F489199

General Info

Members Datasets Scaffolds Average Seq Length
1057 479 2114 331

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10219233|Ga0075365_102192332
Length 381
Sequence MIRKSGHRFSEKIMLKKKMIDEHDSTLLKHALEFEKSIKTINNIRRNTMKRRDFIKLSAGLGATMAATTPLSSAFAQTKMVLKASDVHPLGYPTVEAVVRMGKKLEAATNGRLTIQMFPSMQLGGEKEMIEQAQLGALQIARISVGAVGPVVDDVNVFNMPFVFRNSKHMEKVIDGEIGDELLAKISAAEKTGLIALCWMNAGSRNVYNNKRPIKTIADLKGLKVRMMGNPLFVDTMNALGGNGVALGFDQVFSSMQTGVVDGAENNPPSFIAQNHYQVAKYFTMTEHLIIPELLVFSRISWQKLSPEDQALIKKLSKETQAEQRVLWYEAENAAIEKMKAAGTEIITDIDKKPFQDAVKPVWDKYGAKYAAMVKRIEAVN

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
199 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
203 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
263 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
264 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
265 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
377 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
378 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
379 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
380 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
399 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
400 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
401 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
404 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
406 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
407 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
408 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
409 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
410 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
411 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
412 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
413 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
414 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
415 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
416 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
417 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
418 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
419 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
420 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
423 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
424 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
425 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
426 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
427 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
431 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
432 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
433 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
434 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
435 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
437 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
438 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
439 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
440 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
441 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
442 2791355199
443 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
444 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
445 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
446 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
447 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
448 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
449 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
450 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
451 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
452 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
453 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
454 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
455 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
456 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
457 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
458 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
459 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
460 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
461 2922425934
462 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
463 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
464 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
465 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
466 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
467 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
468 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
469 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
470 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
471 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
472 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
473 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
474 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
475 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
476 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
477 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
478 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
479 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0.47
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.58
Nodule 2.55
Rhizoplane 4.82
Rhizosphere 73.7
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10219233 3300006038 Bacteria 1334
2 rootH2_10076215 3300003320 Bacteria 2795
3 Ga0065165_1031353 3300005262 Bacteria 1681
4 Ga0065712_10010742 3300005290 Bacteria 3141
5 Ga0070658_10134615 3300005327 Bacteria 2061
6 Ga0070658_10166078 3300005327 Bacteria 1853
7 Ga0070683_100010779 3300005329 Bacteria 7866
8 Ga0070683_100033581 3300005329 Bacteria 4680
9 Ga0068869_100161773 3300005334 Bacteria 1743
10 Ga0070666_10007550 3300005335 Bacteria 6705
11 Ga0070680_100003232 3300005336 Bacteria 12125
12 Ga0070680_100023993 3300005336 Bacteria 4868
13 Ga0070680_100111433 3300005336 Bacteria 2278
14 Ga0068868_100006674 3300005338 Bacteria 8190
15 Ga0070660_100054851 3300005339 Bacteria 3079
16 Ga0070689_100018748 3300005340 Bacteria 5104
17 Ga0070661_100031364 3300005344 Bacteria 3843
18 Ga0070661_100047804 3300005344 Bacteria 3131
19 Ga0070661_100374093 3300005344 Bacteria 1122
20 Ga0070692_10177951 3300005345 Bacteria 1231
21 Ga0070668_100063107 3300005347 Bacteria 2871
22 Ga0070668_100282663 3300005347 Bacteria 1386
23 Ga0070675_100282785 3300005354 Bacteria 1458
24 Ga0070671_100074767 3300005355 Bacteria 2831
25 Ga0070671_100102394 3300005355 Bacteria 2403
26 Ga0070671_100439400 3300005355 Bacteria 1119
27 Ga0070674_100005057 3300005356 Bacteria 7582
28 Ga0070674_100240705 3300005356 Bacteria 1416
29 Ga0070674_100247513 3300005356 Bacteria 1398
30 Ga0070673_100092917 3300005364 Bacteria 2469
31 Ga0070673_100127565 3300005364 Bacteria 2130
32 Ga0070673_100333033 3300005364 Bacteria 1343
33 Ga0070688_100018632 3300005365 Bacteria 4009
34 Ga0070659_100055656 3300005366 Bacteria 3118
35 Ga0070667_100007371 3300005367 Bacteria 9134
36 Ga0070667_100150126 3300005367 Bacteria 2047
37 Ga0070703_10000651 3300005406 Bacteria 12106
38 Ga0070709_10029048 3300005434 Bacteria 3303
39 Ga0070709_10077546 3300005434 Bacteria 2160
40 Ga0070709_10111416 3300005434 Bacteria 1840
41 Ga0070714_100022197 3300005435 Bacteria 5203
42 Ga0070714_100027863 3300005435 Bacteria 4681
43 Ga0070714_100061698 3300005435 Bacteria 3220
44 Ga0070714_100071718 3300005435 Bacteria 2996
45 Ga0070714_100132616 3300005435 Bacteria 2227
46 Ga0070714_100226567 3300005435 Bacteria 1720
47 Ga0070714_100524121 3300005435 Bacteria 1132
48 Ga0070713_100004734 3300005436 Bacteria 9199
49 Ga0070713_100014299 3300005436 Bacteria 5889
50 Ga0070713_100065457 3300005436 Bacteria 3053
51 Ga0070713_100068131 3300005436 Bacteria 2998
52 Ga0070713_100152241 3300005436 Bacteria 2058
53 Ga0070713_100232694 3300005436 Bacteria 1676
54 Ga0070713_100316426 3300005436 Bacteria 1440
55 Ga0070710_10000586 3300005437 Bacteria 17299
56 Ga0070710_10003922 3300005437 Bacteria 7049
57 Ga0070710_10014356 3300005437 Bacteria 3986
58 Ga0070710_10019605 3300005437 Bacteria 3497
59 Ga0070710_10136760 3300005437 Bacteria 1499
60 Ga0070701_10064051 3300005438 Bacteria 1947
61 Ga0070701_10119509 3300005438 Bacteria 1483
62 Ga0070711_100005860 3300005439 Bacteria 7376
63 Ga0070711_100009005 3300005439 Bacteria 6128
64 Ga0070711_100017661 3300005439 Bacteria 4545
65 Ga0070711_100024621 3300005439 Bacteria 3929
66 Ga0070711_100048425 3300005439 Bacteria 2906
67 Ga0070705_100000101 3300005440 Bacteria 48577
68 Ga0070705_100116207 3300005440 Bacteria 1719
69 Ga0070705_100162470 3300005440 Bacteria 1495
70 Ga0070700_100150960 3300005441 Bacteria 1589
71 Ga0070694_100000321 3300005444 Bacteria 25869
72 Ga0070694_100022228 3300005444 Bacteria 4062
73 Ga0070694_100160533 3300005444 Bacteria 1649
74 Ga0070708_100000726 3300005445 Bacteria 25018
75 Ga0070708_100011955 3300005445 Bacteria 7074
76 Ga0070708_100195848 3300005445 Bacteria 1891
77 Ga0070708_100267045 3300005445 Bacteria 1609
78 Ga0070663_100007449 3300005455 Bacteria 6658
79 Ga0070663_100023527 3300005455 Bacteria 4131
80 Ga0070663_100144753 3300005455 Bacteria 1817
81 Ga0070678_100027852 3300005456 Bacteria 3843
82 Ga0070678_100289694 3300005456 Bacteria 1387
83 Ga0070662_100013385 3300005457 Bacteria 5459
84 Ga0070662_100255726 3300005457 Bacteria 1410
85 Ga0070662_100281124 3300005457 Bacteria 1347
86 Ga0070681_10025308 3300005458 Bacteria 5969
87 Ga0070681_10106355 3300005458 Bacteria 2747
88 Ga0070681_10128227 3300005458 Bacteria 2470
89 Ga0068867_100026332 3300005459 Bacteria 4176
90 Ga0068867_100036340 3300005459 Bacteria 3575
91 Ga0068867_100243206 3300005459 Bacteria 1460
92 Ga0070685_10030190 3300005466 Bacteria 3018
93 Ga0070706_100021627 3300005467 Bacteria 5924
94 Ga0070706_100431953 3300005467 Bacteria 1226
95 Ga0070707_100330174 3300005468 Bacteria 1482
96 Ga0070698_100264832 3300005471 Bacteria 1651
97 Ga0070699_100000281 3300005518 Bacteria 48573
98 Ga0070679_100045232 3300005530 Bacteria 4387
99 Ga0070679_100232077 3300005530 Bacteria 1804
100 Ga0070684_100006541 3300005535 Bacteria 9022
101 Ga0070684_100250818 3300005535 Bacteria 1618
102 Ga0070697_100008863 3300005536 Bacteria 7853
103 Ga0070697_100028285 3300005536 Bacteria 4488
104 Ga0068853_100155935 3300005539 Bacteria 2058
105 Ga0070672_100010256 3300005543 Bacteria 6492
106 Ga0070672_100075256 3300005543 Bacteria 2695
107 Ga0070672_100371081 3300005543 Bacteria 1223
108 Ga0070695_100004104 3300005545 Bacteria 8515
109 Ga0070695_100014438 3300005545 Bacteria 4762
110 Ga0070695_100214542 3300005545 Bacteria 1383
111 Ga0070696_100000811 3300005546 Bacteria 20108
112 Ga0070696_100175334 3300005546 Bacteria 1588
113 Ga0070696_100193126 3300005546 Bacteria 1516
114 Ga0070693_100007751 3300005547 Bacteria 5264
115 Ga0070693_100022290 3300005547 Bacteria 3365
116 Ga0070665_100141231 3300005548 Bacteria 2411
117 Ga0070704_100099583 3300005549 Bacteria 2186
118 Ga0068855_100022696 3300005563 Bacteria 7520
119 Ga0068855_100064892 3300005563 Bacteria 4258
120 Ga0068855_100174539 3300005563 Bacteria 2433
121 Ga0068855_100600849 3300005563 Bacteria 1186
122 Ga0070664_100046730 3300005564 Bacteria 3657
123 Ga0070664_100109474 3300005564 Bacteria 2410
124 Ga0070664_100113488 3300005564 Bacteria 2367
125 Ga0068857_100003319 3300005577 Bacteria 13380
126 Ga0068857_100075134 3300005577 Bacteria 3013
127 Ga0068857_100154781 3300005577 Bacteria 2078
128 Ga0068857_100170743 3300005577 Bacteria 1977
129 Ga0068857_100317361 3300005577 Bacteria 1438
130 Ga0068854_100019516 3300005578 Bacteria 4571
131 Ga0068854_100090515 3300005578 Bacteria 2275
132 Ga0068856_100000066 3300005614 Bacteria 98376
133 Ga0068856_100023411 3300005614 Bacteria 6005
134 Ga0068856_100033294 3300005614 Bacteria 5045
135 Ga0068856_100110066 3300005614 Bacteria 2751
136 Ga0068856_100376605 3300005614 Bacteria 1438
137 Ga0070702_100065280 3300005615 Bacteria 2132
138 Ga0070702_100096815 3300005615 Bacteria 1802
139 Ga0070702_100121592 3300005615 Bacteria 1635
140 Ga0068852_100002462 3300005616 Bacteria 12744
141 Ga0068852_100010672 3300005616 Bacteria 6877
142 Ga0068852_100119821 3300005616 Bacteria 2407
143 Ga0068859_100006260 3300005617 Bacteria 12073
144 Ga0068859_100011754 3300005617 Bacteria 8795
145 Ga0068859_100018584 3300005617 Bacteria 6988
146 Ga0068859_100182333 3300005617 Bacteria 2182
147 Ga0068864_100089468 3300005618 Bacteria 2712
148 Ga0068864_100416446 3300005618 Bacteria 1279
149 Ga0068864_100499749 3300005618 Bacteria 1170
150 Ga0068866_10022649 3300005718 Bacteria 2910
151 Ga0068866_10158523 3300005718 Bacteria 1317
152 Ga0068861_100035422 3300005719 Bacteria 3697
153 Ga0068861_100037067 3300005719 Bacteria 3624
154 Ga0068861_100351674 3300005719 Bacteria 1293
155 Ga0068870_10143662 3300005840 Bacteria 1399
156 Ga0068863_100005165 3300005841 Bacteria 12873
157 Ga0068863_100074770 3300005841 Bacteria 3205
158 Ga0068863_100169221 3300005841 Bacteria 2095
159 Ga0068858_100016247 3300005842 Bacteria 6992
160 Ga0068858_100022839 3300005842 Bacteria 5834
161 Ga0068858_100255861 3300005842 Bacteria 1664
162 Ga0068858_100258420 3300005842 Bacteria 1655
163 Ga0068860_100001582 3300005843 Bacteria 24502
164 Ga0068860_100004600 3300005843 Bacteria 14090
165 Ga0068860_100030287 3300005843 Bacteria 5205
166 Ga0081455_10000014 3300005937 Bacteria 193884
167 Ga0081455_10003956 3300005937 Bacteria 16827
168 Ga0081455_10004726 3300005937 Bacteria 15138
169 Ga0081455_10041561 3300005937 Bacteria 4041
170 Ga0081540_1001902 3300005983 Bacteria 17470
171 Ga0081540_1033630 3300005983 Bacteria 2780
172 Ga0081540_1034190 3300005983 Bacteria 2746
173 Ga0081539_10020579 3300005985 Bacteria 4452
174 Ga0081539_10069592 3300005985 Bacteria 1893
175 Ga0070717_10000926 3300006028 Bacteria 19535
176 Ga0070717_10317791 3300006028 Bacteria 1387
177 Ga0075365_10019309 3300006038 Bacteria 4206
178 Ga0075365_10020412 3300006038 Bacteria 4107
179 Ga0075365_10121584 3300006038 Bacteria 1801
180 Ga0075365_10146985 3300006038 Bacteria 1638
181 Ga0075368_10008841 3300006042 Bacteria 3607
182 Ga0075368_10058639 3300006042 Bacteria 1539
183 Ga0075363_100009358 3300006048 Bacteria 4604
184 Ga0075363_100044157 3300006048 Bacteria 2360
185 Ga0075363_100078670 3300006048 Bacteria 1800
186 Ga0075364_10002466 3300006051 Bacteria 10364
187 Ga0075364_10006004 3300006051 Bacteria 7098
188 Ga0075364_10009887 3300006051 Bacteria 5738
189 Ga0075364_10030814 3300006051 Bacteria 3444
190 Ga0075364_10059980 3300006051 Bacteria 2495
191 Ga0070715_10089756 3300006163 Bacteria 1412
192 Ga0070715_10095021 3300006163 Bacteria 1379
193 Ga0070716_100075350 3300006173 Bacteria 1996
194 Ga0070716_100076581 3300006173 Bacteria 1983
195 Ga0070716_100130746 3300006173 Bacteria 1586
196 Ga0070716_100200234 3300006173 Bacteria 1327
197 Ga0070712_100000412 3300006175 Bacteria 24423
198 Ga0070712_100006858 3300006175 Bacteria 7096
199 Ga0070712_100028515 3300006175 Bacteria 3734
200 Ga0070712_100028607 3300006175 Bacteria 3729
201 Ga0070712_100060845 3300006175 Bacteria 2665
202 Ga0070712_100092789 3300006175 Bacteria 2215
203 Ga0070712_100099906 3300006175 Bacteria 2143
204 Ga0070712_100105892 3300006175 Bacteria 2089
205 Ga0070712_100148536 3300006175 Bacteria 1797
206 Ga0070712_100353300 3300006175 Bacteria 1204
207 Ga0075362_10000965 3300006177 Bacteria 8804
208 Ga0075362_10008875 3300006177 Bacteria 3865
209 Ga0075362_10046267 3300006177 Bacteria 1934
210 Ga0075367_10000878 3300006178 Bacteria 12058
211 Ga0075367_10001658 3300006178 Bacteria 9706
212 Ga0075367_10004378 3300006178 Bacteria 6887
213 Ga0075367_10011660 3300006178 Bacteria 4662
214 Ga0075367_10038372 3300006178 Bacteria 2788
215 Ga0075367_10041143 3300006178 Bacteria 2701
216 Ga0075367_10076025 3300006178 Bacteria 2026
217 Ga0075369_10026428 3300006186 Bacteria 2419
218 Ga0075366_10006131 3300006195 Bacteria 6555
219 Ga0075366_10029088 3300006195 Bacteria 3245
220 Ga0075366_10081172 3300006195 Bacteria 1937
221 Ga0075366_10107745 3300006195 Bacteria 1675
222 Ga0097621_100089872 3300006237 Bacteria 2569
223 Ga0075370_10015337 3300006353 Bacteria 4100
224 Ga0075370_10134592 3300006353 Bacteria 1443
225 Ga0068871_100149386 3300006358 Bacteria 1992
226 Ga0068871_100152040 3300006358 Bacteria 1974
227 Ga0075428_100140325 3300006844 Bacteria 2628
228 Ga0075428_100422791 3300006844 Bacteria 1428
229 Ga0075430_100004348 3300006846 Bacteria 11969
230 Ga0075431_100005249 3300006847 Bacteria 12758
231 Ga0075433_10011738 3300006852 Bacteria 7054
232 Ga0075434_100005130 3300006871 Bacteria 11896
233 Ga0075434_100006402 3300006871 Bacteria 10789
234 Ga0068865_100073788 3300006881 Bacteria 2427
235 Ga0075436_100001047 3300006914 Bacteria 18675
236 Ga0075436_100105359 3300006914 Bacteria 1966
237 Ga0075436_100274854 3300006914 Bacteria 1204
238 Ga0097620_100006260 3300006931 Bacteria 12073
239 Ga0097620_100011754 3300006931 Bacteria 8795
240 Ga0097620_100018584 3300006931 Bacteria 6988
241 Ga0097620_100182326 3300006931 Bacteria 2182
242 Ga0075435_100019399 3300007076 Bacteria 5194
243 Ga0075435_100315385 3300007076 Bacteria 1338
244 Ga0099794_10029160 3300007265 Bacteria 2570
245 Ga0099794_10061249 3300007265 Bacteria 1828
246 Ga0099794_10093188 3300007265 Bacteria 1497
247 Ga0099795_10030171 3300007788 Bacteria 1859
248 Ga0099795_10034282 3300007788 Bacteria 1768
249 Ga0099795_10062935 3300007788 Bacteria 1381
250 Ga0105240_10006645 3300009093 Bacteria 16975
251 Ga0105240_10007301 3300009093 Bacteria 16084
252 Ga0105240_10070911 3300009093 Bacteria 4309
253 Ga0105240_10088210 3300009093 Bacteria 3796
254 Ga0105240_10330018 3300009093 Bacteria 1736
255 Ga0105240_10410743 3300009093 Bacteria 1523
256 Ga0111539_10004677 3300009094 Bacteria 17885
257 Ga0111539_10009581 3300009094 Bacteria 12223
258 Ga0111539_10013311 3300009094 Bacteria 10280
259 Ga0111539_10151813 3300009094 Bacteria 2711
260 Ga0105245_10004067 3300009098 Bacteria 12992
261 Ga0105245_10006433 3300009098 Bacteria 10340
262 Ga0105245_10031288 3300009098 Bacteria 4708
263 Ga0105245_10038950 3300009098 Bacteria 4230
264 Ga0105245_10065437 3300009098 Bacteria 3288
265 Ga0105245_10088645 3300009098 Bacteria 2842
266 Ga0105247_10021588 3300009101 Bacteria 3875
267 Ga0105247_10036022 3300009101 Bacteria 3017
268 Ga0105247_10070772 3300009101 Bacteria 2180
269 Ga0105247_10108410 3300009101 Bacteria 1784
270 Ga0105247_10116130 3300009101 Bacteria 1728
271 Ga0114129_10082645 3300009147 Bacteria 4462
272 Ga0114129_10203496 3300009147 Bacteria 2680
273 Ga0105241_10018995 3300009174 Bacteria 5066
274 Ga0105241_10038542 3300009174 Bacteria 3603
275 Ga0105241_10074324 3300009174 Bacteria 2647
276 Ga0105241_10097895 3300009174 Bacteria 2327
277 Ga0105242_10037241 3300009176 Bacteria 3906
278 Ga0105242_10061497 3300009176 Bacteria 3089
279 Ga0105242_10189410 3300009176 Bacteria 1820
280 Ga0105242_10262216 3300009176 Bacteria 1561
281 Ga0105242_10311372 3300009176 Bacteria 1441
282 Ga0105242_10313176 3300009176 Bacteria 1437
283 Ga0105248_10007036 3300009177 Bacteria 12323
284 Ga0105237_10005677 3300009545 Bacteria 14037
285 Ga0105237_10070763 3300009545 Bacteria 3484
286 Ga0105237_10082031 3300009545 Bacteria 3216
287 Ga0105237_10103825 3300009545 Bacteria 2834
288 Ga0105237_10131053 3300009545 Bacteria 2502
289 Ga0105237_10164168 3300009545 Bacteria 2220
290 Ga0105237_10474604 3300009545 Bacteria 1257
291 Ga0105238_10025920 3300009551 Bacteria 5977
292 Ga0105238_10031915 3300009551 Bacteria 5360
293 Ga0105238_10078885 3300009551 Bacteria 3283
294 Ga0105238_10136335 3300009551 Bacteria 2432
295 Ga0105238_10194210 3300009551 Bacteria 2006
296 Ga0105238_10445607 3300009551 Bacteria 1291
297 Ga0105238_10463432 3300009551 Bacteria 1265
298 Ga0105238_10496987 3300009551 Bacteria 1220
299 Ga0105249_10009590 3300009553 Bacteria 8483
300 Ga0099796_10000999 3300010159 Bacteria 5329
301 Ga0099796_10010628 3300010159 Bacteria 2537
302 Ga0099796_10014871 3300010159 Bacteria 2259
303 Ga0105239_10013662 3300010375 Bacteria 9016
304 Ga0105239_10035753 3300010375 Bacteria 5454
305 Ga0105239_10092226 3300010375 Bacteria 3343
306 Ga0105239_10243437 3300010375 Bacteria 2019
307 Ga0105239_10281693 3300010375 Bacteria 1871
308 Ga0105239_10411731 3300010375 Bacteria 1531
309 Ga0105246_10010353 3300011119 Bacteria 5768
310 Ga0157373_10054362 3300013100 Bacteria 2845
311 Ga0157371_10012441 3300013102 Bacteria 6504
312 Ga0157370_10034068 3300013104 Bacteria 4962
313 Ga0157370_10070950 3300013104 Bacteria 3287
314 Ga0157369_10004338 3300013105 Bacteria 16741
315 Ga0157369_10010807 3300013105 Bacteria 10395
316 Ga0157374_10012898 3300013296 Bacteria 7279
317 Ga0157374_10149490 3300013296 Bacteria 2270
318 Ga0157374_10171838 3300013296 Bacteria 2114
319 Ga0157378_10001343 3300013297 Bacteria 22101
320 Ga0157378_10086729 3300013297 Bacteria 2838
321 Ga0157378_10249206 3300013297 Bacteria 1700
322 Ga0157378_10318426 3300013297 Bacteria 1510
323 Ga0157378_10324029 3300013297 Bacteria 1498
324 Ga0163162_10007091 3300013306 Bacteria 10875
325 Ga0163162_10024766 3300013306 Bacteria 5927
326 Ga0163162_10060820 3300013306 Bacteria 3814
327 Ga0163162_10153308 3300013306 Bacteria 2423
328 Ga0157372_10049063 3300013307 Bacteria 4693
329 Ga0157372_10104355 3300013307 Bacteria 3240
330 Ga0157372_10265177 3300013307 Bacteria 1994
331 Ga0157375_10003647 3300013308 Bacteria 13358
332 Ga0157375_10260714 3300013308 Bacteria 1895
333 Ga0157375_10434064 3300013308 Bacteria 1479
334 Ga0163163_10009357 3300014325 Bacteria 8746
335 Ga0157380_10089746 3300014326 Bacteria 2533
336 Ga0157380_10193031 3300014326 Bacteria 1800
337 Ga0182008_10054953 3300014497 Bacteria 1969
338 Ga0157379_10000412 3300014968 Bacteria 34763
339 Ga0157376_10017075 3300014969 Bacteria 5527
340 Ga0157376_10249774 3300014969 Bacteria 1656
341 Ga0213874_10004128 3300021377 Bacteria 3282
342 Ga0213874_10049022 3300021377 Bacteria 1290
343 Ga0213876_10005223 3300021384 Bacteria 7159
344 Ga0213876_10076446 3300021384 Bacteria 1768
345 Ga0213875_10000030 3300021388 Bacteria 178500
346 Ga0209563_106750 3300025230 Bacteria 1946
347 Ga0209677_100749 3300025253 Bacteria 16460
348 Ga0209148_1000711 3300025254 Bacteria 26722
349 Ga0209233_1002053 3300025261 Bacteria 7631
350 Ga0209233_1005766 3300025261 Bacteria 4072
351 Ga0209233_1017691 3300025261 Bacteria 1936
352 Ga0209455_1001471 3300025272 Bacteria 10598
353 Ga0209455_1002106 3300025272 Bacteria 7942
354 Ga0209455_1017435 3300025272 Bacteria 1505
355 Ga0209564_1000503 3300025295 Bacteria 64437
356 Ga0209564_1024573 3300025295 Bacteria 2055
357 Ga0209758_1003246 3300025297 Bacteria 15078
358 Ga0209758_1013786 3300025297 Bacteria 4370
359 Ga0207653_10004798 3300025885 Bacteria 4229
360 Ga0207682_10046666 3300025893 Bacteria 1781
361 Ga0207692_10000750 3300025898 Bacteria 11461
362 Ga0207692_10021336 3300025898 Bacteria 2962
363 Ga0207692_10028491 3300025898 Bacteria 2642
364 Ga0207692_10043154 3300025898 Bacteria 2242
365 Ga0207642_10036265 3300025899 Bacteria 2115
366 Ga0207710_10025386 3300025900 Bacteria 2557
367 Ga0207710_10062801 3300025900 Bacteria 1689
368 Ga0207688_10068602 3300025901 Bacteria 2008
369 Ga0207688_10095562 3300025901 Bacteria 1710
370 Ga0207680_10003578 3300025903 Bacteria 7301
371 Ga0207685_10084654 3300025905 Bacteria 1321
372 Ga0207699_10041705 3300025906 Bacteria 2653
373 Ga0207699_10082446 3300025906 Bacteria 1998
374 Ga0207699_10279938 3300025906 Bacteria 1159
375 Ga0207645_10055417 3300025907 Bacteria 2531
376 Ga0207643_10050130 3300025908 Bacteria 2367
377 Ga0207643_10115471 3300025908 Bacteria 1585
378 Ga0207705_10261882 3300025909 Bacteria 1320
379 Ga0207684_10048203 3300025910 Bacteria 3613
380 Ga0207707_10009615 3300025912 Bacteria 8389
381 Ga0207707_10038943 3300025912 Bacteria 4155
382 Ga0207707_10045184 3300025912 Bacteria 3838
383 Ga0207707_10049476 3300025912 Bacteria 3662
384 Ga0207695_10000029 3300025913 Bacteria 548364
385 Ga0207695_10111957 3300025913 Bacteria 2708
386 Ga0207695_10134869 3300025913 Bacteria 2423
387 Ga0207695_10166253 3300025913 Bacteria 2134
388 Ga0207695_10176901 3300025913 Bacteria 2056
389 Ga0207695_10189865 3300025913 Bacteria 1972
390 Ga0207695_10384490 3300025913 Bacteria 1289
391 Ga0207671_10002337 3300025914 Bacteria 20455
392 Ga0207671_10042369 3300025914 Bacteria 3369
393 Ga0207671_10052329 3300025914 Bacteria 3026
394 Ga0207671_10137655 3300025914 Bacteria 1879
395 Ga0207693_10000969 3300025915 Bacteria 25801
396 Ga0207693_10001536 3300025915 Bacteria 20416
397 Ga0207693_10002407 3300025915 Bacteria 16244
398 Ga0207693_10015794 3300025915 Bacteria 6049
399 Ga0207693_10020767 3300025915 Bacteria 5223
400 Ga0207693_10022603 3300025915 Bacteria 4996
401 Ga0207693_10029915 3300025915 Bacteria 4298
402 Ga0207693_10031820 3300025915 Bacteria 4168
403 Ga0207693_10035068 3300025915 Bacteria 3957
404 Ga0207693_10069433 3300025915 Bacteria 2757
405 Ga0207693_10178367 3300025915 Bacteria 1671
406 Ga0207663_10000225 3300025916 Bacteria 25184
407 Ga0207663_10019032 3300025916 Bacteria 3859
408 Ga0207663_10081597 3300025916 Bacteria 2118
409 Ga0207663_10097744 3300025916 Bacteria 1964
410 Ga0207663_10163793 3300025916 Bacteria 1573
411 Ga0207663_10297012 3300025916 Bacteria 1205
412 Ga0207663_10308822 3300025916 Bacteria 1184
413 Ga0207660_10024703 3300025917 Bacteria 4071
414 Ga0207660_10027553 3300025917 Bacteria 3879
415 Ga0207660_10108645 3300025917 Bacteria 2083
416 Ga0207660_10217939 3300025917 Bacteria 1497
417 Ga0207660_10322887 3300025917 Bacteria 1233
418 Ga0207662_10140382 3300025918 Bacteria 1530
419 Ga0207657_10068585 3300025919 Bacteria 3012
420 Ga0207657_10122290 3300025919 Bacteria 2141
421 Ga0207649_10117838 3300025920 Bacteria 1785
422 Ga0207649_10124143 3300025920 Bacteria 1745
423 Ga0207652_10015556 3300025921 Bacteria 6189
424 Ga0207652_10057386 3300025921 Bacteria 3353
425 Ga0207652_10243145 3300025921 Bacteria 1623
426 Ga0207652_10336385 3300025921 Bacteria 1363
427 Ga0207646_10290149 3300025922 Bacteria 1478
428 Ga0207694_10048261 3300025924 Bacteria 3294
429 Ga0207694_10097763 3300025924 Bacteria 2323
430 Ga0207694_10156368 3300025924 Bacteria 1839
431 Ga0207694_10217054 3300025924 Bacteria 1559
432 Ga0207694_10347220 3300025924 Bacteria 1228
433 Ga0207650_10162045 3300025925 Bacteria 1773
434 Ga0207659_10086397 3300025926 Bacteria 2332
435 Ga0207659_10162476 3300025926 Bacteria 1755
436 Ga0207659_10197627 3300025926 Bacteria 1604
437 Ga0207687_10005601 3300025927 Bacteria 8301
438 Ga0207687_10010336 3300025927 Bacteria 6100
439 Ga0207687_10081405 3300025927 Bacteria 2340
440 Ga0207700_10012696 3300025928 Bacteria 5445
441 Ga0207700_10013786 3300025928 Bacteria 5274
442 Ga0207700_10045624 3300025928 Bacteria 3235
443 Ga0207700_10070128 3300025928 Bacteria 2693
444 Ga0207700_10093357 3300025928 Bacteria 2381
445 Ga0207700_10162139 3300025928 Bacteria 1858
446 Ga0207700_10279601 3300025928 Bacteria 1435
447 Ga0207664_10002384 3300025929 Bacteria 12422
448 Ga0207664_10020293 3300025929 Bacteria 4922
449 Ga0207664_10039165 3300025929 Bacteria 3679
450 Ga0207664_10092565 3300025929 Bacteria 2481
451 Ga0207664_10116449 3300025929 Bacteria 2230
452 Ga0207664_10122745 3300025929 Bacteria 2176
453 Ga0207664_10124832 3300025929 Bacteria 2160
454 Ga0207664_10254575 3300025929 Bacteria 1533
455 Ga0207644_10004181 3300025931 Bacteria 9365
456 Ga0207644_10077380 3300025931 Bacteria 2450
457 Ga0207644_10128624 3300025931 Bacteria 1936
458 Ga0207690_10019392 3300025932 Bacteria 4187
459 Ga0207706_10015114 3300025933 Bacteria 6985
460 Ga0207706_10050826 3300025933 Bacteria 3662
461 Ga0207706_10055534 3300025933 Bacteria 3492
462 Ga0207706_10063408 3300025933 Bacteria 3254
463 Ga0207686_10006380 3300025934 Bacteria 6346
464 Ga0207686_10043238 3300025934 Bacteria 2759
465 Ga0207686_10154173 3300025934 Bacteria 1603
466 Ga0207670_10006134 3300025936 Bacteria 6648
467 Ga0207669_10034219 3300025937 Bacteria 2877
468 Ga0207669_10114508 3300025937 Bacteria 1815
469 Ga0207704_10142974 3300025938 Bacteria 1677
470 Ga0207704_10382641 3300025938 Bacteria 1105
471 Ga0207665_10000243 3300025939 Bacteria 37399
472 Ga0207665_10027338 3300025939 Bacteria 3769
473 Ga0207665_10032689 3300025939 Bacteria 3445
474 Ga0207665_10114189 3300025939 Bacteria 1901
475 Ga0207665_10270736 3300025939 Bacteria 1261
476 Ga0207691_10006249 3300025940 Bacteria 11505
477 Ga0207691_10070297 3300025940 Bacteria 3161
478 Ga0207691_10086046 3300025940 Bacteria 2821
479 Ga0207691_10261679 3300025940 Bacteria 1491
480 Ga0207711_10005199 3300025941 Bacteria 11021
481 Ga0207689_10025104 3300025942 Bacteria 4996
482 Ga0207689_10052282 3300025942 Bacteria 3366
483 Ga0207689_10136032 3300025942 Bacteria 2023
484 Ga0207689_10141898 3300025942 Bacteria 1979
485 Ga0207661_10001465 3300025944 Bacteria 15950
486 Ga0207661_10097163 3300025944 Bacteria 2466
487 Ga0207661_10155469 3300025944 Bacteria 1980
488 Ga0207661_10190835 3300025944 Bacteria 1796
489 Ga0207661_10524653 3300025944 Bacteria 1083
490 Ga0207679_10074164 3300025945 Bacteria 2577
491 Ga0207679_10125731 3300025945 Bacteria 2049
492 Ga0207679_10214564 3300025945 Bacteria 1616
493 Ga0207667_10098999 3300025949 Bacteria 3008
494 Ga0207712_10005744 3300025961 Bacteria 7821
495 Ga0207640_10125890 3300025981 Bacteria 1845
496 Ga0207677_10000152 3300026023 Bacteria 55261
497 Ga0207677_10039784 3300026023 Bacteria 3094
498 Ga0207677_10159676 3300026023 Bacteria 1750
499 Ga0207639_10111884 3300026041 Bacteria 2227
500 Ga0207639_10315654 3300026041 Bacteria 1386
501 Ga0207678_10001761 3300026067 Bacteria 19821
502 Ga0207678_10038587 3300026067 Bacteria 4149
503 Ga0207678_10286843 3300026067 Bacteria 1413
504 Ga0207708_10004485 3300026075 Bacteria 10286
505 Ga0207708_10100101 3300026075 Bacteria 2242
506 Ga0207708_10154577 3300026075 Bacteria 1808
507 Ga0207702_10000044 3300026078 Bacteria 149419
508 Ga0207702_10024967 3300026078 Bacteria 4958
509 Ga0207702_10025069 3300026078 Bacteria 4947
510 Ga0207702_10029073 3300026078 Bacteria 4597
511 Ga0207702_10185087 3300026078 Bacteria 1920
512 Ga0207702_10229012 3300026078 Bacteria 1736
513 Ga0207702_10241583 3300026078 Bacteria 1692
514 Ga0207641_10007382 3300026088 Bacteria 9149
515 Ga0207641_10044711 3300026088 Bacteria 3725
516 Ga0207641_10074448 3300026088 Bacteria 2929
517 Ga0207648_10135873 3300026089 Bacteria 2166
518 Ga0207648_10142309 3300026089 Bacteria 2114
519 Ga0207676_10014486 3300026095 Bacteria 5675
520 Ga0207676_10018694 3300026095 Bacteria 5044
521 Ga0207676_10075567 3300026095 Bacteria 2718
522 Ga0207674_10001070 3300026116 Bacteria 35647
523 Ga0207674_10001334 3300026116 Bacteria 31998
524 Ga0207674_10033029 3300026116 Bacteria 5422
525 Ga0207674_10042363 3300026116 Bacteria 4702
526 Ga0207674_10055622 3300026116 Bacteria 4022
527 Ga0207674_10092025 3300026116 Bacteria 3022
528 Ga0207675_100185749 3300026118 Bacteria 1992
529 Ga0207675_100368702 3300026118 Bacteria 1410
530 Ga0207683_10010764 3300026121 Bacteria 7798
531 Ga0207683_10018922 3300026121 Bacteria 5876
532 Ga0207683_10020117 3300026121 Bacteria 5706
533 Ga0207698_10035554 3300026142 Bacteria 3646
534 Ga0209813_10015031 3300027866 Bacteria 2091
535 Ga0207428_10044709 3300027907 Bacteria 3571
536 Ga0207428_10072180 3300027907 Bacteria 2710
537 Ga0207428_10169532 3300027907 Bacteria 1654
538 Ga0268266_10023001 3300028379 Bacteria 5304
539 Ga0268266_10075373 3300028379 Bacteria 2930
540 Ga0268266_10129370 3300028379 Bacteria 2256
541 Ga0268266_10129620 3300028379 Bacteria 2254
542 Ga0268265_10005167 3300028380 Bacteria 8941
543 Ga0268265_10238919 3300028380 Bacteria 1602
544 Ga0268264_10000020 3300028381 Bacteria 483593
545 Ga0268264_10008583 3300028381 Bacteria 8489
546 Ga0268264_10017114 3300028381 Bacteria 5936
547 Ga0268264_10193957 3300028381 Bacteria 1853
548 Ga0265337_1006750 3300028556 Bacteria 4373
549 Ga0265326_10038516 3300028558 Bacteria 1358
550 Ga0265334_10002301 3300028573 Bacteria 8979
551 Ga0265318_10005804 3300028577 Bacteria 5756
552 Ga0265323_10000169 3300028653 Bacteria 38978
553 Ga0265322_10004434 3300028654 Bacteria 4184
554 Ga0265336_10000663 3300028666 Bacteria 18699
555 Ga0307517_10000053 3300028786 Bacteria 155723
556 Ga0307515_10060521 3300028794 Bacteria 5397
557 Ga0307515_10199845 3300028794 Bacteria 1878
558 Ga0265338_10000013 3300028800 Bacteria 379065
559 Ga0265324_10003787 3300029957 Bacteria 7067
560 Ga0265773_1001235 3300031018 Bacteria 1320
561 Ga0265760_10021107 3300031090 Bacteria 1882
562 Ga0265760_10060465 3300031090 Bacteria 1150
563 Ga0265330_10031036 3300031235 Bacteria 2396
564 Ga0265320_10110497 3300031240 Bacteria 1259
565 Ga0265325_10042997 3300031241 Bacteria 2359
566 Ga0265329_10042643 3300031242 Bacteria 1452
567 Ga0265340_10039967 3300031247 Bacteria 2311
568 Ga0265340_10067060 3300031247 Bacteria 1706
569 Ga0265339_10097647 3300031249 Bacteria 1533
570 Ga0265316_10139588 3300031344 Bacteria 1821
571 Ga0307513_10138904 3300031456 Bacteria 2360
572 Ga0307509_10276022 3300031507 Bacteria 1445
573 Ga0265313_10009853 3300031595 Bacteria 6148
574 Ga0307508_10000058 3300031616 Bacteria 125293
575 Ga0307508_10208897 3300031616 Bacteria 1553
576 Ga0265314_10022142 3300031711 Bacteria 4872
577 Ga0265314_10071456 3300031711 Bacteria 2322
578 Ga0265342_10083042 3300031712 Bacteria 1847
579 Ga0307516_10038551 3300031730 Bacteria 4768
580 Ga0307410_10112508 3300031852 Bacteria 1972
581 Ga0307412_10232424 3300031911 Bacteria 1421
582 Ga0307414_10253655 3300032004 Bacteria 1464
583 Ga0307411_10197156 3300032005 Bacteria 1543
584 Ga0316053_101306 3300032120 Bacteria 1303
585 Ga0307510_10165027 3300033180 Bacteria 1804
586 Ga0316215_1001197 3300033544 Bacteria 2518
587 Ga0373926_0013143 3300035083 Bacteria 2805
588 Ga0373926_0034568 3300035083 Bacteria 1790
589 Ga0373929_0006496 3300035085 Bacteria 2115
590 Ga0373934_0074664 3300035086 Bacteria 1358
591 Ga0373944_0013310 3300035089 Bacteria 2279
592 Ga0373944_0020457 3300035089 Bacteria 1907
593 Ga0373923_0029400 3300035111 Bacteria 2203
594 Ga0373936_0077081 3300035113 Bacteria 1382
595 Ga0373945_0030664 3300035116 Bacteria 1896
596 Ga0373945_0041011 3300035116 Bacteria 1673
597 Ga0373945_0101774 3300035116 Bacteria 1125
598 Ga0373953_0045980 3300035117 Bacteria 1751
599 Ga0373954_0015689 3300035118 Bacteria 3388
600 Ga0373943_0000625 3300035170 Bacteria 15319
601 Ga0373943_0046483 3300035170 Bacteria 2119
602 Ga0373943_0111657 3300035170 Bacteria 1442
603 Ga0373943_0117477 3300035170 Bacteria 1410
604 Ga0373924_0026717 3300035410 Bacteria 2291
605 Ga0373924_0035287 3300035410 Bacteria 2028
606 Ga0373931_0012802 3300035691 Bacteria 4072
607 Ga0373935_0050898 3300035692 Bacteria 2630
608 Ga0373935_0085244 3300035692 Bacteria 2059
609 Ga0373935_0139241 3300035692 Bacteria 1638
610 Ga0373935_0246781 3300035692 Bacteria 1248
611 Ga0373927_0000208 3300035695 Bacteria 46839
612 Ga0373927_0005624 3300035695 Bacteria 8614
613 Ga0373927_0007126 3300035695 Bacteria 7588
614 Ga0373927_0010764 3300035695 Bacteria 6093
615 Ga0373927_0034151 3300035695 Bacteria 3309
616 Ga0373927_0036366 3300035695 Bacteria 3202
617 Ga0373927_0102049 3300035695 Bacteria 1866
618 Ga0373927_0151223 3300035695 Bacteria 1520
619 Ga0373927_0193902 3300035695 Bacteria 1333
620 Ga0373933_0000052 3300035724 Bacteria 70592
621 Ga0373933_0043435 3300035724 Bacteria 2659
622 Ga0373933_0052699 3300035724 Bacteria 2435
623 Ga0373947_0000572 3300035725 Bacteria 21522
624 Ga0373947_0019808 3300035725 Bacteria 3882
625 Ga0373947_0106292 3300035725 Bacteria 1769
626 Ga0373947_0109238 3300035725 Bacteria 1746
627 Ga0373937_0003631 3300036401 Bacteria 13015
628 Ga0373937_0035244 3300036401 Bacteria 4554
629 Ga0373937_0047933 3300036401 Bacteria 3909
630 Ga0373937_0065599 3300036401 Bacteria 3343
631 Ga0373937_0128368 3300036401 Bacteria 2366
632 Ga0373937_0179707 3300036401 Bacteria 1987
633 Ga0373925_0002541 3300037068 Bacteria 14535
634 Ga0373925_0019815 3300037068 Bacteria 4895
635 Ga0373925_0026932 3300037068 Bacteria 4208
636 Ga0373925_0029850 3300037068 Bacteria 4000
637 Ga0373925_0047259 3300037068 Bacteria 3203
638 Ga0373925_0134557 3300037068 Bacteria 1930
639 Ga0395900_0029644 3300037418 Bacteria 5614
640 Ga0395898_0008229 3300037466 Bacteria 11026
641 Ga0395905_0417289 3300037471 Bacteria 1238
642 Ga0436364_0207431 3300037853 Bacteria 52858
643 Ga0436364_0716994 3300037853 Bacteria 1551
644 Ga0395901_0602840 3300038443 Bacteria 1107
645 Ga0400483_078811 3300039062 Bacteria 2073
646 Ga0400483_199136 3300039062 Bacteria 2091
647 Ga0400483_281213 3300039062 Unclassified 1677
648 Ga0436365_0086833 3300039437 Bacteria 3032
649 Ga0436365_0220203 3300039437 Bacteria 19855
650 Ga0436365_0289679 3300039437 Bacteria 2590
651 Ga0436365_0338285 3300039437 Bacteria 3069
652 Ga0436365_1165498 3300039437 Bacteria 1468
653 Ga0436365_1289758 3300039437 Bacteria 2013
654 Ga0436365_1742880 3300039437 Bacteria 1399
655 Ga0436365_1873205 3300039437 Bacteria 55177
656 Ga0436360_1354193 3300039438 Bacteria 2122
657 Ga0436361_0248960 3300039447 Bacteria 2175
658 Ga0436361_0324422 3300039447 Bacteria 3105
659 Ga0436361_0559458 3300039447 Bacteria 1854
660 Ga0436361_0963044 3300039447 Bacteria 2477
661 Ga0436363_0800589 3300039450 Bacteria 7194
662 Ga0439453_0000155 3300041408 Bacteria 6149
663 Ga0439465_0061524 3300041413 Bacteria 1245
664 Ga0451789_0018586 3300041443 Bacteria 1949
665 Ga0451800_0830467 3300041459 Bacteria 1188
666 Ga0439441_003763 3300042001 Bacteria 2261
667 Ga0439435_0004722 3300042436 Bacteria 2953
668 Ga0439460_0009225 3300042461 Bacteria 2503
669 Ga0439440_0009586 3300042993 Bacteria 2009
670 Ga0466969_0064388 3300044656 Bacteria 1775
671 Ga0466966_0032661 3300044684 Bacteria 3372
672 Ga0466966_0244635 3300044684 Bacteria 1081
673 Ga0466961_0056721 3300044693 Bacteria 2496
674 Ga0466963_0263441 3300044694 Bacteria 1210
675 Ga0466970_0026255 3300044765 Bacteria 3053
676 Ga0466970_0202672 3300044765 Bacteria 1104
677 Ga0466957_0032036 3300044842 Bacteria 3146
678 Ga0466959_0056634 3300045049 Bacteria 2860
679 Ga0466959_0068328 3300045049 Bacteria 2575
680 Ga0466958_0208703 3300045836 Bacteria 1244
681 Ga0466967_0030956 3300045976 Bacteria 4498
682 Ga0466967_0073667 3300045976 Bacteria 3064
683 Ga0466967_0081586 3300045976 Bacteria 2921
684 Ga0466967_0243783 3300045976 Bacteria 1715
685 Ga0466967_0258382 3300045976 Bacteria 1666
686 Ga0495617_015952 3300046452 Bacteria 2542
687 Ga0495592_0010258 3300046454 Bacteria 7063
688 Ga0495592_0109149 3300046454 Bacteria 1960
689 Ga0495603_0019795 3300046455 Bacteria 4074
690 Ga0495603_0036083 3300046455 Bacteria 2968
691 Ga0495603_0088727 3300046455 Bacteria 1809
692 Ga0495603_0180018 3300046455 Bacteria 1223
693 Ga0495629_0031462 3300046459 Bacteria 3757
694 Ga0495638_0031899 3300046460 Bacteria 3382
695 Ga0495638_0070779 3300046460 Bacteria 2135
696 Ga0495641_0106384 3300046461 Bacteria 1252
697 Ga0495651_0010805 3300046462 Bacteria 7018
698 Ga0495580_0024643 3300046472 Bacteria 4401
699 Ga0495580_0096371 3300046472 Bacteria 2057
700 Ga0495580_0245928 3300046472 Bacteria 1225
701 Ga0495580_0269376 3300046472 Bacteria 1163
702 Ga0495582_0007925 3300046473 Bacteria 5869
703 Ga0495582_0058508 3300046473 Bacteria 2125
704 Ga0495639_0014764 3300046475 Bacteria 3384
705 Ga0495639_0033644 3300046475 Bacteria 2289
706 Ga0495639_0120359 3300046475 Bacteria 1252
707 Ga0495662_0014430 3300046476 Bacteria 3842
708 Ga0495662_0024022 3300046476 Bacteria 2941
709 Ga0495662_0048650 3300046476 Bacteria 2047
710 Ga0495664_0000914 3300046477 Bacteria 15178
711 Ga0495664_0014283 3300046477 Bacteria 4499
712 Ga0495664_0048541 3300046477 Bacteria 2520
713 Ga0495664_0058956 3300046477 Bacteria 2284
714 Ga0495594_0003849 3300046499 Bacteria 7710
715 Ga0495607_0023434 3300046501 Bacteria 3865
716 Ga0495608_0016760 3300046511 Bacteria 5070
717 Ga0495608_0072337 3300046511 Bacteria 2249
718 Ga0495616_0020481 3300046513 Bacteria 3596
719 Ga0495618_0001314 3300046514 Bacteria 16718
720 Ga0495618_0026210 3300046514 Bacteria 3622
721 Ga0495628_0047872 3300046516 Bacteria 3390
722 Ga0495628_0106249 3300046516 Bacteria 2162
723 Ga0495630_0015328 3300046517 Bacteria 5596
724 Ga0495630_0089300 3300046517 Bacteria 2328
725 Ga0495630_0142876 3300046517 Bacteria 1820
726 Ga0495631_0005942 3300046518 Bacteria 6349
727 Ga0495631_0021534 3300046518 Bacteria 3002
728 Ga0495631_0057707 3300046518 Bacteria 1689
729 Ga0495632_0013773 3300046519 Bacteria 4599
730 Ga0495637_0030425 3300046520 Bacteria 2396
731 Ga0495648_0001411 3300046524 Bacteria 23498
732 Ga0495652_0056253 3300046529 Bacteria 3342
733 Ga0495652_0058974 3300046529 Bacteria 3249
734 Ga0495652_0104176 3300046529 Bacteria 2295
735 Ga0495665_0002990 3300046531 Bacteria 9136
736 Ga0495665_0017200 3300046531 Bacteria 3891
737 Ga0495640_0001789 3300046533 Bacteria 17054
738 Ga0495640_0051257 3300046533 Bacteria 2837
739 Ga0495640_0057176 3300046533 Bacteria 2663
740 Ga0495640_0106358 3300046533 Bacteria 1837
741 Ga0495587_0087973 3300046536 Bacteria 1797
742 Ga0495621_0009030 3300046539 Bacteria 3011
743 Ga0495597_0042780 3300046542 Bacteria 2019
744 Ga0495645_0007907 3300046543 Bacteria 7399
745 Ga0495645_0022537 3300046543 Bacteria 4557
746 Ga0495645_0028110 3300046543 Bacteria 4085
747 Ga0495622_0010976 3300046557 Bacteria 4181
748 Ga0495622_0045806 3300046557 Bacteria 2032
749 Ga0495622_0065380 3300046557 Bacteria 1681
750 Ga0495667_0087014 3300046559 Bacteria 2026
751 Ga0495667_0220505 3300046559 Bacteria 1210
752 Ga0495656_0019166 3300046615 Bacteria 2638
753 Ga0495634_0005018 3300046642 Bacteria 10216
754 Ga0495634_0018970 3300046642 Bacteria 4890
755 Ga0495634_0023106 3300046642 Bacteria 4375
756 Ga0495634_0045749 3300046642 Bacteria 2957
757 Ga0495634_0153618 3300046642 Bacteria 1454
758 Ga0495611_0078466 3300046648 Bacteria 1516
759 Ga0495625_0124262 3300046660 Bacteria 1753
760 Ga0495635_0001579 3300046663 Bacteria 15313
761 Ga0495635_0030467 3300046663 Bacteria 3749
762 Ga0495635_0089551 3300046663 Bacteria 2105
763 Ga0495661_0054722 3300046665 Bacteria 2394
764 Ga0495588_0017364 3300046674 Bacteria 3492
765 Ga0495657_0011125 3300046675 Bacteria 6742
766 Ga0495657_0105660 3300046675 Bacteria 1789
767 Ga0495657_0241944 3300046675 Bacteria 1089
768 Ga0495599_0093896 3300046678 Bacteria 1871
769 Ga0495623_0054488 3300046679 Bacteria 2523
770 Ga0495647_0004216 3300046681 Bacteria 4655
771 Ga0495647_0017755 3300046681 Bacteria 2522
772 Ga0495658_0005488 3300046683 Bacteria 6233
773 Ga0495658_0007978 3300046683 Bacteria 5244
774 Ga0495613_0015165 3300046689 Bacteria 5726
775 Ga0495613_0061127 3300046689 Bacteria 2759
776 Ga0495613_0091325 3300046689 Bacteria 2205
777 Ga0495624_0006069 3300046690 Bacteria 8612
778 Ga0495624_0022696 3300046690 Bacteria 4144
779 Ga0495624_0058575 3300046690 Bacteria 2418
780 Ga0495670_0164870 3300046691 Bacteria 1165
781 Ga0495671_0011887 3300046692 Bacteria 4771
782 Ga0495600_0022342 3300046809 Bacteria 4060
783 Ga0495600_0084531 3300046809 Bacteria 2071
784 Ga0495600_0146293 3300046809 Bacteria 1531
785 Ga0495660_0154108 3300046810 Bacteria 1132
786 Ga0495581_0009664 3300047315 Bacteria 5580
787 Ga0495581_0013235 3300047315 Bacteria 4784
788 Ga0495581_0016397 3300047315 Bacteria 4308
789 Ga0495581_0051065 3300047315 Bacteria 2388
790 Ga0495581_0174289 3300047315 Bacteria 1258
791 Ga0495604_0025374 3300047317 Bacteria 4723
792 Ga0495674_0000765 3300047319 Bacteria 30490
793 Ga0495674_0151554 3300047319 Bacteria 1944
794 Ga0495672_0043987 3300047320 Bacteria 2681
795 Ga0495684_0002602 3300047471 Bacteria 14334
796 Ga0495684_0005012 3300047471 Bacteria 10329
797 Ga0495684_0015044 3300047471 Bacteria 5958
798 Ga0495684_0254138 3300047471 Bacteria 1277
799 Ga0495686_0024993 3300047472 Bacteria 3917
800 Ga0495593_0009145 3300047673 Bacteria 5747
801 Ga0495593_0012996 3300047673 Bacteria 4755
802 Ga0495593_0110405 3300047673 Bacteria 1405
803 Ga0495602_0257901 3300048088 Bacteria 1295
804 Ga0496100_0127860 3300048903 Bacteria 1786
805 Ga0496101_0008690 3300048904 Bacteria 6641
806 Ga0496101_0129827 3300048904 Bacteria 1913
807 Ga0496101_0259908 3300048904 Bacteria 1354
808 Ga0496102_0232981 3300048905 Bacteria 1736
809 Ga0496103_0280663 3300048906 Bacteria 1071
810 Ga0496104_0018406 3300048907 Bacteria 6372
811 Ga0496104_0064651 3300048907 Bacteria 3470
812 Ga0496104_0084486 3300048907 Bacteria 3029
813 Ga0496104_0451287 3300048907 Bacteria 1197
814 Ga0496105_0010974 3300048908 Bacteria 7138
815 Ga0496105_0018379 3300048908 Bacteria 5617
816 Ga0496105_0056259 3300048908 Bacteria 3247
817 Ga0496106_0002130 3300048909 Bacteria 14795
818 Ga0496106_0089259 3300048909 Bacteria 2377
819 Ga0496106_0451141 3300048909 Bacteria 1033
820 Ga0496107_0039259 3300048910 Bacteria 3395
821 Ga0496107_0199838 3300048910 Bacteria 1486
822 Ga0496107_0208951 3300048910 Bacteria 1451
823 Ga0496108_0017925 3300048911 Bacteria 5792
824 Ga0496108_0057356 3300048911 Bacteria 3272
825 Ga0496108_0165235 3300048911 Bacteria 1913
826 Ga0496108_0229516 3300048911 Bacteria 1614
827 Ga0496109_0047750 3300048912 Bacteria 3893
828 Ga0496109_0096794 3300048912 Bacteria 2735
829 Ga0496109_0214059 3300048912 Bacteria 1812
830 Ga0496110_0053914 3300048913 Bacteria 3536
831 Ga0496110_0132174 3300048913 Bacteria 2254
832 Ga0496110_0178065 3300048913 Bacteria 1930
833 Ga0496111_0044940 3300048914 Bacteria 3176
834 Ga0496111_0162982 3300048914 Bacteria 1656
835 Ga0496111_0206276 3300048914 Bacteria 1460
836 Ga0496112_0005365 3300048915 Bacteria 11074
837 Ga0496112_0015998 3300048915 Bacteria 7013
838 Ga0496112_0037314 3300048915 Bacteria 4743
839 Ga0496112_0209782 3300048915 Bacteria 1905
840 Ga0496112_0213614 3300048915 Bacteria 1886
841 Ga0496112_0307888 3300048915 Bacteria 1529
842 Ga0496112_0525563 3300048915 Bacteria 1118
843 Ga0496113_0026191 3300048916 Bacteria 4166
844 Ga0496113_0199367 3300048916 Bacteria 1591
845 Ga0496114_0043870 3300048917 Bacteria 3708
846 Ga0496114_0314240 3300048917 Bacteria 1384
847 Ga0496114_0319810 3300048917 Bacteria 1371
848 Ga0496114_0394090 3300048917 Bacteria 1226
849 Ga0496115_0025874 3300048918 Bacteria 4573
850 Ga0496115_0026963 3300048918 Bacteria 4491
851 Ga0496115_0232569 3300048918 Bacteria 1520
852 Ga0496116_0005902 3300048919 Bacteria 11240
853 Ga0496118_0017640 3300048921 Bacteria 6484
854 Ga0496118_0018267 3300048921 Bacteria 6333
855 Ga0496118_0030143 3300048921 Bacteria 4534
856 Ga0496119_0135845 3300048922 Bacteria 1334
857 Ga0496120_0072379 3300048923 Bacteria 1889
858 Ga0496121_0008659 3300048924 Bacteria 11890
859 Ga0496121_0018301 3300048924 Bacteria 7074
860 Ga0496121_0040068 3300048924 Bacteria 4115
861 Ga0496121_0119074 3300048924 Bacteria 1997
862 Ga0496123_0102813 3300048926 Bacteria 1657
863 Ga0496124_0009222 3300048927 Bacteria 10177
864 Ga0496125_0000099 3300048928 Bacteria 203333
865 Ga0496125_0004213 3300048928 Bacteria 16756
866 Ga0496125_0007383 3300048928 Bacteria 11700
867 Ga0496125_0051008 3300048928 Bacteria 3417
868 Ga0496125_0071950 3300048928 Bacteria 2698
869 Ga0496126_0020239 3300048929 Bacteria 6530
870 Ga0496126_0060859 3300048929 Bacteria 3394
871 Ga0496126_0086590 3300048929 Bacteria 2761
872 Ga0496126_0199483 3300048929 Bacteria 1690
873 Ga0496126_0295711 3300048929 Bacteria 1338
874 Ga0496126_0347728 3300048929 Bacteria 1213
875 Ga0495682_0069480 3300049460 Bacteria 1268
876 Ga0501036_0011182 3300049572 Bacteria 7427
877 Ga0501038_0029094 3300049574 Bacteria 4900
878 Ga0501040_0060914 3300049576 Bacteria 2594
879 Ga0501041_0024261 3300049577 Bacteria 3640
880 Ga0501047_0003837 3300049581 Bacteria 14131
881 Ga0501047_0013032 3300049581 Bacteria 7875
882 Ga0501068_0157910 3300049584 Bacteria 1428
883 Ga0501071_0069071 3300049587 Bacteria 2572
884 Ga0501072_0067598 3300049588 Bacteria 2819
885 Ga0501073_0006350 3300049589 Bacteria 8799
886 Ga0501075_0000021 3300049591 Bacteria 66125
887 Ga0501076_0000070 3300049592 Bacteria 50841
888 Ga0501077_0101368 3300049593 Bacteria 1824
889 Ga0501077_0169623 3300049593 Bacteria 1386
890 Ga0501077_0223160 3300049593 Bacteria 1198
891 Ga0501080_0025522 3300049742 Bacteria 5485
892 Ga0501080_0121729 3300049742 Bacteria 2417
893 Ga0501081_0007271 3300049743 Bacteria 7198
894 Ga0501081_0058954 3300049743 Bacteria 2657
895 Ga0501083_0008206 3300049744 Bacteria 7384
896 Ga0501083_0115603 3300049744 Bacteria 1761
897 Ga0501044_0012923 3300049823 Bacteria 9037
898 Ga0501044_0019733 3300049823 Bacteria 7203
899 Ga0501044_0024908 3300049823 Bacteria 6346
900 nmdc:mga03683_11274_c1 3300050489 Bacteria 3231
901 nmdc:mga03683_1348_c1 3300050489 Bacteria 7276
902 nmdc:mga03683_7273_c1 3300050489 Bacteria 3835
903 nmdc:mga03n38_4669_c1 3300050490 Bacteria 4570
904 nmdc:mga03n38_50005_c1 3300050490 Bacteria 1861
905 nmdc:mga00v17_2774_c2 3300050491 Bacteria 6938
906 nmdc:mga00v17_74975_c1 3300050491 Bacteria 2103
907 nmdc:mga00v17_8048_c1 3300050491 Bacteria 5658
908 nmdc:mga0yw44_111149_c1 3300050492 Bacteria 1756
909 nmdc:mga0yw44_14847_c1 3300050492 Bacteria 4151
910 nmdc:mga0yw44_38117_c1 3300050492 Bacteria 2842
911 nmdc:mga0yw44_61057_c1 3300050492 Bacteria 2311
912 nmdc:mga0yw44_66216_c1 3300050492 Bacteria 2229
913 nmdc:mga0k408_62446_c1 3300050493 Bacteria 2166
914 nmdc:mga0k408_8709_c1 3300050493 Bacteria 5458
915 nmdc:mga06z11_11396_c1 3300050494 Bacteria 3833
916 nmdc:mga06z11_11953_c1 3300050494 Bacteria 3761
917 nmdc:mga06z11_1471_c1 3300050494 Bacteria 8772
918 nmdc:mga06z11_200988_c1 3300050494 Bacteria 1158
919 nmdc:mga06z11_28496_c1 3300050494 Bacteria 2680
920 nmdc:mga06z11_6700_c1 3300050494 Bacteria 4708
921 nmdc:mga06z11_75136_c1 3300050494 Bacteria 1798
922 nmdc:mga06z11_88105_c1 3300050494 Bacteria 1680
923 nmdc:mga04h51_13363_c1 3300050495 Bacteria 2323
924 nmdc:mga04h51_21905_c1 3300050495 Bacteria 1927
925 nmdc:mga04h51_3038_c1 3300050495 Bacteria 2624
926 nmdc:mga07m45_19228_c1 3300050496 Bacteria 3699
927 nmdc:mga07m45_31253_c1 3300050496 Bacteria 2950
928 nmdc:mga07m45_58102_c1 3300050496 Bacteria 2188
929 nmdc:mga07m45_63417_c1 3300050496 Bacteria 2096
930 nmdc:mga05p37_365781_c1 3300050507 Bacteria 1694
931 nmdc:mga06r32_125085_c1 3300050510 Bacteria 2539
932 nmdc:mga08y16_1102_c1 3300050511 Bacteria 26611
933 nmdc:mga08y16_156751_c1 3300050511 Bacteria 2366
934 nmdc:mga08y16_18538_c1 3300050511 Bacteria 7333
935 nmdc:mga08y16_246129_c1 3300050511 Bacteria 1848
936 nmdc:mga08y16_522386_c1 3300050511 Bacteria 1204
937 nmdc:mga0n895_22807_c1 3300050512 Bacteria 5873
938 nmdc:mga0n895_3720_c1 3300050512 Bacteria 12340
939 nmdc:mga0rr50_34020_c1 3300050513 Bacteria 3646
940 nmdc:mga0rr50_76248_c1 3300050513 Bacteria 2573
941 nmdc:mga08x19_10922_c1 3300050514 Bacteria 5462
942 nmdc:mga08x19_234460_c1 3300050514 Bacteria 1264
943 nmdc:mga08x19_41071_c1 3300050514 Bacteria 2946
944 nmdc:mga0a205_488180_c1 3300050515 Bacteria 1089
945 nmdc:mga0sz30_12388_c1 3300050516 Bacteria 3318
946 Ga0495601_0001037 3300053077 Bacteria 15167
947 Ga0495601_0266999 3300053077 Bacteria 1116
948 Ga0495612_0030096 3300053078 Bacteria 2187
949 Ga0495655_0010393 3300053083 Bacteria 1837
950 Ga0495595_0044491 3300053084 Bacteria 2040
951 Ga0495619_0003331 3300053085 Bacteria 10388
952 Ga0495619_0009743 3300053085 Bacteria 6056
953 Ga0495619_0038726 3300053085 Bacteria 3110
954 Ga0500578_0082765 3300053086 Bacteria 2040
955 Ga0500647_0016038 3300053091 Bacteria 3436
956 Ga0500647_0023286 3300053091 Bacteria 2904
957 Ga0500651_0030239 3300053093 Bacteria 3407
958 Ga0500651_0066248 3300053093 Bacteria 2249
959 Ga0500566_0000097 3300053094 Bacteria 43920
960 Ga0500566_0000422 3300053094 Bacteria 23611
961 Ga0500641_0012123 3300053096 Bacteria 3142
962 Ga0500641_0034453 3300053096 Bacteria 2015
963 Ga0500641_0113167 3300053096 Bacteria 1169
964 Ga0500650_0014093 3300053098 Bacteria 3373
965 Ga0500554_020777 3300053102 Bacteria 1810
966 Ga0500556_0000045 3300053104 Bacteria 130653
967 Ga0500562_011206 3300053108 Bacteria 2276
968 Ga0500572_000375 3300053111 Bacteria 15925
969 Ga0500593_085577 3300053117 Bacteria 1343
970 Ga0500595_000467 3300053119 Bacteria 25049
971 Ga0500595_003181 3300053119 Bacteria 7772
972 Ga0500595_008173 3300053119 Bacteria 4292
973 Ga0500595_014078 3300053119 Bacteria 3045
974 Ga0500595_014515 3300053119 Bacteria 2986
975 Ga0500607_083825 3300053121 Bacteria 1619
976 Ga0500608_010599 3300053122 Bacteria 3962
977 Ga0500608_071849 3300053122 Bacteria 1645
978 Ga0500614_030577 3300053123 Bacteria 1314
979 Ga0500642_0000024 3300053130 Bacteria 134373
980 Ga0500642_0006124 3300053130 Bacteria 3937
981 Ga0500642_0056077 3300053130 Bacteria 1754
982 Ga0500652_069113 3300053131 Bacteria 1461
983 Ga0500559_0000051 3300053136 Bacteria 91468
984 Ga0500559_0000553 3300053136 Bacteria 25900
985 Ga0500568_0003653 3300053139 Bacteria 8466
986 Ga0500568_0063626 3300053139 Bacteria 1423
987 Ga0500577_0018255 3300053142 Bacteria 2251
988 Ga0500588_0071183 3300053146 Bacteria 1141
989 Ga0500603_000285 3300053150 Bacteria 13430
990 Ga0500603_000511 3300053150 Bacteria 9856
991 Ga0500604_0031281 3300053151 Bacteria 1561
992 Ga0500616_0000002 3300053153 Bacteria 1611257
993 Ga0500616_0000054 3300053153 Bacteria 290186
994 Ga0500616_0036200 3300053153 Bacteria 2679
995 Ga0500622_0004533 3300053156 Bacteria 8676
996 Ga0500627_0054820 3300053158 Bacteria 1744
997 Ga0500630_009189 3300053159 Bacteria 4852
998 Ga0500633_0007617 3300053160 Bacteria 2738
999 Ga0500638_016255 3300053162 Bacteria 3430
1000 Ga0500638_033937 3300053162 Bacteria 2468
1001 Ga0500639_019063 3300053163 Bacteria 3619
1002 Ga0500636_0009532 3300053177 Bacteria 5648
1003 Ga0500637_0000660 3300053178 Bacteria 13684
1004 Ga0500637_0000984 3300053178 Bacteria 11627
1005 Ga0500567_084559 3300053723 Bacteria 1360
1006 Ga0500645_001737 3300053730 Bacteria 10567
1007 Ga0500552_008246 3300053733 Bacteria 1225
1008 Ga0501084_0021469 3300054114 Bacteria 5382
1009 Ga0501084_0087962 3300054114 Bacteria 2608
1010 Ga0500661_000043 3300055283 Bacteria 19291
1011 Ga0587076_013563 3300059645 Bacteria 1238
1012 Ga0501082_0016934 3300060353 Bacteria 6275
1013 Ga0501082_0034247 3300060353 Bacteria 4380
1014 Ga0530510_0000012 3300061734 Bacteria 115789
1015 Ga0530510_0011559 3300061734 Bacteria 6195
1016 2513693610 2513237101 Bacteria 7952346
1017 2513888433 2513237141 Bacteria 8496279
1018 2603860563 2602042107 Bacteria 6226103
1019 2723847510 2721755755 Bacteria 8322773
1020 2793081334
1021 2841916019 2841911363 Bacteria 6173697
1022 2841921601 2841917233 Bacteria 6173500
1023 2844317352 2844315083 Bacteria 8138177
1024 2857525519 2857524615 Bacteria 6615449
1025 2874611471 2874604998 Bacteria 7834745
1026 2876817066 2876808645 Bacteria 8824342
1027 2879117549 2879110137 Bacteria 8907982
1028 2885389481 2885383462 Bacteria 9473874
1029 2889042264 2889033259 Bacteria 9099371
1030 2893070759 2893066018 Bacteria 6158120
1031 2903733262 2903727486 Bacteria 8281579
1032 2903757236 2903748898 Bacteria 9972761
1033 2906606228 2906602504 Bacteria 8295279
1034 2908744623 2908739725 Bacteria 8628932
1035 2908762220 2908756301 Bacteria 8864324
1036 2919074672 2919073203 Bacteria 6531949
1037 2919706538 2919704043 Bacteria 5560311
1038 2922362922 2922361189 Bacteria 7436256
1039 2922428207
1040 2935631894 2935630451 Bacteria 8169952
1041 2935963626 2935959822 Bacteria 7869783
1042 2941507842 2941507105 Bacteria 8166816
1043 2941515653 2941515067 Bacteria 8166720
1044 2941523772 2941523033 Bacteria 8169134
1045 2941535166 2941531003 Bacteria 7653939
1046 3005478192 3005474847 Bacteria 9259049
1047 3005597050 3005594810 Bacteria 8716512
1048 3005713114 3005710791 Bacteria 7622528
1049 3005720481 3005718088 Bacteria 8283608
1050 8006970168 8006964411 Bacteria 8966052
1051 8006985456 8006984368 Bacteria 9651211
1052 8006994495 8006994254 Bacteria 8309700
1053 8019558866 8019555841 Bacteria 9642137
1054 8019566443 8019565922 Bacteria 9639779
1055 8056681227 8056673599 Bacteria 7871253
1056 8056694424 8056689827 Bacteria 6712655
1057 8056971937 8056967851 Bacteria 9038162
1058 Ga0075365_10219233
1059 rootH2_10076215
1060 Ga0065165_1031353
1061 Ga0065712_10010742
1062 Ga0070658_10134615
1063 Ga0070658_10166078
1064 Ga0070683_100010779
1065 Ga0070683_100033581
1066 Ga0068869_100161773
1067 Ga0070666_10007550
1068 Ga0070680_100003232
1069 Ga0070680_100023993
1070 Ga0070680_100111433
1071 Ga0068868_100006674
1072 Ga0070660_100054851
1073 Ga0070689_100018748
1074 Ga0070661_100031364
1075 Ga0070661_100047804
1076 Ga0070661_100374093
1077 Ga0070692_10177951
1078 Ga0070668_100063107
1079 Ga0070668_100282663
1080 Ga0070675_100282785
1081 Ga0070671_100074767
1082 Ga0070671_100102394
1083 Ga0070671_100439400
1084 Ga0070674_100005057
1085 Ga0070674_100240705
1086 Ga0070674_100247513
1087 Ga0070673_100092917
1088 Ga0070673_100127565
1089 Ga0070673_100333033
1090 Ga0070688_100018632
1091 Ga0070659_100055656
1092 Ga0070667_100007371
1093 Ga0070667_100150126
1094 Ga0070703_10000651
1095 Ga0070709_10029048
1096 Ga0070709_10077546
1097 Ga0070709_10111416
1098 Ga0070714_100022197
1099 Ga0070714_100027863
1100 Ga0070714_100061698
1101 Ga0070714_100071718
1102 Ga0070714_100132616
1103 Ga0070714_100226567
1104 Ga0070714_100524121
1105 Ga0070713_100004734
1106 Ga0070713_100014299
1107 Ga0070713_100065457
1108 Ga0070713_100068131
1109 Ga0070713_100152241
1110 Ga0070713_100232694
1111 Ga0070713_100316426
1112 Ga0070710_10000586
1113 Ga0070710_10003922
1114 Ga0070710_10014356
1115 Ga0070710_10019605
1116 Ga0070710_10136760
1117 Ga0070701_10064051
1118 Ga0070701_10119509
1119 Ga0070711_100005860
1120 Ga0070711_100009005
1121 Ga0070711_100017661
1122 Ga0070711_100024621
1123 Ga0070711_100048425
1124 Ga0070705_100000101
1125 Ga0070705_100116207
1126 Ga0070705_100162470
1127 Ga0070700_100150960
1128 Ga0070694_100000321
1129 Ga0070694_100022228
1130 Ga0070694_100160533
1131 Ga0070708_100000726
1132 Ga0070708_100011955
1133 Ga0070708_100195848
1134 Ga0070708_100267045
1135 Ga0070663_100007449
1136 Ga0070663_100023527
1137 Ga0070663_100144753
1138 Ga0070678_100027852
1139 Ga0070678_100289694
1140 Ga0070662_100013385
1141 Ga0070662_100255726
1142 Ga0070662_100281124
1143 Ga0070681_10025308
1144 Ga0070681_10106355
1145 Ga0070681_10128227
1146 Ga0068867_100026332
1147 Ga0068867_100036340
1148 Ga0068867_100243206
1149 Ga0070685_10030190
1150 Ga0070706_100021627
1151 Ga0070706_100431953
1152 Ga0070707_100330174
1153 Ga0070698_100264832
1154 Ga0070699_100000281
1155 Ga0070679_100045232
1156 Ga0070679_100232077
1157 Ga0070684_100006541
1158 Ga0070684_100250818
1159 Ga0070697_100008863
1160 Ga0070697_100028285
1161 Ga0068853_100155935
1162 Ga0070672_100010256
1163 Ga0070672_100075256
1164 Ga0070672_100371081
1165 Ga0070695_100004104
1166 Ga0070695_100014438
1167 Ga0070695_100214542
1168 Ga0070696_100000811
1169 Ga0070696_100175334
1170 Ga0070696_100193126
1171 Ga0070693_100007751
1172 Ga0070693_100022290
1173 Ga0070665_100141231
1174 Ga0070704_100099583
1175 Ga0068855_100022696
1176 Ga0068855_100064892
1177 Ga0068855_100174539
1178 Ga0068855_100600849
1179 Ga0070664_100046730
1180 Ga0070664_100109474
1181 Ga0070664_100113488
1182 Ga0068857_100003319
1183 Ga0068857_100075134
1184 Ga0068857_100154781
1185 Ga0068857_100170743
1186 Ga0068857_100317361
1187 Ga0068854_100019516
1188 Ga0068854_100090515
1189 Ga0068856_100000066
1190 Ga0068856_100023411
1191 Ga0068856_100033294
1192 Ga0068856_100110066
1193 Ga0068856_100376605
1194 Ga0070702_100065280
1195 Ga0070702_100096815
1196 Ga0070702_100121592
1197 Ga0068852_100002462
1198 Ga0068852_100010672
1199 Ga0068852_100119821
1200 Ga0068859_100006260
1201 Ga0068859_100011754
1202 Ga0068859_100018584
1203 Ga0068859_100182333
1204 Ga0068864_100089468
1205 Ga0068864_100416446
1206 Ga0068864_100499749
1207 Ga0068866_10022649
1208 Ga0068866_10158523
1209 Ga0068861_100035422
1210 Ga0068861_100037067
1211 Ga0068861_100351674
1212 Ga0068870_10143662
1213 Ga0068863_100005165
1214 Ga0068863_100074770
1215 Ga0068863_100169221
1216 Ga0068858_100016247
1217 Ga0068858_100022839
1218 Ga0068858_100255861
1219 Ga0068858_100258420
1220 Ga0068860_100001582
1221 Ga0068860_100004600
1222 Ga0068860_100030287
1223 Ga0081455_10000014
1224 Ga0081455_10003956
1225 Ga0081455_10004726
1226 Ga0081455_10041561
1227 Ga0081540_1001902
1228 Ga0081540_1033630
1229 Ga0081540_1034190
1230 Ga0081539_10020579
1231 Ga0081539_10069592
1232 Ga0070717_10000926
1233 Ga0070717_10317791
1234 Ga0075365_10019309
1235 Ga0075365_10020412
1236 Ga0075365_10121584
1237 Ga0075365_10146985
1238 Ga0075368_10008841
1239 Ga0075368_10058639
1240 Ga0075363_100009358
1241 Ga0075363_100044157
1242 Ga0075363_100078670
1243 Ga0075364_10002466
1244 Ga0075364_10006004
1245 Ga0075364_10009887
1246 Ga0075364_10030814
1247 Ga0075364_10059980
1248 Ga0070715_10089756
1249 Ga0070715_10095021
1250 Ga0070716_100075350
1251 Ga0070716_100076581
1252 Ga0070716_100130746
1253 Ga0070716_100200234
1254 Ga0070712_100000412
1255 Ga0070712_100006858
1256 Ga0070712_100028515
1257 Ga0070712_100028607
1258 Ga0070712_100060845
1259 Ga0070712_100092789
1260 Ga0070712_100099906
1261 Ga0070712_100105892
1262 Ga0070712_100148536
1263 Ga0070712_100353300
1264 Ga0075362_10000965
1265 Ga0075362_10008875
1266 Ga0075362_10046267
1267 Ga0075367_10000878
1268 Ga0075367_10001658
1269 Ga0075367_10004378
1270 Ga0075367_10011660
1271 Ga0075367_10038372
1272 Ga0075367_10041143
1273 Ga0075367_10076025
1274 Ga0075369_10026428
1275 Ga0075366_10006131
1276 Ga0075366_10029088
1277 Ga0075366_10081172
1278 Ga0075366_10107745
1279 Ga0097621_100089872
1280 Ga0075370_10015337
1281 Ga0075370_10134592
1282 Ga0068871_100149386
1283 Ga0068871_100152040
1284 Ga0075428_100140325
1285 Ga0075428_100422791
1286 Ga0075430_100004348
1287 Ga0075431_100005249
1288 Ga0075433_10011738
1289 Ga0075434_100005130
1290 Ga0075434_100006402
1291 Ga0068865_100073788
1292 Ga0075436_100001047
1293 Ga0075436_100105359
1294 Ga0075436_100274854
1295 Ga0097620_100006260
1296 Ga0097620_100011754
1297 Ga0097620_100018584
1298 Ga0097620_100182326
1299 Ga0075435_100019399
1300 Ga0075435_100315385
1301 Ga0099794_10029160
1302 Ga0099794_10061249
1303 Ga0099794_10093188
1304 Ga0099795_10030171
1305 Ga0099795_10034282
1306 Ga0099795_10062935
1307 Ga0105240_10006645
1308 Ga0105240_10007301
1309 Ga0105240_10070911
1310 Ga0105240_10088210
1311 Ga0105240_10330018
1312 Ga0105240_10410743
1313 Ga0111539_10004677
1314 Ga0111539_10009581
1315 Ga0111539_10013311
1316 Ga0111539_10151813
1317 Ga0105245_10004067
1318 Ga0105245_10006433
1319 Ga0105245_10031288
1320 Ga0105245_10038950
1321 Ga0105245_10065437
1322 Ga0105245_10088645
1323 Ga0105247_10021588
1324 Ga0105247_10036022
1325 Ga0105247_10070772
1326 Ga0105247_10108410
1327 Ga0105247_10116130
1328 Ga0114129_10082645
1329 Ga0114129_10203496
1330 Ga0105241_10018995
1331 Ga0105241_10038542
1332 Ga0105241_10074324
1333 Ga0105241_10097895
1334 Ga0105242_10037241
1335 Ga0105242_10061497
1336 Ga0105242_10189410
1337 Ga0105242_10262216
1338 Ga0105242_10311372
1339 Ga0105242_10313176
1340 Ga0105248_10007036
1341 Ga0105237_10005677
1342 Ga0105237_10070763
1343 Ga0105237_10082031
1344 Ga0105237_10103825
1345 Ga0105237_10131053
1346 Ga0105237_10164168
1347 Ga0105237_10474604
1348 Ga0105238_10025920
1349 Ga0105238_10031915
1350 Ga0105238_10078885
1351 Ga0105238_10136335
1352 Ga0105238_10194210
1353 Ga0105238_10445607
1354 Ga0105238_10463432
1355 Ga0105238_10496987
1356 Ga0105249_10009590
1357 Ga0099796_10000999
1358 Ga0099796_10010628
1359 Ga0099796_10014871
1360 Ga0105239_10013662
1361 Ga0105239_10035753
1362 Ga0105239_10092226
1363 Ga0105239_10243437
1364 Ga0105239_10281693
1365 Ga0105239_10411731
1366 Ga0105246_10010353
1367 Ga0157373_10054362
1368 Ga0157371_10012441
1369 Ga0157370_10034068
1370 Ga0157370_10070950
1371 Ga0157369_10004338
1372 Ga0157369_10010807
1373 Ga0157374_10012898
1374 Ga0157374_10149490
1375 Ga0157374_10171838
1376 Ga0157378_10001343
1377 Ga0157378_10086729
1378 Ga0157378_10249206
1379 Ga0157378_10318426
1380 Ga0157378_10324029
1381 Ga0163162_10007091
1382 Ga0163162_10024766
1383 Ga0163162_10060820
1384 Ga0163162_10153308
1385 Ga0157372_10049063
1386 Ga0157372_10104355
1387 Ga0157372_10265177
1388 Ga0157375_10003647
1389 Ga0157375_10260714
1390 Ga0157375_10434064
1391 Ga0163163_10009357
1392 Ga0157380_10089746
1393 Ga0157380_10193031
1394 Ga0182008_10054953
1395 Ga0157379_10000412
1396 Ga0157376_10017075
1397 Ga0157376_10249774
1398 Ga0213874_10004128
1399 Ga0213874_10049022
1400 Ga0213876_10005223
1401 Ga0213876_10076446
1402 Ga0213875_10000030
1403 Ga0209563_106750
1404 Ga0209677_100749
1405 Ga0209148_1000711
1406 Ga0209233_1002053
1407 Ga0209233_1005766
1408 Ga0209233_1017691
1409 Ga0209455_1001471
1410 Ga0209455_1002106
1411 Ga0209455_1017435
1412 Ga0209564_1000503
1413 Ga0209564_1024573
1414 Ga0209758_1003246
1415 Ga0209758_1013786
1416 Ga0207653_10004798
1417 Ga0207682_10046666
1418 Ga0207692_10000750
1419 Ga0207692_10021336
1420 Ga0207692_10028491
1421 Ga0207692_10043154
1422 Ga0207642_10036265
1423 Ga0207710_10025386
1424 Ga0207710_10062801
1425 Ga0207688_10068602
1426 Ga0207688_10095562
1427 Ga0207680_10003578
1428 Ga0207685_10084654
1429 Ga0207699_10041705
1430 Ga0207699_10082446
1431 Ga0207699_10279938
1432 Ga0207645_10055417
1433 Ga0207643_10050130
1434 Ga0207643_10115471
1435 Ga0207705_10261882
1436 Ga0207684_10048203
1437 Ga0207707_10009615
1438 Ga0207707_10038943
1439 Ga0207707_10045184
1440 Ga0207707_10049476
1441 Ga0207695_10000029
1442 Ga0207695_10111957
1443 Ga0207695_10134869
1444 Ga0207695_10166253
1445 Ga0207695_10176901
1446 Ga0207695_10189865
1447 Ga0207695_10384490
1448 Ga0207671_10002337
1449 Ga0207671_10042369
1450 Ga0207671_10052329
1451 Ga0207671_10137655
1452 Ga0207693_10000969
1453 Ga0207693_10001536
1454 Ga0207693_10002407
1455 Ga0207693_10015794
1456 Ga0207693_10020767
1457 Ga0207693_10022603
1458 Ga0207693_10029915
1459 Ga0207693_10031820
1460 Ga0207693_10035068
1461 Ga0207693_10069433
1462 Ga0207693_10178367
1463 Ga0207663_10000225
1464 Ga0207663_10019032
1465 Ga0207663_10081597
1466 Ga0207663_10097744
1467 Ga0207663_10163793
1468 Ga0207663_10297012
1469 Ga0207663_10308822
1470 Ga0207660_10024703
1471 Ga0207660_10027553
1472 Ga0207660_10108645
1473 Ga0207660_10217939
1474 Ga0207660_10322887
1475 Ga0207662_10140382
1476 Ga0207657_10068585
1477 Ga0207657_10122290
1478 Ga0207649_10117838
1479 Ga0207649_10124143
1480 Ga0207652_10015556
1481 Ga0207652_10057386
1482 Ga0207652_10243145
1483 Ga0207652_10336385
1484 Ga0207646_10290149
1485 Ga0207694_10048261
1486 Ga0207694_10097763
1487 Ga0207694_10156368
1488 Ga0207694_10217054
1489 Ga0207694_10347220
1490 Ga0207650_10162045
1491 Ga0207659_10086397
1492 Ga0207659_10162476
1493 Ga0207659_10197627
1494 Ga0207687_10005601
1495 Ga0207687_10010336
1496 Ga0207687_10081405
1497 Ga0207700_10012696
1498 Ga0207700_10013786
1499 Ga0207700_10045624
1500 Ga0207700_10070128
1501 Ga0207700_10093357
1502 Ga0207700_10162139
1503 Ga0207700_10279601
1504 Ga0207664_10002384
1505 Ga0207664_10020293
1506 Ga0207664_10039165
1507 Ga0207664_10092565
1508 Ga0207664_10116449
1509 Ga0207664_10122745
1510 Ga0207664_10124832
1511 Ga0207664_10254575
1512 Ga0207644_10004181
1513 Ga0207644_10077380
1514 Ga0207644_10128624
1515 Ga0207690_10019392
1516 Ga0207706_10015114
1517 Ga0207706_10050826
1518 Ga0207706_10055534
1519 Ga0207706_10063408
1520 Ga0207686_10006380
1521 Ga0207686_10043238
1522 Ga0207686_10154173
1523 Ga0207670_10006134
1524 Ga0207669_10034219
1525 Ga0207669_10114508
1526 Ga0207704_10142974
1527 Ga0207704_10382641
1528 Ga0207665_10000243
1529 Ga0207665_10027338
1530 Ga0207665_10032689
1531 Ga0207665_10114189
1532 Ga0207665_10270736
1533 Ga0207691_10006249
1534 Ga0207691_10070297
1535 Ga0207691_10086046
1536 Ga0207691_10261679
1537 Ga0207711_10005199
1538 Ga0207689_10025104
1539 Ga0207689_10052282
1540 Ga0207689_10136032
1541 Ga0207689_10141898
1542 Ga0207661_10001465
1543 Ga0207661_10097163
1544 Ga0207661_10155469
1545 Ga0207661_10190835
1546 Ga0207661_10524653
1547 Ga0207679_10074164
1548 Ga0207679_10125731
1549 Ga0207679_10214564
1550 Ga0207667_10098999
1551 Ga0207712_10005744
1552 Ga0207640_10125890
1553 Ga0207677_10000152
1554 Ga0207677_10039784
1555 Ga0207677_10159676
1556 Ga0207639_10111884
1557 Ga0207639_10315654
1558 Ga0207678_10001761
1559 Ga0207678_10038587
1560 Ga0207678_10286843
1561 Ga0207708_10004485
1562 Ga0207708_10100101
1563 Ga0207708_10154577
1564 Ga0207702_10000044
1565 Ga0207702_10024967
1566 Ga0207702_10025069
1567 Ga0207702_10029073
1568 Ga0207702_10185087
1569 Ga0207702_10229012
1570 Ga0207702_10241583
1571 Ga0207641_10007382
1572 Ga0207641_10044711
1573 Ga0207641_10074448
1574 Ga0207648_10135873
1575 Ga0207648_10142309
1576 Ga0207676_10014486
1577 Ga0207676_10018694
1578 Ga0207676_10075567
1579 Ga0207674_10001070
1580 Ga0207674_10001334
1581 Ga0207674_10033029
1582 Ga0207674_10042363
1583 Ga0207674_10055622
1584 Ga0207674_10092025
1585 Ga0207675_100185749
1586 Ga0207675_100368702
1587 Ga0207683_10010764
1588 Ga0207683_10018922
1589 Ga0207683_10020117
1590 Ga0207698_10035554
1591 Ga0209813_10015031
1592 Ga0207428_10044709
1593 Ga0207428_10072180
1594 Ga0207428_10169532
1595 Ga0268266_10023001
1596 Ga0268266_10075373
1597 Ga0268266_10129370
1598 Ga0268266_10129620
1599 Ga0268265_10005167
1600 Ga0268265_10238919
1601 Ga0268264_10000020
1602 Ga0268264_10008583
1603 Ga0268264_10017114
1604 Ga0268264_10193957
1605 Ga0265337_1006750
1606 Ga0265326_10038516
1607 Ga0265334_10002301
1608 Ga0265318_10005804
1609 Ga0265323_10000169
1610 Ga0265322_10004434
1611 Ga0265336_10000663
1612 Ga0307517_10000053
1613 Ga0307515_10060521
1614 Ga0307515_10199845
1615 Ga0265338_10000013
1616 Ga0265324_10003787
1617 Ga0265773_1001235
1618 Ga0265760_10021107
1619 Ga0265760_10060465
1620 Ga0265330_10031036
1621 Ga0265320_10110497
1622 Ga0265325_10042997
1623 Ga0265329_10042643
1624 Ga0265340_10039967
1625 Ga0265340_10067060
1626 Ga0265339_10097647
1627 Ga0265316_10139588
1628 Ga0307513_10138904
1629 Ga0307509_10276022
1630 Ga0265313_10009853
1631 Ga0307508_10000058
1632 Ga0307508_10208897
1633 Ga0265314_10022142
1634 Ga0265314_10071456
1635 Ga0265342_10083042
1636 Ga0307516_10038551
1637 Ga0307410_10112508
1638 Ga0307412_10232424
1639 Ga0307414_10253655
1640 Ga0307411_10197156
1641 Ga0316053_101306
1642 Ga0307510_10165027
1643 Ga0316215_1001197
1644 Ga0373926_0013143
1645 Ga0373926_0034568
1646 Ga0373929_0006496
1647 Ga0373934_0074664
1648 Ga0373944_0013310
1649 Ga0373944_0020457
1650 Ga0373923_0029400
1651 Ga0373936_0077081
1652 Ga0373945_0030664
1653 Ga0373945_0041011
1654 Ga0373945_0101774
1655 Ga0373953_0045980
1656 Ga0373954_0015689
1657 Ga0373943_0000625
1658 Ga0373943_0046483
1659 Ga0373943_0111657
1660 Ga0373943_0117477
1661 Ga0373924_0026717
1662 Ga0373924_0035287
1663 Ga0373931_0012802
1664 Ga0373935_0050898
1665 Ga0373935_0085244
1666 Ga0373935_0139241
1667 Ga0373935_0246781
1668 Ga0373927_0000208
1669 Ga0373927_0005624
1670 Ga0373927_0007126
1671 Ga0373927_0010764
1672 Ga0373927_0034151
1673 Ga0373927_0036366
1674 Ga0373927_0102049
1675 Ga0373927_0151223
1676 Ga0373927_0193902
1677 Ga0373933_0000052
1678 Ga0373933_0043435
1679 Ga0373933_0052699
1680 Ga0373947_0000572
1681 Ga0373947_0019808
1682 Ga0373947_0106292
1683 Ga0373947_0109238
1684 Ga0373937_0003631
1685 Ga0373937_0035244
1686 Ga0373937_0047933
1687 Ga0373937_0065599
1688 Ga0373937_0128368
1689 Ga0373937_0179707
1690 Ga0373925_0002541
1691 Ga0373925_0019815
1692 Ga0373925_0026932
1693 Ga0373925_0029850
1694 Ga0373925_0047259
1695 Ga0373925_0134557
1696 Ga0395900_0029644
1697 Ga0395898_0008229
1698 Ga0395905_0417289
1699 Ga0436364_0207431
1700 Ga0436364_0716994
1701 Ga0395901_0602840
1702 Ga0400483_078811
1703 Ga0400483_199136
1704 Ga0400483_281213
1705 Ga0436365_0086833
1706 Ga0436365_0220203
1707 Ga0436365_0289679
1708 Ga0436365_0338285
1709 Ga0436365_1165498
1710 Ga0436365_1289758
1711 Ga0436365_1742880
1712 Ga0436365_1873205
1713 Ga0436360_1354193
1714 Ga0436361_0248960
1715 Ga0436361_0324422
1716 Ga0436361_0559458
1717 Ga0436361_0963044
1718 Ga0436363_0800589
1719 Ga0439453_0000155
1720 Ga0439465_0061524
1721 Ga0451789_0018586
1722 Ga0451800_0830467
1723 Ga0439441_003763
1724 Ga0439435_0004722
1725 Ga0439460_0009225
1726 Ga0439440_0009586
1727 Ga0466969_0064388
1728 Ga0466966_0032661
1729 Ga0466966_0244635
1730 Ga0466961_0056721
1731 Ga0466963_0263441
1732 Ga0466970_0026255
1733 Ga0466970_0202672
1734 Ga0466957_0032036
1735 Ga0466959_0056634
1736 Ga0466959_0068328
1737 Ga0466958_0208703
1738 Ga0466967_0030956
1739 Ga0466967_0073667
1740 Ga0466967_0081586
1741 Ga0466967_0243783
1742 Ga0466967_0258382
1743 Ga0495617_015952
1744 Ga0495592_0010258
1745 Ga0495592_0109149
1746 Ga0495603_0019795
1747 Ga0495603_0036083
1748 Ga0495603_0088727
1749 Ga0495603_0180018
1750 Ga0495629_0031462
1751 Ga0495638_0031899
1752 Ga0495638_0070779
1753 Ga0495641_0106384
1754 Ga0495651_0010805
1755 Ga0495580_0024643
1756 Ga0495580_0096371
1757 Ga0495580_0245928
1758 Ga0495580_0269376
1759 Ga0495582_0007925
1760 Ga0495582_0058508
1761 Ga0495639_0014764
1762 Ga0495639_0033644
1763 Ga0495639_0120359
1764 Ga0495662_0014430
1765 Ga0495662_0024022
1766 Ga0495662_0048650
1767 Ga0495664_0000914
1768 Ga0495664_0014283
1769 Ga0495664_0048541
1770 Ga0495664_0058956
1771 Ga0495594_0003849
1772 Ga0495607_0023434
1773 Ga0495608_0016760
1774 Ga0495608_0072337
1775 Ga0495616_0020481
1776 Ga0495618_0001314
1777 Ga0495618_0026210
1778 Ga0495628_0047872
1779 Ga0495628_0106249
1780 Ga0495630_0015328
1781 Ga0495630_0089300
1782 Ga0495630_0142876
1783 Ga0495631_0005942
1784 Ga0495631_0021534
1785 Ga0495631_0057707
1786 Ga0495632_0013773
1787 Ga0495637_0030425
1788 Ga0495648_0001411
1789 Ga0495652_0056253
1790 Ga0495652_0058974
1791 Ga0495652_0104176
1792 Ga0495665_0002990
1793 Ga0495665_0017200
1794 Ga0495640_0001789
1795 Ga0495640_0051257
1796 Ga0495640_0057176
1797 Ga0495640_0106358
1798 Ga0495587_0087973
1799 Ga0495621_0009030
1800 Ga0495597_0042780
1801 Ga0495645_0007907
1802 Ga0495645_0022537
1803 Ga0495645_0028110
1804 Ga0495622_0010976
1805 Ga0495622_0045806
1806 Ga0495622_0065380
1807 Ga0495667_0087014
1808 Ga0495667_0220505
1809 Ga0495656_0019166
1810 Ga0495634_0005018
1811 Ga0495634_0018970
1812 Ga0495634_0023106
1813 Ga0495634_0045749
1814 Ga0495634_0153618
1815 Ga0495611_0078466
1816 Ga0495625_0124262
1817 Ga0495635_0001579
1818 Ga0495635_0030467
1819 Ga0495635_0089551
1820 Ga0495661_0054722
1821 Ga0495588_0017364
1822 Ga0495657_0011125
1823 Ga0495657_0105660
1824 Ga0495657_0241944
1825 Ga0495599_0093896
1826 Ga0495623_0054488
1827 Ga0495647_0004216
1828 Ga0495647_0017755
1829 Ga0495658_0005488
1830 Ga0495658_0007978
1831 Ga0495613_0015165
1832 Ga0495613_0061127
1833 Ga0495613_0091325
1834 Ga0495624_0006069
1835 Ga0495624_0022696
1836 Ga0495624_0058575
1837 Ga0495670_0164870
1838 Ga0495671_0011887
1839 Ga0495600_0022342
1840 Ga0495600_0084531
1841 Ga0495600_0146293
1842 Ga0495660_0154108
1843 Ga0495581_0009664
1844 Ga0495581_0013235
1845 Ga0495581_0016397
1846 Ga0495581_0051065
1847 Ga0495581_0174289
1848 Ga0495604_0025374
1849 Ga0495674_0000765
1850 Ga0495674_0151554
1851 Ga0495672_0043987
1852 Ga0495684_0002602
1853 Ga0495684_0005012
1854 Ga0495684_0015044
1855 Ga0495684_0254138
1856 Ga0495686_0024993
1857 Ga0495593_0009145
1858 Ga0495593_0012996
1859 Ga0495593_0110405
1860 Ga0495602_0257901
1861 Ga0496100_0127860
1862 Ga0496101_0008690
1863 Ga0496101_0129827
1864 Ga0496101_0259908
1865 Ga0496102_0232981
1866 Ga0496103_0280663
1867 Ga0496104_0018406
1868 Ga0496104_0064651
1869 Ga0496104_0084486
1870 Ga0496104_0451287
1871 Ga0496105_0010974
1872 Ga0496105_0018379
1873 Ga0496105_0056259
1874 Ga0496106_0002130
1875 Ga0496106_0089259
1876 Ga0496106_0451141
1877 Ga0496107_0039259
1878 Ga0496107_0199838
1879 Ga0496107_0208951
1880 Ga0496108_0017925
1881 Ga0496108_0057356
1882 Ga0496108_0165235
1883 Ga0496108_0229516
1884 Ga0496109_0047750
1885 Ga0496109_0096794
1886 Ga0496109_0214059
1887 Ga0496110_0053914
1888 Ga0496110_0132174
1889 Ga0496110_0178065
1890 Ga0496111_0044940
1891 Ga0496111_0162982
1892 Ga0496111_0206276
1893 Ga0496112_0005365
1894 Ga0496112_0015998
1895 Ga0496112_0037314
1896 Ga0496112_0209782
1897 Ga0496112_0213614
1898 Ga0496112_0307888
1899 Ga0496112_0525563
1900 Ga0496113_0026191
1901 Ga0496113_0199367
1902 Ga0496114_0043870
1903 Ga0496114_0314240
1904 Ga0496114_0319810
1905 Ga0496114_0394090
1906 Ga0496115_0025874
1907 Ga0496115_0026963
1908 Ga0496115_0232569
1909 Ga0496116_0005902
1910 Ga0496118_0017640
1911 Ga0496118_0018267
1912 Ga0496118_0030143
1913 Ga0496119_0135845
1914 Ga0496120_0072379
1915 Ga0496121_0008659
1916 Ga0496121_0018301
1917 Ga0496121_0040068
1918 Ga0496121_0119074
1919 Ga0496123_0102813
1920 Ga0496124_0009222
1921 Ga0496125_0000099
1922 Ga0496125_0004213
1923 Ga0496125_0007383
1924 Ga0496125_0051008
1925 Ga0496125_0071950
1926 Ga0496126_0020239
1927 Ga0496126_0060859
1928 Ga0496126_0086590
1929 Ga0496126_0199483
1930 Ga0496126_0295711
1931 Ga0496126_0347728
1932 Ga0495682_0069480
1933 Ga0501036_0011182
1934 Ga0501038_0029094
1935 Ga0501040_0060914
1936 Ga0501041_0024261
1937 Ga0501047_0003837
1938 Ga0501047_0013032
1939 Ga0501068_0157910
1940 Ga0501071_0069071
1941 Ga0501072_0067598
1942 Ga0501073_0006350
1943 Ga0501075_0000021
1944 Ga0501076_0000070
1945 Ga0501077_0101368
1946 Ga0501077_0169623
1947 Ga0501077_0223160
1948 Ga0501080_0025522
1949 Ga0501080_0121729
1950 Ga0501081_0007271
1951 Ga0501081_0058954
1952 Ga0501083_0008206
1953 Ga0501083_0115603
1954 Ga0501044_0012923
1955 Ga0501044_0019733
1956 Ga0501044_0024908
1957 nmdc:mga03683_11274_c1
1958 nmdc:mga03683_1348_c1
1959 nmdc:mga03683_7273_c1
1960 nmdc:mga03n38_4669_c1
1961 nmdc:mga03n38_50005_c1
1962 nmdc:mga00v17_2774_c2
1963 nmdc:mga00v17_74975_c1
1964 nmdc:mga00v17_8048_c1
1965 nmdc:mga0yw44_111149_c1
1966 nmdc:mga0yw44_14847_c1
1967 nmdc:mga0yw44_38117_c1
1968 nmdc:mga0yw44_61057_c1
1969 nmdc:mga0yw44_66216_c1
1970 nmdc:mga0k408_62446_c1
1971 nmdc:mga0k408_8709_c1
1972 nmdc:mga06z11_11396_c1
1973 nmdc:mga06z11_11953_c1
1974 nmdc:mga06z11_1471_c1
1975 nmdc:mga06z11_200988_c1
1976 nmdc:mga06z11_28496_c1
1977 nmdc:mga06z11_6700_c1
1978 nmdc:mga06z11_75136_c1
1979 nmdc:mga06z11_88105_c1
1980 nmdc:mga04h51_13363_c1
1981 nmdc:mga04h51_21905_c1
1982 nmdc:mga04h51_3038_c1
1983 nmdc:mga07m45_19228_c1
1984 nmdc:mga07m45_31253_c1
1985 nmdc:mga07m45_58102_c1
1986 nmdc:mga07m45_63417_c1
1987 nmdc:mga05p37_365781_c1
1988 nmdc:mga06r32_125085_c1
1989 nmdc:mga08y16_1102_c1
1990 nmdc:mga08y16_156751_c1
1991 nmdc:mga08y16_18538_c1
1992 nmdc:mga08y16_246129_c1
1993 nmdc:mga08y16_522386_c1
1994 nmdc:mga0n895_22807_c1
1995 nmdc:mga0n895_3720_c1
1996 nmdc:mga0rr50_34020_c1
1997 nmdc:mga0rr50_76248_c1
1998 nmdc:mga08x19_10922_c1
1999 nmdc:mga08x19_234460_c1
2000 nmdc:mga08x19_41071_c1
2001 nmdc:mga0a205_488180_c1
2002 nmdc:mga0sz30_12388_c1
2003 Ga0495601_0001037
2004 Ga0495601_0266999
2005 Ga0495612_0030096
2006 Ga0495655_0010393
2007 Ga0495595_0044491
2008 Ga0495619_0003331
2009 Ga0495619_0009743
2010 Ga0495619_0038726
2011 Ga0500578_0082765
2012 Ga0500647_0016038
2013 Ga0500647_0023286
2014 Ga0500651_0030239
2015 Ga0500651_0066248
2016 Ga0500566_0000097
2017 Ga0500566_0000422
2018 Ga0500641_0012123
2019 Ga0500641_0034453
2020 Ga0500641_0113167
2021 Ga0500650_0014093
2022 Ga0500554_020777
2023 Ga0500556_0000045
2024 Ga0500562_011206
2025 Ga0500572_000375
2026 Ga0500593_085577
2027 Ga0500595_000467
2028 Ga0500595_003181
2029 Ga0500595_008173
2030 Ga0500595_014078
2031 Ga0500595_014515
2032 Ga0500607_083825
2033 Ga0500608_010599
2034 Ga0500608_071849
2035 Ga0500614_030577
2036 Ga0500642_0000024
2037 Ga0500642_0006124
2038 Ga0500642_0056077
2039 Ga0500652_069113
2040 Ga0500559_0000051
2041 Ga0500559_0000553
2042 Ga0500568_0003653
2043 Ga0500568_0063626
2044 Ga0500577_0018255
2045 Ga0500588_0071183
2046 Ga0500603_000285
2047 Ga0500603_000511
2048 Ga0500604_0031281
2049 Ga0500616_0000002
2050 Ga0500616_0000054
2051 Ga0500616_0036200
2052 Ga0500622_0004533
2053 Ga0500627_0054820
2054 Ga0500630_009189
2055 Ga0500633_0007617
2056 Ga0500638_016255
2057 Ga0500638_033937
2058 Ga0500639_019063
2059 Ga0500636_0009532
2060 Ga0500637_0000660
2061 Ga0500637_0000984
2062 Ga0500567_084559
2063 Ga0500645_001737
2064 Ga0500552_008246
2065 Ga0501084_0021469
2066 Ga0501084_0087962
2067 Ga0500661_000043
2068 Ga0587076_013563
2069 Ga0501082_0016934
2070 Ga0501082_0034247
2071 Ga0530510_0000012
2072 Ga0530510_0011559
2073 2513693610
2074 2513888433
2075 2603860563
2076 2723847510
2077 2793081334
2078 2841916019
2079 2841921601
2080 2844317352
2081 2857525519
2082 2874611471
2083 2876817066
2084 2879117549
2085 2885389481
2086 2889042264
2087 2893070759
2088 2903733262
2089 2903757236
2090 2906606228
2091 2908744623
2092 2908762220
2093 2919074672
2094 2919706538
2095 2922362922
2096 2922428207
2097 2935631894
2098 2935963626
2099 2941507842
2100 2941515653
2101 2941523772
2102 2941535166
2103 3005478192
2104 3005597050
2105 3005713114
2106 3005720481
2107 8006970168
2108 8006985456
2109 8006994495
2110 8019558866
2111 8019566443
2112 8056681227
2113 8056694424
2114 8056971937

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

84

369

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xfe-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d-glucuronate 0.99 30 329
4x04-assembly1.cif.gz_D crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d-glucuronate 0.9841 30 328
4x8r-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate 0.9735 31 328
4n8y-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate 0.9713 30 328
4ovr-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d-galacturonate 0.97 32 327
ID Description Score Start End Superfamily
4n8yB00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9713 30 328 3.40.190.170
4x8rB00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9706 31 328 3.40.190.170
4n8yB00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9618 30 328 3.40.190.170
af_P37676_23_328_3.40.190.170 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9591 29 328 3.40.190.170
4pf8A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9546 32 324 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A656JY05-F1-model_v4 TRAP dicarboxylate transporter subunit DctP 0.992 108 284 GO:0030246
GO:0055085
AF-A0A6D0EIF7-F1-model_v4 deleted 0.9871 28 328
AF-A0A1I7FN40-F1-model_v4 Tripartite ATP-independent transporter solute receptor, DctP family 0.9866 30 329 GO:0030246
GO:0030288
GO:0055085
AF-A0A519ME77-F1-model_v4 TRAP transporter substrate-binding protein 0.977 32 329 GO:0030246
GO:0030288
GO:0055085
AF-A0A1I7FN40-F1-model_v4 Tripartite ATP-independent transporter solute receptor, DctP family 0.9768 30 329 GO:0030246
GO:0030288
GO:0055085

Map