F489189
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1056 | 599 | 2112 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100006258|Ga0307409_1000062582 |
| Length | 414 |
| Sequence | METPTFNGFEGPVWWAGGVPCSGVVMLNILTFEPEAQDFCSADPAAGCVCSWRPRITFCGVPAVTYVQRRPRLEAMKVLVTGGAGYIGSHTTLCLLEAGHEVVVLDNLMNSNPESLRRVEKLSGKKVDFRKVDLLDAASVDRLFEEGTFDAVIHFAGLKAVGESVAKPLWYYQNNVVGTLNLLHSMERAGVRRLVFSSSATVYGASEEVPLIEKAPLDATNPYGRTKEQIEDILSDLGAADPSWSIALLRYFNPVGAHESGLIGEDPVGVPNNLLPFVAQVAVGRREKVMVFGDDYPTADGTGVRDYIHVMDLAAGHLAALGYLQDKAGVYRWNLGTGRGSSVLEVIEAFSKAAGAPVPYEIAPRRPGDAAVSYSDPSAALADLGWSARRDLATMCEDHWRWQSRNPSGYEESV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 221 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 222 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 230 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 243 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 250 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 253 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 254 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 255 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 256 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 364 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 365 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 366 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 367 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 368 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 407 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 409 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 410 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 411 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 414 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 415 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 419 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 420 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 421 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 422 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 424 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 426 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 428 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 430 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 431 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 433 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 434 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 436 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 442 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 443 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 444 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 445 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 446 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 447 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 448 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 449 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 450 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 451 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 452 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 453 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 454 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 455 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 456 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 457 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 458 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 459 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 460 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 461 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 462 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 463 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 464 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 465 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 466 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 467 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 468 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 469 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 470 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 471 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 472 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 473 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 474 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 475 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 476 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 477 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 478 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 479 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 480 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 481 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 482 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 483 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 484 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 485 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 486 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 487 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 488 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 489 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 490 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 491 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 492 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 493 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 494 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 495 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 496 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 497 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 498 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 499 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 500 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 501 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 502 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 503 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 504 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 505 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 506 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 507 | 2791355199 | |||
| 508 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 509 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 510 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 511 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 512 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 513 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 514 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 515 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 516 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 517 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 518 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 519 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 520 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 521 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 522 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 523 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 524 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 525 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 526 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 527 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 528 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 529 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 530 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 531 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 532 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 533 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 534 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 535 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 536 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 537 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 538 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 539 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 540 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 541 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 542 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 543 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 544 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 545 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 546 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 547 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 548 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 549 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 550 | 2904699407 | |||
| 551 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 552 | 2906610324 | |||
| 553 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 554 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 555 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 556 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 557 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 558 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 559 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 560 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 561 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 562 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 563 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 564 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 565 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 566 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 567 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 568 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 569 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 570 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 571 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 572 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 573 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 574 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 575 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 576 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 577 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 578 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 579 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 580 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 581 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 582 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 583 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 584 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 585 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 586 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 587 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 588 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 589 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 590 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 591 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 592 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 593 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 594 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 595 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 596 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 597 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 598 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 599 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.05 |
| Metatranscriptomes | 0.76 |
| Isolates | 15.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.87 |
| Nodule | 4.92 |
| Rhizoplane | 4.26 |
| Rhizosphere | 62.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307409_100006258 | 3300031995 | Bacteria | 6974 |
| 2 | LJQas_1008444 | 3300000549 | Bacteria | 1252 |
| 3 | JGI24740J21852_10002056 | 3300001979 | Bacteria | 9201 |
| 4 | JGI24739J22299_10003515 | 3300001989 | Bacteria | 5981 |
| 5 | JGI24739J22299_10021682 | 3300001989 | Bacteria | 2285 |
| 6 | JGI24735J21928_10003656 | 3300002067 | Bacteria | 5213 |
| 7 | JGI24735J21928_10010195 | 3300002067 | Bacteria | 3002 |
| 8 | JGI24738J21930_10010003 | 3300002075 | Bacteria | 2121 |
| 9 | JGI25156J39149_1000178 | 3300002705 | Bacteria | 46629 |
| 10 | JGI25156J39149_1000226 | 3300002705 | Bacteria | 38895 |
| 11 | JGI25156J39149_1000337 | 3300002705 | Bacteria | 30825 |
| 12 | JGI25156J39149_1007431 | 3300002705 | Bacteria | 2879 |
| 13 | JGI25159J45721_1000145 | 3300002987 | Bacteria | 32623 |
| 14 | JGI25151J46595_10001061 | 3300003187 | Bacteria | 20487 |
| 15 | JGI25151J46595_10004161 | 3300003187 | Bacteria | 7724 |
| 16 | JGI25165J46597_1001162 | 3300003214 | Bacteria | 16252 |
| 17 | rootH2_10299511 | 3300003320 | Bacteria | 2719 |
| 18 | rootH1_10007027 | 3300003323 | Bacteria | 4599 |
| 19 | JGI25160J50197_1000327 | 3300003354 | Bacteria | 32616 |
| 20 | JGI25161J50226_1000245 | 3300003374 | Bacteria | 32623 |
| 21 | Ga0007409J51694_1005204 | 3300003575 | Bacteria | 9118 |
| 22 | Ga0007416J51690_1004145 | 3300003577 | Bacteria | 9118 |
| 23 | Ga0032354_1011833 | 3300003693 | Bacteria | 9107 |
| 24 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 25 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 26 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 27 | Ga0055533_1000124 | 3300003756 | Bacteria | 87900 |
| 28 | Ga0055533_1000563 | 3300003756 | Bacteria | 13037 |
| 29 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 30 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 31 | Ga0055527_1000014 | 3300003760 | Bacteria | 289449 |
| 32 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 33 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 34 | Ga0055529_1000001 | 3300003763 | Bacteria | 826680 |
| 35 | Ga0055529_1000100 | 3300003763 | Bacteria | 131049 |
| 36 | Ga0055526_1013866 | 3300003771 | Bacteria | 3368 |
| 37 | Ga0055537_1000229 | 3300003773 | Bacteria | 41052 |
| 38 | Ga0055536_1002843 | 3300003781 | Bacteria | 9535 |
| 39 | Ga0055534_1000081 | 3300003784 | Bacteria | 75591 |
| 40 | Ga0055528_1000107 | 3300003790 | Bacteria | 67056 |
| 41 | Ga0055540_1000641 | 3300003792 | Bacteria | 24815 |
| 42 | Ga0055531_10003438 | 3300003794 | Bacteria | 10102 |
| 43 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 44 | Ga0055543_1000325 | 3300004625 | Bacteria | 32876 |
| 45 | Ga0055543_1002357 | 3300004625 | Bacteria | 6319 |
| 46 | Ga0065165_1000120 | 3300005262 | Bacteria | 134211 |
| 47 | Ga0065165_1001062 | 3300005262 | Bacteria | 32876 |
| 48 | Ga0065165_1002142 | 3300005262 | Bacteria | 17905 |
| 49 | Ga0065704_10081616 | 3300005289 | Bacteria | 3729 |
| 50 | Ga0070658_10000023 | 3300005327 | Bacteria | 185522 |
| 51 | Ga0070658_10002509 | 3300005327 | Bacteria | 15336 |
| 52 | Ga0068869_100003661 | 3300005334 | Bacteria | 9444 |
| 53 | Ga0070666_10034313 | 3300005335 | Bacteria | 3363 |
| 54 | Ga0068868_100080764 | 3300005338 | Bacteria | 2606 |
| 55 | Ga0070660_100067618 | 3300005339 | Bacteria | 2784 |
| 56 | Ga0070687_100008147 | 3300005343 | Bacteria | 4419 |
| 57 | Ga0070692_10048994 | 3300005345 | Bacteria | 2190 |
| 58 | Ga0070669_100052901 | 3300005353 | Bacteria | 2971 |
| 59 | Ga0070671_100122145 | 3300005355 | Bacteria | 2192 |
| 60 | Ga0070674_100031273 | 3300005356 | Bacteria | 3526 |
| 61 | Ga0070674_100116630 | 3300005356 | Bacteria | 1970 |
| 62 | Ga0070674_100253909 | 3300005356 | Bacteria | 1382 |
| 63 | Ga0070673_100000226 | 3300005364 | Bacteria | 28311 |
| 64 | Ga0070659_100202824 | 3300005366 | Bacteria | 1633 |
| 65 | Ga0070659_100247619 | 3300005366 | Bacteria | 1476 |
| 66 | Ga0070667_100229459 | 3300005367 | Bacteria | 1655 |
| 67 | Ga0070713_100000597 | 3300005436 | Bacteria | 22955 |
| 68 | Ga0070710_10160650 | 3300005437 | Bacteria | 1393 |
| 69 | Ga0070705_100014971 | 3300005440 | Bacteria | 4002 |
| 70 | Ga0070700_100009577 | 3300005441 | Bacteria | 5322 |
| 71 | Ga0070694_100053561 | 3300005444 | Bacteria | 2731 |
| 72 | Ga0070663_100034260 | 3300005455 | Bacteria | 3516 |
| 73 | Ga0070663_100083409 | 3300005455 | Bacteria | 2353 |
| 74 | Ga0070678_100000633 | 3300005456 | Bacteria | 17225 |
| 75 | Ga0070678_100070874 | 3300005456 | Bacteria | 2608 |
| 76 | Ga0070681_10014815 | 3300005458 | Bacteria | 7755 |
| 77 | Ga0070681_10034876 | 3300005458 | Bacteria | 5053 |
| 78 | Ga0070681_10185792 | 3300005458 | Bacteria | 1999 |
| 79 | Ga0068867_100004040 | 3300005459 | Bacteria | 10322 |
| 80 | Ga0068867_100012498 | 3300005459 | Bacteria | 6009 |
| 81 | Ga0070685_10045066 | 3300005466 | Unclassified | 2527 |
| 82 | Ga0070679_100099164 | 3300005530 | Bacteria | 2900 |
| 83 | Ga0070684_100035112 | 3300005535 | Bacteria | 4290 |
| 84 | Ga0070697_100037403 | 3300005536 | Bacteria | 3921 |
| 85 | Ga0068853_100044527 | 3300005539 | Bacteria | 3799 |
| 86 | Ga0068853_100045570 | 3300005539 | Bacteria | 3757 |
| 87 | Ga0068853_100228122 | 3300005539 | Bacteria | 1703 |
| 88 | Ga0070672_100002363 | 3300005543 | Bacteria | 11939 |
| 89 | Ga0070672_100097588 | 3300005543 | Bacteria | 2379 |
| 90 | Ga0070686_100000404 | 3300005544 | Bacteria | 27098 |
| 91 | Ga0070695_100007120 | 3300005545 | Bacteria | 6629 |
| 92 | Ga0070696_100004953 | 3300005546 | Bacteria | 8891 |
| 93 | Ga0070665_100001295 | 3300005548 | Bacteria | 29936 |
| 94 | Ga0070665_100066937 | 3300005548 | Bacteria | 3603 |
| 95 | Ga0070665_100137102 | 3300005548 | Bacteria | 2450 |
| 96 | Ga0070665_100213471 | 3300005548 | Bacteria | 1931 |
| 97 | Ga0070665_100260884 | 3300005548 | Bacteria | 1734 |
| 98 | Ga0070665_100320649 | 3300005548 | Bacteria | 1554 |
| 99 | Ga0068855_100014208 | 3300005563 | Bacteria | 9591 |
| 100 | Ga0068855_100026819 | 3300005563 | Bacteria | 6893 |
| 101 | Ga0068855_100074389 | 3300005563 | Bacteria | 3946 |
| 102 | Ga0068855_100365544 | 3300005563 | Bacteria | 1587 |
| 103 | Ga0068854_100006860 | 3300005578 | Bacteria | 7261 |
| 104 | Ga0068854_100007052 | 3300005578 | Bacteria | 7171 |
| 105 | Ga0068854_100048170 | 3300005578 | Bacteria | 3040 |
| 106 | Ga0068854_100137278 | 3300005578 | Bacteria | 1873 |
| 107 | Ga0068854_100244785 | 3300005578 | Bacteria | 1429 |
| 108 | Ga0070702_100014379 | 3300005615 | Bacteria | 4015 |
| 109 | Ga0068852_100046505 | 3300005616 | Bacteria | 3699 |
| 110 | Ga0068859_100069877 | 3300005617 | Bacteria | 3547 |
| 111 | Ga0068864_100022903 | 3300005618 | Bacteria | 5241 |
| 112 | Ga0068866_10000265 | 3300005718 | Bacteria | 24733 |
| 113 | Ga0068861_100000207 | 3300005719 | Bacteria | 31461 |
| 114 | Ga0068851_10000255 | 3300005834 | Bacteria | 25249 |
| 115 | Ga0068870_10025274 | 3300005840 | Bacteria | 2947 |
| 116 | Ga0068858_100003094 | 3300005842 | Bacteria | 16643 |
| 117 | Ga0068860_100024757 | 3300005843 | Bacteria | 5798 |
| 118 | Ga0068862_100002710 | 3300005844 | Bacteria | 15551 |
| 119 | Ga0081455_10018727 | 3300005937 | Bacteria | 6573 |
| 120 | Ga0081540_1014084 | 3300005983 | Bacteria | 5151 |
| 121 | Ga0081540_1014939 | 3300005983 | Bacteria | 4939 |
| 122 | Ga0075365_10021610 | 3300006038 | Bacteria | 4017 |
| 123 | Ga0075365_10176295 | 3300006038 | Bacteria | 1493 |
| 124 | Ga0075363_100095788 | 3300006048 | Bacteria | 1638 |
| 125 | Ga0075364_10000085 | 3300006051 | Bacteria | 37086 |
| 126 | Ga0075364_10000342 | 3300006051 | Bacteria | 23182 |
| 127 | Ga0075364_10031014 | 3300006051 | Bacteria | 3434 |
| 128 | Ga0075364_10112207 | 3300006051 | Bacteria | 1820 |
| 129 | Ga0075362_10002319 | 3300006177 | Bacteria | 6359 |
| 130 | Ga0075362_10058467 | 3300006177 | Bacteria | 1739 |
| 131 | Ga0075367_10005597 | 3300006178 | Bacteria | 6258 |
| 132 | Ga0075367_10007757 | 3300006178 | Bacteria | 5520 |
| 133 | Ga0075369_10006660 | 3300006186 | Bacteria | 4378 |
| 134 | Ga0075369_10057272 | 3300006186 | Bacteria | 1695 |
| 135 | Ga0075369_10094925 | 3300006186 | Bacteria | 1333 |
| 136 | Ga0075369_10112983 | 3300006186 | Bacteria | 1225 |
| 137 | Ga0075366_10000152 | 3300006195 | Bacteria | 29263 |
| 138 | Ga0075366_10007229 | 3300006195 | Bacteria | 6118 |
| 139 | Ga0075366_10011587 | 3300006195 | Bacteria | 4981 |
| 140 | Ga0075366_10012147 | 3300006195 | Bacteria | 4879 |
| 141 | Ga0075366_10020135 | 3300006195 | Bacteria | 3867 |
| 142 | Ga0075366_10127546 | 3300006195 | Bacteria | 1535 |
| 143 | Ga0075366_10128855 | 3300006195 | Bacteria | 1526 |
| 144 | Ga0075366_10143559 | 3300006195 | Bacteria | 1444 |
| 145 | Ga0097621_100010305 | 3300006237 | Bacteria | 6830 |
| 146 | Ga0075370_10011056 | 3300006353 | Bacteria | 4733 |
| 147 | Ga0075428_100012004 | 3300006844 | Bacteria | 9638 |
| 148 | Ga0075430_100031742 | 3300006846 | Bacteria | 4483 |
| 149 | Ga0068865_100019287 | 3300006881 | Bacteria | 4413 |
| 150 | Ga0097620_100069877 | 3300006931 | Bacteria | 3547 |
| 151 | Ga0099822_1024140 | 3300006943 | Bacteria | 5489 |
| 152 | Ga0079104_1001448 | 3300006946 | Bacteria | 15868 |
| 153 | Ga0079104_1001983 | 3300006946 | Bacteria | 12008 |
| 154 | Ga0079104_1003315 | 3300006946 | Bacteria | 7632 |
| 155 | Ga0079104_1008755 | 3300006946 | Bacteria | 3495 |
| 156 | Ga0099826_10000087 | 3300006948 | Bacteria | 46364 |
| 157 | Ga0099795_10000287 | 3300007788 | Bacteria | 9029 |
| 158 | Ga0099795_10023436 | 3300007788 | Bacteria | 2049 |
| 159 | Ga0105251_10000405 | 3300009011 | Bacteria | 42135 |
| 160 | Ga0105251_10000869 | 3300009011 | Bacteria | 27105 |
| 161 | Ga0105251_10001189 | 3300009011 | Bacteria | 22551 |
| 162 | Ga0105251_10001416 | 3300009011 | Bacteria | 20666 |
| 163 | Ga0105251_10006773 | 3300009011 | Bacteria | 7229 |
| 164 | Ga0105251_10008305 | 3300009011 | Bacteria | 6269 |
| 165 | Ga0105251_10042879 | 3300009011 | Bacteria | 2193 |
| 166 | Ga0105251_10077891 | 3300009011 | Bacteria | 1536 |
| 167 | Ga0105244_10000864 | 3300009036 | Bacteria | 25593 |
| 168 | Ga0105244_10003298 | 3300009036 | Bacteria | 11622 |
| 169 | Ga0105244_10030368 | 3300009036 | Bacteria | 2876 |
| 170 | Ga0105250_10009703 | 3300009092 | Bacteria | 4045 |
| 171 | Ga0105250_10075631 | 3300009092 | Bacteria | 1362 |
| 172 | Ga0105240_10037364 | 3300009093 | Bacteria | 6242 |
| 173 | Ga0105240_10043539 | 3300009093 | Bacteria | 5711 |
| 174 | Ga0105240_10052645 | 3300009093 | Bacteria | 5115 |
| 175 | Ga0105240_10112554 | 3300009093 | Bacteria | 3290 |
| 176 | Ga0105240_10234108 | 3300009093 | Bacteria | 2133 |
| 177 | Ga0105245_10000257 | 3300009098 | Bacteria | 50535 |
| 178 | Ga0105245_10233232 | 3300009098 | Bacteria | 1781 |
| 179 | Ga0105247_10000018 | 3300009101 | Bacteria | 259335 |
| 180 | Ga0105247_10025401 | 3300009101 | Bacteria | 3573 |
| 181 | Ga0105247_10141698 | 3300009101 | Bacteria | 1576 |
| 182 | Ga0114129_10134216 | 3300009147 | Bacteria | 3397 |
| 183 | Ga0105243_10002572 | 3300009148 | Bacteria | 15157 |
| 184 | Ga0105243_10549837 | 3300009148 | Bacteria | 1103 |
| 185 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 186 | Ga0105241_10038817 | 3300009174 | Bacteria | 3590 |
| 187 | Ga0105242_10000371 | 3300009176 | Bacteria | 35724 |
| 188 | Ga0105242_10015952 | 3300009176 | Bacteria | 5838 |
| 189 | Ga0105242_10293720 | 3300009176 | Bacteria | 1481 |
| 190 | Ga0105248_10038127 | 3300009177 | Bacteria | 5377 |
| 191 | Ga0105248_10067149 | 3300009177 | Bacteria | 4026 |
| 192 | Ga0105248_10288123 | 3300009177 | Bacteria | 1849 |
| 193 | Ga0105248_10587945 | 3300009177 | Bacteria | 1256 |
| 194 | Ga0105237_10019838 | 3300009545 | Bacteria | 6940 |
| 195 | Ga0105237_10059278 | 3300009545 | Bacteria | 3830 |
| 196 | Ga0105238_10000038 | 3300009551 | Bacteria | 162920 |
| 197 | Ga0105238_10088633 | 3300009551 | Bacteria | 3080 |
| 198 | Ga0105238_10236725 | 3300009551 | Bacteria | 1803 |
| 199 | Ga0105249_10000243 | 3300009553 | Bacteria | 60371 |
| 200 | Ga0105249_10066635 | 3300009553 | Bacteria | 3315 |
| 201 | Ga0105249_10117450 | 3300009553 | Bacteria | 2523 |
| 202 | Ga0105249_10127223 | 3300009553 | Bacteria | 2428 |
| 203 | Ga0105249_10508503 | 3300009553 | Bacteria | 1251 |
| 204 | Ga0099796_10007059 | 3300010159 | Bacteria | 2915 |
| 205 | Ga0105239_10000303 | 3300010375 | Bacteria | 72769 |
| 206 | Ga0105239_10015338 | 3300010375 | Bacteria | 8490 |
| 207 | Ga0157347_1003449 | 3300012502 | Bacteria | 1418 |
| 208 | Ga0157373_10000633 | 3300013100 | Bacteria | 27561 |
| 209 | Ga0157373_10000981 | 3300013100 | Bacteria | 22059 |
| 210 | Ga0157373_10001613 | 3300013100 | Bacteria | 17234 |
| 211 | Ga0157373_10009523 | 3300013100 | Bacteria | 7171 |
| 212 | Ga0157371_10005108 | 3300013102 | Bacteria | 11195 |
| 213 | Ga0157371_10013078 | 3300013102 | Bacteria | 6318 |
| 214 | Ga0157370_10000485 | 3300013104 | Bacteria | 49509 |
| 215 | Ga0157370_10000756 | 3300013104 | Bacteria | 40377 |
| 216 | Ga0157370_10012877 | 3300013104 | Bacteria | 8647 |
| 217 | Ga0157370_10013422 | 3300013104 | Bacteria | 8440 |
| 218 | Ga0157369_10000138 | 3300013105 | Bacteria | 102776 |
| 219 | Ga0157369_10000510 | 3300013105 | Bacteria | 51123 |
| 220 | Ga0157369_10014085 | 3300013105 | Bacteria | 9037 |
| 221 | Ga0157369_10024923 | 3300013105 | Bacteria | 6647 |
| 222 | Ga0157369_10034798 | 3300013105 | Bacteria | 5526 |
| 223 | Ga0157369_10035030 | 3300013105 | Bacteria | 5505 |
| 224 | Ga0157369_10103667 | 3300013105 | Bacteria | 3030 |
| 225 | Ga0157369_10118636 | 3300013105 | Bacteria | 2808 |
| 226 | Ga0157374_10000056 | 3300013296 | Bacteria | 117163 |
| 227 | Ga0157374_10064879 | 3300013296 | Bacteria | 3428 |
| 228 | Ga0157374_10159705 | 3300013296 | Bacteria | 2195 |
| 229 | Ga0157374_10268028 | 3300013296 | Bacteria | 1683 |
| 230 | Ga0157378_10000651 | 3300013297 | Bacteria | 32716 |
| 231 | Ga0157378_10005243 | 3300013297 | Bacteria | 11383 |
| 232 | Ga0163162_10031705 | 3300013306 | Bacteria | 5243 |
| 233 | Ga0163162_10144520 | 3300013306 | Bacteria | 2494 |
| 234 | Ga0163162_10194891 | 3300013306 | Bacteria | 2154 |
| 235 | Ga0163162_10355455 | 3300013306 | Bacteria | 1598 |
| 236 | Ga0163162_10433579 | 3300013306 | Bacteria | 1446 |
| 237 | Ga0163162_10518994 | 3300013306 | Bacteria | 1321 |
| 238 | Ga0163162_10542389 | 3300013306 | Bacteria | 1292 |
| 239 | Ga0157372_10018305 | 3300013307 | Bacteria | 7529 |
| 240 | Ga0157372_10271228 | 3300013307 | Bacteria | 1972 |
| 241 | Ga0157372_10435499 | 3300013307 | Bacteria | 1528 |
| 242 | Ga0157375_10165333 | 3300013308 | Bacteria | 2357 |
| 243 | Ga0157375_10221768 | 3300013308 | Bacteria | 2049 |
| 244 | Ga0157375_10456583 | 3300013308 | Bacteria | 1443 |
| 245 | Ga0157375_10473760 | 3300013308 | Bacteria | 1417 |
| 246 | Ga0163163_10014066 | 3300014325 | Bacteria | 7346 |
| 247 | Ga0157380_10004646 | 3300014326 | Bacteria | 9551 |
| 248 | Ga0157380_10124899 | 3300014326 | Bacteria | 2185 |
| 249 | Ga0182008_10000556 | 3300014497 | Bacteria | 27658 |
| 250 | Ga0182008_10004707 | 3300014497 | Bacteria | 7915 |
| 251 | Ga0182008_10028269 | 3300014497 | Bacteria | 2835 |
| 252 | Ga0157379_10011772 | 3300014968 | Bacteria | 7641 |
| 253 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 254 | Ga0182006_1000118 | 3300015261 | Bacteria | 85805 |
| 255 | Ga0182006_1000152 | 3300015261 | Bacteria | 74063 |
| 256 | Ga0182006_1002843 | 3300015261 | Bacteria | 9220 |
| 257 | Ga0182006_1008317 | 3300015261 | Bacteria | 4704 |
| 258 | Ga0182006_1058423 | 3300015261 | Bacteria | 1463 |
| 259 | Ga0182007_10002938 | 3300015262 | Bacteria | 8276 |
| 260 | Ga0182005_1000005 | 3300015265 | Bacteria | 537378 |
| 261 | Ga0183361_10018 | 3300016635 | Bacteria | 133279 |
| 262 | Ga0163161_10000004 | 3300017792 | Bacteria | 333149 |
| 263 | Ga0163161_10000738 | 3300017792 | Bacteria | 25670 |
| 264 | Ga0163161_10037604 | 3300017792 | Bacteria | 3471 |
| 265 | Ga0224712_10000040 | 3300022467 | Bacteria | 19652 |
| 266 | Ga0224712_10058763 | 3300022467 | Bacteria | 1524 |
| 267 | Ga0209436_100135 | 3300025208 | Bacteria | 36415 |
| 268 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 269 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 270 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 271 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 272 | Ga0209674_100150 | 3300025226 | Bacteria | 96511 |
| 273 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 274 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 275 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 276 | Ga0209563_100794 | 3300025230 | Bacteria | 9503 |
| 277 | Ga0207427_100394 | 3300025231 | Bacteria | 25938 |
| 278 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 279 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 280 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 281 | Ga0209148_1000620 | 3300025254 | Bacteria | 31479 |
| 282 | Ga0209759_1000228 | 3300025256 | Bacteria | 84202 |
| 283 | Ga0209759_1000275 | 3300025256 | Bacteria | 72571 |
| 284 | Ga0209759_1000543 | 3300025256 | Bacteria | 39344 |
| 285 | Ga0209759_1001138 | 3300025256 | Bacteria | 17013 |
| 286 | Ga0209129_1001909 | 3300025258 | Bacteria | 10989 |
| 287 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 288 | Ga0209565_1000150 | 3300025263 | Bacteria | 94073 |
| 289 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 290 | Ga0209455_1000047 | 3300025272 | Bacteria | 379709 |
| 291 | Ga0209673_1000114 | 3300025273 | Bacteria | 178557 |
| 292 | Ga0209130_1000057 | 3300025284 | Bacteria | 210593 |
| 293 | Ga0209130_1000574 | 3300025284 | Bacteria | 35904 |
| 294 | Ga0209675_1000062 | 3300025291 | Bacteria | 178557 |
| 295 | Ga0209676_1000164 | 3300025292 | Bacteria | 156826 |
| 296 | Ga0209676_1000244 | 3300025292 | Bacteria | 116654 |
| 297 | Ga0209676_1021981 | 3300025292 | Bacteria | 2125 |
| 298 | Ga0209025_1000049 | 3300025294 | Bacteria | 333459 |
| 299 | Ga0209025_1000191 | 3300025294 | Bacteria | 152552 |
| 300 | Ga0209025_1000709 | 3300025294 | Bacteria | 56684 |
| 301 | Ga0209564_1002709 | 3300025295 | Bacteria | 13379 |
| 302 | Ga0209564_1004984 | 3300025295 | Bacteria | 7818 |
| 303 | Ga0209050_1000904 | 3300025298 | Bacteria | 39210 |
| 304 | Ga0207426_1000657 | 3300025302 | Bacteria | 42328 |
| 305 | Ga0207426_1002801 | 3300025302 | Bacteria | 10455 |
| 306 | Ga0207426_1006276 | 3300025302 | Bacteria | 5198 |
| 307 | Ga0209051_1000208 | 3300025303 | Bacteria | 102967 |
| 308 | Ga0209257_1004516 | 3300025304 | Bacteria | 10706 |
| 309 | Ga0209257_1010985 | 3300025304 | Bacteria | 4449 |
| 310 | Ga0207656_10001797 | 3300025321 | Bacteria | 7140 |
| 311 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 312 | Ga0207655_1001151 | 3300025728 | Bacteria | 25725 |
| 313 | Ga0207655_1003515 | 3300025728 | Bacteria | 11623 |
| 314 | Ga0207713_1000093 | 3300025735 | Bacteria | 146199 |
| 315 | Ga0207713_1000205 | 3300025735 | Bacteria | 80817 |
| 316 | Ga0207713_1000699 | 3300025735 | Bacteria | 31392 |
| 317 | Ga0207713_1001376 | 3300025735 | Bacteria | 19744 |
| 318 | Ga0207713_1001567 | 3300025735 | Bacteria | 17940 |
| 319 | Ga0207642_10022646 | 3300025899 | Bacteria | 2496 |
| 320 | Ga0207710_10000016 | 3300025900 | Bacteria | 388568 |
| 321 | Ga0207647_10000410 | 3300025904 | Bacteria | 35247 |
| 322 | Ga0207647_10000430 | 3300025904 | Bacteria | 34390 |
| 323 | Ga0207647_10011603 | 3300025904 | Bacteria | 6171 |
| 324 | Ga0207647_10013337 | 3300025904 | Bacteria | 5703 |
| 325 | Ga0207647_10013559 | 3300025904 | Bacteria | 5644 |
| 326 | Ga0207645_10008061 | 3300025907 | Bacteria | 7388 |
| 327 | Ga0207645_10019099 | 3300025907 | Bacteria | 4500 |
| 328 | Ga0207705_10000129 | 3300025909 | Bacteria | 82827 |
| 329 | Ga0207705_10005484 | 3300025909 | Bacteria | 9487 |
| 330 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 331 | Ga0207707_10046163 | 3300025912 | Unclassified | 3793 |
| 332 | Ga0207707_10102181 | 3300025912 | Bacteria | 2506 |
| 333 | Ga0207695_10012277 | 3300025913 | Bacteria | 10288 |
| 334 | Ga0207695_10012751 | 3300025913 | Bacteria | 10063 |
| 335 | Ga0207695_10063221 | 3300025913 | Bacteria | 3817 |
| 336 | Ga0207671_10171065 | 3300025914 | Bacteria | 1687 |
| 337 | Ga0207671_10187055 | 3300025914 | Bacteria | 1614 |
| 338 | Ga0207693_10265151 | 3300025915 | Bacteria | 1346 |
| 339 | Ga0207663_10206381 | 3300025916 | Bacteria | 1421 |
| 340 | Ga0207660_10178590 | 3300025917 | Bacteria | 1647 |
| 341 | Ga0207657_10013828 | 3300025919 | Bacteria | 7898 |
| 342 | Ga0207652_10021290 | 3300025921 | Bacteria | 5351 |
| 343 | Ga0207694_10000126 | 3300025924 | Bacteria | 79243 |
| 344 | Ga0207694_10013637 | 3300025924 | Bacteria | 6125 |
| 345 | Ga0207694_10279127 | 3300025924 | Bacteria | 1372 |
| 346 | Ga0207687_10023025 | 3300025927 | Bacteria | 4149 |
| 347 | Ga0207700_10004741 | 3300025928 | Bacteria | 8066 |
| 348 | Ga0207690_10179013 | 3300025932 | Bacteria | 1595 |
| 349 | Ga0207686_10003545 | 3300025934 | Bacteria | 8372 |
| 350 | Ga0207686_10047434 | 3300025934 | Bacteria | 2656 |
| 351 | Ga0207709_10003067 | 3300025935 | Bacteria | 10096 |
| 352 | Ga0207669_10024658 | 3300025937 | Bacteria | 3237 |
| 353 | Ga0207669_10045061 | 3300025937 | Bacteria | 2597 |
| 354 | Ga0207669_10176018 | 3300025937 | Bacteria | 1528 |
| 355 | Ga0207704_10005412 | 3300025938 | Bacteria | 5886 |
| 356 | Ga0207691_10135597 | 3300025940 | Bacteria | 2171 |
| 357 | Ga0207711_10026051 | 3300025941 | Bacteria | 4905 |
| 358 | Ga0207711_10309015 | 3300025941 | Bacteria | 1459 |
| 359 | Ga0207711_10444961 | 3300025941 | Bacteria | 1206 |
| 360 | Ga0207689_10000465 | 3300025942 | Bacteria | 38002 |
| 361 | Ga0207689_10129531 | 3300025942 | Bacteria | 2076 |
| 362 | Ga0207667_10000427 | 3300025949 | Bacteria | 56780 |
| 363 | Ga0207667_10028128 | 3300025949 | Bacteria | 6107 |
| 364 | Ga0207667_10148183 | 3300025949 | Bacteria | 2415 |
| 365 | Ga0207667_10319366 | 3300025949 | Bacteria | 1586 |
| 366 | Ga0207651_10000125 | 3300025960 | Bacteria | 32722 |
| 367 | Ga0207712_10000433 | 3300025961 | Bacteria | 35737 |
| 368 | Ga0207712_10069123 | 3300025961 | Bacteria | 2533 |
| 369 | Ga0207668_10099867 | 3300025972 | Bacteria | 2154 |
| 370 | Ga0207640_10077107 | 3300025981 | Bacteria | 2264 |
| 371 | Ga0207640_10236046 | 3300025981 | Bacteria | 1410 |
| 372 | Ga0207658_10139733 | 3300025986 | Bacteria | 1958 |
| 373 | Ga0207677_10023862 | 3300026023 | Bacteria | 3787 |
| 374 | Ga0207703_10015850 | 3300026035 | Bacteria | 5880 |
| 375 | Ga0207678_10106794 | 3300026067 | Bacteria | 2388 |
| 376 | Ga0207678_10126657 | 3300026067 | Bacteria | 2178 |
| 377 | Ga0207708_10000376 | 3300026075 | Bacteria | 34827 |
| 378 | Ga0207702_10278497 | 3300026078 | Bacteria | 1580 |
| 379 | Ga0207641_10129547 | 3300026088 | Bacteria | 2264 |
| 380 | Ga0207648_10000092 | 3300026089 | Bacteria | 84700 |
| 381 | Ga0207676_10041160 | 3300026095 | Bacteria | 3545 |
| 382 | Ga0207674_10244418 | 3300026116 | Bacteria | 1742 |
| 383 | Ga0207675_100000181 | 3300026118 | Bacteria | 56942 |
| 384 | Ga0207675_100222708 | 3300026118 | Bacteria | 1818 |
| 385 | Ga0207683_10001307 | 3300026121 | Bacteria | 22512 |
| 386 | Ga0207683_10098198 | 3300026121 | Bacteria | 2613 |
| 387 | Ga0209281_1001285 | 3300027111 | Bacteria | 16101 |
| 388 | Ga0209281_1005294 | 3300027111 | Bacteria | 3616 |
| 389 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 390 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 391 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 392 | Ga0209282_1002130 | 3300027666 | Bacteria | 11281 |
| 393 | Ga0268266_10000916 | 3300028379 | Bacteria | 37956 |
| 394 | Ga0268266_10023525 | 3300028379 | Bacteria | 5244 |
| 395 | Ga0268266_10218115 | 3300028379 | Bacteria | 1752 |
| 396 | Ga0268266_10284684 | 3300028379 | Bacteria | 1538 |
| 397 | Ga0268265_10006000 | 3300028380 | Bacteria | 8265 |
| 398 | Ga0268264_10021329 | 3300028381 | Bacteria | 5289 |
| 399 | Ga0265338_10049870 | 3300028800 | Bacteria | 3789 |
| 400 | Ga0307511_10000109 | 3300030521 | Bacteria | 74186 |
| 401 | Ga0316180_1141634 | 3300030736 | Bacteria | 3981 |
| 402 | Ga0316181_1264586 | 3300030744 | Bacteria | 3840 |
| 403 | Ga0265328_10000002 | 3300031239 | Bacteria | 275819 |
| 404 | Ga0265328_10007645 | 3300031239 | Bacteria | 4495 |
| 405 | Ga0265320_10100830 | 3300031240 | Bacteria | 1330 |
| 406 | Ga0265331_10053560 | 3300031250 | Bacteria | 1924 |
| 407 | Ga0265327_10005493 | 3300031251 | Bacteria | 10556 |
| 408 | Ga0265316_10000511 | 3300031344 | Bacteria | 43817 |
| 409 | Ga0307408_100001595 | 3300031548 | Bacteria | 16749 |
| 410 | Ga0307408_100009230 | 3300031548 | Bacteria | 6501 |
| 411 | Ga0307408_100030979 | 3300031548 | Bacteria | 3719 |
| 412 | Ga0307408_100087687 | 3300031548 | Bacteria | 2342 |
| 413 | Ga0316576_10004707 | 3300031727 | Bacteria | 8236 |
| 414 | Ga0316578_10027905 | 3300031728 | Bacteria | 3193 |
| 415 | Ga0307405_10026202 | 3300031731 | Bacteria | 3361 |
| 416 | Ga0307405_10109589 | 3300031731 | Bacteria | 1868 |
| 417 | Ga0316577_10202466 | 3300031733 | Bacteria | 1122 |
| 418 | Ga0307413_10253810 | 3300031824 | Bacteria | 1306 |
| 419 | Ga0307410_10010788 | 3300031852 | Bacteria | 5197 |
| 420 | Ga0307407_10048464 | 3300031903 | Bacteria | 2418 |
| 421 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 422 | Ga0307412_10000069 | 3300031911 | Bacteria | 108218 |
| 423 | Ga0307412_10009054 | 3300031911 | Bacteria | 5704 |
| 424 | Ga0307412_10020542 | 3300031911 | Bacteria | 4021 |
| 425 | Ga0307409_100364197 | 3300031995 | Bacteria | 1368 |
| 426 | Ga0307416_100006168 | 3300032002 | Bacteria | 7474 |
| 427 | Ga0307416_100008505 | 3300032002 | Bacteria | 6630 |
| 428 | Ga0307416_100090969 | 3300032002 | Bacteria | 2619 |
| 429 | Ga0307414_10100900 | 3300032004 | Bacteria | 2172 |
| 430 | Ga0307510_10000948 | 3300033180 | Bacteria | 30647 |
| 431 | Ga0315911_1000018 | 3300033442 | Bacteria | 152089 |
| 432 | Ga0316574_0013130 | 3300035398 | Bacteria | 4756 |
| 433 | Ga0316582_0276906 | 3300036647 | Bacteria | 1151 |
| 434 | Ga0316584_0002399 | 3300036712 | Bacteria | 11842 |
| 435 | Ga0316584_0014538 | 3300036712 | Bacteria | 5605 |
| 436 | Ga0395899_0040683 | 3300037312 | Bacteria | 3476 |
| 437 | Ga0395900_0052659 | 3300037418 | Bacteria | 4190 |
| 438 | Ga0395900_0216701 | 3300037418 | Bacteria | 1931 |
| 439 | Ga0395900_0233979 | 3300037418 | Bacteria | 1846 |
| 440 | Ga0395898_0012898 | 3300037466 | Bacteria | 8622 |
| 441 | Ga0395898_0073469 | 3300037466 | Bacteria | 3304 |
| 442 | Ga0395898_0131666 | 3300037466 | Bacteria | 2395 |
| 443 | Ga0395905_0000236 | 3300037471 | Bacteria | 83344 |
| 444 | Ga0395905_0007181 | 3300037471 | Bacteria | 11123 |
| 445 | Ga0395905_0007879 | 3300037471 | Bacteria | 10546 |
| 446 | Ga0395905_0008311 | 3300037471 | Bacteria | 10241 |
| 447 | Ga0395905_0015581 | 3300037471 | Bacteria | 7223 |
| 448 | Ga0395905_0031654 | 3300037471 | Bacteria | 4978 |
| 449 | Ga0395905_0036002 | 3300037471 | Bacteria | 4648 |
| 450 | Ga0395905_0165040 | 3300037471 | Bacteria | 2081 |
| 451 | Ga0395905_0275078 | 3300037471 | Bacteria | 1570 |
| 452 | Ga0395905_0279247 | 3300037471 | Bacteria | 1556 |
| 453 | Ga0395901_0000154 | 3300038443 | Bacteria | 89750 |
| 454 | Ga0395901_0004377 | 3300038443 | Bacteria | 14249 |
| 455 | Ga0395901_0031280 | 3300038443 | Bacteria | 5488 |
| 456 | Ga0395901_0447378 | 3300038443 | Bacteria | 1322 |
| 457 | Ga0439439_0010800 | 3300041406 | Bacteria | 2189 |
| 458 | Ga0439466_0008698 | 3300041411 | Bacteria | 3825 |
| 459 | Ga0451807_1151223 | 3300041486 | Bacteria | 2109 |
| 460 | Ga0439449_0011594 | 3300042007 | Bacteria | 3315 |
| 461 | Ga0439462_0005035 | 3300042015 | Bacteria | 3242 |
| 462 | Ga0439463_004189 | 3300042016 | Bacteria | 3619 |
| 463 | Ga0439446_0032084 | 3300042156 | Bacteria | 1522 |
| 464 | Ga0450909_005168 | 3300042185 | Bacteria | 1878 |
| 465 | Ga0451577_0008941 | 3300042876 | Bacteria | 9690 |
| 466 | Ga0466969_0003919 | 3300044656 | Bacteria | 7901 |
| 467 | Ga0466972_0055584 | 3300044658 | Bacteria | 1904 |
| 468 | Ga0466973_0023612 | 3300044659 | Bacteria | 5893 |
| 469 | Ga0466966_0000008 | 3300044684 | Bacteria | 155597 |
| 470 | Ga0466966_0003154 | 3300044684 | Bacteria | 10855 |
| 471 | Ga0466961_0007135 | 3300044693 | Bacteria | 7108 |
| 472 | Ga0466961_0042890 | 3300044693 | Bacteria | 2898 |
| 473 | Ga0466963_0003221 | 3300044694 | Bacteria | 9291 |
| 474 | Ga0466963_0004171 | 3300044694 | Bacteria | 8366 |
| 475 | Ga0466964_0005801 | 3300044706 | Bacteria | 4594 |
| 476 | Ga0453684_0041659 | 3300044712 | Bacteria | 6206 |
| 477 | Ga0453684_0094361 | 3300044712 | Bacteria | 3681 |
| 478 | Ga0453684_0158893 | 3300044712 | Bacteria | 2676 |
| 479 | Ga0466957_0032011 | 3300044842 | Bacteria | 3146 |
| 480 | Ga0466957_0053462 | 3300044842 | Bacteria | 2462 |
| 481 | Ga0466959_0000027 | 3300045049 | Bacteria | 114262 |
| 482 | Ga0466967_0074519 | 3300045976 | Bacteria | 3049 |
| 483 | Ga0495627_000038 | 3300046453 | Bacteria | 198316 |
| 484 | Ga0495627_000231 | 3300046453 | Bacteria | 59148 |
| 485 | Ga0495627_000396 | 3300046453 | Bacteria | 39486 |
| 486 | Ga0495592_0008737 | 3300046454 | Bacteria | 7605 |
| 487 | Ga0495603_0021997 | 3300046455 | Bacteria | 3861 |
| 488 | Ga0495603_0055671 | 3300046455 | Bacteria | 2343 |
| 489 | Ga0495603_0187281 | 3300046455 | Bacteria | 1197 |
| 490 | Ga0495590_0000062 | 3300046457 | Bacteria | 82552 |
| 491 | Ga0495590_0003467 | 3300046457 | Bacteria | 6435 |
| 492 | Ga0495590_0019222 | 3300046457 | Bacteria | 2436 |
| 493 | Ga0495591_001099 | 3300046458 | Bacteria | 18000 |
| 494 | Ga0495629_0000054 | 3300046459 | Bacteria | 106374 |
| 495 | Ga0495629_0000099 | 3300046459 | Bacteria | 75956 |
| 496 | Ga0495629_0047453 | 3300046459 | Bacteria | 3012 |
| 497 | Ga0495629_0067906 | 3300046459 | Bacteria | 2487 |
| 498 | Ga0495638_0007214 | 3300046460 | Bacteria | 7992 |
| 499 | Ga0495638_0007523 | 3300046460 | Bacteria | 7797 |
| 500 | Ga0495638_0016585 | 3300046460 | Bacteria | 4930 |
| 501 | Ga0495638_0035271 | 3300046460 | Bacteria | 3190 |
| 502 | Ga0495638_0120959 | 3300046460 | Bacteria | 1547 |
| 503 | Ga0495651_0036224 | 3300046462 | Bacteria | 3841 |
| 504 | Ga0495651_0059265 | 3300046462 | Bacteria | 2936 |
| 505 | Ga0495651_0070947 | 3300046462 | Bacteria | 2649 |
| 506 | Ga0495653_0000099 | 3300046463 | Bacteria | 71802 |
| 507 | Ga0495653_0013098 | 3300046463 | Bacteria | 6760 |
| 508 | Ga0495650_0001143 | 3300046471 | Bacteria | 28780 |
| 509 | Ga0495650_0002455 | 3300046471 | Bacteria | 14954 |
| 510 | Ga0495650_0002504 | 3300046471 | Bacteria | 14727 |
| 511 | Ga0495650_0018748 | 3300046471 | Bacteria | 3430 |
| 512 | Ga0495580_0000082 | 3300046472 | Bacteria | 61156 |
| 513 | Ga0495580_0000208 | 3300046472 | Bacteria | 45347 |
| 514 | Ga0495580_0014112 | 3300046472 | Bacteria | 6073 |
| 515 | Ga0495580_0015382 | 3300046472 | Bacteria | 5772 |
| 516 | Ga0495580_0038009 | 3300046472 | Bacteria | 3451 |
| 517 | Ga0495580_0048682 | 3300046472 | Bacteria | 2999 |
| 518 | Ga0495580_0054404 | 3300046472 | Bacteria | 2823 |
| 519 | Ga0495582_0008194 | 3300046473 | Bacteria | 5768 |
| 520 | Ga0495582_0010405 | 3300046473 | Bacteria | 5117 |
| 521 | Ga0495582_0015819 | 3300046473 | Bacteria | 4138 |
| 522 | Ga0495582_0019610 | 3300046473 | Bacteria | 3699 |
| 523 | Ga0495582_0052010 | 3300046473 | Bacteria | 2259 |
| 524 | Ga0495605_0000250 | 3300046474 | Bacteria | 63615 |
| 525 | Ga0495605_0002569 | 3300046474 | Bacteria | 11163 |
| 526 | Ga0495605_0004126 | 3300046474 | Bacteria | 8564 |
| 527 | Ga0495605_0009441 | 3300046474 | Bacteria | 5480 |
| 528 | Ga0495664_0012257 | 3300046477 | Bacteria | 4854 |
| 529 | Ga0495584_0000055 | 3300046491 | Bacteria | 81977 |
| 530 | Ga0495596_0001254 | 3300046500 | Bacteria | 14780 |
| 531 | Ga0495596_0015853 | 3300046500 | Bacteria | 3142 |
| 532 | Ga0495607_0002944 | 3300046501 | Bacteria | 13378 |
| 533 | Ga0495583_0003132 | 3300046506 | Bacteria | 13051 |
| 534 | Ga0495583_0006321 | 3300046506 | Bacteria | 7777 |
| 535 | Ga0495606_0000240 | 3300046507 | Bacteria | 96783 |
| 536 | Ga0495606_0009476 | 3300046507 | Bacteria | 8232 |
| 537 | Ga0495606_0015029 | 3300046507 | Bacteria | 5996 |
| 538 | Ga0495606_0020115 | 3300046507 | Bacteria | 4935 |
| 539 | Ga0495606_0040054 | 3300046507 | Bacteria | 3152 |
| 540 | Ga0495606_0152876 | 3300046507 | Bacteria | 1353 |
| 541 | Ga0495610_0001010 | 3300046512 | Bacteria | 25912 |
| 542 | Ga0495610_0005858 | 3300046512 | Bacteria | 8629 |
| 543 | Ga0495616_0000211 | 3300046513 | Bacteria | 48566 |
| 544 | Ga0495618_0030599 | 3300046514 | Bacteria | 3362 |
| 545 | Ga0495620_0000720 | 3300046515 | Bacteria | 20399 |
| 546 | Ga0495620_0011883 | 3300046515 | Bacteria | 4524 |
| 547 | Ga0495620_0016675 | 3300046515 | Bacteria | 3680 |
| 548 | Ga0495628_0004119 | 3300046516 | Bacteria | 12931 |
| 549 | Ga0495628_0017922 | 3300046516 | Bacteria | 5877 |
| 550 | Ga0495628_0065029 | 3300046516 | Bacteria | 2854 |
| 551 | Ga0495628_0065782 | 3300046516 | Bacteria | 2834 |
| 552 | Ga0495628_0173768 | 3300046516 | Bacteria | 1632 |
| 553 | Ga0495630_0003148 | 3300046517 | Bacteria | 11447 |
| 554 | Ga0495630_0006005 | 3300046517 | Bacteria | 8589 |
| 555 | Ga0495631_0000054 | 3300046518 | Bacteria | 70253 |
| 556 | Ga0495631_0000932 | 3300046518 | Bacteria | 18216 |
| 557 | Ga0495637_0012154 | 3300046520 | Bacteria | 4123 |
| 558 | Ga0495643_0045249 | 3300046522 | Bacteria | 2390 |
| 559 | Ga0495644_0045471 | 3300046523 | Bacteria | 1651 |
| 560 | Ga0495648_0000971 | 3300046524 | Bacteria | 29603 |
| 561 | Ga0495648_0003217 | 3300046524 | Bacteria | 14492 |
| 562 | Ga0495648_0004756 | 3300046524 | Bacteria | 11492 |
| 563 | Ga0495648_0052631 | 3300046524 | Bacteria | 2471 |
| 564 | Ga0495648_0114174 | 3300046524 | Bacteria | 1463 |
| 565 | Ga0495648_0149648 | 3300046524 | Bacteria | 1219 |
| 566 | Ga0495666_0054900 | 3300046526 | Bacteria | 1910 |
| 567 | Ga0495666_0064354 | 3300046526 | Bacteria | 1750 |
| 568 | Ga0495666_0130873 | 3300046526 | Bacteria | 1172 |
| 569 | Ga0495642_0000006 | 3300046528 | Bacteria | 172412 |
| 570 | Ga0495652_0024230 | 3300046529 | Bacteria | 5373 |
| 571 | Ga0495652_0047659 | 3300046529 | Bacteria | 3674 |
| 572 | Ga0495654_0000424 | 3300046530 | Bacteria | 35763 |
| 573 | Ga0495654_0006828 | 3300046530 | Bacteria | 6441 |
| 574 | Ga0495654_0010213 | 3300046530 | Bacteria | 5116 |
| 575 | Ga0495654_0045562 | 3300046530 | Bacteria | 2163 |
| 576 | Ga0495654_0051889 | 3300046530 | Bacteria | 2000 |
| 577 | Ga0495665_0006780 | 3300046531 | Bacteria | 6178 |
| 578 | Ga0495665_0010499 | 3300046531 | Bacteria | 5013 |
| 579 | Ga0495665_0012030 | 3300046531 | Bacteria | 4684 |
| 580 | Ga0495665_0022519 | 3300046531 | Bacteria | 3387 |
| 581 | Ga0495665_0048049 | 3300046531 | Bacteria | 2263 |
| 582 | Ga0495640_0002986 | 3300046533 | Bacteria | 13619 |
| 583 | Ga0495640_0006341 | 3300046533 | Bacteria | 9374 |
| 584 | Ga0495640_0071184 | 3300046533 | Bacteria | 2334 |
| 585 | Ga0495586_0030103 | 3300046535 | Bacteria | 2905 |
| 586 | Ga0495586_0123042 | 3300046535 | Bacteria | 1450 |
| 587 | Ga0495586_0195080 | 3300046535 | Bacteria | 1147 |
| 588 | Ga0495587_0041837 | 3300046536 | Bacteria | 2733 |
| 589 | Ga0495609_0000069 | 3300046538 | Bacteria | 128601 |
| 590 | Ga0495609_0000357 | 3300046538 | Bacteria | 39838 |
| 591 | Ga0495621_0001102 | 3300046539 | Bacteria | 6956 |
| 592 | Ga0495621_0030015 | 3300046539 | Bacteria | 1856 |
| 593 | Ga0495597_0007210 | 3300046542 | Bacteria | 5667 |
| 594 | Ga0495645_0018667 | 3300046543 | Bacteria | 4984 |
| 595 | Ga0495622_0000880 | 3300046557 | Bacteria | 16384 |
| 596 | Ga0495633_0008364 | 3300046558 | Bacteria | 5838 |
| 597 | Ga0495667_0004661 | 3300046559 | Bacteria | 9270 |
| 598 | Ga0495668_0000064 | 3300046616 | Bacteria | 180583 |
| 599 | Ga0495668_0000319 | 3300046616 | Bacteria | 66006 |
| 600 | Ga0495668_0003544 | 3300046616 | Bacteria | 11604 |
| 601 | Ga0495668_0025365 | 3300046616 | Bacteria | 3368 |
| 602 | Ga0495634_0142422 | 3300046642 | Bacteria | 1521 |
| 603 | Ga0495611_0017239 | 3300046648 | Bacteria | 3088 |
| 604 | Ga0495611_0046716 | 3300046648 | Bacteria | 1942 |
| 605 | Ga0495611_0117353 | 3300046648 | Bacteria | 1240 |
| 606 | Ga0495625_0020529 | 3300046660 | Bacteria | 5098 |
| 607 | Ga0495625_0049416 | 3300046660 | Bacteria | 3024 |
| 608 | Ga0495625_0172162 | 3300046660 | Bacteria | 1445 |
| 609 | Ga0495635_0029567 | 3300046663 | Bacteria | 3811 |
| 610 | Ga0495661_0017617 | 3300046665 | Bacteria | 4715 |
| 611 | Ga0495661_0020918 | 3300046665 | Bacteria | 4267 |
| 612 | Ga0495661_0155273 | 3300046665 | Bacteria | 1233 |
| 613 | Ga0495657_0021542 | 3300046675 | Bacteria | 4624 |
| 614 | Ga0495657_0079614 | 3300046675 | Bacteria | 2122 |
| 615 | Ga0495599_0019288 | 3300046678 | Bacteria | 4251 |
| 616 | Ga0495623_0002988 | 3300046679 | Bacteria | 11120 |
| 617 | Ga0495623_0034113 | 3300046679 | Bacteria | 3264 |
| 618 | Ga0495623_0104159 | 3300046679 | Bacteria | 1725 |
| 619 | Ga0495646_0001798 | 3300046680 | Bacteria | 12872 |
| 620 | Ga0495646_0003633 | 3300046680 | Bacteria | 9626 |
| 621 | Ga0495646_0048346 | 3300046680 | Bacteria | 2584 |
| 622 | Ga0495669_0004952 | 3300046684 | Bacteria | 5535 |
| 623 | Ga0495669_0008446 | 3300046684 | Bacteria | 4331 |
| 624 | Ga0495613_0007126 | 3300046689 | Bacteria | 8323 |
| 625 | Ga0495613_0109898 | 3300046689 | Bacteria | 1987 |
| 626 | Ga0495624_0002851 | 3300046690 | Bacteria | 12937 |
| 627 | Ga0495624_0014790 | 3300046690 | Bacteria | 5284 |
| 628 | Ga0495624_0016562 | 3300046690 | Bacteria | 4961 |
| 629 | Ga0495624_0018031 | 3300046690 | Bacteria | 4727 |
| 630 | Ga0495624_0046239 | 3300046690 | Bacteria | 2768 |
| 631 | Ga0495624_0051742 | 3300046690 | Bacteria | 2597 |
| 632 | Ga0495670_0000603 | 3300046691 | Bacteria | 17150 |
| 633 | Ga0495670_0002733 | 3300046691 | Bacteria | 8710 |
| 634 | Ga0495671_0001569 | 3300046692 | Bacteria | 15147 |
| 635 | Ga0495671_0020281 | 3300046692 | Bacteria | 3503 |
| 636 | Ga0495671_0023174 | 3300046692 | Bacteria | 3245 |
| 637 | Ga0495671_0045650 | 3300046692 | Bacteria | 2193 |
| 638 | Ga0495671_0047884 | 3300046692 | Bacteria | 2134 |
| 639 | Ga0495649_0000844 | 3300046694 | Bacteria | 24615 |
| 640 | Ga0495649_0005939 | 3300046694 | Bacteria | 7655 |
| 641 | Ga0495649_0055517 | 3300046694 | Bacteria | 2140 |
| 642 | Ga0495649_0066462 | 3300046694 | Bacteria | 1935 |
| 643 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 644 | Ga0495589_0000928 | 3300046794 | Bacteria | 18001 |
| 645 | Ga0495589_0025596 | 3300046794 | Bacteria | 2994 |
| 646 | Ga0495600_0004096 | 3300046809 | Bacteria | 8676 |
| 647 | Ga0495660_0000080 | 3300046810 | Bacteria | 103751 |
| 648 | Ga0495660_0000177 | 3300046810 | Bacteria | 69130 |
| 649 | Ga0495581_0014339 | 3300047315 | Bacteria | 4596 |
| 650 | Ga0495604_0018563 | 3300047317 | Bacteria | 5572 |
| 651 | Ga0495604_0020358 | 3300047317 | Bacteria | 5300 |
| 652 | Ga0495604_0025620 | 3300047317 | Bacteria | 4697 |
| 653 | Ga0495604_0080016 | 3300047317 | Bacteria | 2449 |
| 654 | Ga0495674_0004220 | 3300047319 | Bacteria | 13838 |
| 655 | Ga0495674_0007713 | 3300047319 | Bacteria | 10280 |
| 656 | Ga0495674_0012326 | 3300047319 | Bacteria | 8053 |
| 657 | Ga0495674_0057474 | 3300047319 | Bacteria | 3404 |
| 658 | Ga0495674_0118705 | 3300047319 | Bacteria | 2236 |
| 659 | Ga0495674_0149829 | 3300047319 | Bacteria | 1956 |
| 660 | Ga0495674_0341658 | 3300047319 | Bacteria | 1216 |
| 661 | Ga0495672_0000010 | 3300047320 | Bacteria | 545038 |
| 662 | Ga0495672_0000158 | 3300047320 | Bacteria | 98531 |
| 663 | Ga0495672_0004354 | 3300047320 | Bacteria | 11636 |
| 664 | Ga0495672_0014192 | 3300047320 | Bacteria | 5465 |
| 665 | Ga0495672_0121310 | 3300047320 | Bacteria | 1389 |
| 666 | Ga0495676_0022045 | 3300047321 | Bacteria | 5551 |
| 667 | Ga0495680_0023583 | 3300047322 | Bacteria | 5114 |
| 668 | Ga0495680_0031745 | 3300047322 | Bacteria | 4295 |
| 669 | Ga0495680_0069170 | 3300047322 | Bacteria | 2694 |
| 670 | Ga0495680_0076445 | 3300047322 | Bacteria | 2538 |
| 671 | Ga0495683_0002027 | 3300047323 | Bacteria | 12553 |
| 672 | Ga0495683_0004646 | 3300047323 | Bacteria | 7738 |
| 673 | Ga0495683_0015176 | 3300047323 | Bacteria | 4011 |
| 674 | Ga0495683_0026041 | 3300047323 | Bacteria | 2995 |
| 675 | Ga0495687_000104 | 3300047443 | Bacteria | 128704 |
| 676 | Ga0495687_013575 | 3300047443 | Bacteria | 4241 |
| 677 | Ga0495687_014501 | 3300047443 | Bacteria | 4054 |
| 678 | Ga0495687_026210 | 3300047443 | Bacteria | 2748 |
| 679 | Ga0495687_030850 | 3300047443 | Bacteria | 2465 |
| 680 | Ga0495687_037021 | 3300047443 | Bacteria | 2177 |
| 681 | Ga0495687_042575 | 3300047443 | Bacteria | 1983 |
| 682 | Ga0495675_0001679 | 3300047444 | Bacteria | 13286 |
| 683 | Ga0495675_0054579 | 3300047444 | Bacteria | 2535 |
| 684 | Ga0495675_0072682 | 3300047444 | Bacteria | 2169 |
| 685 | Ga0495679_000062 | 3300047446 | Bacteria | 107181 |
| 686 | Ga0495679_000063 | 3300047446 | Bacteria | 103758 |
| 687 | Ga0495679_001490 | 3300047446 | Bacteria | 13210 |
| 688 | Ga0495679_002444 | 3300047446 | Bacteria | 9462 |
| 689 | Ga0495679_013378 | 3300047446 | Bacteria | 3083 |
| 690 | Ga0495673_0001271 | 3300047469 | Bacteria | 20784 |
| 691 | Ga0495673_0019368 | 3300047469 | Bacteria | 3410 |
| 692 | Ga0495673_0049331 | 3300047469 | Bacteria | 1853 |
| 693 | Ga0495673_0050304 | 3300047469 | Bacteria | 1829 |
| 694 | Ga0495673_0061242 | 3300047469 | Bacteria | 1612 |
| 695 | Ga0495684_0138695 | 3300047471 | Bacteria | 1824 |
| 696 | Ga0495686_0002575 | 3300047472 | Bacteria | 16881 |
| 697 | Ga0495686_0028742 | 3300047472 | Bacteria | 3620 |
| 698 | Ga0495686_0041236 | 3300047472 | Bacteria | 2939 |
| 699 | Ga0495686_0043715 | 3300047472 | Bacteria | 2839 |
| 700 | Ga0495593_0011480 | 3300047673 | Bacteria | 5086 |
| 701 | Ga0495593_0019601 | 3300047673 | Bacteria | 3791 |
| 702 | Ga0495593_0044331 | 3300047673 | Bacteria | 2380 |
| 703 | Ga0495602_0000856 | 3300048088 | Bacteria | 29354 |
| 704 | Ga0495602_0028550 | 3300048088 | Bacteria | 5336 |
| 705 | Ga0495602_0081496 | 3300048088 | Bacteria | 2720 |
| 706 | Ga0495614_0118602 | 3300048089 | Bacteria | 1165 |
| 707 | Ga0496100_0063024 | 3300048903 | Bacteria | 2449 |
| 708 | Ga0496100_0064098 | 3300048903 | Bacteria | 2430 |
| 709 | Ga0496101_0001501 | 3300048904 | Bacteria | 13958 |
| 710 | Ga0496101_0009824 | 3300048904 | Bacteria | 6303 |
| 711 | Ga0496101_0076060 | 3300048904 | Bacteria | 2472 |
| 712 | Ga0496101_0261609 | 3300048904 | Bacteria | 1350 |
| 713 | Ga0496102_0004504 | 3300048905 | Bacteria | 11768 |
| 714 | Ga0496102_0004959 | 3300048905 | Bacteria | 11276 |
| 715 | Ga0496102_0005431 | 3300048905 | Bacteria | 10811 |
| 716 | Ga0496102_0016284 | 3300048905 | Bacteria | 6494 |
| 717 | Ga0496102_0042541 | 3300048905 | Bacteria | 4116 |
| 718 | Ga0496102_0085628 | 3300048905 | Bacteria | 2910 |
| 719 | Ga0496102_0151506 | 3300048905 | Bacteria | 2179 |
| 720 | Ga0496102_0179263 | 3300048905 | Bacteria | 1996 |
| 721 | Ga0496102_0192183 | 3300048905 | Bacteria | 1923 |
| 722 | Ga0496102_0193752 | 3300048905 | Bacteria | 1915 |
| 723 | Ga0496102_0311666 | 3300048905 | Bacteria | 1483 |
| 724 | Ga0496102_0479345 | 3300048905 | Bacteria | 1165 |
| 725 | Ga0496103_0001546 | 3300048906 | Bacteria | 15290 |
| 726 | Ga0496103_0002245 | 3300048906 | Bacteria | 12238 |
| 727 | Ga0496103_0004401 | 3300048906 | Bacteria | 8547 |
| 728 | Ga0496103_0011170 | 3300048906 | Bacteria | 5317 |
| 729 | Ga0496103_0098874 | 3300048906 | Bacteria | 1845 |
| 730 | Ga0496104_0099819 | 3300048907 | Bacteria | 2779 |
| 731 | Ga0496105_0018285 | 3300048908 | Bacteria | 5629 |
| 732 | Ga0496106_0002122 | 3300048909 | Bacteria | 14837 |
| 733 | Ga0496107_0025617 | 3300048910 | Bacteria | 4176 |
| 734 | Ga0496107_0037012 | 3300048910 | Bacteria | 3502 |
| 735 | Ga0496108_0334082 | 3300048911 | Bacteria | 1322 |
| 736 | Ga0496109_0162694 | 3300048912 | Bacteria | 2091 |
| 737 | Ga0496110_0005967 | 3300048913 | Bacteria | 9593 |
| 738 | Ga0496110_0383698 | 3300048913 | Bacteria | 1280 |
| 739 | Ga0496111_0031413 | 3300048914 | Bacteria | 3783 |
| 740 | Ga0496112_0113275 | 3300048915 | Bacteria | 2683 |
| 741 | Ga0496114_0065402 | 3300048917 | Bacteria | 3047 |
| 742 | Ga0496116_0000031 | 3300048919 | Bacteria | 420043 |
| 743 | Ga0496117_0001221 | 3300048920 | Bacteria | 38481 |
| 744 | Ga0496117_0003334 | 3300048920 | Bacteria | 18760 |
| 745 | Ga0496117_0012014 | 3300048920 | Bacteria | 7690 |
| 746 | Ga0496117_0024611 | 3300048920 | Bacteria | 4755 |
| 747 | Ga0496117_0117992 | 3300048920 | Bacteria | 1637 |
| 748 | Ga0496117_0170475 | 3300048920 | Bacteria | 1264 |
| 749 | Ga0496118_0001708 | 3300048921 | Bacteria | 32058 |
| 750 | Ga0496118_0004252 | 3300048921 | Bacteria | 17141 |
| 751 | Ga0496118_0016225 | 3300048921 | Bacteria | 6842 |
| 752 | Ga0496118_0044336 | 3300048921 | Bacteria | 3484 |
| 753 | Ga0496118_0072369 | 3300048921 | Bacteria | 2476 |
| 754 | Ga0496119_0000468 | 3300048922 | Bacteria | 55018 |
| 755 | Ga0496119_0033243 | 3300048922 | Bacteria | 3423 |
| 756 | Ga0496120_0000137 | 3300048923 | Bacteria | 123518 |
| 757 | Ga0496121_0000437 | 3300048924 | Bacteria | 82376 |
| 758 | Ga0496121_0000573 | 3300048924 | Bacteria | 69111 |
| 759 | Ga0496121_0006494 | 3300048924 | Bacteria | 14471 |
| 760 | Ga0496121_0009566 | 3300048924 | Bacteria | 11105 |
| 761 | Ga0496121_0014837 | 3300048924 | Bacteria | 8222 |
| 762 | Ga0496121_0051729 | 3300048924 | Bacteria | 3457 |
| 763 | Ga0496121_0161963 | 3300048924 | Bacteria | 1635 |
| 764 | Ga0496122_0001630 | 3300048925 | Bacteria | 35015 |
| 765 | Ga0496122_0002855 | 3300048925 | Bacteria | 23658 |
| 766 | Ga0496122_0041369 | 3300048925 | Bacteria | 3645 |
| 767 | Ga0496122_0072071 | 3300048925 | Bacteria | 2458 |
| 768 | Ga0496123_0001111 | 3300048926 | Bacteria | 40321 |
| 769 | Ga0496123_0003528 | 3300048926 | Bacteria | 17419 |
| 770 | Ga0496123_0015546 | 3300048926 | Bacteria | 6236 |
| 771 | Ga0496123_0048914 | 3300048926 | Bacteria | 2840 |
| 772 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 773 | Ga0496124_0000138 | 3300048927 | Bacteria | 150311 |
| 774 | Ga0496124_0002733 | 3300048927 | Bacteria | 22485 |
| 775 | Ga0496124_0205923 | 3300048927 | Bacteria | 1492 |
| 776 | Ga0496125_0001586 | 3300048928 | Bacteria | 32273 |
| 777 | Ga0496125_0007850 | 3300048928 | Bacteria | 11280 |
| 778 | Ga0496125_0022722 | 3300048928 | Bacteria | 5814 |
| 779 | Ga0496125_0046935 | 3300048928 | Bacteria | 3618 |
| 780 | Ga0496125_0076609 | 3300048928 | Bacteria | 2582 |
| 781 | Ga0496125_0118496 | 3300048928 | Bacteria | 1896 |
| 782 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 783 | Ga0496126_0000446 | 3300048929 | Bacteria | 82267 |
| 784 | Ga0496126_0000882 | 3300048929 | Bacteria | 52767 |
| 785 | Ga0496126_0006636 | 3300048929 | Bacteria | 12879 |
| 786 | Ga0496126_0019981 | 3300048929 | Bacteria | 6581 |
| 787 | Ga0496126_0034277 | 3300048929 | Bacteria | 4769 |
| 788 | Ga0496126_0073429 | 3300048929 | Bacteria | 3041 |
| 789 | Ga0496126_0092103 | 3300048929 | Bacteria | 2664 |
| 790 | Ga0496126_0126700 | 3300048929 | Bacteria | 2210 |
| 791 | Ga0496126_0162752 | 3300048929 | Bacteria | 1906 |
| 792 | Ga0496126_0186025 | 3300048929 | Bacteria | 1761 |
| 793 | Ga0495678_009436 | 3300049459 | Bacteria | 4828 |
| 794 | Ga0495678_012518 | 3300049459 | Bacteria | 4019 |
| 795 | Ga0495682_0025422 | 3300049460 | Bacteria | 2203 |
| 796 | Ga0501033_0056048 | 3300049570 | Bacteria | 2914 |
| 797 | Ga0501033_0173407 | 3300049570 | Bacteria | 1548 |
| 798 | Ga0501034_0000042 | 3300049571 | Bacteria | 229124 |
| 799 | Ga0501036_0165230 | 3300049572 | Bacteria | 1866 |
| 800 | Ga0501038_0241156 | 3300049574 | Bacteria | 1435 |
| 801 | Ga0501041_0047297 | 3300049577 | Bacteria | 2619 |
| 802 | Ga0501042_0041141 | 3300049578 | Bacteria | 3286 |
| 803 | Ga0501043_0117598 | 3300049579 | Bacteria | 2086 |
| 804 | Ga0501046_0082618 | 3300049580 | Bacteria | 2481 |
| 805 | Ga0501047_0024493 | 3300049581 | Bacteria | 5792 |
| 806 | Ga0501047_0030160 | 3300049581 | Bacteria | 5229 |
| 807 | Ga0501048_0215348 | 3300049582 | Bacteria | 1362 |
| 808 | Ga0501071_0080338 | 3300049587 | Bacteria | 2384 |
| 809 | Ga0501072_0029409 | 3300049588 | Bacteria | 4292 |
| 810 | Ga0501075_0021514 | 3300049591 | Bacteria | 4704 |
| 811 | Ga0501075_0084934 | 3300049591 | Bacteria | 2398 |
| 812 | Ga0501077_0140931 | 3300049593 | Bacteria | 1529 |
| 813 | Ga0501227_001375 | 3300049665 | Bacteria | 5456 |
| 814 | Ga0501080_0029512 | 3300049742 | Bacteria | 5106 |
| 815 | Ga0501081_0070143 | 3300049743 | Bacteria | 2442 |
| 816 | Ga0501279_000660 | 3300049775 | Bacteria | 4548 |
| 817 | Ga0501035_0026358 | 3300049822 | Bacteria | 5319 |
| 818 | Ga0501035_0229014 | 3300049822 | Bacteria | 1584 |
| 819 | Ga0501044_0000059 | 3300049823 | Bacteria | 134132 |
| 820 | Ga0501044_0001443 | 3300049823 | Bacteria | 27936 |
| 821 | Ga0501045_0049438 | 3300049824 | Bacteria | 3066 |
| 822 | nmdc:mga03683_490_c1 | 3300050489 | Bacteria | 11307 |
| 823 | nmdc:mga03n38_23536_c1 | 3300050490 | Bacteria | 2507 |
| 824 | nmdc:mga03n38_32004_c1 | 3300050490 | Bacteria | 2224 |
| 825 | nmdc:mga03n38_99544_c1 | 3300050490 | Bacteria | 1400 |
| 826 | nmdc:mga00v17_157_c1 | 3300050491 | Bacteria | 40094 |
| 827 | nmdc:mga00v17_253000_c1 | 3300050491 | Bacteria | 1142 |
| 828 | nmdc:mga00v17_25948_c1 | 3300050491 | Bacteria | 3409 |
| 829 | nmdc:mga00v17_3382_c1 | 3300050491 | Bacteria | 8234 |
| 830 | nmdc:mga00v17_41288_c1 | 3300050491 | Bacteria | 2770 |
| 831 | nmdc:mga0yw44_152651_c1 | 3300050492 | Bacteria | 1507 |
| 832 | nmdc:mga0yw44_16617_c1 | 3300050492 | Bacteria | 3981 |
| 833 | nmdc:mga0yw44_246638_c1 | 3300050492 | Bacteria | 1188 |
| 834 | nmdc:mga0yw44_36855_c1 | 3300050492 | Bacteria | 2885 |
| 835 | nmdc:mga0k408_103016_c1 | 3300050493 | Bacteria | 1684 |
| 836 | nmdc:mga0k408_134985_c1 | 3300050493 | Bacteria | 1466 |
| 837 | nmdc:mga0k408_15670_c1 | 3300050493 | Bacteria | 4196 |
| 838 | nmdc:mga0k408_264_c1 | 3300050493 | Bacteria | 28733 |
| 839 | nmdc:mga06z11_43335_c1 | 3300050494 | Bacteria | 2263 |
| 840 | nmdc:mga07m45_101710_c1 | 3300050496 | Bacteria | 1650 |
| 841 | nmdc:mga07m45_18103_c1 | 3300050496 | Bacteria | 3796 |
| 842 | nmdc:mga07m45_33873_c1 | 3300050496 | Bacteria | 2838 |
| 843 | nmdc:mga0qj67_26252_c1 | 3300050509 | Bacteria | 4508 |
| 844 | Ga0495619_0027397 | 3300053085 | Unclassified | 3669 |
| 845 | Ga0500643_005454 | 3300053087 | Bacteria | 5481 |
| 846 | Ga0500581_047926 | 3300053089 | Bacteria | 2182 |
| 847 | Ga0500647_0001969 | 3300053091 | Bacteria | 7413 |
| 848 | Ga0500583_0080956 | 3300053092 | Bacteria | 1568 |
| 849 | Ga0500651_0000011 | 3300053093 | Bacteria | 246573 |
| 850 | Ga0500566_0002124 | 3300053094 | Bacteria | 11676 |
| 851 | Ga0500556_0000058 | 3300053104 | Bacteria | 114257 |
| 852 | Ga0500557_000056 | 3300053105 | Bacteria | 49363 |
| 853 | Ga0500562_008953 | 3300053108 | Bacteria | 2529 |
| 854 | Ga0500569_017661 | 3300053109 | Bacteria | 1828 |
| 855 | Ga0500571_000008 | 3300053110 | Bacteria | 87309 |
| 856 | Ga0500595_006780 | 3300053119 | Bacteria | 4823 |
| 857 | Ga0500595_022855 | 3300053119 | Bacteria | 2205 |
| 858 | Ga0500614_013147 | 3300053123 | Bacteria | 1815 |
| 859 | Ga0500642_0000025 | 3300053130 | Bacteria | 130425 |
| 860 | Ga0500642_0000295 | 3300053130 | Bacteria | 18073 |
| 861 | Ga0500652_000007 | 3300053131 | Bacteria | 165913 |
| 862 | Ga0500652_001122 | 3300053131 | Bacteria | 8613 |
| 863 | Ga0500655_000511 | 3300053133 | Bacteria | 7830 |
| 864 | Ga0500658_0000085 | 3300053134 | Bacteria | 43497 |
| 865 | Ga0500658_0000181 | 3300053134 | Bacteria | 29974 |
| 866 | Ga0500658_0017903 | 3300053134 | Bacteria | 2651 |
| 867 | Ga0500658_0028537 | 3300053134 | Bacteria | 2166 |
| 868 | Ga0500559_0005262 | 3300053136 | Bacteria | 5965 |
| 869 | Ga0500559_0051010 | 3300053136 | Bacteria | 1826 |
| 870 | Ga0500568_0000547 | 3300053139 | Bacteria | 27675 |
| 871 | Ga0500568_0001205 | 3300053139 | Bacteria | 17266 |
| 872 | Ga0500574_005440 | 3300053141 | Bacteria | 2481 |
| 873 | Ga0500588_0003547 | 3300053146 | Bacteria | 3306 |
| 874 | Ga0500600_0024281 | 3300053149 | Bacteria | 3613 |
| 875 | Ga0500604_0011096 | 3300053151 | Bacteria | 2416 |
| 876 | Ga0500620_035558 | 3300053155 | Bacteria | 1606 |
| 877 | Ga0500622_0000112 | 3300053156 | Bacteria | 83558 |
| 878 | Ga0500627_0019290 | 3300053158 | Bacteria | 2714 |
| 879 | Ga0500634_0016121 | 3300053161 | Bacteria | 3983 |
| 880 | Ga0500634_0034310 | 3300053161 | Bacteria | 2764 |
| 881 | Ga0500634_0041670 | 3300053161 | Bacteria | 2493 |
| 882 | Ga0500634_0048936 | 3300053161 | Bacteria | 2280 |
| 883 | Ga0500638_062146 | 3300053162 | Bacteria | 1793 |
| 884 | Ga0500636_0073472 | 3300053177 | Bacteria | 1980 |
| 885 | Ga0500611_001649 | 3300053727 | Bacteria | 2514 |
| 886 | Ga0590075_026072 | 3300059424 | Bacteria | 1471 |
| 887 | Ga0587090_000446 | 3300059510 | Bacteria | 3416 |
| 888 | Ga0587072_000808 | 3300059643 | Bacteria | 3495 |
| 889 | Ga0587124_000762 | 3300059660 | Bacteria | 1893 |
| 890 | Ga0501082_0020019 | 3300060353 | Bacteria | 5766 |
| 891 | Ga0501082_0361104 | 3300060353 | Bacteria | 1267 |
| 892 | Ga0466962_0006642 | 3300061719 | Bacteria | 5550 |
| 893 | Ga0466962_0021693 | 3300061719 | Bacteria | 3082 |
| 894 | 2501071161 | 2501025501 | Bacteria | 7768574 |
| 895 | 2501078646 | 2501025502 | Bacteria | 9641094 |
| 896 | 2501414043 | 2501025504 | Bacteria | 8008976 |
| 897 | 2506577259 | 2506520007 | Bacteria | 5442880 |
| 898 | 2506582397 | 2506520008 | Bacteria | 5443009 |
| 899 | 2508851188 | 2508501071 | Bacteria | 5454741 |
| 900 | 2509127460 | 2508501125 | Bacteria | 7208311 |
| 901 | 2509153415 | 2508501128 | Bacteria | 8613869 |
| 902 | 2510250135 | 2510065045 | Bacteria | 7761063 |
| 903 | 2511089293 | 2510917013 | Bacteria | 9951648 |
| 904 | 2511094697 | 2510917014 | Bacteria | 8296963 |
| 905 | 2511104407 | 2510917015 | Bacteria | 7950052 |
| 906 | 2512347686 | 2512047030 | Bacteria | 9031815 |
| 907 | 2513555977 | 2513237082 | Bacteria | 8640282 |
| 908 | 2513565530 | 2513237083 | Bacteria | 8410967 |
| 909 | 2513658138 | 2513237096 | Bacteria | 8722461 |
| 910 | 2513675972 | 2513237098 | Bacteria | 9902361 |
| 911 | 2513678860 | 2513237098 | Bacteria | 9902361 |
| 912 | 2513723552 | 2513237104 | Bacteria | 10034502 |
| 913 | 2513860270 | 2513237137 | Bacteria | 9558895 |
| 914 | 2513889889 | 2513237141 | Bacteria | 8496279 |
| 915 | 2513920370 | 2513237145 | Bacteria | 8979722 |
| 916 | 2513962164 | 2513237151 | Bacteria | 6309801 |
| 917 | 2515679273 | 2515154122 | Bacteria | 8609520 |
| 918 | 2515688480 | 2515154123 | Bacteria | 6387382 |
| 919 | 2516017150 | 2515154189 | Bacteria | 9629850 |
| 920 | 2517105405 | 2517093001 | Bacteria | 9002274 |
| 921 | 2517889207 | 2517572143 | Bacteria | 9484767 |
| 922 | 2521560316 | 2521172590 | Bacteria | 5047645 |
| 923 | 2524467980 | 2524023210 | Bacteria | 9029266 |
| 924 | 2524541580 | 2524023228 | Bacteria | 10118060 |
| 925 | 2527076825 | 2526164713 | Bacteria | 6780608 |
| 926 | 2535484790 | 2534681786 | Bacteria | 3308809 |
| 927 | 2563062146 | 2562617112 | Bacteria | 10918404 |
| 928 | 2599396456 | 2599185167 | Bacteria | 6353609 |
| 929 | 2599453488 | 2599185179 | Bacteria | 6611171 |
| 930 | 2599514769 | 2599185190 | Bacteria | 6285678 |
| 931 | 2599517249 | 2599185191 | Bacteria | 6297582 |
| 932 | 2599893966 | 2599185290 | Bacteria | 6289611 |
| 933 | 2599904353 | 2599185292 | Bacteria | 6290804 |
| 934 | 2600005361 | 2599185313 | Bacteria | 6658188 |
| 935 | 2600072358 | 2599185324 | Bacteria | 6590677 |
| 936 | 2600812632 | 2600255067 | Bacteria | 6795583 |
| 937 | 2643734223 | 2643221542 | Bacteria | 3563959 |
| 938 | 2644161231 | 2643221628 | Bacteria | 5745828 |
| 939 | 2644170809 | 2643221630 | Bacteria | 3601215 |
| 940 | 2656277915 | 2654587920 | Bacteria | 5475511 |
| 941 | 2671118403 | 2667528175 | Bacteria | 7532676 |
| 942 | 2689443715 | 2687453601 | Bacteria | 5546041 |
| 943 | 2713478006 | 2711768613 | Bacteria | 11048459 |
| 944 | 2719639293 | 2718217991 | Bacteria | 7829542 |
| 945 | 2723877632 | 2721755763 | Bacteria | 4464185 |
| 946 | 2728749317 | 2728368998 | Bacteria | 8720350 |
| 947 | 2738717898 | 2738541277 | Bacteria | 7458140 |
| 948 | 2738819924 | 2738541296 | Bacteria | 7285013 |
| 949 | 2738832404 | 2738541298 | Bacteria | 7286732 |
| 950 | 2738873931 | 2738541306 | Bacteria | 7284992 |
| 951 | 2739185561 | 2738543002 | Bacteria | 7284546 |
| 952 | 2739220529 | 2738543008 | Bacteria | 7282815 |
| 953 | 2739278584 | 2738543019 | Bacteria | 7459457 |
| 954 | 2746092048 | 2744054900 | Bacteria | 8399525 |
| 955 | 2746093641 | 2744054901 | Bacteria | 8397047 |
| 956 | 2753357371 | 2751185800 | Bacteria | 5467370 |
| 957 | 2753359403 | 2751185800 | Bacteria | 5467370 |
| 958 | 2757572385 | 2757320392 | Bacteria | 3737298 |
| 959 | 2758641665 | 2758568016 | Bacteria | 5645291 |
| 960 | 2777762776 | 2775507177 | Bacteria | 4384303 |
| 961 | 2793078954 | |||
| 962 | 2807180513 | 2806310673 | Bacteria | 4801221 |
| 963 | 2808891892 | 2808606370 | Bacteria | 4942454 |
| 964 | 2808897002 | 2808606371 | Bacteria | 4251511 |
| 965 | 2819594832 | 2818991445 | Bacteria | 4955017 |
| 966 | 2819616678 | 2818991449 | Bacteria | 5518009 |
| 967 | 2819621039 | 2818991450 | Bacteria | 6962147 |
| 968 | 2821134442 | 2821131069 | Bacteria | 6108407 |
| 969 | 2824710736 | 2824704595 | Bacteria | 9667483 |
| 970 | 2824761312 | 2824753945 | Bacteria | 9787441 |
| 971 | 2824765916 | 2824763712 | Bacteria | 9792355 |
| 972 | 2842331167 | 2842324504 | Bacteria | 9364110 |
| 973 | 2842355506 | 2842348783 | Bacteria | 9002918 |
| 974 | 2842457895 | 2842454564 | Bacteria | 8730687 |
| 975 | 2842681162 | 2842677519 | Bacteria | 5615038 |
| 976 | 2854911970 | 2854911287 | Bacteria | 5582813 |
| 977 | 2857364653 | 2857357740 | Bacteria | 9937880 |
| 978 | 2857570104 | 2857564685 | Bacteria | 6290584 |
| 979 | 2869553114 | 2869551831 | Bacteria | 5474685 |
| 980 | 2874635542 | 2874628541 | Bacteria | 8630250 |
| 981 | 2876812528 | 2876808645 | Bacteria | 8824342 |
| 982 | 2879116171 | 2879110137 | Bacteria | 8907982 |
| 983 | 2883093841 | 2883087390 | Bacteria | 9532701 |
| 984 | 2885278402 | 2885270888 | Bacteria | 9831543 |
| 985 | 2885380165 | 2885374607 | Bacteria | 8927485 |
| 986 | 2885392379 | 2885383462 | Bacteria | 9473874 |
| 987 | 2888368166 | 2888366609 | Bacteria | 5155009 |
| 988 | 2888374221 | 2888373701 | Bacteria | 5098052 |
| 989 | 2888381744 | 2888378607 | Bacteria | 9652610 |
| 990 | 2900635452 | 2900634093 | Bacteria | 10263517 |
| 991 | 2900636050 | 2900634093 | Bacteria | 10263517 |
| 992 | 2902683285 | 2902682994 | Bacteria | 8951596 |
| 993 | 2903751239 | 2903748898 | Bacteria | 9972761 |
| 994 | 2903752196 | 2903748898 | Bacteria | 9972761 |
| 995 | 2903775544 | 2903768456 | Bacteria | 9749579 |
| 996 | 2904442555 | 2904439833 | Bacteria | 5931679 |
| 997 | 2904454136 | 2904449895 | Bacteria | 6927402 |
| 998 | 2904462007 | 2904456579 | Bacteria | 6819253 |
| 999 | 2904484146 | 2904483920 | Bacteria | 7545285 |
| 1000 | 2904535237 | 2904530477 | Bacteria | 5876334 |
| 1001 | 2904542026 | 2904541872 | Bacteria | 8915136 |
| 1002 | 2904589581 | 2904584206 | Bacteria | 6028872 |
| 1003 | 2904594488 | 2904589729 | Bacteria | 6113573 |
| 1004 | 2904606254 | 2904601388 | Bacteria | 5884906 |
| 1005 | 2904624589 | 2904615490 | Bacteria | 10047340 |
| 1006 | 2904706917 | |||
| 1007 | 2904715353 | 2904711408 | Bacteria | 9771557 |
| 1008 | 2906617002 | |||
| 1009 | 2906641336 | 2906635258 | Bacteria | 8601019 |
| 1010 | 2906668530 | 2906660503 | Bacteria | 8595048 |
| 1011 | 2915653891 | 2915650412 | Bacteria | 4288180 |
| 1012 | 2919076965 | 2919073203 | Bacteria | 6531949 |
| 1013 | 2919084203 | 2919079590 | Bacteria | 5946433 |
| 1014 | 2919391401 | 2919391150 | Bacteria | 4884741 |
| 1015 | 2919465264 | 2919462493 | Bacteria | 5817112 |
| 1016 | 2919497461 | 2919493220 | Bacteria | 4598500 |
| 1017 | 2919530088 | 2919527303 | Bacteria | 7718827 |
| 1018 | 2919546078 | 2919543075 | Bacteria | 4728703 |
| 1019 | 2921654750 | 2921643360 | Bacteria | 11448031 |
| 1020 | 2923514090 | 2923510766 | Bacteria | 5926163 |
| 1021 | 2923529636 | 2923525760 | Bacteria | 4472324 |
| 1022 | 2928084515 | 2928084124 | Bacteria | 7159212 |
| 1023 | 2928109842 | 2928108538 | Bacteria | 7360024 |
| 1024 | 2928136703 | 2928135762 | Bacteria | 7259641 |
| 1025 | 2928508917 | 2928503688 | Bacteria | 7268108 |
| 1026 | 2929167316 | 2929160207 | Bacteria | 9075316 |
| 1027 | 2931392655 | 2931390751 | Bacteria | 6273349 |
| 1028 | 2932408407 | 2932406140 | Bacteria | 5134491 |
| 1029 | 2939580068 | 2939577877 | Bacteria | 5132791 |
| 1030 | 2945918338 | 2945916053 | Bacteria | 4555517 |
| 1031 | 2945935711 | 2945934425 | Bacteria | 7444609 |
| 1032 | 2945959786 | 2945956166 | Bacteria | 5110334 |
| 1033 | 2945973934 | 2945972063 | Bacteria | 6086495 |
| 1034 | 2946037831 | 2946037020 | Bacteria | 4900426 |
| 1035 | 2953999660 | 2953998280 | Bacteria | 4812144 |
| 1036 | 2990710376 | 2990703756 | Bacteria | 7715990 |
| 1037 | 3001271538 | 3001267043 | Bacteria | 4823521 |
| 1038 | 3001272485 | 3001272096 | Bacteria | 4729684 |
| 1039 | 3005480733 | 3005474847 | Bacteria | 9259049 |
| 1040 | 3006987758 | 3006984091 | Bacteria | 4207523 |
| 1041 | 3006992270 | 3006988479 | Bacteria | 4767936 |
| 1042 | 640936761 | 640753048 | Bacteria | 5495657 |
| 1043 | 642594062 | 642555112 | Bacteria | 8676562 |
| 1044 | 642620476 | 642555113 | Bacteria | 8214658 |
| 1045 | 642621065 | 642555113 | Bacteria | 8214658 |
| 1046 | 8003961804 | 8003955200 | Bacteria | 8601927 |
| 1047 | 8004023410 | 8004021418 | Bacteria | 4313954 |
| 1048 | 8004026504 | 8004025490 | Bacteria | 4327753 |
| 1049 | 8004597540 | 8004592986 | Bacteria | 5122074 |
| 1050 | 8006934693 | 8006933436 | Bacteria | 10410654 |
| 1051 | 8006974661 | 8006973647 | Bacteria | 10679141 |
| 1052 | 8006985411 | 8006984368 | Bacteria | 9651211 |
| 1053 | 8019648932 | 8019648815 | Bacteria | 10014479 |
| 1054 | 8055266537 | 8055266321 | Bacteria | 7999742 |
| 1055 | 8055305064 | 8055301274 | Bacteria | 8587385 |
| 1056 | 8056684960 | 8056681323 | Bacteria | 8472857 |
| 1057 | Ga0307409_100006258 | |||
| 1058 | LJQas_1008444 | |||
| 1059 | JGI24740J21852_10002056 | |||
| 1060 | JGI24739J22299_10003515 | |||
| 1061 | JGI24739J22299_10021682 | |||
| 1062 | JGI24735J21928_10003656 | |||
| 1063 | JGI24735J21928_10010195 | |||
| 1064 | JGI24738J21930_10010003 | |||
| 1065 | JGI25156J39149_1000178 | |||
| 1066 | JGI25156J39149_1000226 | |||
| 1067 | JGI25156J39149_1000337 | |||
| 1068 | JGI25156J39149_1007431 | |||
| 1069 | JGI25159J45721_1000145 | |||
| 1070 | JGI25151J46595_10001061 | |||
| 1071 | JGI25151J46595_10004161 | |||
| 1072 | JGI25165J46597_1001162 | |||
| 1073 | rootH2_10299511 | |||
| 1074 | rootH1_10007027 | |||
| 1075 | JGI25160J50197_1000327 | |||
| 1076 | JGI25161J50226_1000245 | |||
| 1077 | Ga0007409J51694_1005204 | |||
| 1078 | Ga0007416J51690_1004145 | |||
| 1079 | Ga0032354_1011833 | |||
| 1080 | Ga0055538_1000002 | |||
| 1081 | Ga0055539_1000002 | |||
| 1082 | Ga0055533_1000004 | |||
| 1083 | Ga0055533_1000124 | |||
| 1084 | Ga0055533_1000563 | |||
| 1085 | Ga0055532_1000001 | |||
| 1086 | Ga0055525_1000002 | |||
| 1087 | Ga0055527_1000014 | |||
| 1088 | Ga0055535_1000001 | |||
| 1089 | Ga0055542_1000001 | |||
| 1090 | Ga0055529_1000001 | |||
| 1091 | Ga0055529_1000100 | |||
| 1092 | Ga0055526_1013866 | |||
| 1093 | Ga0055537_1000229 | |||
| 1094 | Ga0055536_1002843 | |||
| 1095 | Ga0055534_1000081 | |||
| 1096 | Ga0055528_1000107 | |||
| 1097 | Ga0055540_1000641 | |||
| 1098 | Ga0055531_10003438 | |||
| 1099 | Ga0055541_1000002 | |||
| 1100 | Ga0055543_1000325 | |||
| 1101 | Ga0055543_1002357 | |||
| 1102 | Ga0065165_1000120 | |||
| 1103 | Ga0065165_1001062 | |||
| 1104 | Ga0065165_1002142 | |||
| 1105 | Ga0065704_10081616 | |||
| 1106 | Ga0070658_10000023 | |||
| 1107 | Ga0070658_10002509 | |||
| 1108 | Ga0068869_100003661 | |||
| 1109 | Ga0070666_10034313 | |||
| 1110 | Ga0068868_100080764 | |||
| 1111 | Ga0070660_100067618 | |||
| 1112 | Ga0070687_100008147 | |||
| 1113 | Ga0070692_10048994 | |||
| 1114 | Ga0070669_100052901 | |||
| 1115 | Ga0070671_100122145 | |||
| 1116 | Ga0070674_100031273 | |||
| 1117 | Ga0070674_100116630 | |||
| 1118 | Ga0070674_100253909 | |||
| 1119 | Ga0070673_100000226 | |||
| 1120 | Ga0070659_100202824 | |||
| 1121 | Ga0070659_100247619 | |||
| 1122 | Ga0070667_100229459 | |||
| 1123 | Ga0070713_100000597 | |||
| 1124 | Ga0070710_10160650 | |||
| 1125 | Ga0070705_100014971 | |||
| 1126 | Ga0070700_100009577 | |||
| 1127 | Ga0070694_100053561 | |||
| 1128 | Ga0070663_100034260 | |||
| 1129 | Ga0070663_100083409 | |||
| 1130 | Ga0070678_100000633 | |||
| 1131 | Ga0070678_100070874 | |||
| 1132 | Ga0070681_10014815 | |||
| 1133 | Ga0070681_10034876 | |||
| 1134 | Ga0070681_10185792 | |||
| 1135 | Ga0068867_100004040 | |||
| 1136 | Ga0068867_100012498 | |||
| 1137 | Ga0070685_10045066 | |||
| 1138 | Ga0070679_100099164 | |||
| 1139 | Ga0070684_100035112 | |||
| 1140 | Ga0070697_100037403 | |||
| 1141 | Ga0068853_100044527 | |||
| 1142 | Ga0068853_100045570 | |||
| 1143 | Ga0068853_100228122 | |||
| 1144 | Ga0070672_100002363 | |||
| 1145 | Ga0070672_100097588 | |||
| 1146 | Ga0070686_100000404 | |||
| 1147 | Ga0070695_100007120 | |||
| 1148 | Ga0070696_100004953 | |||
| 1149 | Ga0070665_100001295 | |||
| 1150 | Ga0070665_100066937 | |||
| 1151 | Ga0070665_100137102 | |||
| 1152 | Ga0070665_100213471 | |||
| 1153 | Ga0070665_100260884 | |||
| 1154 | Ga0070665_100320649 | |||
| 1155 | Ga0068855_100014208 | |||
| 1156 | Ga0068855_100026819 | |||
| 1157 | Ga0068855_100074389 | |||
| 1158 | Ga0068855_100365544 | |||
| 1159 | Ga0068854_100006860 | |||
| 1160 | Ga0068854_100007052 | |||
| 1161 | Ga0068854_100048170 | |||
| 1162 | Ga0068854_100137278 | |||
| 1163 | Ga0068854_100244785 | |||
| 1164 | Ga0070702_100014379 | |||
| 1165 | Ga0068852_100046505 | |||
| 1166 | Ga0068859_100069877 | |||
| 1167 | Ga0068864_100022903 | |||
| 1168 | Ga0068866_10000265 | |||
| 1169 | Ga0068861_100000207 | |||
| 1170 | Ga0068851_10000255 | |||
| 1171 | Ga0068870_10025274 | |||
| 1172 | Ga0068858_100003094 | |||
| 1173 | Ga0068860_100024757 | |||
| 1174 | Ga0068862_100002710 | |||
| 1175 | Ga0081455_10018727 | |||
| 1176 | Ga0081540_1014084 | |||
| 1177 | Ga0081540_1014939 | |||
| 1178 | Ga0075365_10021610 | |||
| 1179 | Ga0075365_10176295 | |||
| 1180 | Ga0075363_100095788 | |||
| 1181 | Ga0075364_10000085 | |||
| 1182 | Ga0075364_10000342 | |||
| 1183 | Ga0075364_10031014 | |||
| 1184 | Ga0075364_10112207 | |||
| 1185 | Ga0075362_10002319 | |||
| 1186 | Ga0075362_10058467 | |||
| 1187 | Ga0075367_10005597 | |||
| 1188 | Ga0075367_10007757 | |||
| 1189 | Ga0075369_10006660 | |||
| 1190 | Ga0075369_10057272 | |||
| 1191 | Ga0075369_10094925 | |||
| 1192 | Ga0075369_10112983 | |||
| 1193 | Ga0075366_10000152 | |||
| 1194 | Ga0075366_10007229 | |||
| 1195 | Ga0075366_10011587 | |||
| 1196 | Ga0075366_10012147 | |||
| 1197 | Ga0075366_10020135 | |||
| 1198 | Ga0075366_10127546 | |||
| 1199 | Ga0075366_10128855 | |||
| 1200 | Ga0075366_10143559 | |||
| 1201 | Ga0097621_100010305 | |||
| 1202 | Ga0075370_10011056 | |||
| 1203 | Ga0075428_100012004 | |||
| 1204 | Ga0075430_100031742 | |||
| 1205 | Ga0068865_100019287 | |||
| 1206 | Ga0097620_100069877 | |||
| 1207 | Ga0099822_1024140 | |||
| 1208 | Ga0079104_1001448 | |||
| 1209 | Ga0079104_1001983 | |||
| 1210 | Ga0079104_1003315 | |||
| 1211 | Ga0079104_1008755 | |||
| 1212 | Ga0099826_10000087 | |||
| 1213 | Ga0099795_10000287 | |||
| 1214 | Ga0099795_10023436 | |||
| 1215 | Ga0105251_10000405 | |||
| 1216 | Ga0105251_10000869 | |||
| 1217 | Ga0105251_10001189 | |||
| 1218 | Ga0105251_10001416 | |||
| 1219 | Ga0105251_10006773 | |||
| 1220 | Ga0105251_10008305 | |||
| 1221 | Ga0105251_10042879 | |||
| 1222 | Ga0105251_10077891 | |||
| 1223 | Ga0105244_10000864 | |||
| 1224 | Ga0105244_10003298 | |||
| 1225 | Ga0105244_10030368 | |||
| 1226 | Ga0105250_10009703 | |||
| 1227 | Ga0105250_10075631 | |||
| 1228 | Ga0105240_10037364 | |||
| 1229 | Ga0105240_10043539 | |||
| 1230 | Ga0105240_10052645 | |||
| 1231 | Ga0105240_10112554 | |||
| 1232 | Ga0105240_10234108 | |||
| 1233 | Ga0105245_10000257 | |||
| 1234 | Ga0105245_10233232 | |||
| 1235 | Ga0105247_10000018 | |||
| 1236 | Ga0105247_10025401 | |||
| 1237 | Ga0105247_10141698 | |||
| 1238 | Ga0114129_10134216 | |||
| 1239 | Ga0105243_10002572 | |||
| 1240 | Ga0105243_10549837 | |||
| 1241 | Ga0105241_10000004 | |||
| 1242 | Ga0105241_10038817 | |||
| 1243 | Ga0105242_10000371 | |||
| 1244 | Ga0105242_10015952 | |||
| 1245 | Ga0105242_10293720 | |||
| 1246 | Ga0105248_10038127 | |||
| 1247 | Ga0105248_10067149 | |||
| 1248 | Ga0105248_10288123 | |||
| 1249 | Ga0105248_10587945 | |||
| 1250 | Ga0105237_10019838 | |||
| 1251 | Ga0105237_10059278 | |||
| 1252 | Ga0105238_10000038 | |||
| 1253 | Ga0105238_10088633 | |||
| 1254 | Ga0105238_10236725 | |||
| 1255 | Ga0105249_10000243 | |||
| 1256 | Ga0105249_10066635 | |||
| 1257 | Ga0105249_10117450 | |||
| 1258 | Ga0105249_10127223 | |||
| 1259 | Ga0105249_10508503 | |||
| 1260 | Ga0099796_10007059 | |||
| 1261 | Ga0105239_10000303 | |||
| 1262 | Ga0105239_10015338 | |||
| 1263 | Ga0157347_1003449 | |||
| 1264 | Ga0157373_10000633 | |||
| 1265 | Ga0157373_10000981 | |||
| 1266 | Ga0157373_10001613 | |||
| 1267 | Ga0157373_10009523 | |||
| 1268 | Ga0157371_10005108 | |||
| 1269 | Ga0157371_10013078 | |||
| 1270 | Ga0157370_10000485 | |||
| 1271 | Ga0157370_10000756 | |||
| 1272 | Ga0157370_10012877 | |||
| 1273 | Ga0157370_10013422 | |||
| 1274 | Ga0157369_10000138 | |||
| 1275 | Ga0157369_10000510 | |||
| 1276 | Ga0157369_10014085 | |||
| 1277 | Ga0157369_10024923 | |||
| 1278 | Ga0157369_10034798 | |||
| 1279 | Ga0157369_10035030 | |||
| 1280 | Ga0157369_10103667 | |||
| 1281 | Ga0157369_10118636 | |||
| 1282 | Ga0157374_10000056 | |||
| 1283 | Ga0157374_10064879 | |||
| 1284 | Ga0157374_10159705 | |||
| 1285 | Ga0157374_10268028 | |||
| 1286 | Ga0157378_10000651 | |||
| 1287 | Ga0157378_10005243 | |||
| 1288 | Ga0163162_10031705 | |||
| 1289 | Ga0163162_10144520 | |||
| 1290 | Ga0163162_10194891 | |||
| 1291 | Ga0163162_10355455 | |||
| 1292 | Ga0163162_10433579 | |||
| 1293 | Ga0163162_10518994 | |||
| 1294 | Ga0163162_10542389 | |||
| 1295 | Ga0157372_10018305 | |||
| 1296 | Ga0157372_10271228 | |||
| 1297 | Ga0157372_10435499 | |||
| 1298 | Ga0157375_10165333 | |||
| 1299 | Ga0157375_10221768 | |||
| 1300 | Ga0157375_10456583 | |||
| 1301 | Ga0157375_10473760 | |||
| 1302 | Ga0163163_10014066 | |||
| 1303 | Ga0157380_10004646 | |||
| 1304 | Ga0157380_10124899 | |||
| 1305 | Ga0182008_10000556 | |||
| 1306 | Ga0182008_10004707 | |||
| 1307 | Ga0182008_10028269 | |||
| 1308 | Ga0157379_10011772 | |||
| 1309 | Ga0157376_10000001 | |||
| 1310 | Ga0182006_1000118 | |||
| 1311 | Ga0182006_1000152 | |||
| 1312 | Ga0182006_1002843 | |||
| 1313 | Ga0182006_1008317 | |||
| 1314 | Ga0182006_1058423 | |||
| 1315 | Ga0182007_10002938 | |||
| 1316 | Ga0182005_1000005 | |||
| 1317 | Ga0183361_10018 | |||
| 1318 | Ga0163161_10000004 | |||
| 1319 | Ga0163161_10000738 | |||
| 1320 | Ga0163161_10037604 | |||
| 1321 | Ga0224712_10000040 | |||
| 1322 | Ga0224712_10058763 | |||
| 1323 | Ga0209436_100135 | |||
| 1324 | Ga0209784_100002 | |||
| 1325 | Ga0209566_100003 | |||
| 1326 | Ga0209674_100004 | |||
| 1327 | Ga0209674_100005 | |||
| 1328 | Ga0209674_100150 | |||
| 1329 | Ga0209672_100001 | |||
| 1330 | Ga0209147_100001 | |||
| 1331 | Ga0209563_100006 | |||
| 1332 | Ga0209563_100794 | |||
| 1333 | Ga0207427_100394 | |||
| 1334 | Ga0209258_100001 | |||
| 1335 | Ga0209677_100003 | |||
| 1336 | Ga0209148_1000003 | |||
| 1337 | Ga0209148_1000620 | |||
| 1338 | Ga0209759_1000228 | |||
| 1339 | Ga0209759_1000275 | |||
| 1340 | Ga0209759_1000543 | |||
| 1341 | Ga0209759_1001138 | |||
| 1342 | Ga0209129_1001909 | |||
| 1343 | Ga0209233_1000016 | |||
| 1344 | Ga0209565_1000150 | |||
| 1345 | Ga0209455_1000001 | |||
| 1346 | Ga0209455_1000047 | |||
| 1347 | Ga0209673_1000114 | |||
| 1348 | Ga0209130_1000057 | |||
| 1349 | Ga0209130_1000574 | |||
| 1350 | Ga0209675_1000062 | |||
| 1351 | Ga0209676_1000164 | |||
| 1352 | Ga0209676_1000244 | |||
| 1353 | Ga0209676_1021981 | |||
| 1354 | Ga0209025_1000049 | |||
| 1355 | Ga0209025_1000191 | |||
| 1356 | Ga0209025_1000709 | |||
| 1357 | Ga0209564_1002709 | |||
| 1358 | Ga0209564_1004984 | |||
| 1359 | Ga0209050_1000904 | |||
| 1360 | Ga0207426_1000657 | |||
| 1361 | Ga0207426_1002801 | |||
| 1362 | Ga0207426_1006276 | |||
| 1363 | Ga0209051_1000208 | |||
| 1364 | Ga0209257_1004516 | |||
| 1365 | Ga0209257_1010985 | |||
| 1366 | Ga0207656_10001797 | |||
| 1367 | Ga0207696_1000001 | |||
| 1368 | Ga0207655_1001151 | |||
| 1369 | Ga0207655_1003515 | |||
| 1370 | Ga0207713_1000093 | |||
| 1371 | Ga0207713_1000205 | |||
| 1372 | Ga0207713_1000699 | |||
| 1373 | Ga0207713_1001376 | |||
| 1374 | Ga0207713_1001567 | |||
| 1375 | Ga0207642_10022646 | |||
| 1376 | Ga0207710_10000016 | |||
| 1377 | Ga0207647_10000410 | |||
| 1378 | Ga0207647_10000430 | |||
| 1379 | Ga0207647_10011603 | |||
| 1380 | Ga0207647_10013337 | |||
| 1381 | Ga0207647_10013559 | |||
| 1382 | Ga0207645_10008061 | |||
| 1383 | Ga0207645_10019099 | |||
| 1384 | Ga0207705_10000129 | |||
| 1385 | Ga0207705_10005484 | |||
| 1386 | Ga0207654_10000006 | |||
| 1387 | Ga0207707_10046163 | |||
| 1388 | Ga0207707_10102181 | |||
| 1389 | Ga0207695_10012277 | |||
| 1390 | Ga0207695_10012751 | |||
| 1391 | Ga0207695_10063221 | |||
| 1392 | Ga0207671_10171065 | |||
| 1393 | Ga0207671_10187055 | |||
| 1394 | Ga0207693_10265151 | |||
| 1395 | Ga0207663_10206381 | |||
| 1396 | Ga0207660_10178590 | |||
| 1397 | Ga0207657_10013828 | |||
| 1398 | Ga0207652_10021290 | |||
| 1399 | Ga0207694_10000126 | |||
| 1400 | Ga0207694_10013637 | |||
| 1401 | Ga0207694_10279127 | |||
| 1402 | Ga0207687_10023025 | |||
| 1403 | Ga0207700_10004741 | |||
| 1404 | Ga0207690_10179013 | |||
| 1405 | Ga0207686_10003545 | |||
| 1406 | Ga0207686_10047434 | |||
| 1407 | Ga0207709_10003067 | |||
| 1408 | Ga0207669_10024658 | |||
| 1409 | Ga0207669_10045061 | |||
| 1410 | Ga0207669_10176018 | |||
| 1411 | Ga0207704_10005412 | |||
| 1412 | Ga0207691_10135597 | |||
| 1413 | Ga0207711_10026051 | |||
| 1414 | Ga0207711_10309015 | |||
| 1415 | Ga0207711_10444961 | |||
| 1416 | Ga0207689_10000465 | |||
| 1417 | Ga0207689_10129531 | |||
| 1418 | Ga0207667_10000427 | |||
| 1419 | Ga0207667_10028128 | |||
| 1420 | Ga0207667_10148183 | |||
| 1421 | Ga0207667_10319366 | |||
| 1422 | Ga0207651_10000125 | |||
| 1423 | Ga0207712_10000433 | |||
| 1424 | Ga0207712_10069123 | |||
| 1425 | Ga0207668_10099867 | |||
| 1426 | Ga0207640_10077107 | |||
| 1427 | Ga0207640_10236046 | |||
| 1428 | Ga0207658_10139733 | |||
| 1429 | Ga0207677_10023862 | |||
| 1430 | Ga0207703_10015850 | |||
| 1431 | Ga0207678_10106794 | |||
| 1432 | Ga0207678_10126657 | |||
| 1433 | Ga0207708_10000376 | |||
| 1434 | Ga0207702_10278497 | |||
| 1435 | Ga0207641_10129547 | |||
| 1436 | Ga0207648_10000092 | |||
| 1437 | Ga0207676_10041160 | |||
| 1438 | Ga0207674_10244418 | |||
| 1439 | Ga0207675_100000181 | |||
| 1440 | Ga0207675_100222708 | |||
| 1441 | Ga0207683_10001307 | |||
| 1442 | Ga0207683_10098198 | |||
| 1443 | Ga0209281_1001285 | |||
| 1444 | Ga0209281_1005294 | |||
| 1445 | Ga0209589_1000014 | |||
| 1446 | Ga0209489_100014 | |||
| 1447 | Ga0209700_100024 | |||
| 1448 | Ga0209282_1002130 | |||
| 1449 | Ga0268266_10000916 | |||
| 1450 | Ga0268266_10023525 | |||
| 1451 | Ga0268266_10218115 | |||
| 1452 | Ga0268266_10284684 | |||
| 1453 | Ga0268265_10006000 | |||
| 1454 | Ga0268264_10021329 | |||
| 1455 | Ga0265338_10049870 | |||
| 1456 | Ga0307511_10000109 | |||
| 1457 | Ga0316180_1141634 | |||
| 1458 | Ga0316181_1264586 | |||
| 1459 | Ga0265328_10000002 | |||
| 1460 | Ga0265328_10007645 | |||
| 1461 | Ga0265320_10100830 | |||
| 1462 | Ga0265331_10053560 | |||
| 1463 | Ga0265327_10005493 | |||
| 1464 | Ga0265316_10000511 | |||
| 1465 | Ga0307408_100001595 | |||
| 1466 | Ga0307408_100009230 | |||
| 1467 | Ga0307408_100030979 | |||
| 1468 | Ga0307408_100087687 | |||
| 1469 | Ga0316576_10004707 | |||
| 1470 | Ga0316578_10027905 | |||
| 1471 | Ga0307405_10026202 | |||
| 1472 | Ga0307405_10109589 | |||
| 1473 | Ga0316577_10202466 | |||
| 1474 | Ga0307413_10253810 | |||
| 1475 | Ga0307410_10010788 | |||
| 1476 | Ga0307407_10048464 | |||
| 1477 | Ga0307412_10000005 | |||
| 1478 | Ga0307412_10000069 | |||
| 1479 | Ga0307412_10009054 | |||
| 1480 | Ga0307412_10020542 | |||
| 1481 | Ga0307409_100364197 | |||
| 1482 | Ga0307416_100006168 | |||
| 1483 | Ga0307416_100008505 | |||
| 1484 | Ga0307416_100090969 | |||
| 1485 | Ga0307414_10100900 | |||
| 1486 | Ga0307510_10000948 | |||
| 1487 | Ga0315911_1000018 | |||
| 1488 | Ga0316574_0013130 | |||
| 1489 | Ga0316582_0276906 | |||
| 1490 | Ga0316584_0002399 | |||
| 1491 | Ga0316584_0014538 | |||
| 1492 | Ga0395899_0040683 | |||
| 1493 | Ga0395900_0052659 | |||
| 1494 | Ga0395900_0216701 | |||
| 1495 | Ga0395900_0233979 | |||
| 1496 | Ga0395898_0012898 | |||
| 1497 | Ga0395898_0073469 | |||
| 1498 | Ga0395898_0131666 | |||
| 1499 | Ga0395905_0000236 | |||
| 1500 | Ga0395905_0007181 | |||
| 1501 | Ga0395905_0007879 | |||
| 1502 | Ga0395905_0008311 | |||
| 1503 | Ga0395905_0015581 | |||
| 1504 | Ga0395905_0031654 | |||
| 1505 | Ga0395905_0036002 | |||
| 1506 | Ga0395905_0165040 | |||
| 1507 | Ga0395905_0275078 | |||
| 1508 | Ga0395905_0279247 | |||
| 1509 | Ga0395901_0000154 | |||
| 1510 | Ga0395901_0004377 | |||
| 1511 | Ga0395901_0031280 | |||
| 1512 | Ga0395901_0447378 | |||
| 1513 | Ga0439439_0010800 | |||
| 1514 | Ga0439466_0008698 | |||
| 1515 | Ga0451807_1151223 | |||
| 1516 | Ga0439449_0011594 | |||
| 1517 | Ga0439462_0005035 | |||
| 1518 | Ga0439463_004189 | |||
| 1519 | Ga0439446_0032084 | |||
| 1520 | Ga0450909_005168 | |||
| 1521 | Ga0451577_0008941 | |||
| 1522 | Ga0466969_0003919 | |||
| 1523 | Ga0466972_0055584 | |||
| 1524 | Ga0466973_0023612 | |||
| 1525 | Ga0466966_0000008 | |||
| 1526 | Ga0466966_0003154 | |||
| 1527 | Ga0466961_0007135 | |||
| 1528 | Ga0466961_0042890 | |||
| 1529 | Ga0466963_0003221 | |||
| 1530 | Ga0466963_0004171 | |||
| 1531 | Ga0466964_0005801 | |||
| 1532 | Ga0453684_0041659 | |||
| 1533 | Ga0453684_0094361 | |||
| 1534 | Ga0453684_0158893 | |||
| 1535 | Ga0466957_0032011 | |||
| 1536 | Ga0466957_0053462 | |||
| 1537 | Ga0466959_0000027 | |||
| 1538 | Ga0466967_0074519 | |||
| 1539 | Ga0495627_000038 | |||
| 1540 | Ga0495627_000231 | |||
| 1541 | Ga0495627_000396 | |||
| 1542 | Ga0495592_0008737 | |||
| 1543 | Ga0495603_0021997 | |||
| 1544 | Ga0495603_0055671 | |||
| 1545 | Ga0495603_0187281 | |||
| 1546 | Ga0495590_0000062 | |||
| 1547 | Ga0495590_0003467 | |||
| 1548 | Ga0495590_0019222 | |||
| 1549 | Ga0495591_001099 | |||
| 1550 | Ga0495629_0000054 | |||
| 1551 | Ga0495629_0000099 | |||
| 1552 | Ga0495629_0047453 | |||
| 1553 | Ga0495629_0067906 | |||
| 1554 | Ga0495638_0007214 | |||
| 1555 | Ga0495638_0007523 | |||
| 1556 | Ga0495638_0016585 | |||
| 1557 | Ga0495638_0035271 | |||
| 1558 | Ga0495638_0120959 | |||
| 1559 | Ga0495651_0036224 | |||
| 1560 | Ga0495651_0059265 | |||
| 1561 | Ga0495651_0070947 | |||
| 1562 | Ga0495653_0000099 | |||
| 1563 | Ga0495653_0013098 | |||
| 1564 | Ga0495650_0001143 | |||
| 1565 | Ga0495650_0002455 | |||
| 1566 | Ga0495650_0002504 | |||
| 1567 | Ga0495650_0018748 | |||
| 1568 | Ga0495580_0000082 | |||
| 1569 | Ga0495580_0000208 | |||
| 1570 | Ga0495580_0014112 | |||
| 1571 | Ga0495580_0015382 | |||
| 1572 | Ga0495580_0038009 | |||
| 1573 | Ga0495580_0048682 | |||
| 1574 | Ga0495580_0054404 | |||
| 1575 | Ga0495582_0008194 | |||
| 1576 | Ga0495582_0010405 | |||
| 1577 | Ga0495582_0015819 | |||
| 1578 | Ga0495582_0019610 | |||
| 1579 | Ga0495582_0052010 | |||
| 1580 | Ga0495605_0000250 | |||
| 1581 | Ga0495605_0002569 | |||
| 1582 | Ga0495605_0004126 | |||
| 1583 | Ga0495605_0009441 | |||
| 1584 | Ga0495664_0012257 | |||
| 1585 | Ga0495584_0000055 | |||
| 1586 | Ga0495596_0001254 | |||
| 1587 | Ga0495596_0015853 | |||
| 1588 | Ga0495607_0002944 | |||
| 1589 | Ga0495583_0003132 | |||
| 1590 | Ga0495583_0006321 | |||
| 1591 | Ga0495606_0000240 | |||
| 1592 | Ga0495606_0009476 | |||
| 1593 | Ga0495606_0015029 | |||
| 1594 | Ga0495606_0020115 | |||
| 1595 | Ga0495606_0040054 | |||
| 1596 | Ga0495606_0152876 | |||
| 1597 | Ga0495610_0001010 | |||
| 1598 | Ga0495610_0005858 | |||
| 1599 | Ga0495616_0000211 | |||
| 1600 | Ga0495618_0030599 | |||
| 1601 | Ga0495620_0000720 | |||
| 1602 | Ga0495620_0011883 | |||
| 1603 | Ga0495620_0016675 | |||
| 1604 | Ga0495628_0004119 | |||
| 1605 | Ga0495628_0017922 | |||
| 1606 | Ga0495628_0065029 | |||
| 1607 | Ga0495628_0065782 | |||
| 1608 | Ga0495628_0173768 | |||
| 1609 | Ga0495630_0003148 | |||
| 1610 | Ga0495630_0006005 | |||
| 1611 | Ga0495631_0000054 | |||
| 1612 | Ga0495631_0000932 | |||
| 1613 | Ga0495637_0012154 | |||
| 1614 | Ga0495643_0045249 | |||
| 1615 | Ga0495644_0045471 | |||
| 1616 | Ga0495648_0000971 | |||
| 1617 | Ga0495648_0003217 | |||
| 1618 | Ga0495648_0004756 | |||
| 1619 | Ga0495648_0052631 | |||
| 1620 | Ga0495648_0114174 | |||
| 1621 | Ga0495648_0149648 | |||
| 1622 | Ga0495666_0054900 | |||
| 1623 | Ga0495666_0064354 | |||
| 1624 | Ga0495666_0130873 | |||
| 1625 | Ga0495642_0000006 | |||
| 1626 | Ga0495652_0024230 | |||
| 1627 | Ga0495652_0047659 | |||
| 1628 | Ga0495654_0000424 | |||
| 1629 | Ga0495654_0006828 | |||
| 1630 | Ga0495654_0010213 | |||
| 1631 | Ga0495654_0045562 | |||
| 1632 | Ga0495654_0051889 | |||
| 1633 | Ga0495665_0006780 | |||
| 1634 | Ga0495665_0010499 | |||
| 1635 | Ga0495665_0012030 | |||
| 1636 | Ga0495665_0022519 | |||
| 1637 | Ga0495665_0048049 | |||
| 1638 | Ga0495640_0002986 | |||
| 1639 | Ga0495640_0006341 | |||
| 1640 | Ga0495640_0071184 | |||
| 1641 | Ga0495586_0030103 | |||
| 1642 | Ga0495586_0123042 | |||
| 1643 | Ga0495586_0195080 | |||
| 1644 | Ga0495587_0041837 | |||
| 1645 | Ga0495609_0000069 | |||
| 1646 | Ga0495609_0000357 | |||
| 1647 | Ga0495621_0001102 | |||
| 1648 | Ga0495621_0030015 | |||
| 1649 | Ga0495597_0007210 | |||
| 1650 | Ga0495645_0018667 | |||
| 1651 | Ga0495622_0000880 | |||
| 1652 | Ga0495633_0008364 | |||
| 1653 | Ga0495667_0004661 | |||
| 1654 | Ga0495668_0000064 | |||
| 1655 | Ga0495668_0000319 | |||
| 1656 | Ga0495668_0003544 | |||
| 1657 | Ga0495668_0025365 | |||
| 1658 | Ga0495634_0142422 | |||
| 1659 | Ga0495611_0017239 | |||
| 1660 | Ga0495611_0046716 | |||
| 1661 | Ga0495611_0117353 | |||
| 1662 | Ga0495625_0020529 | |||
| 1663 | Ga0495625_0049416 | |||
| 1664 | Ga0495625_0172162 | |||
| 1665 | Ga0495635_0029567 | |||
| 1666 | Ga0495661_0017617 | |||
| 1667 | Ga0495661_0020918 | |||
| 1668 | Ga0495661_0155273 | |||
| 1669 | Ga0495657_0021542 | |||
| 1670 | Ga0495657_0079614 | |||
| 1671 | Ga0495599_0019288 | |||
| 1672 | Ga0495623_0002988 | |||
| 1673 | Ga0495623_0034113 | |||
| 1674 | Ga0495623_0104159 | |||
| 1675 | Ga0495646_0001798 | |||
| 1676 | Ga0495646_0003633 | |||
| 1677 | Ga0495646_0048346 | |||
| 1678 | Ga0495669_0004952 | |||
| 1679 | Ga0495669_0008446 | |||
| 1680 | Ga0495613_0007126 | |||
| 1681 | Ga0495613_0109898 | |||
| 1682 | Ga0495624_0002851 | |||
| 1683 | Ga0495624_0014790 | |||
| 1684 | Ga0495624_0016562 | |||
| 1685 | Ga0495624_0018031 | |||
| 1686 | Ga0495624_0046239 | |||
| 1687 | Ga0495624_0051742 | |||
| 1688 | Ga0495670_0000603 | |||
| 1689 | Ga0495670_0002733 | |||
| 1690 | Ga0495671_0001569 | |||
| 1691 | Ga0495671_0020281 | |||
| 1692 | Ga0495671_0023174 | |||
| 1693 | Ga0495671_0045650 | |||
| 1694 | Ga0495671_0047884 | |||
| 1695 | Ga0495649_0000844 | |||
| 1696 | Ga0495649_0005939 | |||
| 1697 | Ga0495649_0055517 | |||
| 1698 | Ga0495649_0066462 | |||
| 1699 | Ga0495589_0000002 | |||
| 1700 | Ga0495589_0000928 | |||
| 1701 | Ga0495589_0025596 | |||
| 1702 | Ga0495600_0004096 | |||
| 1703 | Ga0495660_0000080 | |||
| 1704 | Ga0495660_0000177 | |||
| 1705 | Ga0495581_0014339 | |||
| 1706 | Ga0495604_0018563 | |||
| 1707 | Ga0495604_0020358 | |||
| 1708 | Ga0495604_0025620 | |||
| 1709 | Ga0495604_0080016 | |||
| 1710 | Ga0495674_0004220 | |||
| 1711 | Ga0495674_0007713 | |||
| 1712 | Ga0495674_0012326 | |||
| 1713 | Ga0495674_0057474 | |||
| 1714 | Ga0495674_0118705 | |||
| 1715 | Ga0495674_0149829 | |||
| 1716 | Ga0495674_0341658 | |||
| 1717 | Ga0495672_0000010 | |||
| 1718 | Ga0495672_0000158 | |||
| 1719 | Ga0495672_0004354 | |||
| 1720 | Ga0495672_0014192 | |||
| 1721 | Ga0495672_0121310 | |||
| 1722 | Ga0495676_0022045 | |||
| 1723 | Ga0495680_0023583 | |||
| 1724 | Ga0495680_0031745 | |||
| 1725 | Ga0495680_0069170 | |||
| 1726 | Ga0495680_0076445 | |||
| 1727 | Ga0495683_0002027 | |||
| 1728 | Ga0495683_0004646 | |||
| 1729 | Ga0495683_0015176 | |||
| 1730 | Ga0495683_0026041 | |||
| 1731 | Ga0495687_000104 | |||
| 1732 | Ga0495687_013575 | |||
| 1733 | Ga0495687_014501 | |||
| 1734 | Ga0495687_026210 | |||
| 1735 | Ga0495687_030850 | |||
| 1736 | Ga0495687_037021 | |||
| 1737 | Ga0495687_042575 | |||
| 1738 | Ga0495675_0001679 | |||
| 1739 | Ga0495675_0054579 | |||
| 1740 | Ga0495675_0072682 | |||
| 1741 | Ga0495679_000062 | |||
| 1742 | Ga0495679_000063 | |||
| 1743 | Ga0495679_001490 | |||
| 1744 | Ga0495679_002444 | |||
| 1745 | Ga0495679_013378 | |||
| 1746 | Ga0495673_0001271 | |||
| 1747 | Ga0495673_0019368 | |||
| 1748 | Ga0495673_0049331 | |||
| 1749 | Ga0495673_0050304 | |||
| 1750 | Ga0495673_0061242 | |||
| 1751 | Ga0495684_0138695 | |||
| 1752 | Ga0495686_0002575 | |||
| 1753 | Ga0495686_0028742 | |||
| 1754 | Ga0495686_0041236 | |||
| 1755 | Ga0495686_0043715 | |||
| 1756 | Ga0495593_0011480 | |||
| 1757 | Ga0495593_0019601 | |||
| 1758 | Ga0495593_0044331 | |||
| 1759 | Ga0495602_0000856 | |||
| 1760 | Ga0495602_0028550 | |||
| 1761 | Ga0495602_0081496 | |||
| 1762 | Ga0495614_0118602 | |||
| 1763 | Ga0496100_0063024 | |||
| 1764 | Ga0496100_0064098 | |||
| 1765 | Ga0496101_0001501 | |||
| 1766 | Ga0496101_0009824 | |||
| 1767 | Ga0496101_0076060 | |||
| 1768 | Ga0496101_0261609 | |||
| 1769 | Ga0496102_0004504 | |||
| 1770 | Ga0496102_0004959 | |||
| 1771 | Ga0496102_0005431 | |||
| 1772 | Ga0496102_0016284 | |||
| 1773 | Ga0496102_0042541 | |||
| 1774 | Ga0496102_0085628 | |||
| 1775 | Ga0496102_0151506 | |||
| 1776 | Ga0496102_0179263 | |||
| 1777 | Ga0496102_0192183 | |||
| 1778 | Ga0496102_0193752 | |||
| 1779 | Ga0496102_0311666 | |||
| 1780 | Ga0496102_0479345 | |||
| 1781 | Ga0496103_0001546 | |||
| 1782 | Ga0496103_0002245 | |||
| 1783 | Ga0496103_0004401 | |||
| 1784 | Ga0496103_0011170 | |||
| 1785 | Ga0496103_0098874 | |||
| 1786 | Ga0496104_0099819 | |||
| 1787 | Ga0496105_0018285 | |||
| 1788 | Ga0496106_0002122 | |||
| 1789 | Ga0496107_0025617 | |||
| 1790 | Ga0496107_0037012 | |||
| 1791 | Ga0496108_0334082 | |||
| 1792 | Ga0496109_0162694 | |||
| 1793 | Ga0496110_0005967 | |||
| 1794 | Ga0496110_0383698 | |||
| 1795 | Ga0496111_0031413 | |||
| 1796 | Ga0496112_0113275 | |||
| 1797 | Ga0496114_0065402 | |||
| 1798 | Ga0496116_0000031 | |||
| 1799 | Ga0496117_0001221 | |||
| 1800 | Ga0496117_0003334 | |||
| 1801 | Ga0496117_0012014 | |||
| 1802 | Ga0496117_0024611 | |||
| 1803 | Ga0496117_0117992 | |||
| 1804 | Ga0496117_0170475 | |||
| 1805 | Ga0496118_0001708 | |||
| 1806 | Ga0496118_0004252 | |||
| 1807 | Ga0496118_0016225 | |||
| 1808 | Ga0496118_0044336 | |||
| 1809 | Ga0496118_0072369 | |||
| 1810 | Ga0496119_0000468 | |||
| 1811 | Ga0496119_0033243 | |||
| 1812 | Ga0496120_0000137 | |||
| 1813 | Ga0496121_0000437 | |||
| 1814 | Ga0496121_0000573 | |||
| 1815 | Ga0496121_0006494 | |||
| 1816 | Ga0496121_0009566 | |||
| 1817 | Ga0496121_0014837 | |||
| 1818 | Ga0496121_0051729 | |||
| 1819 | Ga0496121_0161963 | |||
| 1820 | Ga0496122_0001630 | |||
| 1821 | Ga0496122_0002855 | |||
| 1822 | Ga0496122_0041369 | |||
| 1823 | Ga0496122_0072071 | |||
| 1824 | Ga0496123_0001111 | |||
| 1825 | Ga0496123_0003528 | |||
| 1826 | Ga0496123_0015546 | |||
| 1827 | Ga0496123_0048914 | |||
| 1828 | Ga0496124_0000017 | |||
| 1829 | Ga0496124_0000138 | |||
| 1830 | Ga0496124_0002733 | |||
| 1831 | Ga0496124_0205923 | |||
| 1832 | Ga0496125_0001586 | |||
| 1833 | Ga0496125_0007850 | |||
| 1834 | Ga0496125_0022722 | |||
| 1835 | Ga0496125_0046935 | |||
| 1836 | Ga0496125_0076609 | |||
| 1837 | Ga0496125_0118496 | |||
| 1838 | Ga0496126_0000034 | |||
| 1839 | Ga0496126_0000446 | |||
| 1840 | Ga0496126_0000882 | |||
| 1841 | Ga0496126_0006636 | |||
| 1842 | Ga0496126_0019981 | |||
| 1843 | Ga0496126_0034277 | |||
| 1844 | Ga0496126_0073429 | |||
| 1845 | Ga0496126_0092103 | |||
| 1846 | Ga0496126_0126700 | |||
| 1847 | Ga0496126_0162752 | |||
| 1848 | Ga0496126_0186025 | |||
| 1849 | Ga0495678_009436 | |||
| 1850 | Ga0495678_012518 | |||
| 1851 | Ga0495682_0025422 | |||
| 1852 | Ga0501033_0056048 | |||
| 1853 | Ga0501033_0173407 | |||
| 1854 | Ga0501034_0000042 | |||
| 1855 | Ga0501036_0165230 | |||
| 1856 | Ga0501038_0241156 | |||
| 1857 | Ga0501041_0047297 | |||
| 1858 | Ga0501042_0041141 | |||
| 1859 | Ga0501043_0117598 | |||
| 1860 | Ga0501046_0082618 | |||
| 1861 | Ga0501047_0024493 | |||
| 1862 | Ga0501047_0030160 | |||
| 1863 | Ga0501048_0215348 | |||
| 1864 | Ga0501071_0080338 | |||
| 1865 | Ga0501072_0029409 | |||
| 1866 | Ga0501075_0021514 | |||
| 1867 | Ga0501075_0084934 | |||
| 1868 | Ga0501077_0140931 | |||
| 1869 | Ga0501227_001375 | |||
| 1870 | Ga0501080_0029512 | |||
| 1871 | Ga0501081_0070143 | |||
| 1872 | Ga0501279_000660 | |||
| 1873 | Ga0501035_0026358 | |||
| 1874 | Ga0501035_0229014 | |||
| 1875 | Ga0501044_0000059 | |||
| 1876 | Ga0501044_0001443 | |||
| 1877 | Ga0501045_0049438 | |||
| 1878 | nmdc:mga03683_490_c1 | |||
| 1879 | nmdc:mga03n38_23536_c1 | |||
| 1880 | nmdc:mga03n38_32004_c1 | |||
| 1881 | nmdc:mga03n38_99544_c1 | |||
| 1882 | nmdc:mga00v17_157_c1 | |||
| 1883 | nmdc:mga00v17_253000_c1 | |||
| 1884 | nmdc:mga00v17_25948_c1 | |||
| 1885 | nmdc:mga00v17_3382_c1 | |||
| 1886 | nmdc:mga00v17_41288_c1 | |||
| 1887 | nmdc:mga0yw44_152651_c1 | |||
| 1888 | nmdc:mga0yw44_16617_c1 | |||
| 1889 | nmdc:mga0yw44_246638_c1 | |||
| 1890 | nmdc:mga0yw44_36855_c1 | |||
| 1891 | nmdc:mga0k408_103016_c1 | |||
| 1892 | nmdc:mga0k408_134985_c1 | |||
| 1893 | nmdc:mga0k408_15670_c1 | |||
| 1894 | nmdc:mga0k408_264_c1 | |||
| 1895 | nmdc:mga06z11_43335_c1 | |||
| 1896 | nmdc:mga07m45_101710_c1 | |||
| 1897 | nmdc:mga07m45_18103_c1 | |||
| 1898 | nmdc:mga07m45_33873_c1 | |||
| 1899 | nmdc:mga0qj67_26252_c1 | |||
| 1900 | Ga0495619_0027397 | |||
| 1901 | Ga0500643_005454 | |||
| 1902 | Ga0500581_047926 | |||
| 1903 | Ga0500647_0001969 | |||
| 1904 | Ga0500583_0080956 | |||
| 1905 | Ga0500651_0000011 | |||
| 1906 | Ga0500566_0002124 | |||
| 1907 | Ga0500556_0000058 | |||
| 1908 | Ga0500557_000056 | |||
| 1909 | Ga0500562_008953 | |||
| 1910 | Ga0500569_017661 | |||
| 1911 | Ga0500571_000008 | |||
| 1912 | Ga0500595_006780 | |||
| 1913 | Ga0500595_022855 | |||
| 1914 | Ga0500614_013147 | |||
| 1915 | Ga0500642_0000025 | |||
| 1916 | Ga0500642_0000295 | |||
| 1917 | Ga0500652_000007 | |||
| 1918 | Ga0500652_001122 | |||
| 1919 | Ga0500655_000511 | |||
| 1920 | Ga0500658_0000085 | |||
| 1921 | Ga0500658_0000181 | |||
| 1922 | Ga0500658_0017903 | |||
| 1923 | Ga0500658_0028537 | |||
| 1924 | Ga0500559_0005262 | |||
| 1925 | Ga0500559_0051010 | |||
| 1926 | Ga0500568_0000547 | |||
| 1927 | Ga0500568_0001205 | |||
| 1928 | Ga0500574_005440 | |||
| 1929 | Ga0500588_0003547 | |||
| 1930 | Ga0500600_0024281 | |||
| 1931 | Ga0500604_0011096 | |||
| 1932 | Ga0500620_035558 | |||
| 1933 | Ga0500622_0000112 | |||
| 1934 | Ga0500627_0019290 | |||
| 1935 | Ga0500634_0016121 | |||
| 1936 | Ga0500634_0034310 | |||
| 1937 | Ga0500634_0041670 | |||
| 1938 | Ga0500634_0048936 | |||
| 1939 | Ga0500638_062146 | |||
| 1940 | Ga0500636_0073472 | |||
| 1941 | Ga0500611_001649 | |||
| 1942 | Ga0590075_026072 | |||
| 1943 | Ga0587090_000446 | |||
| 1944 | Ga0587072_000808 | |||
| 1945 | Ga0587124_000762 | |||
| 1946 | Ga0501082_0020019 | |||
| 1947 | Ga0501082_0361104 | |||
| 1948 | Ga0466962_0006642 | |||
| 1949 | Ga0466962_0021693 | |||
| 1950 | 2501071161 | |||
| 1951 | 2501078646 | |||
| 1952 | 2501414043 | |||
| 1953 | 2506577259 | |||
| 1954 | 2506582397 | |||
| 1955 | 2508851188 | |||
| 1956 | 2509127460 | |||
| 1957 | 2509153415 | |||
| 1958 | 2510250135 | |||
| 1959 | 2511089293 | |||
| 1960 | 2511094697 | |||
| 1961 | 2511104407 | |||
| 1962 | 2512347686 | |||
| 1963 | 2513555977 | |||
| 1964 | 2513565530 | |||
| 1965 | 2513658138 | |||
| 1966 | 2513675972 | |||
| 1967 | 2513678860 | |||
| 1968 | 2513723552 | |||
| 1969 | 2513860270 | |||
| 1970 | 2513889889 | |||
| 1971 | 2513920370 | |||
| 1972 | 2513962164 | |||
| 1973 | 2515679273 | |||
| 1974 | 2515688480 | |||
| 1975 | 2516017150 | |||
| 1976 | 2517105405 | |||
| 1977 | 2517889207 | |||
| 1978 | 2521560316 | |||
| 1979 | 2524467980 | |||
| 1980 | 2524541580 | |||
| 1981 | 2527076825 | |||
| 1982 | 2535484790 | |||
| 1983 | 2563062146 | |||
| 1984 | 2599396456 | |||
| 1985 | 2599453488 | |||
| 1986 | 2599514769 | |||
| 1987 | 2599517249 | |||
| 1988 | 2599893966 | |||
| 1989 | 2599904353 | |||
| 1990 | 2600005361 | |||
| 1991 | 2600072358 | |||
| 1992 | 2600812632 | |||
| 1993 | 2643734223 | |||
| 1994 | 2644161231 | |||
| 1995 | 2644170809 | |||
| 1996 | 2656277915 | |||
| 1997 | 2671118403 | |||
| 1998 | 2689443715 | |||
| 1999 | 2713478006 | |||
| 2000 | 2719639293 | |||
| 2001 | 2723877632 | |||
| 2002 | 2728749317 | |||
| 2003 | 2738717898 | |||
| 2004 | 2738819924 | |||
| 2005 | 2738832404 | |||
| 2006 | 2738873931 | |||
| 2007 | 2739185561 | |||
| 2008 | 2739220529 | |||
| 2009 | 2739278584 | |||
| 2010 | 2746092048 | |||
| 2011 | 2746093641 | |||
| 2012 | 2753357371 | |||
| 2013 | 2753359403 | |||
| 2014 | 2757572385 | |||
| 2015 | 2758641665 | |||
| 2016 | 2777762776 | |||
| 2017 | 2793078954 | |||
| 2018 | 2807180513 | |||
| 2019 | 2808891892 | |||
| 2020 | 2808897002 | |||
| 2021 | 2819594832 | |||
| 2022 | 2819616678 | |||
| 2023 | 2819621039 | |||
| 2024 | 2821134442 | |||
| 2025 | 2824710736 | |||
| 2026 | 2824761312 | |||
| 2027 | 2824765916 | |||
| 2028 | 2842331167 | |||
| 2029 | 2842355506 | |||
| 2030 | 2842457895 | |||
| 2031 | 2842681162 | |||
| 2032 | 2854911970 | |||
| 2033 | 2857364653 | |||
| 2034 | 2857570104 | |||
| 2035 | 2869553114 | |||
| 2036 | 2874635542 | |||
| 2037 | 2876812528 | |||
| 2038 | 2879116171 | |||
| 2039 | 2883093841 | |||
| 2040 | 2885278402 | |||
| 2041 | 2885380165 | |||
| 2042 | 2885392379 | |||
| 2043 | 2888368166 | |||
| 2044 | 2888374221 | |||
| 2045 | 2888381744 | |||
| 2046 | 2900635452 | |||
| 2047 | 2900636050 | |||
| 2048 | 2902683285 | |||
| 2049 | 2903751239 | |||
| 2050 | 2903752196 | |||
| 2051 | 2903775544 | |||
| 2052 | 2904442555 | |||
| 2053 | 2904454136 | |||
| 2054 | 2904462007 | |||
| 2055 | 2904484146 | |||
| 2056 | 2904535237 | |||
| 2057 | 2904542026 | |||
| 2058 | 2904589581 | |||
| 2059 | 2904594488 | |||
| 2060 | 2904606254 | |||
| 2061 | 2904624589 | |||
| 2062 | 2904706917 | |||
| 2063 | 2904715353 | |||
| 2064 | 2906617002 | |||
| 2065 | 2906641336 | |||
| 2066 | 2906668530 | |||
| 2067 | 2915653891 | |||
| 2068 | 2919076965 | |||
| 2069 | 2919084203 | |||
| 2070 | 2919391401 | |||
| 2071 | 2919465264 | |||
| 2072 | 2919497461 | |||
| 2073 | 2919530088 | |||
| 2074 | 2919546078 | |||
| 2075 | 2921654750 | |||
| 2076 | 2923514090 | |||
| 2077 | 2923529636 | |||
| 2078 | 2928084515 | |||
| 2079 | 2928109842 | |||
| 2080 | 2928136703 | |||
| 2081 | 2928508917 | |||
| 2082 | 2929167316 | |||
| 2083 | 2931392655 | |||
| 2084 | 2932408407 | |||
| 2085 | 2939580068 | |||
| 2086 | 2945918338 | |||
| 2087 | 2945935711 | |||
| 2088 | 2945959786 | |||
| 2089 | 2945973934 | |||
| 2090 | 2946037831 | |||
| 2091 | 2953999660 | |||
| 2092 | 2990710376 | |||
| 2093 | 3001271538 | |||
| 2094 | 3001272485 | |||
| 2095 | 3005480733 | |||
| 2096 | 3006987758 | |||
| 2097 | 3006992270 | |||
| 2098 | 640936761 | |||
| 2099 | 642594062 | |||
| 2100 | 642620476 | |||
| 2101 | 642621065 | |||
| 2102 | 8003961804 | |||
| 2103 | 8004023410 | |||
| 2104 | 8004026504 | |||
| 2105 | 8004597540 | |||
| 2106 | 8006934693 | |||
| 2107 | 8006974661 | |||
| 2108 | 8006985411 | |||
| 2109 | 8019648932 | |||
| 2110 | 8055266537 | |||
| 2111 | 8055305064 | |||
| 2112 | 8056684960 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i3n-assembly1.cif.gz_B | molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase | 0.9915 | 2 | 335 |
| 7xpq-assembly1.cif.gz_A | crystal structure of udp-glc/glcnac 4-epimerase with nad/udp-glcnac | 0.9907 | 2 | 335 |
| 3enk-assembly1.cif.gz_B | 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei | 0.9897 | 2 | 334 |
| 1kvr-assembly1.cif.gz_A-2 | udp-galactose 4-epimerase complexed with udp-phenol | 0.9887 | 1 | 335 |
| 1kvt-assembly1.cif.gz_A-2 | udp-galactose 4-epimerase complexed with udp-phenol | 0.9886 | 1 | 335 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3enkB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9761 | 1 | 261 | 3.40.50.720 |
| af_P18645_3_269_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9757 | 1 | 261 | 3.40.50.720 |
| 4lisA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9749 | 181 | 337 | 3.90.25.10 |
| 3enkB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9715 | 1 | 261 | 3.40.50.720 |
| af_A0A1D6I245_15_71_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9636 | 6 | 57 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661Y9Y6-F1-model_v4 | deleted | 0.9953 | 1 | 153 |
|
| AF-A0A7Y0BJL8-F1-model_v4 | UDP-glucose 4-epimerase (EC 5.1.3.2) | 0.9921 | 1 | 335 |
GO:0003978
GO:0005829 GO:0006012 |
| AF-A0A3L8RXC4-F1-model_v4 | UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.2) (EC 5.1.3.7) | 0.9919 | 2 | 335 |
GO:0003974
GO:0003978 GO:0005829 GO:0033499 |
| AF-A0A2J6M7Q8-F1-model_v4 | deleted | 0.9917 | 2 | 335 |
|
| AF-A0A5E4A169-F1-model_v4 | UDP-N-acetylglucosamine 4-epimerase (EC 4.1.3.4) (EC 5.1.3.2) (EC 5.1.3.7) | 0.9912 | 2 | 334 |
GO:0003974
GO:0003978 GO:0004419 GO:0005829 GO:0033499 |