
1998	2689443715
1999	2713478006
2000	2719639293
2001	2723877632
2002	2728749317
2003	2738717898
2004	2738819924
2005	2738832404
2006	2738873931
2007	2739185561
2008	2739220529
2009	2739278584
2010	2746092048
2011	2746093641
2012	2753357371
2013	2753359403
2014	2757572385
2015	2758641665
2016	2777762776
2017	2793078954
2018	2807180513
2019	2808891892
2020	2808897002
2021	2819594832
2022	2819616678
2023	2819621039
2024	2821134442
2025	2824710736
2026	2824761312
2027	2824765916
2028	2842331167
2029	2842355506
2030	2842457895
2031	2842681162
2032	2854911970
2033	2857364653
2034	2857570104
2035	2869553114
2036	2874635542
2037	2876812528
2038	2879116171
2039	2883093841
2040	2885278402
2041	2885380165
2042	2885392379
2043	2888368166
2044	2888374221
2045	2888381744
2046	2900635452
2047	2900636050
2048	2902683285
2049	2903751239
2050	2903752196
2051	2903775544
2052	2904442555
2053	2904454136
2054	2904462007
2055	2904484146
2056	2904535237
2057	2904542026
2058	2904589581
2059	2904594488
2060	2904606254
2061	2904624589
2062	2904706917
2063	2904715353
2064	2906617002
2065	2906641336
2066	2906668530
2067	2915653891
2068	2919076965
2069	2919084203
2070	2919391401
2071	2919465264
2072	2919497461
2073	2919530088
2074	2919546078
2075	2921654750
2076	2923514090
2077	2923529636
2078	2928084515
2079	2928109842
2080	2928136703
2081	2928508917
2082	2929167316
2083	2931392655
2084	2932408407
2085	2939580068
2086	2945918338
2087	2945935711
2088	2945959786
2089	2945973934
2090	2946037831
2091	2953999660
2092	2990710376
2093	3001271538
2094	3001272485
2095	3005480733
2096	3006987758
2097	3006992270
2098	640936761
2099	642594062
2100	642620476
2101	642621065
2102	8003961804
2103	8004023410
2104	8004026504
2105	8004597540
2106	8006934693
2107	8006974661
2108	8006985411
2109	8019648932
2110	8055266537
2111	8055305064
2112	8056684960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

76

244

0.96 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

78

336

0.94 PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

79

239

0.88 PF05368

NmrA

NmrA-like family

78

213

0.87 PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

79

399

0.86 PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

78

260

0.83 PF08659

KR

KR domain

77

210

0.81 PF13460

NAD_binding_10

NAD(P)H-binding

82

248

0.76 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1i3n-assembly1.cif.gz_B	molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase	0.9915	2	335
7xpq-assembly1.cif.gz_A	crystal structure of udp-glc/glcnac 4-epimerase with nad/udp-glcnac	0.9907	2	335
3enk-assembly1.cif.gz_B	1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei	0.9897	2	334
1kvr-assembly1.cif.gz_A-2	udp-galactose 4-epimerase complexed with udp-phenol	0.9887	1	335
1kvt-assembly1.cif.gz_A-2	udp-galactose 4-epimerase complexed with udp-phenol	0.9886	1	335

ID	Description	Score	Start	End	Superfamily
3enkB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9761	1	261	3.40.50.720
af_P18645_3_269_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9757	1	261	3.40.50.720
4lisA02	Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1	0.9749	181	337	3.90.25.10
3enkB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9715	1	261	3.40.50.720
af_A0A1D6I245_15_71_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9636	6	57	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A661Y9Y6-F1-model_v4	deleted	0.9953	1	153
AF-A0A7Y0BJL8-F1-model_v4	UDP-glucose 4-epimerase (EC 5.1.3.2)	0.9921	1	335	GO:0003978 GO:0005829 GO:0006012
AF-A0A3L8RXC4-F1-model_v4	UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.2) (EC 5.1.3.7)	0.9919	2	335	GO:0003974 GO:0003978 GO:0005829 GO:0033499
AF-A0A2J6M7Q8-F1-model_v4	deleted	0.9917	2	335
AF-A0A5E4A169-F1-model_v4	UDP-N-acetylglucosamine 4-epimerase (EC 4.1.3.4) (EC 5.1.3.2) (EC 5.1.3.7)	0.9912	2	334	GO:0003974 GO:0003978 GO:0004419 GO:0005829 GO:0033499

Map