F489193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1056 | 449 | 2112 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0317379|Ga0501035_0317379_117_1031 |
| Length | 304 |
| Sequence | MQNNVGGRNWPMVRGATLASNPALSDAGHSKTGKSEAASHIDAEPTLGRPLLDVCSVTLQYKTQQHIVTATYRVSFRVLQSDRFVLLGPSGCGKSTLLKAVCAYIHPTEGEIRLKGATIRKPGPDRIMVFQEFDQLLPWKTVLENVTFPLKATGKLHGKEAHDRAMHYIEKVNLSSFANSYPHTLSGGMKQRVAIARGMAMEPDILLMDEPFAALDALTRTRMQDELLSLWDETNFTVLFVTHSIPEAIKLGSRILLLSPHPGQVKAEINSVARGQENSNEAAELGREIHQMLFADQIEEKPNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 269 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 270 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 373 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 374 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 416 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 418 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 425 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 426 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 427 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 428 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 429 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 430 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 431 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 432 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 433 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 434 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 435 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 436 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 437 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 438 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 439 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 440 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 441 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 442 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 443 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 444 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 445 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 446 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 447 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 448 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 449 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.35 |
| Metatranscriptomes | 0.28 |
| Isolates | 2.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.49 |
| Nodule | 1.04 |
| Rhizoplane | 3.98 |
| Rhizosphere | 86.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501035_0317379 | 3300049822 | Bacteria | 1310 |
| 2 | JGI24741J21665_1000130 | 3300001915 | Bacteria | 20656 |
| 3 | JGI24746J21847_1019481 | 3300001977 | Bacteria | 956 |
| 4 | JGI24740J21852_10000362 | 3300001979 | Bacteria | 19455 |
| 5 | JGI24740J21852_10017815 | 3300001979 | Bacteria | 2532 |
| 6 | JGI24744J21845_10010999 | 3300002077 | Bacteria | 1853 |
| 7 | JGI24033J26618_1016338 | 3300002155 | Bacteria | 921 |
| 8 | JGI24034J26672_10020808 | 3300002239 | Bacteria | 1029 |
| 9 | JGI24742J22300_10012193 | 3300002244 | Bacteria | 1431 |
| 10 | JGI25156J39149_1008023 | 3300002705 | Bacteria | 2704 |
| 11 | JGI25154J39366_1000523 | 3300002738 | Bacteria | 19290 |
| 12 | JGI25404J52841_10009902 | 3300003659 | Bacteria | 2045 |
| 13 | Ga0055538_1004882 | 3300003751 | Bacteria | 1454 |
| 14 | Ga0055539_1000059 | 3300003752 | Bacteria | 146394 |
| 15 | Ga0055533_1000764 | 3300003756 | Bacteria | 10257 |
| 16 | Ga0055533_1008780 | 3300003756 | Bacteria | 1247 |
| 17 | Ga0055532_1000025 | 3300003758 | Bacteria | 240145 |
| 18 | Ga0055525_1000447 | 3300003759 | Bacteria | 23685 |
| 19 | Ga0055527_1005432 | 3300003760 | Bacteria | 1658 |
| 20 | Ga0055535_1000019 | 3300003761 | Bacteria | 240145 |
| 21 | Ga0055542_1000767 | 3300003762 | Bacteria | 24292 |
| 22 | Ga0055529_1000035 | 3300003763 | Bacteria | 240145 |
| 23 | Ga0065712_10014003 | 3300005290 | Bacteria | 1785 |
| 24 | Ga0065715_10217703 | 3300005293 | Bacteria | 1285 |
| 25 | Ga0070658_10035088 | 3300005327 | Bacteria | 4038 |
| 26 | Ga0070658_10409143 | 3300005327 | Bacteria | 1166 |
| 27 | Ga0070676_10020503 | 3300005328 | Bacteria | 3691 |
| 28 | Ga0070683_100005780 | 3300005329 | Bacteria | 10342 |
| 29 | Ga0070683_100011116 | 3300005329 | Bacteria | 7763 |
| 30 | Ga0070683_100039545 | 3300005329 | Bacteria | 4331 |
| 31 | Ga0070683_100039574 | 3300005329 | Bacteria | 4329 |
| 32 | Ga0070683_100059808 | 3300005329 | Bacteria | 3540 |
| 33 | Ga0070683_100097023 | 3300005329 | Bacteria | 2773 |
| 34 | Ga0070690_100043239 | 3300005330 | Bacteria | 2856 |
| 35 | Ga0070670_100049495 | 3300005331 | Bacteria | 3613 |
| 36 | Ga0070670_100770835 | 3300005331 | Bacteria | 867 |
| 37 | Ga0070677_10041601 | 3300005333 | Bacteria | 1815 |
| 38 | Ga0068869_100035037 | 3300005334 | Bacteria | 3555 |
| 39 | Ga0068869_100349140 | 3300005334 | Bacteria | 1205 |
| 40 | Ga0070666_10015360 | 3300005335 | Bacteria | 4883 |
| 41 | Ga0070666_10137360 | 3300005335 | Bacteria | 1701 |
| 42 | Ga0070666_10157018 | 3300005335 | Bacteria | 1589 |
| 43 | Ga0070666_10535555 | 3300005335 | Bacteria | 851 |
| 44 | Ga0070680_100006745 | 3300005336 | Bacteria | 8746 |
| 45 | Ga0070680_100035933 | 3300005336 | Bacteria | 4001 |
| 46 | Ga0070680_100050340 | 3300005336 | Bacteria | 3398 |
| 47 | Ga0068868_100037068 | 3300005338 | Bacteria | 3778 |
| 48 | Ga0068868_100467467 | 3300005338 | Bacteria | 1100 |
| 49 | Ga0070660_100037989 | 3300005339 | Bacteria | 3653 |
| 50 | Ga0070660_100074617 | 3300005339 | Bacteria | 2654 |
| 51 | Ga0070660_100124409 | 3300005339 | Bacteria | 2060 |
| 52 | Ga0070660_100137792 | 3300005339 | Bacteria | 1956 |
| 53 | Ga0070660_100156577 | 3300005339 | Bacteria | 1834 |
| 54 | Ga0070660_100513244 | 3300005339 | Bacteria | 998 |
| 55 | Ga0070689_100015635 | 3300005340 | Bacteria | 5538 |
| 56 | Ga0070691_10000207 | 3300005341 | Bacteria | 19782 |
| 57 | Ga0070691_10022510 | 3300005341 | Bacteria | 2924 |
| 58 | Ga0070691_10048094 | 3300005341 | Bacteria | 2029 |
| 59 | Ga0070691_10076624 | 3300005341 | Bacteria | 1631 |
| 60 | Ga0070687_100002662 | 3300005343 | Bacteria | 6757 |
| 61 | Ga0070661_100000047 | 3300005344 | Bacteria | 92087 |
| 62 | Ga0070668_100110962 | 3300005347 | Bacteria | 2183 |
| 63 | Ga0070668_100135462 | 3300005347 | Bacteria | 1980 |
| 64 | Ga0070669_100086821 | 3300005353 | Bacteria | 2338 |
| 65 | Ga0070669_100140454 | 3300005353 | Bacteria | 1862 |
| 66 | Ga0070671_100016683 | 3300005355 | Bacteria | 5939 |
| 67 | Ga0070671_100041316 | 3300005355 | Bacteria | 3832 |
| 68 | Ga0070674_100191035 | 3300005356 | Bacteria | 1575 |
| 69 | Ga0070673_100035884 | 3300005364 | Bacteria | 3764 |
| 70 | Ga0070673_100092996 | 3300005364 | Bacteria | 2469 |
| 71 | Ga0070673_100126106 | 3300005364 | Bacteria | 2142 |
| 72 | Ga0070673_100797219 | 3300005364 | Bacteria | 872 |
| 73 | Ga0070688_100002890 | 3300005365 | Bacteria | 8757 |
| 74 | Ga0070688_100091852 | 3300005365 | Bacteria | 1984 |
| 75 | Ga0070688_100100226 | 3300005365 | Bacteria | 1908 |
| 76 | Ga0070659_100000219 | 3300005366 | Bacteria | 44254 |
| 77 | Ga0070659_100020638 | 3300005366 | Bacteria | 5008 |
| 78 | Ga0070659_100032599 | 3300005366 | Bacteria | 4042 |
| 79 | Ga0070659_100075896 | 3300005366 | Bacteria | 2680 |
| 80 | Ga0070659_100093716 | 3300005366 | Bacteria | 2410 |
| 81 | Ga0070709_10035408 | 3300005434 | Bacteria | 3034 |
| 82 | Ga0070709_10057685 | 3300005434 | Bacteria | 2460 |
| 83 | Ga0070709_10132873 | 3300005434 | Bacteria | 1701 |
| 84 | Ga0070714_100204815 | 3300005435 | Bacteria | 1806 |
| 85 | Ga0070714_100264368 | 3300005435 | Bacteria | 1594 |
| 86 | Ga0070714_100316914 | 3300005435 | Bacteria | 1457 |
| 87 | Ga0070713_100000296 | 3300005436 | Bacteria | 32917 |
| 88 | Ga0070713_100000609 | 3300005436 | Bacteria | 22799 |
| 89 | Ga0070713_100039335 | 3300005436 | Bacteria | 3837 |
| 90 | Ga0070711_100117004 | 3300005439 | Bacteria | 1965 |
| 91 | Ga0070700_100014887 | 3300005441 | Bacteria | 4397 |
| 92 | Ga0070694_100034366 | 3300005444 | Bacteria | 3343 |
| 93 | Ga0070708_100005549 | 3300005445 | Bacteria | 10000 |
| 94 | Ga0070663_100000009 | 3300005455 | Bacteria | 187718 |
| 95 | Ga0070663_100014515 | 3300005455 | Bacteria | 5059 |
| 96 | Ga0070663_100026045 | 3300005455 | Bacteria | 3956 |
| 97 | Ga0070663_100101468 | 3300005455 | Bacteria | 2148 |
| 98 | Ga0070663_100169849 | 3300005455 | Bacteria | 1685 |
| 99 | Ga0070663_100450968 | 3300005455 | Bacteria | 1060 |
| 100 | Ga0070678_100698440 | 3300005456 | Bacteria | 914 |
| 101 | Ga0070662_100256178 | 3300005457 | Bacteria | 1408 |
| 102 | Ga0070681_10000654 | 3300005458 | Bacteria | 28595 |
| 103 | Ga0070681_10011866 | 3300005458 | Bacteria | 8640 |
| 104 | Ga0070681_10027109 | 3300005458 | Bacteria | 5761 |
| 105 | Ga0070681_10114575 | 3300005458 | Bacteria | 2634 |
| 106 | Ga0070681_10122990 | 3300005458 | Bacteria | 2528 |
| 107 | Ga0068867_100217625 | 3300005459 | Bacteria | 1537 |
| 108 | Ga0068867_100370562 | 3300005459 | Bacteria | 1200 |
| 109 | Ga0070685_10008750 | 3300005466 | Bacteria | 5211 |
| 110 | Ga0070706_100000341 | 3300005467 | Bacteria | 56333 |
| 111 | Ga0070699_100034921 | 3300005518 | Bacteria | 4345 |
| 112 | Ga0070679_100001048 | 3300005530 | Bacteria | 24094 |
| 113 | Ga0070679_100007044 | 3300005530 | Bacteria | 10485 |
| 114 | Ga0070679_100009100 | 3300005530 | Bacteria | 9372 |
| 115 | Ga0070679_100059348 | 3300005530 | Bacteria | 3813 |
| 116 | Ga0070679_100297320 | 3300005530 | Bacteria | 1565 |
| 117 | Ga0070684_100000471 | 3300005535 | Bacteria | 27496 |
| 118 | Ga0070684_100034999 | 3300005535 | Bacteria | 4296 |
| 119 | Ga0070684_100037551 | 3300005535 | Bacteria | 4156 |
| 120 | Ga0070684_100047190 | 3300005535 | Bacteria | 3732 |
| 121 | Ga0070684_100072773 | 3300005535 | Bacteria | 3027 |
| 122 | Ga0070684_100073089 | 3300005535 | Bacteria | 3021 |
| 123 | Ga0070684_100232296 | 3300005535 | Bacteria | 1684 |
| 124 | Ga0070697_100010330 | 3300005536 | Bacteria | 7279 |
| 125 | Ga0070697_100052945 | 3300005536 | Bacteria | 3299 |
| 126 | Ga0068853_100012907 | 3300005539 | Bacteria | 6808 |
| 127 | Ga0068853_100019915 | 3300005539 | Bacteria | 5572 |
| 128 | Ga0068853_100030506 | 3300005539 | Bacteria | 4554 |
| 129 | Ga0068853_100063931 | 3300005539 | Bacteria | 3189 |
| 130 | Ga0068853_100431705 | 3300005539 | Bacteria | 1237 |
| 131 | Ga0070672_100034395 | 3300005543 | Bacteria | 3846 |
| 132 | Ga0070686_100008616 | 3300005544 | Bacteria | 5715 |
| 133 | Ga0070695_100003408 | 3300005545 | Bacteria | 9296 |
| 134 | Ga0070695_100019194 | 3300005545 | Bacteria | 4159 |
| 135 | Ga0070696_100042591 | 3300005546 | Bacteria | 3138 |
| 136 | Ga0070696_100078063 | 3300005546 | Bacteria | 2340 |
| 137 | Ga0070693_100016907 | 3300005547 | Bacteria | 3783 |
| 138 | Ga0070693_100038400 | 3300005547 | Bacteria | 2676 |
| 139 | Ga0070693_100139376 | 3300005547 | Bacteria | 1525 |
| 140 | Ga0070693_100147896 | 3300005547 | Bacteria | 1485 |
| 141 | Ga0070693_100236836 | 3300005547 | Bacteria | 1204 |
| 142 | Ga0070665_100100237 | 3300005548 | Bacteria | 2900 |
| 143 | Ga0068855_100001577 | 3300005563 | Bacteria | 28635 |
| 144 | Ga0068855_100034067 | 3300005563 | Bacteria | 6076 |
| 145 | Ga0068855_100063063 | 3300005563 | Bacteria | 4326 |
| 146 | Ga0068855_100119809 | 3300005563 | Bacteria | 3013 |
| 147 | Ga0068855_100349215 | 3300005563 | Bacteria | 1630 |
| 148 | Ga0068855_100556271 | 3300005563 | Bacteria | 1241 |
| 149 | Ga0070664_100000011 | 3300005564 | Bacteria | 162277 |
| 150 | Ga0068857_100000185 | 3300005577 | Bacteria | 40020 |
| 151 | Ga0068857_100018367 | 3300005577 | Bacteria | 6135 |
| 152 | Ga0068857_100022793 | 3300005577 | Bacteria | 5509 |
| 153 | Ga0068857_100046075 | 3300005577 | Bacteria | 3869 |
| 154 | Ga0068857_100291692 | 3300005577 | Bacteria | 1502 |
| 155 | Ga0068857_100421563 | 3300005577 | Bacteria | 1244 |
| 156 | Ga0068854_100000017 | 3300005578 | Bacteria | 142796 |
| 157 | Ga0068854_100114660 | 3300005578 | Bacteria | 2037 |
| 158 | Ga0068854_100674357 | 3300005578 | Bacteria | 890 |
| 159 | Ga0068856_100001403 | 3300005614 | Bacteria | 25255 |
| 160 | Ga0068856_100004454 | 3300005614 | Bacteria | 13951 |
| 161 | Ga0068856_100007590 | 3300005614 | Bacteria | 10584 |
| 162 | Ga0068856_100011206 | 3300005614 | Bacteria | 8702 |
| 163 | Ga0068856_100047695 | 3300005614 | Bacteria | 4221 |
| 164 | Ga0068856_100080217 | 3300005614 | Bacteria | 3237 |
| 165 | Ga0068856_100093767 | 3300005614 | Bacteria | 2988 |
| 166 | Ga0068856_100103540 | 3300005614 | Bacteria | 2840 |
| 167 | Ga0068856_100187437 | 3300005614 | Bacteria | 2083 |
| 168 | Ga0068856_100193111 | 3300005614 | Bacteria | 2050 |
| 169 | Ga0068856_100617479 | 3300005614 | Bacteria | 1105 |
| 170 | Ga0070702_100074307 | 3300005615 | Bacteria | 2016 |
| 171 | Ga0068852_100008656 | 3300005616 | Bacteria | 7520 |
| 172 | Ga0068852_100032559 | 3300005616 | Bacteria | 4317 |
| 173 | Ga0068852_100092596 | 3300005616 | Bacteria | 2707 |
| 174 | Ga0068852_100181966 | 3300005616 | Bacteria | 1977 |
| 175 | Ga0068852_100363782 | 3300005616 | Bacteria | 1415 |
| 176 | Ga0068859_100210810 | 3300005617 | Bacteria | 2029 |
| 177 | Ga0068859_100632750 | 3300005617 | Bacteria | 1162 |
| 178 | Ga0068864_100171498 | 3300005618 | Bacteria | 1978 |
| 179 | Ga0068864_100223568 | 3300005618 | Bacteria | 1738 |
| 180 | Ga0068864_100399000 | 3300005618 | Bacteria | 1306 |
| 181 | Ga0068866_10040078 | 3300005718 | Bacteria | 2316 |
| 182 | Ga0068866_10184850 | 3300005718 | Bacteria | 1234 |
| 183 | Ga0068861_100010717 | 3300005719 | Bacteria | 6369 |
| 184 | Ga0068861_100025018 | 3300005719 | Bacteria | 4323 |
| 185 | Ga0068851_10009156 | 3300005834 | Bacteria | 4599 |
| 186 | Ga0068870_10010600 | 3300005840 | Bacteria | 4241 |
| 187 | Ga0068863_100060743 | 3300005841 | Bacteria | 3574 |
| 188 | Ga0068858_100159258 | 3300005842 | Bacteria | 2125 |
| 189 | Ga0068860_100149905 | 3300005843 | Bacteria | 2245 |
| 190 | Ga0068860_100229022 | 3300005843 | Bacteria | 1806 |
| 191 | Ga0068862_100037913 | 3300005844 | Bacteria | 4086 |
| 192 | Ga0068862_100074976 | 3300005844 | Bacteria | 2925 |
| 193 | Ga0081540_1000269 | 3300005983 | Bacteria | 54263 |
| 194 | Ga0081540_1030095 | 3300005983 | Bacteria | 3013 |
| 195 | Ga0081539_10015902 | 3300005985 | Bacteria | 5423 |
| 196 | Ga0075365_10008427 | 3300006038 | Bacteria | 5852 |
| 197 | Ga0075365_10071707 | 3300006038 | Bacteria | 2332 |
| 198 | Ga0075365_10073917 | 3300006038 | Bacteria | 2298 |
| 199 | Ga0075368_10001917 | 3300006042 | Bacteria | 6689 |
| 200 | Ga0075368_10005294 | 3300006042 | Bacteria | 4428 |
| 201 | Ga0075368_10010423 | 3300006042 | Bacteria | 3359 |
| 202 | Ga0075363_100006085 | 3300006048 | Bacteria | 5445 |
| 203 | Ga0075363_100211913 | 3300006048 | Bacteria | 1109 |
| 204 | Ga0075364_10005386 | 3300006051 | Bacteria | 7428 |
| 205 | Ga0070715_10128713 | 3300006163 | Bacteria | 1216 |
| 206 | Ga0070712_100330125 | 3300006175 | Bacteria | 1242 |
| 207 | Ga0075367_10000650 | 3300006178 | Bacteria | 13320 |
| 208 | Ga0075367_10000730 | 3300006178 | Bacteria | 12773 |
| 209 | Ga0075367_10014273 | 3300006178 | Bacteria | 4296 |
| 210 | Ga0075367_10085757 | 3300006178 | Bacteria | 1911 |
| 211 | Ga0097621_100036185 | 3300006237 | Bacteria | 3949 |
| 212 | Ga0097621_100062442 | 3300006237 | Bacteria | 3058 |
| 213 | Ga0097621_100204005 | 3300006237 | Bacteria | 1718 |
| 214 | Ga0097621_100225191 | 3300006237 | Bacteria | 1635 |
| 215 | Ga0068871_100031040 | 3300006358 | Bacteria | 4210 |
| 216 | Ga0068871_100039660 | 3300006358 | Bacteria | 3769 |
| 217 | Ga0068871_100079320 | 3300006358 | Bacteria | 2716 |
| 218 | Ga0075428_100046875 | 3300006844 | Bacteria | 4747 |
| 219 | Ga0075428_100048989 | 3300006844 | Bacteria | 4636 |
| 220 | Ga0075428_100066205 | 3300006844 | Bacteria | 3956 |
| 221 | Ga0075428_100119193 | 3300006844 | Bacteria | 2874 |
| 222 | Ga0075428_100160079 | 3300006844 | Bacteria | 2444 |
| 223 | Ga0075428_100218975 | 3300006844 | Bacteria | 2056 |
| 224 | Ga0075428_100296161 | 3300006844 | Bacteria | 1740 |
| 225 | Ga0075430_100050281 | 3300006846 | Bacteria | 3516 |
| 226 | Ga0075430_100261882 | 3300006846 | Bacteria | 1432 |
| 227 | Ga0075430_100389339 | 3300006846 | Bacteria | 1150 |
| 228 | Ga0075431_100017147 | 3300006847 | Bacteria | 7362 |
| 229 | Ga0075431_100041845 | 3300006847 | Bacteria | 4725 |
| 230 | Ga0075431_100060562 | 3300006847 | Bacteria | 3906 |
| 231 | Ga0075431_100312541 | 3300006847 | Bacteria | 1586 |
| 232 | Ga0075433_10002537 | 3300006852 | Bacteria | 13906 |
| 233 | Ga0075433_10012133 | 3300006852 | Bacteria | 6950 |
| 234 | Ga0075433_10038194 | 3300006852 | Bacteria | 4146 |
| 235 | Ga0075433_10517171 | 3300006852 | Bacteria | 1050 |
| 236 | Ga0075434_100015667 | 3300006871 | Bacteria | 7274 |
| 237 | Ga0075434_100191464 | 3300006871 | Bacteria | 2066 |
| 238 | Ga0075434_100479476 | 3300006871 | Bacteria | 1265 |
| 239 | Ga0075429_100143394 | 3300006880 | Bacteria | 2091 |
| 240 | Ga0075429_100388971 | 3300006880 | Bacteria | 1221 |
| 241 | Ga0068865_100220246 | 3300006881 | Bacteria | 1483 |
| 242 | Ga0068865_100541179 | 3300006881 | Bacteria | 977 |
| 243 | Ga0097620_100210807 | 3300006931 | Bacteria | 2029 |
| 244 | Ga0097620_100632828 | 3300006931 | Bacteria | 1162 |
| 245 | Ga0075435_100162525 | 3300007076 | Bacteria | 1881 |
| 246 | Ga0099794_10000008 | 3300007265 | Bacteria | 124724 |
| 247 | Ga0099794_10017455 | 3300007265 | Bacteria | 3199 |
| 248 | Ga0099794_10043133 | 3300007265 | Bacteria | 2152 |
| 249 | Ga0105240_10005660 | 3300009093 | Bacteria | 18544 |
| 250 | Ga0105240_10015906 | 3300009093 | Bacteria | 10206 |
| 251 | Ga0105240_10029226 | 3300009093 | Bacteria | 7187 |
| 252 | Ga0105240_10079743 | 3300009093 | Bacteria | 4028 |
| 253 | Ga0105240_10152033 | 3300009093 | Bacteria | 2756 |
| 254 | Ga0111539_10013673 | 3300009094 | Bacteria | 10141 |
| 255 | Ga0111539_10072436 | 3300009094 | Bacteria | 4063 |
| 256 | Ga0111539_10099725 | 3300009094 | Bacteria | 3410 |
| 257 | Ga0111539_10177812 | 3300009094 | Bacteria | 2486 |
| 258 | Ga0111539_10228679 | 3300009094 | Bacteria | 2166 |
| 259 | Ga0105245_10000754 | 3300009098 | Bacteria | 29261 |
| 260 | Ga0105245_10067620 | 3300009098 | Bacteria | 3236 |
| 261 | Ga0105245_10087425 | 3300009098 | Bacteria | 2861 |
| 262 | Ga0105245_10160889 | 3300009098 | Bacteria | 2130 |
| 263 | Ga0105245_10167327 | 3300009098 | Bacteria | 2091 |
| 264 | Ga0105245_10349803 | 3300009098 | Bacteria | 1464 |
| 265 | Ga0105247_10104559 | 3300009101 | Bacteria | 1814 |
| 266 | Ga0114129_10005479 | 3300009147 | Bacteria | 17939 |
| 267 | Ga0114129_10030817 | 3300009147 | Bacteria | 7585 |
| 268 | Ga0114129_10042105 | 3300009147 | Bacteria | 6431 |
| 269 | Ga0114129_10133731 | 3300009147 | Bacteria | 3405 |
| 270 | Ga0114129_10211807 | 3300009147 | Bacteria | 2619 |
| 271 | Ga0114129_10296612 | 3300009147 | Bacteria | 2156 |
| 272 | Ga0114129_10420182 | 3300009147 | Bacteria | 1759 |
| 273 | Ga0114129_10590327 | 3300009147 | Bacteria | 1440 |
| 274 | Ga0114129_10615190 | 3300009147 | Bacteria | 1406 |
| 275 | Ga0105243_10122930 | 3300009148 | Bacteria | 2191 |
| 276 | Ga0105241_10003933 | 3300009174 | Bacteria | 10993 |
| 277 | Ga0105241_10022888 | 3300009174 | Bacteria | 4633 |
| 278 | Ga0105241_10062208 | 3300009174 | Bacteria | 2877 |
| 279 | Ga0105241_10214536 | 3300009174 | Bacteria | 1614 |
| 280 | Ga0105241_10282157 | 3300009174 | Bacteria | 1419 |
| 281 | Ga0105242_10005424 | 3300009176 | Bacteria | 9866 |
| 282 | Ga0105242_10012399 | 3300009176 | Bacteria | 6561 |
| 283 | Ga0105242_10036092 | 3300009176 | Bacteria | 3964 |
| 284 | Ga0105242_10070460 | 3300009176 | Bacteria | 2899 |
| 285 | Ga0105242_10070922 | 3300009176 | Bacteria | 2890 |
| 286 | Ga0105242_10105888 | 3300009176 | Bacteria | 2389 |
| 287 | Ga0105242_10339190 | 3300009176 | Bacteria | 1384 |
| 288 | Ga0105248_10011824 | 3300009177 | Bacteria | 9629 |
| 289 | Ga0105248_10026696 | 3300009177 | Bacteria | 6421 |
| 290 | Ga0105248_10092271 | 3300009177 | Bacteria | 3410 |
| 291 | Ga0105248_10153218 | 3300009177 | Bacteria | 2600 |
| 292 | Ga0105248_10213173 | 3300009177 | Bacteria | 2176 |
| 293 | Ga0105237_10010006 | 3300009545 | Bacteria | 10118 |
| 294 | Ga0105237_10027565 | 3300009545 | Bacteria | 5797 |
| 295 | Ga0105237_10141753 | 3300009545 | Bacteria | 2398 |
| 296 | Ga0105238_10000443 | 3300009551 | Bacteria | 43473 |
| 297 | Ga0105238_10005317 | 3300009551 | Bacteria | 12721 |
| 298 | Ga0105238_10017658 | 3300009551 | Bacteria | 7253 |
| 299 | Ga0105238_10040995 | 3300009551 | Bacteria | 4691 |
| 300 | Ga0105238_10207475 | 3300009551 | Bacteria | 1935 |
| 301 | Ga0105249_10003026 | 3300009553 | Bacteria | 14506 |
| 302 | Ga0105249_10073454 | 3300009553 | Bacteria | 3164 |
| 303 | Ga0105249_10142499 | 3300009553 | Bacteria | 2299 |
| 304 | Ga0105239_10000767 | 3300010375 | Bacteria | 45361 |
| 305 | Ga0105239_10009586 | 3300010375 | Bacteria | 10891 |
| 306 | Ga0105239_10019483 | 3300010375 | Bacteria | 7490 |
| 307 | Ga0105239_10062671 | 3300010375 | Bacteria | 4081 |
| 308 | Ga0105239_11210088 | 3300010375 | Bacteria | 871 |
| 309 | Ga0105246_10029255 | 3300011119 | Bacteria | 3626 |
| 310 | Ga0105246_10112241 | 3300011119 | Bacteria | 2004 |
| 311 | Ga0157373_10004105 | 3300013100 | Bacteria | 10976 |
| 312 | Ga0157373_10383181 | 3300013100 | Bacteria | 1006 |
| 313 | Ga0157371_10000033 | 3300013102 | Bacteria | 225328 |
| 314 | Ga0157370_10000010 | 3300013104 | Bacteria | 218199 |
| 315 | Ga0157370_10000997 | 3300013104 | Bacteria | 35747 |
| 316 | Ga0157370_10006183 | 3300013104 | Bacteria | 13274 |
| 317 | Ga0157370_10006794 | 3300013104 | Bacteria | 12546 |
| 318 | Ga0157370_10020680 | 3300013104 | Bacteria | 6568 |
| 319 | Ga0157370_10046339 | 3300013104 | Bacteria | 4168 |
| 320 | Ga0157370_10111535 | 3300013104 | Bacteria | 2556 |
| 321 | Ga0157369_10006586 | 3300013105 | Bacteria | 13430 |
| 322 | Ga0157369_10016540 | 3300013105 | Bacteria | 8293 |
| 323 | Ga0157369_10038194 | 3300013105 | Bacteria | 5250 |
| 324 | Ga0157369_10254492 | 3300013105 | Bacteria | 1832 |
| 325 | Ga0157369_10341334 | 3300013105 | Bacteria | 1556 |
| 326 | Ga0157369_10497616 | 3300013105 | Bacteria | 1261 |
| 327 | Ga0157374_10016328 | 3300013296 | Bacteria | 6523 |
| 328 | Ga0157374_10020663 | 3300013296 | Bacteria | 5846 |
| 329 | Ga0157374_10044232 | 3300013296 | Bacteria | 4116 |
| 330 | Ga0157374_10176784 | 3300013296 | Bacteria | 2083 |
| 331 | Ga0157378_10002798 | 3300013297 | Bacteria | 15556 |
| 332 | Ga0157378_10182318 | 3300013297 | Bacteria | 1976 |
| 333 | Ga0163162_10055007 | 3300013306 | Bacteria | 4005 |
| 334 | Ga0163162_10089813 | 3300013306 | Bacteria | 3153 |
| 335 | Ga0163162_10487457 | 3300013306 | Bacteria | 1364 |
| 336 | Ga0163162_10501606 | 3300013306 | Bacteria | 1344 |
| 337 | Ga0163162_10758190 | 3300013306 | Bacteria | 1089 |
| 338 | Ga0157372_10000176 | 3300013307 | Bacteria | 70656 |
| 339 | Ga0157372_10008622 | 3300013307 | Bacteria | 10829 |
| 340 | Ga0157372_10017214 | 3300013307 | Bacteria | 7759 |
| 341 | Ga0157372_10021026 | 3300013307 | Bacteria | 7046 |
| 342 | Ga0157372_10030111 | 3300013307 | Bacteria | 5934 |
| 343 | Ga0157372_10055106 | 3300013307 | Bacteria | 4438 |
| 344 | Ga0157372_10204320 | 3300013307 | Bacteria | 2289 |
| 345 | Ga0157372_10272383 | 3300013307 | Bacteria | 1967 |
| 346 | Ga0157375_10080080 | 3300013308 | Bacteria | 3303 |
| 347 | Ga0157375_10117513 | 3300013308 | Bacteria | 2765 |
| 348 | Ga0157375_10142545 | 3300013308 | Bacteria | 2524 |
| 349 | Ga0157375_10191380 | 3300013308 | Bacteria | 2200 |
| 350 | Ga0157375_10300704 | 3300013308 | Bacteria | 1768 |
| 351 | Ga0157375_10417370 | 3300013308 | Bacteria | 1508 |
| 352 | Ga0157375_10419940 | 3300013308 | Bacteria | 1503 |
| 353 | Ga0163163_10015922 | 3300014325 | Bacteria | 6966 |
| 354 | Ga0163163_10036358 | 3300014325 | Bacteria | 4783 |
| 355 | Ga0163163_10207828 | 3300014325 | Bacteria | 2006 |
| 356 | Ga0163163_10216135 | 3300014325 | Bacteria | 1966 |
| 357 | Ga0163163_10506793 | 3300014325 | Bacteria | 1269 |
| 358 | Ga0157380_10084060 | 3300014326 | Bacteria | 2609 |
| 359 | Ga0157377_10007961 | 3300014745 | Bacteria | 5145 |
| 360 | Ga0157379_10074496 | 3300014968 | Bacteria | 3039 |
| 361 | Ga0157379_10088865 | 3300014968 | Bacteria | 2771 |
| 362 | Ga0157379_10451578 | 3300014968 | Bacteria | 1187 |
| 363 | Ga0157376_10043547 | 3300014969 | Bacteria | 3684 |
| 364 | Ga0157376_10051192 | 3300014969 | Bacteria | 3430 |
| 365 | Ga0157376_10142804 | 3300014969 | Bacteria | 2150 |
| 366 | Ga0157376_10176857 | 3300014969 | Bacteria | 1947 |
| 367 | Ga0182006_1000198 | 3300015261 | Bacteria | 61642 |
| 368 | Ga0183361_10020 | 3300016635 | Bacteria | 128627 |
| 369 | Ga0163161_10075248 | 3300017792 | Bacteria | 2477 |
| 370 | Ga0163161_10089384 | 3300017792 | Bacteria | 2278 |
| 371 | Ga0206351_10187668 | 3300020077 | Bacteria | 1995 |
| 372 | Ga0206350_10972196 | 3300020080 | Bacteria | 1652 |
| 373 | Ga0154015_1514660 | 3300020610 | Bacteria | 27088 |
| 374 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 375 | Ga0209784_100732 | 3300025224 | Bacteria | 8454 |
| 376 | Ga0209784_102976 | 3300025224 | Bacteria | 1550 |
| 377 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 378 | Ga0209566_100194 | 3300025225 | Bacteria | 63005 |
| 379 | Ga0209566_104401 | 3300025225 | Bacteria | 1931 |
| 380 | Ga0209674_100045 | 3300025226 | Bacteria | 362387 |
| 381 | Ga0209674_100114 | 3300025226 | Bacteria | 139197 |
| 382 | Ga0209674_101646 | 3300025226 | Bacteria | 5593 |
| 383 | Ga0209672_100511 | 3300025228 | Bacteria | 21415 |
| 384 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 385 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 386 | Ga0209563_102859 | 3300025230 | Bacteria | 3754 |
| 387 | Ga0209563_110753 | 3300025230 | Bacteria | 1318 |
| 388 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 389 | Ga0209646_1000016 | 3300025246 | Bacteria | 501688 |
| 390 | Ga0209026_1000832 | 3300025250 | Bacteria | 16288 |
| 391 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 392 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 393 | Ga0209148_1024577 | 3300025254 | Bacteria | 950 |
| 394 | Ga0209759_1002449 | 3300025256 | Bacteria | 8138 |
| 395 | Ga0209759_1012377 | 3300025256 | Bacteria | 2367 |
| 396 | Ga0207666_1001176 | 3300025271 | Bacteria | 3085 |
| 397 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 398 | Ga0207673_1001393 | 3300025290 | Bacteria | 2631 |
| 399 | Ga0207697_10000878 | 3300025315 | Bacteria | 17003 |
| 400 | Ga0207697_10020899 | 3300025315 | Bacteria | 2680 |
| 401 | Ga0207656_10046112 | 3300025321 | Bacteria | 1868 |
| 402 | Ga0207682_10000322 | 3300025893 | Bacteria | 21806 |
| 403 | Ga0207642_10006357 | 3300025899 | Bacteria | 3922 |
| 404 | Ga0207688_10009997 | 3300025901 | Bacteria | 5160 |
| 405 | Ga0207680_10012440 | 3300025903 | Bacteria | 4333 |
| 406 | Ga0207647_10188524 | 3300025904 | Bacteria | 1196 |
| 407 | Ga0207699_10053072 | 3300025906 | Bacteria | 2402 |
| 408 | Ga0207699_10123028 | 3300025906 | Bacteria | 1681 |
| 409 | Ga0207645_10000566 | 3300025907 | Bacteria | 30620 |
| 410 | Ga0207645_10011889 | 3300025907 | Bacteria | 5925 |
| 411 | Ga0207643_10000359 | 3300025908 | Bacteria | 30555 |
| 412 | Ga0207705_10043543 | 3300025909 | Bacteria | 3226 |
| 413 | Ga0207705_10082077 | 3300025909 | Bacteria | 2350 |
| 414 | Ga0207705_10343866 | 3300025909 | Bacteria | 1148 |
| 415 | Ga0207684_10000017 | 3300025910 | Bacteria | 385006 |
| 416 | Ga0207654_10084388 | 3300025911 | Bacteria | 1920 |
| 417 | Ga0207654_10170698 | 3300025911 | Bacteria | 1412 |
| 418 | Ga0207654_10185549 | 3300025911 | Bacteria | 1359 |
| 419 | Ga0207707_10000428 | 3300025912 | Bacteria | 43725 |
| 420 | Ga0207707_10014718 | 3300025912 | Bacteria | 6817 |
| 421 | Ga0207707_10015541 | 3300025912 | Bacteria | 6630 |
| 422 | Ga0207707_10031972 | 3300025912 | Bacteria | 4607 |
| 423 | Ga0207707_10203392 | 3300025912 | Bacteria | 1726 |
| 424 | Ga0207707_10227976 | 3300025912 | Bacteria | 1621 |
| 425 | Ga0207695_10001192 | 3300025913 | Bacteria | 44681 |
| 426 | Ga0207695_10001402 | 3300025913 | Bacteria | 40606 |
| 427 | Ga0207695_10031185 | 3300025913 | Bacteria | 5853 |
| 428 | Ga0207695_10084198 | 3300025913 | Bacteria | 3211 |
| 429 | Ga0207695_10092286 | 3300025913 | Bacteria | 3039 |
| 430 | Ga0207695_10125902 | 3300025913 | Bacteria | 2524 |
| 431 | Ga0207695_10386671 | 3300025913 | Bacteria | 1284 |
| 432 | Ga0207671_10006282 | 3300025914 | Bacteria | 10617 |
| 433 | Ga0207671_10182425 | 3300025914 | Bacteria | 1634 |
| 434 | Ga0207693_10009495 | 3300025915 | Bacteria | 7922 |
| 435 | Ga0207693_10296333 | 3300025915 | Bacteria | 1267 |
| 436 | Ga0207660_10004855 | 3300025917 | Bacteria | 8755 |
| 437 | Ga0207660_10183857 | 3300025917 | Bacteria | 1625 |
| 438 | Ga0207660_10283134 | 3300025917 | Bacteria | 1316 |
| 439 | Ga0207662_10010985 | 3300025918 | Bacteria | 5010 |
| 440 | Ga0207657_10023547 | 3300025919 | Bacteria | 5732 |
| 441 | Ga0207657_10043427 | 3300025919 | Bacteria | 3960 |
| 442 | Ga0207657_10064611 | 3300025919 | Bacteria | 3123 |
| 443 | Ga0207657_10108078 | 3300025919 | Bacteria | 2300 |
| 444 | Ga0207657_10146615 | 3300025919 | Bacteria | 1925 |
| 445 | Ga0207657_10333578 | 3300025919 | Bacteria | 1198 |
| 446 | Ga0207649_10000123 | 3300025920 | Bacteria | 65761 |
| 447 | Ga0207649_10044241 | 3300025920 | Bacteria | 2725 |
| 448 | Ga0207649_10079379 | 3300025920 | Bacteria | 2120 |
| 449 | Ga0207652_10005246 | 3300025921 | Bacteria | 10530 |
| 450 | Ga0207652_10020084 | 3300025921 | Bacteria | 5500 |
| 451 | Ga0207652_10022050 | 3300025921 | Bacteria | 5264 |
| 452 | Ga0207652_10035165 | 3300025921 | Bacteria | 4227 |
| 453 | Ga0207646_10272700 | 3300025922 | Bacteria | 1529 |
| 454 | Ga0207681_10151892 | 3300025923 | Bacteria | 1736 |
| 455 | Ga0207694_10000698 | 3300025924 | Bacteria | 30197 |
| 456 | Ga0207694_10003106 | 3300025924 | Bacteria | 13286 |
| 457 | Ga0207694_10025025 | 3300025924 | Bacteria | 4536 |
| 458 | Ga0207650_10006058 | 3300025925 | Bacteria | 8249 |
| 459 | Ga0207650_10031973 | 3300025925 | Bacteria | 3805 |
| 460 | Ga0207650_10483049 | 3300025925 | Bacteria | 1034 |
| 461 | Ga0207659_10107008 | 3300025926 | Bacteria | 2119 |
| 462 | Ga0207659_10115686 | 3300025926 | Bacteria | 2046 |
| 463 | Ga0207687_10000339 | 3300025927 | Bacteria | 31327 |
| 464 | Ga0207687_10001672 | 3300025927 | Bacteria | 15303 |
| 465 | Ga0207687_10019205 | 3300025927 | Bacteria | 4526 |
| 466 | Ga0207687_10056904 | 3300025927 | Bacteria | 2744 |
| 467 | Ga0207687_10123570 | 3300025927 | Bacteria | 1939 |
| 468 | Ga0207687_10321507 | 3300025927 | Bacteria | 1253 |
| 469 | Ga0207700_10000197 | 3300025928 | Bacteria | 35916 |
| 470 | Ga0207700_10001526 | 3300025928 | Bacteria | 13117 |
| 471 | Ga0207664_10156768 | 3300025929 | Bacteria | 1939 |
| 472 | Ga0207644_10089998 | 3300025931 | Bacteria | 2285 |
| 473 | Ga0207690_10006905 | 3300025932 | Bacteria | 6728 |
| 474 | Ga0207690_10050704 | 3300025932 | Bacteria | 2772 |
| 475 | Ga0207690_10067077 | 3300025932 | Bacteria | 2460 |
| 476 | Ga0207690_10130086 | 3300025932 | Bacteria | 1841 |
| 477 | Ga0207706_10000918 | 3300025933 | Bacteria | 30228 |
| 478 | Ga0207686_10023494 | 3300025934 | Bacteria | 3562 |
| 479 | Ga0207686_10217033 | 3300025934 | Bacteria | 1379 |
| 480 | Ga0207686_10221390 | 3300025934 | Bacteria | 1367 |
| 481 | Ga0207709_10210922 | 3300025935 | Bacteria | 1394 |
| 482 | Ga0207670_10036529 | 3300025936 | Bacteria | 3195 |
| 483 | Ga0207669_10199539 | 3300025937 | Bacteria | 1451 |
| 484 | Ga0207704_10159651 | 3300025938 | Bacteria | 1602 |
| 485 | Ga0207704_10257168 | 3300025938 | Bacteria | 1314 |
| 486 | Ga0207704_10297205 | 3300025938 | Bacteria | 1235 |
| 487 | Ga0207691_10005758 | 3300025940 | Bacteria | 11991 |
| 488 | Ga0207691_10017742 | 3300025940 | Bacteria | 6747 |
| 489 | Ga0207691_10050746 | 3300025940 | Bacteria | 3796 |
| 490 | Ga0207711_10003145 | 3300025941 | Bacteria | 14391 |
| 491 | Ga0207711_10006153 | 3300025941 | Bacteria | 10143 |
| 492 | Ga0207711_10046961 | 3300025941 | Bacteria | 3690 |
| 493 | Ga0207711_10082154 | 3300025941 | Bacteria | 2816 |
| 494 | Ga0207711_10091675 | 3300025941 | Bacteria | 2673 |
| 495 | Ga0207711_10266133 | 3300025941 | Bacteria | 1576 |
| 496 | Ga0207689_10000264 | 3300025942 | Bacteria | 47214 |
| 497 | Ga0207661_10000420 | 3300025944 | Bacteria | 27406 |
| 498 | Ga0207661_10103477 | 3300025944 | Bacteria | 2396 |
| 499 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 500 | Ga0207679_10019683 | 3300025945 | Bacteria | 4541 |
| 501 | Ga0207679_10112697 | 3300025945 | Bacteria | 2150 |
| 502 | Ga0207667_10000573 | 3300025949 | Bacteria | 48021 |
| 503 | Ga0207667_10018640 | 3300025949 | Bacteria | 7778 |
| 504 | Ga0207667_10055004 | 3300025949 | Bacteria | 4185 |
| 505 | Ga0207667_10065089 | 3300025949 | Bacteria | 3803 |
| 506 | Ga0207667_10101808 | 3300025949 | Bacteria | 2963 |
| 507 | Ga0207667_10130914 | 3300025949 | Bacteria | 2584 |
| 508 | Ga0207667_10377101 | 3300025949 | Bacteria | 1445 |
| 509 | Ga0207651_10027762 | 3300025960 | Bacteria | 3560 |
| 510 | Ga0207651_10056862 | 3300025960 | Bacteria | 2695 |
| 511 | Ga0207712_10023705 | 3300025961 | Bacteria | 4054 |
| 512 | Ga0207668_10080977 | 3300025972 | Bacteria | 2354 |
| 513 | Ga0207668_10090333 | 3300025972 | Bacteria | 2248 |
| 514 | Ga0207640_10000138 | 3300025981 | Bacteria | 53518 |
| 515 | Ga0207640_10076244 | 3300025981 | Bacteria | 2275 |
| 516 | Ga0207640_10134887 | 3300025981 | Bacteria | 1790 |
| 517 | Ga0207640_10248396 | 3300025981 | Bacteria | 1379 |
| 518 | Ga0207640_10300766 | 3300025981 | Bacteria | 1269 |
| 519 | Ga0207658_10043251 | 3300025986 | Bacteria | 3274 |
| 520 | Ga0207658_10109419 | 3300025986 | Bacteria | 2181 |
| 521 | Ga0207658_10146511 | 3300025986 | Bacteria | 1918 |
| 522 | Ga0207703_10085613 | 3300026035 | Bacteria | 2638 |
| 523 | Ga0207703_10174848 | 3300026035 | Bacteria | 1891 |
| 524 | Ga0207703_10198980 | 3300026035 | Bacteria | 1779 |
| 525 | Ga0207703_10245032 | 3300026035 | Bacteria | 1613 |
| 526 | Ga0207639_10124505 | 3300026041 | Bacteria | 2123 |
| 527 | Ga0207639_10487685 | 3300026041 | Bacteria | 1124 |
| 528 | Ga0207678_10000015 | 3300026067 | Bacteria | 138937 |
| 529 | Ga0207678_10006130 | 3300026067 | Bacteria | 10695 |
| 530 | Ga0207678_10070788 | 3300026067 | Bacteria | 2990 |
| 531 | Ga0207678_10074943 | 3300026067 | Bacteria | 2899 |
| 532 | Ga0207678_10164297 | 3300026067 | Bacteria | 1896 |
| 533 | Ga0207708_10000494 | 3300026075 | Bacteria | 30296 |
| 534 | Ga0207708_10003123 | 3300026075 | Bacteria | 12195 |
| 535 | Ga0207708_10044289 | 3300026075 | Bacteria | 3391 |
| 536 | Ga0207708_10047153 | 3300026075 | Bacteria | 3281 |
| 537 | Ga0207708_10376575 | 3300026075 | Bacteria | 1169 |
| 538 | Ga0207702_10000084 | 3300026078 | Bacteria | 106893 |
| 539 | Ga0207702_10001951 | 3300026078 | Bacteria | 20113 |
| 540 | Ga0207702_10006488 | 3300026078 | Bacteria | 10083 |
| 541 | Ga0207702_10036849 | 3300026078 | Bacteria | 4092 |
| 542 | Ga0207702_10114856 | 3300026078 | Bacteria | 2400 |
| 543 | Ga0207702_10141653 | 3300026078 | Bacteria | 2176 |
| 544 | Ga0207702_10253551 | 3300026078 | Bacteria | 1653 |
| 545 | Ga0207641_10788441 | 3300026088 | Bacteria | 939 |
| 546 | Ga0207648_10005148 | 3300026089 | Bacteria | 13239 |
| 547 | Ga0207648_10052459 | 3300026089 | Bacteria | 3566 |
| 548 | Ga0207676_10017641 | 3300026095 | Bacteria | 5175 |
| 549 | Ga0207676_10051777 | 3300026095 | Bacteria | 3206 |
| 550 | Ga0207674_10000035 | 3300026116 | Bacteria | 136262 |
| 551 | Ga0207674_10001346 | 3300026116 | Bacteria | 31774 |
| 552 | Ga0207674_10006571 | 3300026116 | Bacteria | 13671 |
| 553 | Ga0207674_10043135 | 3300026116 | Bacteria | 4653 |
| 554 | Ga0207675_100001280 | 3300026118 | Bacteria | 25152 |
| 555 | Ga0207675_100007688 | 3300026118 | Bacteria | 10170 |
| 556 | Ga0207683_10017507 | 3300026121 | Bacteria | 6108 |
| 557 | Ga0207683_10285435 | 3300026121 | Bacteria | 1509 |
| 558 | Ga0207683_10468834 | 3300026121 | Bacteria | 1162 |
| 559 | Ga0207698_10013741 | 3300026142 | Bacteria | 5355 |
| 560 | Ga0207698_10149613 | 3300026142 | Bacteria | 2024 |
| 561 | Ga0209995_1001838 | 3300027471 | Bacteria | 3314 |
| 562 | Ga0209588_1000003 | 3300027671 | Bacteria | 308861 |
| 563 | Ga0209588_1009806 | 3300027671 | Bacteria | 2868 |
| 564 | Ga0209588_1037829 | 3300027671 | Bacteria | 1554 |
| 565 | Ga0209966_1019154 | 3300027695 | Bacteria | 1317 |
| 566 | Ga0209813_10000999 | 3300027866 | Bacteria | 6343 |
| 567 | Ga0209813_10007470 | 3300027866 | Bacteria | 2725 |
| 568 | Ga0207428_10032650 | 3300027907 | Bacteria | 4280 |
| 569 | Ga0207428_10035068 | 3300027907 | Bacteria | 4104 |
| 570 | Ga0207428_10168917 | 3300027907 | Bacteria | 1657 |
| 571 | Ga0268266_10085915 | 3300028379 | Bacteria | 2749 |
| 572 | Ga0268265_10005788 | 3300028380 | Bacteria | 8433 |
| 573 | Ga0268265_10010563 | 3300028380 | Bacteria | 6236 |
| 574 | Ga0268265_10111259 | 3300028380 | Bacteria | 2236 |
| 575 | Ga0268265_10248992 | 3300028380 | Bacteria | 1572 |
| 576 | Ga0268264_10063642 | 3300028381 | Bacteria | 3101 |
| 577 | Ga0268264_10159775 | 3300028381 | Bacteria | 2029 |
| 578 | Ga0268264_10571502 | 3300028381 | Bacteria | 1111 |
| 579 | Ga0265337_1000071 | 3300028556 | Bacteria | 47429 |
| 580 | Ga0265338_10000205 | 3300028800 | Bacteria | 111060 |
| 581 | Ga0265340_10039138 | 3300031247 | Bacteria | 2342 |
| 582 | Ga0307408_100108199 | 3300031548 | Bacteria | 2131 |
| 583 | Ga0307408_100423710 | 3300031548 | Bacteria | 1148 |
| 584 | Ga0265313_10005033 | 3300031595 | Bacteria | 9859 |
| 585 | Ga0307508_10000013 | 3300031616 | Bacteria | 242867 |
| 586 | Ga0307508_10163830 | 3300031616 | Bacteria | 1827 |
| 587 | Ga0265314_10004213 | 3300031711 | Bacteria | 13485 |
| 588 | Ga0265314_10006116 | 3300031711 | Bacteria | 10696 |
| 589 | Ga0307416_100266745 | 3300032002 | Bacteria | 1678 |
| 590 | Ga0307414_10166105 | 3300032004 | Bacteria | 1759 |
| 591 | Ga0316583_10067730 | 3300032133 | Bacteria | 1249 |
| 592 | Ga0373926_0008111 | 3300035083 | Bacteria | 3498 |
| 593 | Ga0373928_0018804 | 3300035084 | Bacteria | 1436 |
| 594 | Ga0373934_0003108 | 3300035086 | Bacteria | 6058 |
| 595 | Ga0373944_0012922 | 3300035089 | Bacteria | 2309 |
| 596 | Ga0373949_0009616 | 3300035090 | Bacteria | 2117 |
| 597 | Ga0373951_0019671 | 3300035091 | Bacteria | 1541 |
| 598 | Ga0373923_0046243 | 3300035111 | Bacteria | 1810 |
| 599 | Ga0373939_0011208 | 3300035114 | Bacteria | 2258 |
| 600 | Ga0373939_0081928 | 3300035114 | Bacteria | 1073 |
| 601 | Ga0373939_0098119 | 3300035114 | Bacteria | 1001 |
| 602 | Ga0373945_0050665 | 3300035116 | Bacteria | 1526 |
| 603 | Ga0373956_0149726 | 3300035119 | Bacteria | 1098 |
| 604 | Ga0373957_0023204 | 3300035120 | Bacteria | 2217 |
| 605 | Ga0373960_0017861 | 3300035121 | Bacteria | 1843 |
| 606 | Ga0373943_0002738 | 3300035170 | Bacteria | 8015 |
| 607 | Ga0373943_0028431 | 3300035170 | Bacteria | 2634 |
| 608 | Ga0373946_0006341 | 3300035171 | Bacteria | 4288 |
| 609 | Ga0373946_0009952 | 3300035171 | Bacteria | 3515 |
| 610 | Ga0373955_0002469 | 3300035172 | Bacteria | 8079 |
| 611 | Ga0373955_0002785 | 3300035172 | Bacteria | 7675 |
| 612 | Ga0373955_0017843 | 3300035172 | Bacteria | 3518 |
| 613 | Ga0373955_0222214 | 3300035172 | Bacteria | 1128 |
| 614 | Ga0373955_0320712 | 3300035172 | Bacteria | 936 |
| 615 | Ga0373942_0034135 | 3300035207 | Bacteria | 1360 |
| 616 | Ga0373962_0037038 | 3300035242 | Bacteria | 1361 |
| 617 | Ga0373924_0063009 | 3300035410 | Bacteria | 1554 |
| 618 | Ga0373931_0047887 | 3300035691 | Bacteria | 2264 |
| 619 | Ga0373931_0137792 | 3300035691 | Bacteria | 1411 |
| 620 | Ga0373935_0003608 | 3300035692 | Bacteria | 9021 |
| 621 | Ga0373935_0009935 | 3300035692 | Bacteria | 5703 |
| 622 | Ga0373935_0377345 | 3300035692 | Bacteria | 1015 |
| 623 | Ga0373927_0008383 | 3300035695 | Bacteria | 6956 |
| 624 | Ga0373927_0022921 | 3300035695 | Bacteria | 4090 |
| 625 | Ga0373933_0002636 | 3300035724 | Bacteria | 10049 |
| 626 | Ga0373947_0001177 | 3300035725 | Bacteria | 16084 |
| 627 | Ga0373947_0159372 | 3300035725 | Bacteria | 1458 |
| 628 | Ga0373937_0014656 | 3300036401 | Bacteria | 6921 |
| 629 | Ga0373937_0019944 | 3300036401 | Bacteria | 6004 |
| 630 | Ga0373937_0022721 | 3300036401 | Bacteria | 5642 |
| 631 | Ga0373937_0530282 | 3300036401 | Bacteria | 1119 |
| 632 | Ga0373925_0015474 | 3300037068 | Bacteria | 5515 |
| 633 | Ga0373925_0015975 | 3300037068 | Bacteria | 5435 |
| 634 | Ga0373925_0077063 | 3300037068 | Bacteria | 2530 |
| 635 | Ga0373925_0544684 | 3300037068 | Bacteria | 954 |
| 636 | Ga0395899_0086752 | 3300037312 | Bacteria | 2273 |
| 637 | Ga0395899_0100292 | 3300037312 | Bacteria | 2091 |
| 638 | Ga0395900_0008184 | 3300037418 | Bacteria | 10761 |
| 639 | Ga0395900_0240314 | 3300037418 | Bacteria | 1817 |
| 640 | Ga0395900_0282737 | 3300037418 | Bacteria | 1650 |
| 641 | Ga0395900_0781994 | 3300037418 | Bacteria | 883 |
| 642 | Ga0395898_0015812 | 3300037466 | Bacteria | 7734 |
| 643 | Ga0395905_0050942 | 3300037471 | Bacteria | 3878 |
| 644 | Ga0395901_0063903 | 3300038443 | Bacteria | 3831 |
| 645 | Ga0395901_0218418 | 3300038443 | Bacteria | 1993 |
| 646 | Ga0436360_0745406 | 3300039438 | Bacteria | 2720 |
| 647 | Ga0436361_1127696 | 3300039447 | Bacteria | 1468 |
| 648 | Ga0436363_0045111 | 3300039450 | Bacteria | 1183 |
| 649 | Ga0439453_0045304 | 3300041408 | Bacteria | 875 |
| 650 | Ga0466972_0026303 | 3300044658 | Bacteria | 2883 |
| 651 | Ga0453684_0324427 | 3300044712 | Bacteria | 1743 |
| 652 | Ga0451576_0132345 | 3300045051 | Bacteria | 2600 |
| 653 | Ga0451576_0304945 | 3300045051 | Bacteria | 1666 |
| 654 | Ga0451576_0479884 | 3300045051 | Bacteria | 1306 |
| 655 | Ga0466958_0182435 | 3300045836 | Bacteria | 1332 |
| 656 | Ga0495627_002644 | 3300046453 | Bacteria | 8423 |
| 657 | Ga0495592_0067019 | 3300046454 | Bacteria | 2625 |
| 658 | Ga0495592_0087806 | 3300046454 | Bacteria | 2236 |
| 659 | Ga0495592_0271095 | 3300046454 | Bacteria | 1113 |
| 660 | Ga0495603_0002120 | 3300046455 | Bacteria | 11667 |
| 661 | Ga0495603_0032062 | 3300046455 | Bacteria | 3162 |
| 662 | Ga0495603_0213558 | 3300046455 | Bacteria | 1114 |
| 663 | Ga0495629_0028450 | 3300046459 | Bacteria | 3968 |
| 664 | Ga0495629_0347375 | 3300046459 | Bacteria | 1012 |
| 665 | Ga0495638_0070984 | 3300046460 | Bacteria | 2131 |
| 666 | Ga0495641_0007385 | 3300046461 | Bacteria | 6872 |
| 667 | Ga0495641_0039035 | 3300046461 | Bacteria | 2216 |
| 668 | Ga0495651_0039225 | 3300046462 | Bacteria | 3688 |
| 669 | Ga0495651_0263127 | 3300046462 | Bacteria | 1173 |
| 670 | Ga0495651_0345340 | 3300046462 | Bacteria | 985 |
| 671 | Ga0495653_0239695 | 3300046463 | Bacteria | 1209 |
| 672 | Ga0495580_0003959 | 3300046472 | Bacteria | 12499 |
| 673 | Ga0495580_0009907 | 3300046472 | Bacteria | 7462 |
| 674 | Ga0495582_0042490 | 3300046473 | Bacteria | 2503 |
| 675 | Ga0495582_0042567 | 3300046473 | Bacteria | 2501 |
| 676 | Ga0495605_0037180 | 3300046474 | Bacteria | 2450 |
| 677 | Ga0495639_0005482 | 3300046475 | Bacteria | 5464 |
| 678 | Ga0495639_0013227 | 3300046475 | Bacteria | 3560 |
| 679 | Ga0495639_0091589 | 3300046475 | Bacteria | 1427 |
| 680 | Ga0495639_0120473 | 3300046475 | Bacteria | 1251 |
| 681 | Ga0495662_0013806 | 3300046476 | Bacteria | 3931 |
| 682 | Ga0495662_0037638 | 3300046476 | Bacteria | 2337 |
| 683 | Ga0495662_0105860 | 3300046476 | Bacteria | 1377 |
| 684 | Ga0495664_0014279 | 3300046477 | Bacteria | 4499 |
| 685 | Ga0495664_0371602 | 3300046477 | Bacteria | 860 |
| 686 | Ga0495584_0037918 | 3300046491 | Bacteria | 2436 |
| 687 | Ga0495584_0044896 | 3300046491 | Bacteria | 2229 |
| 688 | Ga0495585_0002513 | 3300046492 | Bacteria | 13053 |
| 689 | Ga0495585_0004560 | 3300046492 | Bacteria | 8960 |
| 690 | Ga0495585_0011666 | 3300046492 | Bacteria | 5197 |
| 691 | Ga0495585_0015720 | 3300046492 | Bacteria | 4394 |
| 692 | Ga0495585_0119734 | 3300046492 | Bacteria | 1393 |
| 693 | Ga0495594_0004261 | 3300046499 | Bacteria | 7347 |
| 694 | Ga0495594_0005584 | 3300046499 | Bacteria | 6461 |
| 695 | Ga0495596_0000725 | 3300046500 | Bacteria | 20344 |
| 696 | Ga0495596_0005830 | 3300046500 | Bacteria | 5765 |
| 697 | Ga0495607_0149181 | 3300046501 | Bacteria | 1198 |
| 698 | Ga0495583_0070501 | 3300046506 | Bacteria | 1537 |
| 699 | Ga0495606_0030193 | 3300046507 | Bacteria | 3790 |
| 700 | Ga0495606_0040879 | 3300046507 | Bacteria | 3112 |
| 701 | Ga0495606_0122852 | 3300046507 | Bacteria | 1552 |
| 702 | Ga0495606_0162507 | 3300046507 | Bacteria | 1302 |
| 703 | Ga0495608_0005257 | 3300046511 | Bacteria | 9249 |
| 704 | Ga0495608_0079113 | 3300046511 | Bacteria | 2138 |
| 705 | Ga0495616_0010910 | 3300046513 | Bacteria | 5232 |
| 706 | Ga0495616_0070998 | 3300046513 | Bacteria | 1684 |
| 707 | Ga0495618_0005438 | 3300046514 | Bacteria | 7766 |
| 708 | Ga0495618_0242167 | 3300046514 | Bacteria | 1133 |
| 709 | Ga0495628_0182718 | 3300046516 | Bacteria | 1585 |
| 710 | Ga0495630_0010111 | 3300046517 | Bacteria | 6800 |
| 711 | Ga0495630_0057069 | 3300046517 | Bacteria | 2926 |
| 712 | Ga0495630_0102738 | 3300046517 | Bacteria | 2163 |
| 713 | Ga0495630_0460467 | 3300046517 | Bacteria | 974 |
| 714 | Ga0495631_0015577 | 3300046518 | Bacteria | 3639 |
| 715 | Ga0495631_0028601 | 3300046518 | Bacteria | 2542 |
| 716 | Ga0495631_0038811 | 3300046518 | Bacteria | 2116 |
| 717 | Ga0495631_0102609 | 3300046518 | Bacteria | 1230 |
| 718 | Ga0495643_0006775 | 3300046522 | Bacteria | 7491 |
| 719 | Ga0495643_0037391 | 3300046522 | Bacteria | 2662 |
| 720 | Ga0495643_0050971 | 3300046522 | Bacteria | 2227 |
| 721 | Ga0495643_0053968 | 3300046522 | Bacteria | 2153 |
| 722 | Ga0495644_0008725 | 3300046523 | Bacteria | 3900 |
| 723 | Ga0495663_0002535 | 3300046525 | Bacteria | 5471 |
| 724 | Ga0495666_0001518 | 3300046526 | Bacteria | 11355 |
| 725 | Ga0495666_0002022 | 3300046526 | Bacteria | 10035 |
| 726 | Ga0495666_0020114 | 3300046526 | Bacteria | 3311 |
| 727 | Ga0495642_0023069 | 3300046528 | Bacteria | 2455 |
| 728 | Ga0495642_0045824 | 3300046528 | Bacteria | 1787 |
| 729 | Ga0495652_0017487 | 3300046529 | Bacteria | 6398 |
| 730 | Ga0495652_0033738 | 3300046529 | Bacteria | 4465 |
| 731 | Ga0495652_0077503 | 3300046529 | Bacteria | 2755 |
| 732 | Ga0495652_0090879 | 3300046529 | Bacteria | 2497 |
| 733 | Ga0495665_0005227 | 3300046531 | Bacteria | 6994 |
| 734 | Ga0495665_0006107 | 3300046531 | Bacteria | 6501 |
| 735 | Ga0495665_0006841 | 3300046531 | Bacteria | 6151 |
| 736 | Ga0495665_0043326 | 3300046531 | Bacteria | 2394 |
| 737 | Ga0495665_0139093 | 3300046531 | Bacteria | 1269 |
| 738 | Ga0495640_0015851 | 3300046533 | Bacteria | 5656 |
| 739 | Ga0495640_0018853 | 3300046533 | Bacteria | 5106 |
| 740 | Ga0495640_0122334 | 3300046533 | Bacteria | 1690 |
| 741 | Ga0495640_0127368 | 3300046533 | Bacteria | 1650 |
| 742 | Ga0495586_0009251 | 3300046535 | Bacteria | 5238 |
| 743 | Ga0495586_0104407 | 3300046535 | Bacteria | 1574 |
| 744 | Ga0495586_0203981 | 3300046535 | Bacteria | 1121 |
| 745 | Ga0495586_0265845 | 3300046535 | Bacteria | 980 |
| 746 | Ga0495587_0007029 | 3300046536 | Bacteria | 7306 |
| 747 | Ga0495587_0047153 | 3300046536 | Bacteria | 2555 |
| 748 | Ga0495587_0064705 | 3300046536 | Bacteria | 2136 |
| 749 | Ga0495609_0006145 | 3300046538 | Bacteria | 6176 |
| 750 | Ga0495609_0008759 | 3300046538 | Bacteria | 4927 |
| 751 | Ga0495597_0000058 | 3300046542 | Bacteria | 92755 |
| 752 | Ga0495597_0002251 | 3300046542 | Bacteria | 12572 |
| 753 | Ga0495597_0013010 | 3300046542 | Bacteria | 3996 |
| 754 | Ga0495597_0018701 | 3300046542 | Bacteria | 3248 |
| 755 | Ga0495597_0158073 | 3300046542 | Bacteria | 926 |
| 756 | Ga0495645_0032777 | 3300046543 | Bacteria | 3790 |
| 757 | Ga0495645_0353151 | 3300046543 | Bacteria | 947 |
| 758 | Ga0495622_0059645 | 3300046557 | Bacteria | 1766 |
| 759 | Ga0495633_0002296 | 3300046558 | Bacteria | 13647 |
| 760 | Ga0495633_0008149 | 3300046558 | Bacteria | 5940 |
| 761 | Ga0495667_0036095 | 3300046559 | Bacteria | 3301 |
| 762 | Ga0495667_0043333 | 3300046559 | Bacteria | 2982 |
| 763 | Ga0495667_0047488 | 3300046559 | Bacteria | 2837 |
| 764 | Ga0495667_0051910 | 3300046559 | Bacteria | 2704 |
| 765 | Ga0495667_0094403 | 3300046559 | Bacteria | 1937 |
| 766 | Ga0495656_0011057 | 3300046615 | Bacteria | 3303 |
| 767 | Ga0495656_0023005 | 3300046615 | Bacteria | 2447 |
| 768 | Ga0495656_0223711 | 3300046615 | Bacteria | 942 |
| 769 | Ga0495668_0003141 | 3300046616 | Bacteria | 12745 |
| 770 | Ga0495668_0022402 | 3300046616 | Bacteria | 3611 |
| 771 | Ga0495634_0013822 | 3300046642 | Bacteria | 5830 |
| 772 | Ga0495611_0004816 | 3300046648 | Bacteria | 5801 |
| 773 | Ga0495611_0011275 | 3300046648 | Bacteria | 3790 |
| 774 | Ga0495611_0059918 | 3300046648 | Bacteria | 1728 |
| 775 | Ga0495611_0107985 | 3300046648 | Bacteria | 1294 |
| 776 | Ga0495625_0008414 | 3300046660 | Bacteria | 8809 |
| 777 | Ga0495625_0048668 | 3300046660 | Bacteria | 3051 |
| 778 | Ga0495625_0053899 | 3300046660 | Bacteria | 2874 |
| 779 | Ga0495635_0020635 | 3300046663 | Bacteria | 4589 |
| 780 | Ga0495635_0093662 | 3300046663 | Bacteria | 2054 |
| 781 | Ga0495661_0001133 | 3300046665 | Bacteria | 23317 |
| 782 | Ga0495661_0041590 | 3300046665 | Bacteria | 2841 |
| 783 | Ga0495661_0081858 | 3300046665 | Bacteria | 1860 |
| 784 | Ga0495661_0099913 | 3300046665 | Bacteria | 1635 |
| 785 | Ga0495588_0001371 | 3300046674 | Bacteria | 10399 |
| 786 | Ga0495588_0015587 | 3300046674 | Bacteria | 3662 |
| 787 | Ga0495588_0028761 | 3300046674 | Bacteria | 2784 |
| 788 | Ga0495588_0062535 | 3300046674 | Bacteria | 1929 |
| 789 | Ga0495657_0014095 | 3300046675 | Bacteria | 5874 |
| 790 | Ga0495657_0102665 | 3300046675 | Bacteria | 1820 |
| 791 | Ga0495599_0033578 | 3300046678 | Bacteria | 3224 |
| 792 | Ga0495623_0005106 | 3300046679 | Bacteria | 8613 |
| 793 | Ga0495623_0055757 | 3300046679 | Bacteria | 2490 |
| 794 | Ga0495623_0071810 | 3300046679 | Bacteria | 2153 |
| 795 | Ga0495623_0152540 | 3300046679 | Bacteria | 1364 |
| 796 | Ga0495646_0005675 | 3300046680 | Bacteria | 7904 |
| 797 | Ga0495647_0000366 | 3300046681 | Bacteria | 12759 |
| 798 | Ga0495647_0007546 | 3300046681 | Bacteria | 3649 |
| 799 | Ga0495647_0041268 | 3300046681 | Bacteria | 1757 |
| 800 | Ga0495658_0012989 | 3300046683 | Bacteria | 4231 |
| 801 | Ga0495658_0013544 | 3300046683 | Bacteria | 4152 |
| 802 | Ga0495669_0002192 | 3300046684 | Bacteria | 8013 |
| 803 | Ga0495613_0037522 | 3300046689 | Bacteria | 3592 |
| 804 | Ga0495613_0039866 | 3300046689 | Bacteria | 3480 |
| 805 | Ga0495613_0154951 | 3300046689 | Bacteria | 1632 |
| 806 | Ga0495624_0035748 | 3300046690 | Bacteria | 3206 |
| 807 | Ga0495624_0044725 | 3300046690 | Bacteria | 2822 |
| 808 | Ga0495624_0226040 | 3300046690 | Bacteria | 1134 |
| 809 | Ga0495670_0012358 | 3300046691 | Bacteria | 4197 |
| 810 | Ga0495670_0042348 | 3300046691 | Bacteria | 2271 |
| 811 | Ga0495671_0008704 | 3300046692 | Bacteria | 5700 |
| 812 | Ga0495649_0165231 | 3300046694 | Bacteria | 1160 |
| 813 | Ga0495589_0000279 | 3300046794 | Bacteria | 41593 |
| 814 | Ga0495589_0017392 | 3300046794 | Bacteria | 3690 |
| 815 | Ga0495589_0091023 | 3300046794 | Bacteria | 1481 |
| 816 | Ga0495600_0016670 | 3300046809 | Bacteria | 4668 |
| 817 | Ga0495600_0020538 | 3300046809 | Bacteria | 4222 |
| 818 | Ga0495600_0078759 | 3300046809 | Bacteria | 2152 |
| 819 | Ga0495600_0109842 | 3300046809 | Bacteria | 1796 |
| 820 | Ga0495660_0068218 | 3300046810 | Bacteria | 1893 |
| 821 | Ga0495581_0004719 | 3300047315 | Bacteria | 7869 |
| 822 | Ga0495581_0013334 | 3300047315 | Bacteria | 4765 |
| 823 | Ga0495581_0032969 | 3300047315 | Bacteria | 2998 |
| 824 | Ga0495581_0110702 | 3300047315 | Bacteria | 1597 |
| 825 | Ga0495604_0013505 | 3300047317 | Bacteria | 6509 |
| 826 | Ga0495604_0034648 | 3300047317 | Bacteria | 3993 |
| 827 | Ga0495604_0082229 | 3300047317 | Bacteria | 2409 |
| 828 | Ga0495604_0112622 | 3300047317 | Bacteria | 1982 |
| 829 | Ga0495604_0197199 | 3300047317 | Bacteria | 1399 |
| 830 | Ga0495636_0058651 | 3300047318 | Bacteria | 1623 |
| 831 | Ga0495674_0003459 | 3300047319 | Bacteria | 15337 |
| 832 | Ga0495674_0009068 | 3300047319 | Bacteria | 9449 |
| 833 | Ga0495674_0024579 | 3300047319 | Bacteria | 5533 |
| 834 | Ga0495674_0031967 | 3300047319 | Bacteria | 4776 |
| 835 | Ga0495674_0185968 | 3300047319 | Bacteria | 1728 |
| 836 | Ga0495674_0394471 | 3300047319 | Bacteria | 1118 |
| 837 | Ga0495676_0002390 | 3300047321 | Bacteria | 16661 |
| 838 | Ga0495676_0050952 | 3300047321 | Bacteria | 3316 |
| 839 | Ga0495676_0085727 | 3300047321 | Bacteria | 2372 |
| 840 | Ga0495676_0131696 | 3300047321 | Bacteria | 1804 |
| 841 | Ga0495680_0010478 | 3300047322 | Bacteria | 8272 |
| 842 | Ga0495680_0024734 | 3300047322 | Bacteria | 4977 |
| 843 | Ga0495680_0037459 | 3300047322 | Bacteria | 3884 |
| 844 | Ga0495687_000060 | 3300047443 | Bacteria | 179124 |
| 845 | Ga0495677_0005252 | 3300047445 | Bacteria | 4923 |
| 846 | Ga0495677_0005699 | 3300047445 | Bacteria | 4721 |
| 847 | Ga0495677_0006968 | 3300047445 | Bacteria | 4244 |
| 848 | Ga0495677_0008099 | 3300047445 | Bacteria | 3902 |
| 849 | Ga0495677_0012260 | 3300047445 | Bacteria | 3128 |
| 850 | Ga0495677_0111877 | 3300047445 | Bacteria | 1038 |
| 851 | Ga0495679_000245 | 3300047446 | Bacteria | 45040 |
| 852 | Ga0495685_105641 | 3300047447 | Bacteria | 928 |
| 853 | Ga0495673_0026450 | 3300047469 | Bacteria | 2774 |
| 854 | Ga0495681_0000005 | 3300047470 | Bacteria | 225279 |
| 855 | Ga0495681_0001849 | 3300047470 | Bacteria | 15555 |
| 856 | Ga0495681_0013289 | 3300047470 | Bacteria | 4785 |
| 857 | Ga0495681_0053533 | 3300047470 | Bacteria | 1889 |
| 858 | Ga0495684_0014883 | 3300047471 | Bacteria | 5990 |
| 859 | Ga0495684_0029390 | 3300047471 | Bacteria | 4218 |
| 860 | Ga0495684_0067413 | 3300047471 | Bacteria | 2722 |
| 861 | Ga0495684_0368976 | 3300047471 | Bacteria | 1015 |
| 862 | Ga0495684_0414371 | 3300047471 | Bacteria | 943 |
| 863 | Ga0495593_0007872 | 3300047673 | Bacteria | 6205 |
| 864 | Ga0495593_0012345 | 3300047673 | Bacteria | 4882 |
| 865 | Ga0495593_0076455 | 3300047673 | Bacteria | 1735 |
| 866 | Ga0495593_0105940 | 3300047673 | Bacteria | 1438 |
| 867 | Ga0495602_0032879 | 3300048088 | Bacteria | 4876 |
| 868 | Ga0495602_0055778 | 3300048088 | Bacteria | 3478 |
| 869 | Ga0495602_0067798 | 3300048088 | Bacteria | 3067 |
| 870 | Ga0495614_0072221 | 3300048089 | Bacteria | 1488 |
| 871 | Ga0495626_0002382 | 3300048091 | Bacteria | 13128 |
| 872 | Ga0495626_0003494 | 3300048091 | Bacteria | 10062 |
| 873 | Ga0495626_0006344 | 3300048091 | Bacteria | 6743 |
| 874 | Ga0495626_0018297 | 3300048091 | Bacteria | 3521 |
| 875 | Ga0496100_0046500 | 3300048903 | Bacteria | 2791 |
| 876 | Ga0496100_0265885 | 3300048903 | Bacteria | 1273 |
| 877 | Ga0496101_0184813 | 3300048904 | Bacteria | 1606 |
| 878 | Ga0496102_0074143 | 3300048905 | Bacteria | 3128 |
| 879 | Ga0496102_0190170 | 3300048905 | Bacteria | 1934 |
| 880 | Ga0496102_0205984 | 3300048905 | Bacteria | 1854 |
| 881 | Ga0496102_0282935 | 3300048905 | Bacteria | 1563 |
| 882 | Ga0496104_0092523 | 3300048907 | Bacteria | 2891 |
| 883 | Ga0496104_0265494 | 3300048907 | Bacteria | 1629 |
| 884 | Ga0496105_0107466 | 3300048908 | Bacteria | 2303 |
| 885 | Ga0496105_0154395 | 3300048908 | Bacteria | 1886 |
| 886 | Ga0496105_0174991 | 3300048908 | Bacteria | 1758 |
| 887 | Ga0496105_0220273 | 3300048908 | Bacteria | 1545 |
| 888 | Ga0496106_0000334 | 3300048909 | Bacteria | 33088 |
| 889 | Ga0496106_0025576 | 3300048909 | Bacteria | 4394 |
| 890 | Ga0496107_0274654 | 3300048910 | Bacteria | 1254 |
| 891 | Ga0496108_0016826 | 3300048911 | Bacteria | 5974 |
| 892 | Ga0496108_0061883 | 3300048911 | Bacteria | 3151 |
| 893 | Ga0496109_0001151 | 3300048912 | Bacteria | 22020 |
| 894 | Ga0496109_0024259 | 3300048912 | Bacteria | 5390 |
| 895 | Ga0496109_0040815 | 3300048912 | Bacteria | 4203 |
| 896 | Ga0496109_0175158 | 3300048912 | Bacteria | 2013 |
| 897 | Ga0496109_0331946 | 3300048912 | Bacteria | 1436 |
| 898 | Ga0496110_0003520 | 3300048913 | Bacteria | 12018 |
| 899 | Ga0496110_0007807 | 3300048913 | Bacteria | 8574 |
| 900 | Ga0496110_0073717 | 3300048913 | Bacteria | 3029 |
| 901 | Ga0496110_0094133 | 3300048913 | Bacteria | 2682 |
| 902 | Ga0496111_0008589 | 3300048914 | Bacteria | 6770 |
| 903 | Ga0496111_0222714 | 3300048914 | Bacteria | 1401 |
| 904 | Ga0496111_0230298 | 3300048914 | Bacteria | 1376 |
| 905 | Ga0496112_0000056 | 3300048915 | Bacteria | 77708 |
| 906 | Ga0496112_0087561 | 3300048915 | Bacteria | 3081 |
| 907 | Ga0496113_0006169 | 3300048916 | Bacteria | 7566 |
| 908 | Ga0496113_0046532 | 3300048916 | Bacteria | 3221 |
| 909 | Ga0496113_0092982 | 3300048916 | Bacteria | 2327 |
| 910 | Ga0496114_0163735 | 3300048917 | Bacteria | 1935 |
| 911 | Ga0496114_0272877 | 3300048917 | Bacteria | 1490 |
| 912 | Ga0496115_0004072 | 3300048918 | Bacteria | 10561 |
| 913 | Ga0496115_0016507 | 3300048918 | Bacteria | 5624 |
| 914 | Ga0496115_0026242 | 3300048918 | Bacteria | 4545 |
| 915 | Ga0496115_0040003 | 3300048918 | Bacteria | 3725 |
| 916 | Ga0496115_0216938 | 3300048918 | Bacteria | 1579 |
| 917 | Ga0496116_0018358 | 3300048919 | Bacteria | 5395 |
| 918 | Ga0496117_0093573 | 3300048920 | Bacteria | 1927 |
| 919 | Ga0496121_0003905 | 3300048924 | Bacteria | 20690 |
| 920 | Ga0496121_0019368 | 3300048924 | Bacteria | 6807 |
| 921 | Ga0496121_0109380 | 3300048924 | Bacteria | 2112 |
| 922 | Ga0496126_0000389 | 3300048929 | Bacteria | 90452 |
| 923 | Ga0496126_0040718 | 3300048929 | Bacteria | 4306 |
| 924 | Ga0496126_0111517 | 3300048929 | Bacteria | 2382 |
| 925 | Ga0495682_0008457 | 3300049460 | Bacteria | 4053 |
| 926 | Ga0501033_0076444 | 3300049570 | Bacteria | 2458 |
| 927 | Ga0501036_0070317 | 3300049572 | Bacteria | 2959 |
| 928 | Ga0501037_0218401 | 3300049573 | Bacteria | 1342 |
| 929 | Ga0501038_0100272 | 3300049574 | Bacteria | 2413 |
| 930 | Ga0501038_0139641 | 3300049574 | Bacteria | 1983 |
| 931 | Ga0501040_0009843 | 3300049576 | Bacteria | 6242 |
| 932 | Ga0501041_0009596 | 3300049577 | Bacteria | 5706 |
| 933 | Ga0501042_0109459 | 3300049578 | Bacteria | 1989 |
| 934 | Ga0501043_0014233 | 3300049579 | Bacteria | 6225 |
| 935 | Ga0501043_0029694 | 3300049579 | Bacteria | 4296 |
| 936 | Ga0501043_0033878 | 3300049579 | Bacteria | 4018 |
| 937 | Ga0501048_0050203 | 3300049582 | Bacteria | 2971 |
| 938 | Ga0501048_0322358 | 3300049582 | Bacteria | 1101 |
| 939 | Ga0501068_0039499 | 3300049584 | Bacteria | 2830 |
| 940 | Ga0501068_0191631 | 3300049584 | Bacteria | 1295 |
| 941 | Ga0501070_0020640 | 3300049586 | Bacteria | 5525 |
| 942 | Ga0501071_0000963 | 3300049587 | Bacteria | 15696 |
| 943 | Ga0501071_0110069 | 3300049587 | Bacteria | 2035 |
| 944 | Ga0501072_0143487 | 3300049588 | Bacteria | 1904 |
| 945 | Ga0501072_0143624 | 3300049588 | Bacteria | 1903 |
| 946 | Ga0501073_0027634 | 3300049589 | Bacteria | 4056 |
| 947 | Ga0501073_0165582 | 3300049589 | Bacteria | 1531 |
| 948 | Ga0501075_0001532 | 3300049591 | Bacteria | 15066 |
| 949 | Ga0501076_0006596 | 3300049592 | Bacteria | 8417 |
| 950 | Ga0501077_0075393 | 3300049593 | Bacteria | 2136 |
| 951 | Ga0501079_0007208 | 3300049741 | Bacteria | 8395 |
| 952 | Ga0501080_0013792 | 3300049742 | Bacteria | 7440 |
| 953 | Ga0501080_0020498 | 3300049742 | Bacteria | 6121 |
| 954 | Ga0501080_0306238 | 3300049742 | Bacteria | 1440 |
| 955 | Ga0501081_0001634 | 3300049743 | Bacteria | 13870 |
| 956 | Ga0501083_0006483 | 3300049744 | Bacteria | 8302 |
| 957 | Ga0501083_0030444 | 3300049744 | Bacteria | 3708 |
| 958 | Ga0501035_0008112 | 3300049822 | Bacteria | 9788 |
| 959 | Ga0501035_0047960 | 3300049822 | Bacteria | 3832 |
| 960 | Ga0501035_0048822 | 3300049822 | Bacteria | 3794 |
| 961 | Ga0501044_0319055 | 3300049823 | Bacteria | 1479 |
| 962 | Ga0501044_0575981 | 3300049823 | Bacteria | 1021 |
| 963 | Ga0501045_0018938 | 3300049824 | Bacteria | 4901 |
| 964 | nmdc:mga00v17_12438_c1 | 3300050491 | Bacteria | 4697 |
| 965 | nmdc:mga0yw44_2270_c1 | 3300050492 | Bacteria | 8105 |
| 966 | nmdc:mga06z11_1542_c1 | 3300050494 | Bacteria | 8556 |
| 967 | nmdc:mga06z11_448_c1 | 3300050494 | Bacteria | 15394 |
| 968 | nmdc:mga06z11_47888_c1 | 3300050494 | Bacteria | 2173 |
| 969 | nmdc:mga06z11_91325_c1 | 3300050494 | Bacteria | 1653 |
| 970 | nmdc:mga04h51_20951_c1 | 3300050495 | Bacteria | 1961 |
| 971 | nmdc:mga05p37_117581_c1 | 3300050507 | Bacteria | 3267 |
| 972 | nmdc:mga05p37_126546_c1 | 3300050507 | Bacteria | 3138 |
| 973 | nmdc:mga05p37_682941_c1 | 3300050507 | Bacteria | 1144 |
| 974 | nmdc:mga05p37_69148_c1 | 3300050507 | Bacteria | 4343 |
| 975 | nmdc:mga05p37_732390_c1 | 3300050507 | Bacteria | 1093 |
| 976 | nmdc:mga05p37_90127_c1 | 3300050507 | Bacteria | 3779 |
| 977 | nmdc:mga09592_174763_c1 | 3300050508 | Bacteria | 1858 |
| 978 | nmdc:mga09592_211830_c1 | 3300050508 | Bacteria | 1679 |
| 979 | nmdc:mga09592_411054_c1 | 3300050508 | Bacteria | 1169 |
| 980 | nmdc:mga0qj67_59015_c1 | 3300050509 | Bacteria | 3042 |
| 981 | nmdc:mga06r32_223134_c1 | 3300050510 | Bacteria | 1873 |
| 982 | nmdc:mga06r32_22383_c1 | 3300050510 | Bacteria | 5843 |
| 983 | nmdc:mga06r32_285141_c1 | 3300050510 | Bacteria | 1638 |
| 984 | nmdc:mga06r32_65558_c1 | 3300050510 | Bacteria | 3503 |
| 985 | nmdc:mga08y16_236049_c1 | 3300050511 | Bacteria | 1891 |
| 986 | nmdc:mga08y16_28683_c1 | 3300050511 | Bacteria | 5866 |
| 987 | nmdc:mga08y16_42416_c1 | 3300050511 | Bacteria | 4766 |
| 988 | nmdc:mga08y16_64466_c1 | 3300050511 | Bacteria | 3826 |
| 989 | nmdc:mga08y16_71366_c1 | 3300050511 | Bacteria | 3619 |
| 990 | nmdc:mga08y16_96471_c1 | 3300050511 | Bacteria | 3079 |
| 991 | nmdc:mga0n895_104186_c1 | 3300050512 | Bacteria | 2849 |
| 992 | nmdc:mga0n895_119154_c1 | 3300050512 | Bacteria | 2660 |
| 993 | nmdc:mga0n895_137345_c1 | 3300050512 | Bacteria | 2472 |
| 994 | nmdc:mga0n895_170507_c1 | 3300050512 | Bacteria | 2208 |
| 995 | nmdc:mga0n895_333288_c1 | 3300050512 | Bacteria | 1537 |
| 996 | nmdc:mga0n895_643930_c1 | 3300050512 | Bacteria | 1059 |
| 997 | nmdc:mga0n895_80144_c1 | 3300050512 | Bacteria | 3252 |
| 998 | nmdc:mga0a205_110634_c1 | 3300050515 | Bacteria | 2646 |
| 999 | nmdc:mga0a205_26394_c1 | 3300050515 | Bacteria | 5538 |
| 1000 | nmdc:mga0a205_26480_c1 | 3300050515 | Bacteria | 5531 |
| 1001 | Ga0495601_0005200 | 3300053077 | Bacteria | 7565 |
| 1002 | Ga0495601_0006604 | 3300053077 | Bacteria | 6784 |
| 1003 | Ga0495601_0014349 | 3300053077 | Bacteria | 4772 |
| 1004 | Ga0495601_0015883 | 3300053077 | Bacteria | 4555 |
| 1005 | Ga0495601_0069755 | 3300053077 | Bacteria | 2242 |
| 1006 | Ga0495601_0091260 | 3300053077 | Bacteria | 1961 |
| 1007 | Ga0495601_0134599 | 3300053077 | Bacteria | 1611 |
| 1008 | Ga0495612_0000947 | 3300053078 | Bacteria | 11920 |
| 1009 | Ga0495612_0001950 | 3300053078 | Bacteria | 8495 |
| 1010 | Ga0495612_0003437 | 3300053078 | Bacteria | 6567 |
| 1011 | Ga0495612_0015777 | 3300053078 | Bacteria | 3028 |
| 1012 | Ga0495612_0048531 | 3300053078 | Bacteria | 1740 |
| 1013 | Ga0495595_0002199 | 3300053084 | Bacteria | 7578 |
| 1014 | Ga0495595_0022163 | 3300053084 | Bacteria | 2785 |
| 1015 | Ga0495619_0002353 | 3300053085 | Bacteria | 12446 |
| 1016 | Ga0495619_0002916 | 3300053085 | Bacteria | 11113 |
| 1017 | Ga0495619_0004106 | 3300053085 | Bacteria | 9320 |
| 1018 | Ga0495619_0008234 | 3300053085 | Bacteria | 6597 |
| 1019 | Ga0495619_0009809 | 3300053085 | Bacteria | 6036 |
| 1020 | Ga0500643_002652 | 3300053087 | Bacteria | 9031 |
| 1021 | Ga0500644_0000643 | 3300053088 | Bacteria | 12979 |
| 1022 | Ga0500651_0020019 | 3300053093 | Bacteria | 4165 |
| 1023 | Ga0500566_0066615 | 3300053094 | Bacteria | 2029 |
| 1024 | Ga0500595_000394 | 3300053119 | Bacteria | 28047 |
| 1025 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1026 | Ga0500645_000763 | 3300053730 | Bacteria | 19642 |
| 1027 | Ga0501084_0001783 | 3300054114 | Bacteria | 17125 |
| 1028 | Ga0501084_0167818 | 3300054114 | Bacteria | 1853 |
| 1029 | Ga0501082_0006541 | 3300060353 | Bacteria | 10104 |
| 1030 | Ga0501082_0059829 | 3300060353 | Bacteria | 3283 |
| 1031 | Ga0530510_0001881 | 3300061734 | Bacteria | 14322 |
| 1032 | 2512345953 | 2512047030 | Bacteria | 9031815 |
| 1033 | 2524468590 | 2524023210 | Bacteria | 9029266 |
| 1034 | 2528856387 | 2528768022 | Bacteria | 10457665 |
| 1035 | 2597030394 | 2596583598 | Bacteria | 5251611 |
| 1036 | 2644290189 | 2643221651 | Bacteria | 4798932 |
| 1037 | 2723876944 | 2721755763 | Bacteria | 4464185 |
| 1038 | 2738745970 | 2738541281 | Bacteria | 5112672 |
| 1039 | 2739355200 | 2738543032 | Bacteria | 5115625 |
| 1040 | 2792839423 | 2791355137 | Bacteria | 9654227 |
| 1041 | 2824603102 | 2824600985 | Bacteria | 8488197 |
| 1042 | 2824615685 | 2824609381 | Bacteria | 8672835 |
| 1043 | 2824659611 | 2824653114 | Bacteria | 8493680 |
| 1044 | 2829749656 | 2829745981 | Bacteria | 5406054 |
| 1045 | 2885266671 | 2885266251 | Bacteria | 4796748 |
| 1046 | 2887377033 | 2887375801 | Bacteria | 5334027 |
| 1047 | 2900579126 | 2900577576 | Bacteria | 5438534 |
| 1048 | 2904621605 | 2904615490 | Bacteria | 10047340 |
| 1049 | 2928059451 | 2928058823 | Bacteria | 5520022 |
| 1050 | 2935690933 | 2935684952 | Bacteria | 9590419 |
| 1051 | 2935718314 | 2935713505 | Bacteria | 9608509 |
| 1052 | 2935727706 | 2935722832 | Bacteria | 9608746 |
| 1053 | 2935736409 | 2935732158 | Bacteria | 9706831 |
| 1054 | 2935745789 | 2935741537 | Bacteria | 9707219 |
| 1055 | 2935756170 | 2935750917 | Bacteria | 9590372 |
| 1056 | 2940561855 | 2940556831 | Bacteria | 9590747 |
| 1057 | Ga0501035_0317379 | |||
| 1058 | JGI24741J21665_1000130 | |||
| 1059 | JGI24746J21847_1019481 | |||
| 1060 | JGI24740J21852_10000362 | |||
| 1061 | JGI24740J21852_10017815 | |||
| 1062 | JGI24744J21845_10010999 | |||
| 1063 | JGI24033J26618_1016338 | |||
| 1064 | JGI24034J26672_10020808 | |||
| 1065 | JGI24742J22300_10012193 | |||
| 1066 | JGI25156J39149_1008023 | |||
| 1067 | JGI25154J39366_1000523 | |||
| 1068 | JGI25404J52841_10009902 | |||
| 1069 | Ga0055538_1004882 | |||
| 1070 | Ga0055539_1000059 | |||
| 1071 | Ga0055533_1000764 | |||
| 1072 | Ga0055533_1008780 | |||
| 1073 | Ga0055532_1000025 | |||
| 1074 | Ga0055525_1000447 | |||
| 1075 | Ga0055527_1005432 | |||
| 1076 | Ga0055535_1000019 | |||
| 1077 | Ga0055542_1000767 | |||
| 1078 | Ga0055529_1000035 | |||
| 1079 | Ga0065712_10014003 | |||
| 1080 | Ga0065715_10217703 | |||
| 1081 | Ga0070658_10035088 | |||
| 1082 | Ga0070658_10409143 | |||
| 1083 | Ga0070676_10020503 | |||
| 1084 | Ga0070683_100005780 | |||
| 1085 | Ga0070683_100011116 | |||
| 1086 | Ga0070683_100039545 | |||
| 1087 | Ga0070683_100039574 | |||
| 1088 | Ga0070683_100059808 | |||
| 1089 | Ga0070683_100097023 | |||
| 1090 | Ga0070690_100043239 | |||
| 1091 | Ga0070670_100049495 | |||
| 1092 | Ga0070670_100770835 | |||
| 1093 | Ga0070677_10041601 | |||
| 1094 | Ga0068869_100035037 | |||
| 1095 | Ga0068869_100349140 | |||
| 1096 | Ga0070666_10015360 | |||
| 1097 | Ga0070666_10137360 | |||
| 1098 | Ga0070666_10157018 | |||
| 1099 | Ga0070666_10535555 | |||
| 1100 | Ga0070680_100006745 | |||
| 1101 | Ga0070680_100035933 | |||
| 1102 | Ga0070680_100050340 | |||
| 1103 | Ga0068868_100037068 | |||
| 1104 | Ga0068868_100467467 | |||
| 1105 | Ga0070660_100037989 | |||
| 1106 | Ga0070660_100074617 | |||
| 1107 | Ga0070660_100124409 | |||
| 1108 | Ga0070660_100137792 | |||
| 1109 | Ga0070660_100156577 | |||
| 1110 | Ga0070660_100513244 | |||
| 1111 | Ga0070689_100015635 | |||
| 1112 | Ga0070691_10000207 | |||
| 1113 | Ga0070691_10022510 | |||
| 1114 | Ga0070691_10048094 | |||
| 1115 | Ga0070691_10076624 | |||
| 1116 | Ga0070687_100002662 | |||
| 1117 | Ga0070661_100000047 | |||
| 1118 | Ga0070668_100110962 | |||
| 1119 | Ga0070668_100135462 | |||
| 1120 | Ga0070669_100086821 | |||
| 1121 | Ga0070669_100140454 | |||
| 1122 | Ga0070671_100016683 | |||
| 1123 | Ga0070671_100041316 | |||
| 1124 | Ga0070674_100191035 | |||
| 1125 | Ga0070673_100035884 | |||
| 1126 | Ga0070673_100092996 | |||
| 1127 | Ga0070673_100126106 | |||
| 1128 | Ga0070673_100797219 | |||
| 1129 | Ga0070688_100002890 | |||
| 1130 | Ga0070688_100091852 | |||
| 1131 | Ga0070688_100100226 | |||
| 1132 | Ga0070659_100000219 | |||
| 1133 | Ga0070659_100020638 | |||
| 1134 | Ga0070659_100032599 | |||
| 1135 | Ga0070659_100075896 | |||
| 1136 | Ga0070659_100093716 | |||
| 1137 | Ga0070709_10035408 | |||
| 1138 | Ga0070709_10057685 | |||
| 1139 | Ga0070709_10132873 | |||
| 1140 | Ga0070714_100204815 | |||
| 1141 | Ga0070714_100264368 | |||
| 1142 | Ga0070714_100316914 | |||
| 1143 | Ga0070713_100000296 | |||
| 1144 | Ga0070713_100000609 | |||
| 1145 | Ga0070713_100039335 | |||
| 1146 | Ga0070711_100117004 | |||
| 1147 | Ga0070700_100014887 | |||
| 1148 | Ga0070694_100034366 | |||
| 1149 | Ga0070708_100005549 | |||
| 1150 | Ga0070663_100000009 | |||
| 1151 | Ga0070663_100014515 | |||
| 1152 | Ga0070663_100026045 | |||
| 1153 | Ga0070663_100101468 | |||
| 1154 | Ga0070663_100169849 | |||
| 1155 | Ga0070663_100450968 | |||
| 1156 | Ga0070678_100698440 | |||
| 1157 | Ga0070662_100256178 | |||
| 1158 | Ga0070681_10000654 | |||
| 1159 | Ga0070681_10011866 | |||
| 1160 | Ga0070681_10027109 | |||
| 1161 | Ga0070681_10114575 | |||
| 1162 | Ga0070681_10122990 | |||
| 1163 | Ga0068867_100217625 | |||
| 1164 | Ga0068867_100370562 | |||
| 1165 | Ga0070685_10008750 | |||
| 1166 | Ga0070706_100000341 | |||
| 1167 | Ga0070699_100034921 | |||
| 1168 | Ga0070679_100001048 | |||
| 1169 | Ga0070679_100007044 | |||
| 1170 | Ga0070679_100009100 | |||
| 1171 | Ga0070679_100059348 | |||
| 1172 | Ga0070679_100297320 | |||
| 1173 | Ga0070684_100000471 | |||
| 1174 | Ga0070684_100034999 | |||
| 1175 | Ga0070684_100037551 | |||
| 1176 | Ga0070684_100047190 | |||
| 1177 | Ga0070684_100072773 | |||
| 1178 | Ga0070684_100073089 | |||
| 1179 | Ga0070684_100232296 | |||
| 1180 | Ga0070697_100010330 | |||
| 1181 | Ga0070697_100052945 | |||
| 1182 | Ga0068853_100012907 | |||
| 1183 | Ga0068853_100019915 | |||
| 1184 | Ga0068853_100030506 | |||
| 1185 | Ga0068853_100063931 | |||
| 1186 | Ga0068853_100431705 | |||
| 1187 | Ga0070672_100034395 | |||
| 1188 | Ga0070686_100008616 | |||
| 1189 | Ga0070695_100003408 | |||
| 1190 | Ga0070695_100019194 | |||
| 1191 | Ga0070696_100042591 | |||
| 1192 | Ga0070696_100078063 | |||
| 1193 | Ga0070693_100016907 | |||
| 1194 | Ga0070693_100038400 | |||
| 1195 | Ga0070693_100139376 | |||
| 1196 | Ga0070693_100147896 | |||
| 1197 | Ga0070693_100236836 | |||
| 1198 | Ga0070665_100100237 | |||
| 1199 | Ga0068855_100001577 | |||
| 1200 | Ga0068855_100034067 | |||
| 1201 | Ga0068855_100063063 | |||
| 1202 | Ga0068855_100119809 | |||
| 1203 | Ga0068855_100349215 | |||
| 1204 | Ga0068855_100556271 | |||
| 1205 | Ga0070664_100000011 | |||
| 1206 | Ga0068857_100000185 | |||
| 1207 | Ga0068857_100018367 | |||
| 1208 | Ga0068857_100022793 | |||
| 1209 | Ga0068857_100046075 | |||
| 1210 | Ga0068857_100291692 | |||
| 1211 | Ga0068857_100421563 | |||
| 1212 | Ga0068854_100000017 | |||
| 1213 | Ga0068854_100114660 | |||
| 1214 | Ga0068854_100674357 | |||
| 1215 | Ga0068856_100001403 | |||
| 1216 | Ga0068856_100004454 | |||
| 1217 | Ga0068856_100007590 | |||
| 1218 | Ga0068856_100011206 | |||
| 1219 | Ga0068856_100047695 | |||
| 1220 | Ga0068856_100080217 | |||
| 1221 | Ga0068856_100093767 | |||
| 1222 | Ga0068856_100103540 | |||
| 1223 | Ga0068856_100187437 | |||
| 1224 | Ga0068856_100193111 | |||
| 1225 | Ga0068856_100617479 | |||
| 1226 | Ga0070702_100074307 | |||
| 1227 | Ga0068852_100008656 | |||
| 1228 | Ga0068852_100032559 | |||
| 1229 | Ga0068852_100092596 | |||
| 1230 | Ga0068852_100181966 | |||
| 1231 | Ga0068852_100363782 | |||
| 1232 | Ga0068859_100210810 | |||
| 1233 | Ga0068859_100632750 | |||
| 1234 | Ga0068864_100171498 | |||
| 1235 | Ga0068864_100223568 | |||
| 1236 | Ga0068864_100399000 | |||
| 1237 | Ga0068866_10040078 | |||
| 1238 | Ga0068866_10184850 | |||
| 1239 | Ga0068861_100010717 | |||
| 1240 | Ga0068861_100025018 | |||
| 1241 | Ga0068851_10009156 | |||
| 1242 | Ga0068870_10010600 | |||
| 1243 | Ga0068863_100060743 | |||
| 1244 | Ga0068858_100159258 | |||
| 1245 | Ga0068860_100149905 | |||
| 1246 | Ga0068860_100229022 | |||
| 1247 | Ga0068862_100037913 | |||
| 1248 | Ga0068862_100074976 | |||
| 1249 | Ga0081540_1000269 | |||
| 1250 | Ga0081540_1030095 | |||
| 1251 | Ga0081539_10015902 | |||
| 1252 | Ga0075365_10008427 | |||
| 1253 | Ga0075365_10071707 | |||
| 1254 | Ga0075365_10073917 | |||
| 1255 | Ga0075368_10001917 | |||
| 1256 | Ga0075368_10005294 | |||
| 1257 | Ga0075368_10010423 | |||
| 1258 | Ga0075363_100006085 | |||
| 1259 | Ga0075363_100211913 | |||
| 1260 | Ga0075364_10005386 | |||
| 1261 | Ga0070715_10128713 | |||
| 1262 | Ga0070712_100330125 | |||
| 1263 | Ga0075367_10000650 | |||
| 1264 | Ga0075367_10000730 | |||
| 1265 | Ga0075367_10014273 | |||
| 1266 | Ga0075367_10085757 | |||
| 1267 | Ga0097621_100036185 | |||
| 1268 | Ga0097621_100062442 | |||
| 1269 | Ga0097621_100204005 | |||
| 1270 | Ga0097621_100225191 | |||
| 1271 | Ga0068871_100031040 | |||
| 1272 | Ga0068871_100039660 | |||
| 1273 | Ga0068871_100079320 | |||
| 1274 | Ga0075428_100046875 | |||
| 1275 | Ga0075428_100048989 | |||
| 1276 | Ga0075428_100066205 | |||
| 1277 | Ga0075428_100119193 | |||
| 1278 | Ga0075428_100160079 | |||
| 1279 | Ga0075428_100218975 | |||
| 1280 | Ga0075428_100296161 | |||
| 1281 | Ga0075430_100050281 | |||
| 1282 | Ga0075430_100261882 | |||
| 1283 | Ga0075430_100389339 | |||
| 1284 | Ga0075431_100017147 | |||
| 1285 | Ga0075431_100041845 | |||
| 1286 | Ga0075431_100060562 | |||
| 1287 | Ga0075431_100312541 | |||
| 1288 | Ga0075433_10002537 | |||
| 1289 | Ga0075433_10012133 | |||
| 1290 | Ga0075433_10038194 | |||
| 1291 | Ga0075433_10517171 | |||
| 1292 | Ga0075434_100015667 | |||
| 1293 | Ga0075434_100191464 | |||
| 1294 | Ga0075434_100479476 | |||
| 1295 | Ga0075429_100143394 | |||
| 1296 | Ga0075429_100388971 | |||
| 1297 | Ga0068865_100220246 | |||
| 1298 | Ga0068865_100541179 | |||
| 1299 | Ga0097620_100210807 | |||
| 1300 | Ga0097620_100632828 | |||
| 1301 | Ga0075435_100162525 | |||
| 1302 | Ga0099794_10000008 | |||
| 1303 | Ga0099794_10017455 | |||
| 1304 | Ga0099794_10043133 | |||
| 1305 | Ga0105240_10005660 | |||
| 1306 | Ga0105240_10015906 | |||
| 1307 | Ga0105240_10029226 | |||
| 1308 | Ga0105240_10079743 | |||
| 1309 | Ga0105240_10152033 | |||
| 1310 | Ga0111539_10013673 | |||
| 1311 | Ga0111539_10072436 | |||
| 1312 | Ga0111539_10099725 | |||
| 1313 | Ga0111539_10177812 | |||
| 1314 | Ga0111539_10228679 | |||
| 1315 | Ga0105245_10000754 | |||
| 1316 | Ga0105245_10067620 | |||
| 1317 | Ga0105245_10087425 | |||
| 1318 | Ga0105245_10160889 | |||
| 1319 | Ga0105245_10167327 | |||
| 1320 | Ga0105245_10349803 | |||
| 1321 | Ga0105247_10104559 | |||
| 1322 | Ga0114129_10005479 | |||
| 1323 | Ga0114129_10030817 | |||
| 1324 | Ga0114129_10042105 | |||
| 1325 | Ga0114129_10133731 | |||
| 1326 | Ga0114129_10211807 | |||
| 1327 | Ga0114129_10296612 | |||
| 1328 | Ga0114129_10420182 | |||
| 1329 | Ga0114129_10590327 | |||
| 1330 | Ga0114129_10615190 | |||
| 1331 | Ga0105243_10122930 | |||
| 1332 | Ga0105241_10003933 | |||
| 1333 | Ga0105241_10022888 | |||
| 1334 | Ga0105241_10062208 | |||
| 1335 | Ga0105241_10214536 | |||
| 1336 | Ga0105241_10282157 | |||
| 1337 | Ga0105242_10005424 | |||
| 1338 | Ga0105242_10012399 | |||
| 1339 | Ga0105242_10036092 | |||
| 1340 | Ga0105242_10070460 | |||
| 1341 | Ga0105242_10070922 | |||
| 1342 | Ga0105242_10105888 | |||
| 1343 | Ga0105242_10339190 | |||
| 1344 | Ga0105248_10011824 | |||
| 1345 | Ga0105248_10026696 | |||
| 1346 | Ga0105248_10092271 | |||
| 1347 | Ga0105248_10153218 | |||
| 1348 | Ga0105248_10213173 | |||
| 1349 | Ga0105237_10010006 | |||
| 1350 | Ga0105237_10027565 | |||
| 1351 | Ga0105237_10141753 | |||
| 1352 | Ga0105238_10000443 | |||
| 1353 | Ga0105238_10005317 | |||
| 1354 | Ga0105238_10017658 | |||
| 1355 | Ga0105238_10040995 | |||
| 1356 | Ga0105238_10207475 | |||
| 1357 | Ga0105249_10003026 | |||
| 1358 | Ga0105249_10073454 | |||
| 1359 | Ga0105249_10142499 | |||
| 1360 | Ga0105239_10000767 | |||
| 1361 | Ga0105239_10009586 | |||
| 1362 | Ga0105239_10019483 | |||
| 1363 | Ga0105239_10062671 | |||
| 1364 | Ga0105239_11210088 | |||
| 1365 | Ga0105246_10029255 | |||
| 1366 | Ga0105246_10112241 | |||
| 1367 | Ga0157373_10004105 | |||
| 1368 | Ga0157373_10383181 | |||
| 1369 | Ga0157371_10000033 | |||
| 1370 | Ga0157370_10000010 | |||
| 1371 | Ga0157370_10000997 | |||
| 1372 | Ga0157370_10006183 | |||
| 1373 | Ga0157370_10006794 | |||
| 1374 | Ga0157370_10020680 | |||
| 1375 | Ga0157370_10046339 | |||
| 1376 | Ga0157370_10111535 | |||
| 1377 | Ga0157369_10006586 | |||
| 1378 | Ga0157369_10016540 | |||
| 1379 | Ga0157369_10038194 | |||
| 1380 | Ga0157369_10254492 | |||
| 1381 | Ga0157369_10341334 | |||
| 1382 | Ga0157369_10497616 | |||
| 1383 | Ga0157374_10016328 | |||
| 1384 | Ga0157374_10020663 | |||
| 1385 | Ga0157374_10044232 | |||
| 1386 | Ga0157374_10176784 | |||
| 1387 | Ga0157378_10002798 | |||
| 1388 | Ga0157378_10182318 | |||
| 1389 | Ga0163162_10055007 | |||
| 1390 | Ga0163162_10089813 | |||
| 1391 | Ga0163162_10487457 | |||
| 1392 | Ga0163162_10501606 | |||
| 1393 | Ga0163162_10758190 | |||
| 1394 | Ga0157372_10000176 | |||
| 1395 | Ga0157372_10008622 | |||
| 1396 | Ga0157372_10017214 | |||
| 1397 | Ga0157372_10021026 | |||
| 1398 | Ga0157372_10030111 | |||
| 1399 | Ga0157372_10055106 | |||
| 1400 | Ga0157372_10204320 | |||
| 1401 | Ga0157372_10272383 | |||
| 1402 | Ga0157375_10080080 | |||
| 1403 | Ga0157375_10117513 | |||
| 1404 | Ga0157375_10142545 | |||
| 1405 | Ga0157375_10191380 | |||
| 1406 | Ga0157375_10300704 | |||
| 1407 | Ga0157375_10417370 | |||
| 1408 | Ga0157375_10419940 | |||
| 1409 | Ga0163163_10015922 | |||
| 1410 | Ga0163163_10036358 | |||
| 1411 | Ga0163163_10207828 | |||
| 1412 | Ga0163163_10216135 | |||
| 1413 | Ga0163163_10506793 | |||
| 1414 | Ga0157380_10084060 | |||
| 1415 | Ga0157377_10007961 | |||
| 1416 | Ga0157379_10074496 | |||
| 1417 | Ga0157379_10088865 | |||
| 1418 | Ga0157379_10451578 | |||
| 1419 | Ga0157376_10043547 | |||
| 1420 | Ga0157376_10051192 | |||
| 1421 | Ga0157376_10142804 | |||
| 1422 | Ga0157376_10176857 | |||
| 1423 | Ga0182006_1000198 | |||
| 1424 | Ga0183361_10020 | |||
| 1425 | Ga0163161_10075248 | |||
| 1426 | Ga0163161_10089384 | |||
| 1427 | Ga0206351_10187668 | |||
| 1428 | Ga0206350_10972196 | |||
| 1429 | Ga0154015_1514660 | |||
| 1430 | Ga0209784_100008 | |||
| 1431 | Ga0209784_100732 | |||
| 1432 | Ga0209784_102976 | |||
| 1433 | Ga0209566_100006 | |||
| 1434 | Ga0209566_100194 | |||
| 1435 | Ga0209566_104401 | |||
| 1436 | Ga0209674_100045 | |||
| 1437 | Ga0209674_100114 | |||
| 1438 | Ga0209674_101646 | |||
| 1439 | Ga0209672_100511 | |||
| 1440 | Ga0209147_100005 | |||
| 1441 | Ga0209563_100016 | |||
| 1442 | Ga0209563_102859 | |||
| 1443 | Ga0209563_110753 | |||
| 1444 | Ga0209258_100007 | |||
| 1445 | Ga0209646_1000016 | |||
| 1446 | Ga0209026_1000832 | |||
| 1447 | Ga0209677_100008 | |||
| 1448 | Ga0209148_1000019 | |||
| 1449 | Ga0209148_1024577 | |||
| 1450 | Ga0209759_1002449 | |||
| 1451 | Ga0209759_1012377 | |||
| 1452 | Ga0207666_1001176 | |||
| 1453 | Ga0209455_1000011 | |||
| 1454 | Ga0207673_1001393 | |||
| 1455 | Ga0207697_10000878 | |||
| 1456 | Ga0207697_10020899 | |||
| 1457 | Ga0207656_10046112 | |||
| 1458 | Ga0207682_10000322 | |||
| 1459 | Ga0207642_10006357 | |||
| 1460 | Ga0207688_10009997 | |||
| 1461 | Ga0207680_10012440 | |||
| 1462 | Ga0207647_10188524 | |||
| 1463 | Ga0207699_10053072 | |||
| 1464 | Ga0207699_10123028 | |||
| 1465 | Ga0207645_10000566 | |||
| 1466 | Ga0207645_10011889 | |||
| 1467 | Ga0207643_10000359 | |||
| 1468 | Ga0207705_10043543 | |||
| 1469 | Ga0207705_10082077 | |||
| 1470 | Ga0207705_10343866 | |||
| 1471 | Ga0207684_10000017 | |||
| 1472 | Ga0207654_10084388 | |||
| 1473 | Ga0207654_10170698 | |||
| 1474 | Ga0207654_10185549 | |||
| 1475 | Ga0207707_10000428 | |||
| 1476 | Ga0207707_10014718 | |||
| 1477 | Ga0207707_10015541 | |||
| 1478 | Ga0207707_10031972 | |||
| 1479 | Ga0207707_10203392 | |||
| 1480 | Ga0207707_10227976 | |||
| 1481 | Ga0207695_10001192 | |||
| 1482 | Ga0207695_10001402 | |||
| 1483 | Ga0207695_10031185 | |||
| 1484 | Ga0207695_10084198 | |||
| 1485 | Ga0207695_10092286 | |||
| 1486 | Ga0207695_10125902 | |||
| 1487 | Ga0207695_10386671 | |||
| 1488 | Ga0207671_10006282 | |||
| 1489 | Ga0207671_10182425 | |||
| 1490 | Ga0207693_10009495 | |||
| 1491 | Ga0207693_10296333 | |||
| 1492 | Ga0207660_10004855 | |||
| 1493 | Ga0207660_10183857 | |||
| 1494 | Ga0207660_10283134 | |||
| 1495 | Ga0207662_10010985 | |||
| 1496 | Ga0207657_10023547 | |||
| 1497 | Ga0207657_10043427 | |||
| 1498 | Ga0207657_10064611 | |||
| 1499 | Ga0207657_10108078 | |||
| 1500 | Ga0207657_10146615 | |||
| 1501 | Ga0207657_10333578 | |||
| 1502 | Ga0207649_10000123 | |||
| 1503 | Ga0207649_10044241 | |||
| 1504 | Ga0207649_10079379 | |||
| 1505 | Ga0207652_10005246 | |||
| 1506 | Ga0207652_10020084 | |||
| 1507 | Ga0207652_10022050 | |||
| 1508 | Ga0207652_10035165 | |||
| 1509 | Ga0207646_10272700 | |||
| 1510 | Ga0207681_10151892 | |||
| 1511 | Ga0207694_10000698 | |||
| 1512 | Ga0207694_10003106 | |||
| 1513 | Ga0207694_10025025 | |||
| 1514 | Ga0207650_10006058 | |||
| 1515 | Ga0207650_10031973 | |||
| 1516 | Ga0207650_10483049 | |||
| 1517 | Ga0207659_10107008 | |||
| 1518 | Ga0207659_10115686 | |||
| 1519 | Ga0207687_10000339 | |||
| 1520 | Ga0207687_10001672 | |||
| 1521 | Ga0207687_10019205 | |||
| 1522 | Ga0207687_10056904 | |||
| 1523 | Ga0207687_10123570 | |||
| 1524 | Ga0207687_10321507 | |||
| 1525 | Ga0207700_10000197 | |||
| 1526 | Ga0207700_10001526 | |||
| 1527 | Ga0207664_10156768 | |||
| 1528 | Ga0207644_10089998 | |||
| 1529 | Ga0207690_10006905 | |||
| 1530 | Ga0207690_10050704 | |||
| 1531 | Ga0207690_10067077 | |||
| 1532 | Ga0207690_10130086 | |||
| 1533 | Ga0207706_10000918 | |||
| 1534 | Ga0207686_10023494 | |||
| 1535 | Ga0207686_10217033 | |||
| 1536 | Ga0207686_10221390 | |||
| 1537 | Ga0207709_10210922 | |||
| 1538 | Ga0207670_10036529 | |||
| 1539 | Ga0207669_10199539 | |||
| 1540 | Ga0207704_10159651 | |||
| 1541 | Ga0207704_10257168 | |||
| 1542 | Ga0207704_10297205 | |||
| 1543 | Ga0207691_10005758 | |||
| 1544 | Ga0207691_10017742 | |||
| 1545 | Ga0207691_10050746 | |||
| 1546 | Ga0207711_10003145 | |||
| 1547 | Ga0207711_10006153 | |||
| 1548 | Ga0207711_10046961 | |||
| 1549 | Ga0207711_10082154 | |||
| 1550 | Ga0207711_10091675 | |||
| 1551 | Ga0207711_10266133 | |||
| 1552 | Ga0207689_10000264 | |||
| 1553 | Ga0207661_10000420 | |||
| 1554 | Ga0207661_10103477 | |||
| 1555 | Ga0207679_10000002 | |||
| 1556 | Ga0207679_10019683 | |||
| 1557 | Ga0207679_10112697 | |||
| 1558 | Ga0207667_10000573 | |||
| 1559 | Ga0207667_10018640 | |||
| 1560 | Ga0207667_10055004 | |||
| 1561 | Ga0207667_10065089 | |||
| 1562 | Ga0207667_10101808 | |||
| 1563 | Ga0207667_10130914 | |||
| 1564 | Ga0207667_10377101 | |||
| 1565 | Ga0207651_10027762 | |||
| 1566 | Ga0207651_10056862 | |||
| 1567 | Ga0207712_10023705 | |||
| 1568 | Ga0207668_10080977 | |||
| 1569 | Ga0207668_10090333 | |||
| 1570 | Ga0207640_10000138 | |||
| 1571 | Ga0207640_10076244 | |||
| 1572 | Ga0207640_10134887 | |||
| 1573 | Ga0207640_10248396 | |||
| 1574 | Ga0207640_10300766 | |||
| 1575 | Ga0207658_10043251 | |||
| 1576 | Ga0207658_10109419 | |||
| 1577 | Ga0207658_10146511 | |||
| 1578 | Ga0207703_10085613 | |||
| 1579 | Ga0207703_10174848 | |||
| 1580 | Ga0207703_10198980 | |||
| 1581 | Ga0207703_10245032 | |||
| 1582 | Ga0207639_10124505 | |||
| 1583 | Ga0207639_10487685 | |||
| 1584 | Ga0207678_10000015 | |||
| 1585 | Ga0207678_10006130 | |||
| 1586 | Ga0207678_10070788 | |||
| 1587 | Ga0207678_10074943 | |||
| 1588 | Ga0207678_10164297 | |||
| 1589 | Ga0207708_10000494 | |||
| 1590 | Ga0207708_10003123 | |||
| 1591 | Ga0207708_10044289 | |||
| 1592 | Ga0207708_10047153 | |||
| 1593 | Ga0207708_10376575 | |||
| 1594 | Ga0207702_10000084 | |||
| 1595 | Ga0207702_10001951 | |||
| 1596 | Ga0207702_10006488 | |||
| 1597 | Ga0207702_10036849 | |||
| 1598 | Ga0207702_10114856 | |||
| 1599 | Ga0207702_10141653 | |||
| 1600 | Ga0207702_10253551 | |||
| 1601 | Ga0207641_10788441 | |||
| 1602 | Ga0207648_10005148 | |||
| 1603 | Ga0207648_10052459 | |||
| 1604 | Ga0207676_10017641 | |||
| 1605 | Ga0207676_10051777 | |||
| 1606 | Ga0207674_10000035 | |||
| 1607 | Ga0207674_10001346 | |||
| 1608 | Ga0207674_10006571 | |||
| 1609 | Ga0207674_10043135 | |||
| 1610 | Ga0207675_100001280 | |||
| 1611 | Ga0207675_100007688 | |||
| 1612 | Ga0207683_10017507 | |||
| 1613 | Ga0207683_10285435 | |||
| 1614 | Ga0207683_10468834 | |||
| 1615 | Ga0207698_10013741 | |||
| 1616 | Ga0207698_10149613 | |||
| 1617 | Ga0209995_1001838 | |||
| 1618 | Ga0209588_1000003 | |||
| 1619 | Ga0209588_1009806 | |||
| 1620 | Ga0209588_1037829 | |||
| 1621 | Ga0209966_1019154 | |||
| 1622 | Ga0209813_10000999 | |||
| 1623 | Ga0209813_10007470 | |||
| 1624 | Ga0207428_10032650 | |||
| 1625 | Ga0207428_10035068 | |||
| 1626 | Ga0207428_10168917 | |||
| 1627 | Ga0268266_10085915 | |||
| 1628 | Ga0268265_10005788 | |||
| 1629 | Ga0268265_10010563 | |||
| 1630 | Ga0268265_10111259 | |||
| 1631 | Ga0268265_10248992 | |||
| 1632 | Ga0268264_10063642 | |||
| 1633 | Ga0268264_10159775 | |||
| 1634 | Ga0268264_10571502 | |||
| 1635 | Ga0265337_1000071 | |||
| 1636 | Ga0265338_10000205 | |||
| 1637 | Ga0265340_10039138 | |||
| 1638 | Ga0307408_100108199 | |||
| 1639 | Ga0307408_100423710 | |||
| 1640 | Ga0265313_10005033 | |||
| 1641 | Ga0307508_10000013 | |||
| 1642 | Ga0307508_10163830 | |||
| 1643 | Ga0265314_10004213 | |||
| 1644 | Ga0265314_10006116 | |||
| 1645 | Ga0307416_100266745 | |||
| 1646 | Ga0307414_10166105 | |||
| 1647 | Ga0316583_10067730 | |||
| 1648 | Ga0373926_0008111 | |||
| 1649 | Ga0373928_0018804 | |||
| 1650 | Ga0373934_0003108 | |||
| 1651 | Ga0373944_0012922 | |||
| 1652 | Ga0373949_0009616 | |||
| 1653 | Ga0373951_0019671 | |||
| 1654 | Ga0373923_0046243 | |||
| 1655 | Ga0373939_0011208 | |||
| 1656 | Ga0373939_0081928 | |||
| 1657 | Ga0373939_0098119 | |||
| 1658 | Ga0373945_0050665 | |||
| 1659 | Ga0373956_0149726 | |||
| 1660 | Ga0373957_0023204 | |||
| 1661 | Ga0373960_0017861 | |||
| 1662 | Ga0373943_0002738 | |||
| 1663 | Ga0373943_0028431 | |||
| 1664 | Ga0373946_0006341 | |||
| 1665 | Ga0373946_0009952 | |||
| 1666 | Ga0373955_0002469 | |||
| 1667 | Ga0373955_0002785 | |||
| 1668 | Ga0373955_0017843 | |||
| 1669 | Ga0373955_0222214 | |||
| 1670 | Ga0373955_0320712 | |||
| 1671 | Ga0373942_0034135 | |||
| 1672 | Ga0373962_0037038 | |||
| 1673 | Ga0373924_0063009 | |||
| 1674 | Ga0373931_0047887 | |||
| 1675 | Ga0373931_0137792 | |||
| 1676 | Ga0373935_0003608 | |||
| 1677 | Ga0373935_0009935 | |||
| 1678 | Ga0373935_0377345 | |||
| 1679 | Ga0373927_0008383 | |||
| 1680 | Ga0373927_0022921 | |||
| 1681 | Ga0373933_0002636 | |||
| 1682 | Ga0373947_0001177 | |||
| 1683 | Ga0373947_0159372 | |||
| 1684 | Ga0373937_0014656 | |||
| 1685 | Ga0373937_0019944 | |||
| 1686 | Ga0373937_0022721 | |||
| 1687 | Ga0373937_0530282 | |||
| 1688 | Ga0373925_0015474 | |||
| 1689 | Ga0373925_0015975 | |||
| 1690 | Ga0373925_0077063 | |||
| 1691 | Ga0373925_0544684 | |||
| 1692 | Ga0395899_0086752 | |||
| 1693 | Ga0395899_0100292 | |||
| 1694 | Ga0395900_0008184 | |||
| 1695 | Ga0395900_0240314 | |||
| 1696 | Ga0395900_0282737 | |||
| 1697 | Ga0395900_0781994 | |||
| 1698 | Ga0395898_0015812 | |||
| 1699 | Ga0395905_0050942 | |||
| 1700 | Ga0395901_0063903 | |||
| 1701 | Ga0395901_0218418 | |||
| 1702 | Ga0436360_0745406 | |||
| 1703 | Ga0436361_1127696 | |||
| 1704 | Ga0436363_0045111 | |||
| 1705 | Ga0439453_0045304 | |||
| 1706 | Ga0466972_0026303 | |||
| 1707 | Ga0453684_0324427 | |||
| 1708 | Ga0451576_0132345 | |||
| 1709 | Ga0451576_0304945 | |||
| 1710 | Ga0451576_0479884 | |||
| 1711 | Ga0466958_0182435 | |||
| 1712 | Ga0495627_002644 | |||
| 1713 | Ga0495592_0067019 | |||
| 1714 | Ga0495592_0087806 | |||
| 1715 | Ga0495592_0271095 | |||
| 1716 | Ga0495603_0002120 | |||
| 1717 | Ga0495603_0032062 | |||
| 1718 | Ga0495603_0213558 | |||
| 1719 | Ga0495629_0028450 | |||
| 1720 | Ga0495629_0347375 | |||
| 1721 | Ga0495638_0070984 | |||
| 1722 | Ga0495641_0007385 | |||
| 1723 | Ga0495641_0039035 | |||
| 1724 | Ga0495651_0039225 | |||
| 1725 | Ga0495651_0263127 | |||
| 1726 | Ga0495651_0345340 | |||
| 1727 | Ga0495653_0239695 | |||
| 1728 | Ga0495580_0003959 | |||
| 1729 | Ga0495580_0009907 | |||
| 1730 | Ga0495582_0042490 | |||
| 1731 | Ga0495582_0042567 | |||
| 1732 | Ga0495605_0037180 | |||
| 1733 | Ga0495639_0005482 | |||
| 1734 | Ga0495639_0013227 | |||
| 1735 | Ga0495639_0091589 | |||
| 1736 | Ga0495639_0120473 | |||
| 1737 | Ga0495662_0013806 | |||
| 1738 | Ga0495662_0037638 | |||
| 1739 | Ga0495662_0105860 | |||
| 1740 | Ga0495664_0014279 | |||
| 1741 | Ga0495664_0371602 | |||
| 1742 | Ga0495584_0037918 | |||
| 1743 | Ga0495584_0044896 | |||
| 1744 | Ga0495585_0002513 | |||
| 1745 | Ga0495585_0004560 | |||
| 1746 | Ga0495585_0011666 | |||
| 1747 | Ga0495585_0015720 | |||
| 1748 | Ga0495585_0119734 | |||
| 1749 | Ga0495594_0004261 | |||
| 1750 | Ga0495594_0005584 | |||
| 1751 | Ga0495596_0000725 | |||
| 1752 | Ga0495596_0005830 | |||
| 1753 | Ga0495607_0149181 | |||
| 1754 | Ga0495583_0070501 | |||
| 1755 | Ga0495606_0030193 | |||
| 1756 | Ga0495606_0040879 | |||
| 1757 | Ga0495606_0122852 | |||
| 1758 | Ga0495606_0162507 | |||
| 1759 | Ga0495608_0005257 | |||
| 1760 | Ga0495608_0079113 | |||
| 1761 | Ga0495616_0010910 | |||
| 1762 | Ga0495616_0070998 | |||
| 1763 | Ga0495618_0005438 | |||
| 1764 | Ga0495618_0242167 | |||
| 1765 | Ga0495628_0182718 | |||
| 1766 | Ga0495630_0010111 | |||
| 1767 | Ga0495630_0057069 | |||
| 1768 | Ga0495630_0102738 | |||
| 1769 | Ga0495630_0460467 | |||
| 1770 | Ga0495631_0015577 | |||
| 1771 | Ga0495631_0028601 | |||
| 1772 | Ga0495631_0038811 | |||
| 1773 | Ga0495631_0102609 | |||
| 1774 | Ga0495643_0006775 | |||
| 1775 | Ga0495643_0037391 | |||
| 1776 | Ga0495643_0050971 | |||
| 1777 | Ga0495643_0053968 | |||
| 1778 | Ga0495644_0008725 | |||
| 1779 | Ga0495663_0002535 | |||
| 1780 | Ga0495666_0001518 | |||
| 1781 | Ga0495666_0002022 | |||
| 1782 | Ga0495666_0020114 | |||
| 1783 | Ga0495642_0023069 | |||
| 1784 | Ga0495642_0045824 | |||
| 1785 | Ga0495652_0017487 | |||
| 1786 | Ga0495652_0033738 | |||
| 1787 | Ga0495652_0077503 | |||
| 1788 | Ga0495652_0090879 | |||
| 1789 | Ga0495665_0005227 | |||
| 1790 | Ga0495665_0006107 | |||
| 1791 | Ga0495665_0006841 | |||
| 1792 | Ga0495665_0043326 | |||
| 1793 | Ga0495665_0139093 | |||
| 1794 | Ga0495640_0015851 | |||
| 1795 | Ga0495640_0018853 | |||
| 1796 | Ga0495640_0122334 | |||
| 1797 | Ga0495640_0127368 | |||
| 1798 | Ga0495586_0009251 | |||
| 1799 | Ga0495586_0104407 | |||
| 1800 | Ga0495586_0203981 | |||
| 1801 | Ga0495586_0265845 | |||
| 1802 | Ga0495587_0007029 | |||
| 1803 | Ga0495587_0047153 | |||
| 1804 | Ga0495587_0064705 | |||
| 1805 | Ga0495609_0006145 | |||
| 1806 | Ga0495609_0008759 | |||
| 1807 | Ga0495597_0000058 | |||
| 1808 | Ga0495597_0002251 | |||
| 1809 | Ga0495597_0013010 | |||
| 1810 | Ga0495597_0018701 | |||
| 1811 | Ga0495597_0158073 | |||
| 1812 | Ga0495645_0032777 | |||
| 1813 | Ga0495645_0353151 | |||
| 1814 | Ga0495622_0059645 | |||
| 1815 | Ga0495633_0002296 | |||
| 1816 | Ga0495633_0008149 | |||
| 1817 | Ga0495667_0036095 | |||
| 1818 | Ga0495667_0043333 | |||
| 1819 | Ga0495667_0047488 | |||
| 1820 | Ga0495667_0051910 | |||
| 1821 | Ga0495667_0094403 | |||
| 1822 | Ga0495656_0011057 | |||
| 1823 | Ga0495656_0023005 | |||
| 1824 | Ga0495656_0223711 | |||
| 1825 | Ga0495668_0003141 | |||
| 1826 | Ga0495668_0022402 | |||
| 1827 | Ga0495634_0013822 | |||
| 1828 | Ga0495611_0004816 | |||
| 1829 | Ga0495611_0011275 | |||
| 1830 | Ga0495611_0059918 | |||
| 1831 | Ga0495611_0107985 | |||
| 1832 | Ga0495625_0008414 | |||
| 1833 | Ga0495625_0048668 | |||
| 1834 | Ga0495625_0053899 | |||
| 1835 | Ga0495635_0020635 | |||
| 1836 | Ga0495635_0093662 | |||
| 1837 | Ga0495661_0001133 | |||
| 1838 | Ga0495661_0041590 | |||
| 1839 | Ga0495661_0081858 | |||
| 1840 | Ga0495661_0099913 | |||
| 1841 | Ga0495588_0001371 | |||
| 1842 | Ga0495588_0015587 | |||
| 1843 | Ga0495588_0028761 | |||
| 1844 | Ga0495588_0062535 | |||
| 1845 | Ga0495657_0014095 | |||
| 1846 | Ga0495657_0102665 | |||
| 1847 | Ga0495599_0033578 | |||
| 1848 | Ga0495623_0005106 | |||
| 1849 | Ga0495623_0055757 | |||
| 1850 | Ga0495623_0071810 | |||
| 1851 | Ga0495623_0152540 | |||
| 1852 | Ga0495646_0005675 | |||
| 1853 | Ga0495647_0000366 | |||
| 1854 | Ga0495647_0007546 | |||
| 1855 | Ga0495647_0041268 | |||
| 1856 | Ga0495658_0012989 | |||
| 1857 | Ga0495658_0013544 | |||
| 1858 | Ga0495669_0002192 | |||
| 1859 | Ga0495613_0037522 | |||
| 1860 | Ga0495613_0039866 | |||
| 1861 | Ga0495613_0154951 | |||
| 1862 | Ga0495624_0035748 | |||
| 1863 | Ga0495624_0044725 | |||
| 1864 | Ga0495624_0226040 | |||
| 1865 | Ga0495670_0012358 | |||
| 1866 | Ga0495670_0042348 | |||
| 1867 | Ga0495671_0008704 | |||
| 1868 | Ga0495649_0165231 | |||
| 1869 | Ga0495589_0000279 | |||
| 1870 | Ga0495589_0017392 | |||
| 1871 | Ga0495589_0091023 | |||
| 1872 | Ga0495600_0016670 | |||
| 1873 | Ga0495600_0020538 | |||
| 1874 | Ga0495600_0078759 | |||
| 1875 | Ga0495600_0109842 | |||
| 1876 | Ga0495660_0068218 | |||
| 1877 | Ga0495581_0004719 | |||
| 1878 | Ga0495581_0013334 | |||
| 1879 | Ga0495581_0032969 | |||
| 1880 | Ga0495581_0110702 | |||
| 1881 | Ga0495604_0013505 | |||
| 1882 | Ga0495604_0034648 | |||
| 1883 | Ga0495604_0082229 | |||
| 1884 | Ga0495604_0112622 | |||
| 1885 | Ga0495604_0197199 | |||
| 1886 | Ga0495636_0058651 | |||
| 1887 | Ga0495674_0003459 | |||
| 1888 | Ga0495674_0009068 | |||
| 1889 | Ga0495674_0024579 | |||
| 1890 | Ga0495674_0031967 | |||
| 1891 | Ga0495674_0185968 | |||
| 1892 | Ga0495674_0394471 | |||
| 1893 | Ga0495676_0002390 | |||
| 1894 | Ga0495676_0050952 | |||
| 1895 | Ga0495676_0085727 | |||
| 1896 | Ga0495676_0131696 | |||
| 1897 | Ga0495680_0010478 | |||
| 1898 | Ga0495680_0024734 | |||
| 1899 | Ga0495680_0037459 | |||
| 1900 | Ga0495687_000060 | |||
| 1901 | Ga0495677_0005252 | |||
| 1902 | Ga0495677_0005699 | |||
| 1903 | Ga0495677_0006968 | |||
| 1904 | Ga0495677_0008099 | |||
| 1905 | Ga0495677_0012260 | |||
| 1906 | Ga0495677_0111877 | |||
| 1907 | Ga0495679_000245 | |||
| 1908 | Ga0495685_105641 | |||
| 1909 | Ga0495673_0026450 | |||
| 1910 | Ga0495681_0000005 | |||
| 1911 | Ga0495681_0001849 | |||
| 1912 | Ga0495681_0013289 | |||
| 1913 | Ga0495681_0053533 | |||
| 1914 | Ga0495684_0014883 | |||
| 1915 | Ga0495684_0029390 | |||
| 1916 | Ga0495684_0067413 | |||
| 1917 | Ga0495684_0368976 | |||
| 1918 | Ga0495684_0414371 | |||
| 1919 | Ga0495593_0007872 | |||
| 1920 | Ga0495593_0012345 | |||
| 1921 | Ga0495593_0076455 | |||
| 1922 | Ga0495593_0105940 | |||
| 1923 | Ga0495602_0032879 | |||
| 1924 | Ga0495602_0055778 | |||
| 1925 | Ga0495602_0067798 | |||
| 1926 | Ga0495614_0072221 | |||
| 1927 | Ga0495626_0002382 | |||
| 1928 | Ga0495626_0003494 | |||
| 1929 | Ga0495626_0006344 | |||
| 1930 | Ga0495626_0018297 | |||
| 1931 | Ga0496100_0046500 | |||
| 1932 | Ga0496100_0265885 | |||
| 1933 | Ga0496101_0184813 | |||
| 1934 | Ga0496102_0074143 | |||
| 1935 | Ga0496102_0190170 | |||
| 1936 | Ga0496102_0205984 | |||
| 1937 | Ga0496102_0282935 | |||
| 1938 | Ga0496104_0092523 | |||
| 1939 | Ga0496104_0265494 | |||
| 1940 | Ga0496105_0107466 | |||
| 1941 | Ga0496105_0154395 | |||
| 1942 | Ga0496105_0174991 | |||
| 1943 | Ga0496105_0220273 | |||
| 1944 | Ga0496106_0000334 | |||
| 1945 | Ga0496106_0025576 | |||
| 1946 | Ga0496107_0274654 | |||
| 1947 | Ga0496108_0016826 | |||
| 1948 | Ga0496108_0061883 | |||
| 1949 | Ga0496109_0001151 | |||
| 1950 | Ga0496109_0024259 | |||
| 1951 | Ga0496109_0040815 | |||
| 1952 | Ga0496109_0175158 | |||
| 1953 | Ga0496109_0331946 | |||
| 1954 | Ga0496110_0003520 | |||
| 1955 | Ga0496110_0007807 | |||
| 1956 | Ga0496110_0073717 | |||
| 1957 | Ga0496110_0094133 | |||
| 1958 | Ga0496111_0008589 | |||
| 1959 | Ga0496111_0222714 | |||
| 1960 | Ga0496111_0230298 | |||
| 1961 | Ga0496112_0000056 | |||
| 1962 | Ga0496112_0087561 | |||
| 1963 | Ga0496113_0006169 | |||
| 1964 | Ga0496113_0046532 | |||
| 1965 | Ga0496113_0092982 | |||
| 1966 | Ga0496114_0163735 | |||
| 1967 | Ga0496114_0272877 | |||
| 1968 | Ga0496115_0004072 | |||
| 1969 | Ga0496115_0016507 | |||
| 1970 | Ga0496115_0026242 | |||
| 1971 | Ga0496115_0040003 | |||
| 1972 | Ga0496115_0216938 | |||
| 1973 | Ga0496116_0018358 | |||
| 1974 | Ga0496117_0093573 | |||
| 1975 | Ga0496121_0003905 | |||
| 1976 | Ga0496121_0019368 | |||
| 1977 | Ga0496121_0109380 | |||
| 1978 | Ga0496126_0000389 | |||
| 1979 | Ga0496126_0040718 | |||
| 1980 | Ga0496126_0111517 | |||
| 1981 | Ga0495682_0008457 | |||
| 1982 | Ga0501033_0076444 | |||
| 1983 | Ga0501036_0070317 | |||
| 1984 | Ga0501037_0218401 | |||
| 1985 | Ga0501038_0100272 | |||
| 1986 | Ga0501038_0139641 | |||
| 1987 | Ga0501040_0009843 | |||
| 1988 | Ga0501041_0009596 | |||
| 1989 | Ga0501042_0109459 | |||
| 1990 | Ga0501043_0014233 | |||
| 1991 | Ga0501043_0029694 | |||
| 1992 | Ga0501043_0033878 | |||
| 1993 | Ga0501048_0050203 | |||
| 1994 | Ga0501048_0322358 | |||
| 1995 | Ga0501068_0039499 | |||
| 1996 | Ga0501068_0191631 | |||
| 1997 | Ga0501070_0020640 | |||
| 1998 | Ga0501071_0000963 | |||
| 1999 | Ga0501071_0110069 | |||
| 2000 | Ga0501072_0143487 | |||
| 2001 | Ga0501072_0143624 | |||
| 2002 | Ga0501073_0027634 | |||
| 2003 | Ga0501073_0165582 | |||
| 2004 | Ga0501075_0001532 | |||
| 2005 | Ga0501076_0006596 | |||
| 2006 | Ga0501077_0075393 | |||
| 2007 | Ga0501079_0007208 | |||
| 2008 | Ga0501080_0013792 | |||
| 2009 | Ga0501080_0020498 | |||
| 2010 | Ga0501080_0306238 | |||
| 2011 | Ga0501081_0001634 | |||
| 2012 | Ga0501083_0006483 | |||
| 2013 | Ga0501083_0030444 | |||
| 2014 | Ga0501035_0008112 | |||
| 2015 | Ga0501035_0047960 | |||
| 2016 | Ga0501035_0048822 | |||
| 2017 | Ga0501044_0319055 | |||
| 2018 | Ga0501044_0575981 | |||
| 2019 | Ga0501045_0018938 | |||
| 2020 | nmdc:mga00v17_12438_c1 | |||
| 2021 | nmdc:mga0yw44_2270_c1 | |||
| 2022 | nmdc:mga06z11_1542_c1 | |||
| 2023 | nmdc:mga06z11_448_c1 | |||
| 2024 | nmdc:mga06z11_47888_c1 | |||
| 2025 | nmdc:mga06z11_91325_c1 | |||
| 2026 | nmdc:mga04h51_20951_c1 | |||
| 2027 | nmdc:mga05p37_117581_c1 | |||
| 2028 | nmdc:mga05p37_126546_c1 | |||
| 2029 | nmdc:mga05p37_682941_c1 | |||
| 2030 | nmdc:mga05p37_69148_c1 | |||
| 2031 | nmdc:mga05p37_732390_c1 | |||
| 2032 | nmdc:mga05p37_90127_c1 | |||
| 2033 | nmdc:mga09592_174763_c1 | |||
| 2034 | nmdc:mga09592_211830_c1 | |||
| 2035 | nmdc:mga09592_411054_c1 | |||
| 2036 | nmdc:mga0qj67_59015_c1 | |||
| 2037 | nmdc:mga06r32_223134_c1 | |||
| 2038 | nmdc:mga06r32_22383_c1 | |||
| 2039 | nmdc:mga06r32_285141_c1 | |||
| 2040 | nmdc:mga06r32_65558_c1 | |||
| 2041 | nmdc:mga08y16_236049_c1 | |||
| 2042 | nmdc:mga08y16_28683_c1 | |||
| 2043 | nmdc:mga08y16_42416_c1 | |||
| 2044 | nmdc:mga08y16_64466_c1 | |||
| 2045 | nmdc:mga08y16_71366_c1 | |||
| 2046 | nmdc:mga08y16_96471_c1 | |||
| 2047 | nmdc:mga0n895_104186_c1 | |||
| 2048 | nmdc:mga0n895_119154_c1 | |||
| 2049 | nmdc:mga0n895_137345_c1 | |||
| 2050 | nmdc:mga0n895_170507_c1 | |||
| 2051 | nmdc:mga0n895_333288_c1 | |||
| 2052 | nmdc:mga0n895_643930_c1 | |||
| 2053 | nmdc:mga0n895_80144_c1 | |||
| 2054 | nmdc:mga0a205_110634_c1 | |||
| 2055 | nmdc:mga0a205_26394_c1 | |||
| 2056 | nmdc:mga0a205_26480_c1 | |||
| 2057 | Ga0495601_0005200 | |||
| 2058 | Ga0495601_0006604 | |||
| 2059 | Ga0495601_0014349 | |||
| 2060 | Ga0495601_0015883 | |||
| 2061 | Ga0495601_0069755 | |||
| 2062 | Ga0495601_0091260 | |||
| 2063 | Ga0495601_0134599 | |||
| 2064 | Ga0495612_0000947 | |||
| 2065 | Ga0495612_0001950 | |||
| 2066 | Ga0495612_0003437 | |||
| 2067 | Ga0495612_0015777 | |||
| 2068 | Ga0495612_0048531 | |||
| 2069 | Ga0495595_0002199 | |||
| 2070 | Ga0495595_0022163 | |||
| 2071 | Ga0495619_0002353 | |||
| 2072 | Ga0495619_0002916 | |||
| 2073 | Ga0495619_0004106 | |||
| 2074 | Ga0495619_0008234 | |||
| 2075 | Ga0495619_0009809 | |||
| 2076 | Ga0500643_002652 | |||
| 2077 | Ga0500644_0000643 | |||
| 2078 | Ga0500651_0020019 | |||
| 2079 | Ga0500566_0066615 | |||
| 2080 | Ga0500595_000394 | |||
| 2081 | Ga0500616_0000001 | |||
| 2082 | Ga0500645_000763 | |||
| 2083 | Ga0501084_0001783 | |||
| 2084 | Ga0501084_0167818 | |||
| 2085 | Ga0501082_0006541 | |||
| 2086 | Ga0501082_0059829 | |||
| 2087 | Ga0530510_0001881 | |||
| 2088 | 2512345953 | |||
| 2089 | 2524468590 | |||
| 2090 | 2528856387 | |||
| 2091 | 2597030394 | |||
| 2092 | 2644290189 | |||
| 2093 | 2723876944 | |||
| 2094 | 2738745970 | |||
| 2095 | 2739355200 | |||
| 2096 | 2792839423 | |||
| 2097 | 2824603102 | |||
| 2098 | 2824615685 | |||
| 2099 | 2824659611 | |||
| 2100 | 2829749656 | |||
| 2101 | 2885266671 | |||
| 2102 | 2887377033 | |||
| 2103 | 2900579126 | |||
| 2104 | 2904621605 | |||
| 2105 | 2928059451 | |||
| 2106 | 2935690933 | |||
| 2107 | 2935718314 | |||
| 2108 | 2935727706 | |||
| 2109 | 2935736409 | |||
| 2110 | 2935745789 | |||
| 2111 | 2935756170 | |||
| 2112 | 2940561855 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.9339 | 12 | 231 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.931 | 12 | 228 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9272 | 12 | 230 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9268 | 12 | 230 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9256 | 12 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9719 | 11 | 250 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.96 | 11 | 250 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9425 | 10 | 229 | 3.40.50.300 |
| af_P77737_9_333_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9377 | 9 | 217 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9334 | 12 | 241 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A8AKN4-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9793 | 8 | 197 |
GO:0005524
GO:0016887 |
| AF-A0A6A8AKN4-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9742 | 8 | 197 |
GO:0005524
GO:0016887 |
| AF-A0A2S8K3Z3-F1-model_v4 | deleted | 0.9644 | 41 | 193 |
|
| AF-A0A6I1NNV7-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9577 | 47 | 196 |
GO:0005524
GO:0016887 |
| AF-A0A7V4SRL2-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9568 | 7 | 178 |
GO:0005524
GO:0016887 |