F489199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1057 | 479 | 2114 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10219233|Ga0075365_102192332 |
| Length | 381 |
| Sequence | MIRKSGHRFSEKIMLKKKMIDEHDSTLLKHALEFEKSIKTINNIRRNTMKRRDFIKLSAGLGATMAATTPLSSAFAQTKMVLKASDVHPLGYPTVEAVVRMGKKLEAATNGRLTIQMFPSMQLGGEKEMIEQAQLGALQIARISVGAVGPVVDDVNVFNMPFVFRNSKHMEKVIDGEIGDELLAKISAAEKTGLIALCWMNAGSRNVYNNKRPIKTIADLKGLKVRMMGNPLFVDTMNALGGNGVALGFDQVFSSMQTGVVDGAENNPPSFIAQNHYQVAKYFTMTEHLIIPELLVFSRISWQKLSPEDQALIKKLSKETQAEQRVLWYEAENAAIEKMKAAGTEIITDIDKKPFQDAVKPVWDKYGAKYAAMVKRIEAVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 261 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 262 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 264 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 265 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 266 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 267 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 353 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 354 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 381 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 382 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 401 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 404 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 405 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 409 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 411 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 412 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 413 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 414 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 415 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 416 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 418 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 419 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 421 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 423 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 425 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 426 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 430 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 431 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 433 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 435 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 438 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 439 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 440 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 441 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 442 | 2791355199 | |||
| 443 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 444 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 445 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 446 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 447 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 448 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 449 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 450 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 451 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 452 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 453 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 454 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 455 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 456 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 457 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 458 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 459 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 460 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 461 | 2922425934 | |||
| 462 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 463 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 464 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 465 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 466 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 467 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 468 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 469 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 470 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 471 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 472 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 473 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 474 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 475 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 476 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 477 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 478 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 479 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.73 |
| Metatranscriptomes | 0.47 |
| Isolates | 3.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.58 |
| Nodule | 2.55 |
| Rhizoplane | 4.82 |
| Rhizosphere | 73.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10219233 | 3300006038 | Bacteria | 1334 |
| 2 | rootH2_10076215 | 3300003320 | Bacteria | 2795 |
| 3 | Ga0065165_1031353 | 3300005262 | Bacteria | 1681 |
| 4 | Ga0065712_10010742 | 3300005290 | Bacteria | 3141 |
| 5 | Ga0070658_10134615 | 3300005327 | Bacteria | 2061 |
| 6 | Ga0070658_10166078 | 3300005327 | Bacteria | 1853 |
| 7 | Ga0070683_100010779 | 3300005329 | Bacteria | 7866 |
| 8 | Ga0070683_100033581 | 3300005329 | Bacteria | 4680 |
| 9 | Ga0068869_100161773 | 3300005334 | Bacteria | 1743 |
| 10 | Ga0070666_10007550 | 3300005335 | Bacteria | 6705 |
| 11 | Ga0070680_100003232 | 3300005336 | Bacteria | 12125 |
| 12 | Ga0070680_100023993 | 3300005336 | Bacteria | 4868 |
| 13 | Ga0070680_100111433 | 3300005336 | Bacteria | 2278 |
| 14 | Ga0068868_100006674 | 3300005338 | Bacteria | 8190 |
| 15 | Ga0070660_100054851 | 3300005339 | Bacteria | 3079 |
| 16 | Ga0070689_100018748 | 3300005340 | Bacteria | 5104 |
| 17 | Ga0070661_100031364 | 3300005344 | Bacteria | 3843 |
| 18 | Ga0070661_100047804 | 3300005344 | Bacteria | 3131 |
| 19 | Ga0070661_100374093 | 3300005344 | Bacteria | 1122 |
| 20 | Ga0070692_10177951 | 3300005345 | Bacteria | 1231 |
| 21 | Ga0070668_100063107 | 3300005347 | Bacteria | 2871 |
| 22 | Ga0070668_100282663 | 3300005347 | Bacteria | 1386 |
| 23 | Ga0070675_100282785 | 3300005354 | Bacteria | 1458 |
| 24 | Ga0070671_100074767 | 3300005355 | Bacteria | 2831 |
| 25 | Ga0070671_100102394 | 3300005355 | Bacteria | 2403 |
| 26 | Ga0070671_100439400 | 3300005355 | Bacteria | 1119 |
| 27 | Ga0070674_100005057 | 3300005356 | Bacteria | 7582 |
| 28 | Ga0070674_100240705 | 3300005356 | Bacteria | 1416 |
| 29 | Ga0070674_100247513 | 3300005356 | Bacteria | 1398 |
| 30 | Ga0070673_100092917 | 3300005364 | Bacteria | 2469 |
| 31 | Ga0070673_100127565 | 3300005364 | Bacteria | 2130 |
| 32 | Ga0070673_100333033 | 3300005364 | Bacteria | 1343 |
| 33 | Ga0070688_100018632 | 3300005365 | Bacteria | 4009 |
| 34 | Ga0070659_100055656 | 3300005366 | Bacteria | 3118 |
| 35 | Ga0070667_100007371 | 3300005367 | Bacteria | 9134 |
| 36 | Ga0070667_100150126 | 3300005367 | Bacteria | 2047 |
| 37 | Ga0070703_10000651 | 3300005406 | Bacteria | 12106 |
| 38 | Ga0070709_10029048 | 3300005434 | Bacteria | 3303 |
| 39 | Ga0070709_10077546 | 3300005434 | Bacteria | 2160 |
| 40 | Ga0070709_10111416 | 3300005434 | Bacteria | 1840 |
| 41 | Ga0070714_100022197 | 3300005435 | Bacteria | 5203 |
| 42 | Ga0070714_100027863 | 3300005435 | Bacteria | 4681 |
| 43 | Ga0070714_100061698 | 3300005435 | Bacteria | 3220 |
| 44 | Ga0070714_100071718 | 3300005435 | Bacteria | 2996 |
| 45 | Ga0070714_100132616 | 3300005435 | Bacteria | 2227 |
| 46 | Ga0070714_100226567 | 3300005435 | Bacteria | 1720 |
| 47 | Ga0070714_100524121 | 3300005435 | Bacteria | 1132 |
| 48 | Ga0070713_100004734 | 3300005436 | Bacteria | 9199 |
| 49 | Ga0070713_100014299 | 3300005436 | Bacteria | 5889 |
| 50 | Ga0070713_100065457 | 3300005436 | Bacteria | 3053 |
| 51 | Ga0070713_100068131 | 3300005436 | Bacteria | 2998 |
| 52 | Ga0070713_100152241 | 3300005436 | Bacteria | 2058 |
| 53 | Ga0070713_100232694 | 3300005436 | Bacteria | 1676 |
| 54 | Ga0070713_100316426 | 3300005436 | Bacteria | 1440 |
| 55 | Ga0070710_10000586 | 3300005437 | Bacteria | 17299 |
| 56 | Ga0070710_10003922 | 3300005437 | Bacteria | 7049 |
| 57 | Ga0070710_10014356 | 3300005437 | Bacteria | 3986 |
| 58 | Ga0070710_10019605 | 3300005437 | Bacteria | 3497 |
| 59 | Ga0070710_10136760 | 3300005437 | Bacteria | 1499 |
| 60 | Ga0070701_10064051 | 3300005438 | Bacteria | 1947 |
| 61 | Ga0070701_10119509 | 3300005438 | Bacteria | 1483 |
| 62 | Ga0070711_100005860 | 3300005439 | Bacteria | 7376 |
| 63 | Ga0070711_100009005 | 3300005439 | Bacteria | 6128 |
| 64 | Ga0070711_100017661 | 3300005439 | Bacteria | 4545 |
| 65 | Ga0070711_100024621 | 3300005439 | Bacteria | 3929 |
| 66 | Ga0070711_100048425 | 3300005439 | Bacteria | 2906 |
| 67 | Ga0070705_100000101 | 3300005440 | Bacteria | 48577 |
| 68 | Ga0070705_100116207 | 3300005440 | Bacteria | 1719 |
| 69 | Ga0070705_100162470 | 3300005440 | Bacteria | 1495 |
| 70 | Ga0070700_100150960 | 3300005441 | Bacteria | 1589 |
| 71 | Ga0070694_100000321 | 3300005444 | Bacteria | 25869 |
| 72 | Ga0070694_100022228 | 3300005444 | Bacteria | 4062 |
| 73 | Ga0070694_100160533 | 3300005444 | Bacteria | 1649 |
| 74 | Ga0070708_100000726 | 3300005445 | Bacteria | 25018 |
| 75 | Ga0070708_100011955 | 3300005445 | Bacteria | 7074 |
| 76 | Ga0070708_100195848 | 3300005445 | Bacteria | 1891 |
| 77 | Ga0070708_100267045 | 3300005445 | Bacteria | 1609 |
| 78 | Ga0070663_100007449 | 3300005455 | Bacteria | 6658 |
| 79 | Ga0070663_100023527 | 3300005455 | Bacteria | 4131 |
| 80 | Ga0070663_100144753 | 3300005455 | Bacteria | 1817 |
| 81 | Ga0070678_100027852 | 3300005456 | Bacteria | 3843 |
| 82 | Ga0070678_100289694 | 3300005456 | Bacteria | 1387 |
| 83 | Ga0070662_100013385 | 3300005457 | Bacteria | 5459 |
| 84 | Ga0070662_100255726 | 3300005457 | Bacteria | 1410 |
| 85 | Ga0070662_100281124 | 3300005457 | Bacteria | 1347 |
| 86 | Ga0070681_10025308 | 3300005458 | Bacteria | 5969 |
| 87 | Ga0070681_10106355 | 3300005458 | Bacteria | 2747 |
| 88 | Ga0070681_10128227 | 3300005458 | Bacteria | 2470 |
| 89 | Ga0068867_100026332 | 3300005459 | Bacteria | 4176 |
| 90 | Ga0068867_100036340 | 3300005459 | Bacteria | 3575 |
| 91 | Ga0068867_100243206 | 3300005459 | Bacteria | 1460 |
| 92 | Ga0070685_10030190 | 3300005466 | Bacteria | 3018 |
| 93 | Ga0070706_100021627 | 3300005467 | Bacteria | 5924 |
| 94 | Ga0070706_100431953 | 3300005467 | Bacteria | 1226 |
| 95 | Ga0070707_100330174 | 3300005468 | Bacteria | 1482 |
| 96 | Ga0070698_100264832 | 3300005471 | Bacteria | 1651 |
| 97 | Ga0070699_100000281 | 3300005518 | Bacteria | 48573 |
| 98 | Ga0070679_100045232 | 3300005530 | Bacteria | 4387 |
| 99 | Ga0070679_100232077 | 3300005530 | Bacteria | 1804 |
| 100 | Ga0070684_100006541 | 3300005535 | Bacteria | 9022 |
| 101 | Ga0070684_100250818 | 3300005535 | Bacteria | 1618 |
| 102 | Ga0070697_100008863 | 3300005536 | Bacteria | 7853 |
| 103 | Ga0070697_100028285 | 3300005536 | Bacteria | 4488 |
| 104 | Ga0068853_100155935 | 3300005539 | Bacteria | 2058 |
| 105 | Ga0070672_100010256 | 3300005543 | Bacteria | 6492 |
| 106 | Ga0070672_100075256 | 3300005543 | Bacteria | 2695 |
| 107 | Ga0070672_100371081 | 3300005543 | Bacteria | 1223 |
| 108 | Ga0070695_100004104 | 3300005545 | Bacteria | 8515 |
| 109 | Ga0070695_100014438 | 3300005545 | Bacteria | 4762 |
| 110 | Ga0070695_100214542 | 3300005545 | Bacteria | 1383 |
| 111 | Ga0070696_100000811 | 3300005546 | Bacteria | 20108 |
| 112 | Ga0070696_100175334 | 3300005546 | Bacteria | 1588 |
| 113 | Ga0070696_100193126 | 3300005546 | Bacteria | 1516 |
| 114 | Ga0070693_100007751 | 3300005547 | Bacteria | 5264 |
| 115 | Ga0070693_100022290 | 3300005547 | Bacteria | 3365 |
| 116 | Ga0070665_100141231 | 3300005548 | Bacteria | 2411 |
| 117 | Ga0070704_100099583 | 3300005549 | Bacteria | 2186 |
| 118 | Ga0068855_100022696 | 3300005563 | Bacteria | 7520 |
| 119 | Ga0068855_100064892 | 3300005563 | Bacteria | 4258 |
| 120 | Ga0068855_100174539 | 3300005563 | Bacteria | 2433 |
| 121 | Ga0068855_100600849 | 3300005563 | Bacteria | 1186 |
| 122 | Ga0070664_100046730 | 3300005564 | Bacteria | 3657 |
| 123 | Ga0070664_100109474 | 3300005564 | Bacteria | 2410 |
| 124 | Ga0070664_100113488 | 3300005564 | Bacteria | 2367 |
| 125 | Ga0068857_100003319 | 3300005577 | Bacteria | 13380 |
| 126 | Ga0068857_100075134 | 3300005577 | Bacteria | 3013 |
| 127 | Ga0068857_100154781 | 3300005577 | Bacteria | 2078 |
| 128 | Ga0068857_100170743 | 3300005577 | Bacteria | 1977 |
| 129 | Ga0068857_100317361 | 3300005577 | Bacteria | 1438 |
| 130 | Ga0068854_100019516 | 3300005578 | Bacteria | 4571 |
| 131 | Ga0068854_100090515 | 3300005578 | Bacteria | 2275 |
| 132 | Ga0068856_100000066 | 3300005614 | Bacteria | 98376 |
| 133 | Ga0068856_100023411 | 3300005614 | Bacteria | 6005 |
| 134 | Ga0068856_100033294 | 3300005614 | Bacteria | 5045 |
| 135 | Ga0068856_100110066 | 3300005614 | Bacteria | 2751 |
| 136 | Ga0068856_100376605 | 3300005614 | Bacteria | 1438 |
| 137 | Ga0070702_100065280 | 3300005615 | Bacteria | 2132 |
| 138 | Ga0070702_100096815 | 3300005615 | Bacteria | 1802 |
| 139 | Ga0070702_100121592 | 3300005615 | Bacteria | 1635 |
| 140 | Ga0068852_100002462 | 3300005616 | Bacteria | 12744 |
| 141 | Ga0068852_100010672 | 3300005616 | Bacteria | 6877 |
| 142 | Ga0068852_100119821 | 3300005616 | Bacteria | 2407 |
| 143 | Ga0068859_100006260 | 3300005617 | Bacteria | 12073 |
| 144 | Ga0068859_100011754 | 3300005617 | Bacteria | 8795 |
| 145 | Ga0068859_100018584 | 3300005617 | Bacteria | 6988 |
| 146 | Ga0068859_100182333 | 3300005617 | Bacteria | 2182 |
| 147 | Ga0068864_100089468 | 3300005618 | Bacteria | 2712 |
| 148 | Ga0068864_100416446 | 3300005618 | Bacteria | 1279 |
| 149 | Ga0068864_100499749 | 3300005618 | Bacteria | 1170 |
| 150 | Ga0068866_10022649 | 3300005718 | Bacteria | 2910 |
| 151 | Ga0068866_10158523 | 3300005718 | Bacteria | 1317 |
| 152 | Ga0068861_100035422 | 3300005719 | Bacteria | 3697 |
| 153 | Ga0068861_100037067 | 3300005719 | Bacteria | 3624 |
| 154 | Ga0068861_100351674 | 3300005719 | Bacteria | 1293 |
| 155 | Ga0068870_10143662 | 3300005840 | Bacteria | 1399 |
| 156 | Ga0068863_100005165 | 3300005841 | Bacteria | 12873 |
| 157 | Ga0068863_100074770 | 3300005841 | Bacteria | 3205 |
| 158 | Ga0068863_100169221 | 3300005841 | Bacteria | 2095 |
| 159 | Ga0068858_100016247 | 3300005842 | Bacteria | 6992 |
| 160 | Ga0068858_100022839 | 3300005842 | Bacteria | 5834 |
| 161 | Ga0068858_100255861 | 3300005842 | Bacteria | 1664 |
| 162 | Ga0068858_100258420 | 3300005842 | Bacteria | 1655 |
| 163 | Ga0068860_100001582 | 3300005843 | Bacteria | 24502 |
| 164 | Ga0068860_100004600 | 3300005843 | Bacteria | 14090 |
| 165 | Ga0068860_100030287 | 3300005843 | Bacteria | 5205 |
| 166 | Ga0081455_10000014 | 3300005937 | Bacteria | 193884 |
| 167 | Ga0081455_10003956 | 3300005937 | Bacteria | 16827 |
| 168 | Ga0081455_10004726 | 3300005937 | Bacteria | 15138 |
| 169 | Ga0081455_10041561 | 3300005937 | Bacteria | 4041 |
| 170 | Ga0081540_1001902 | 3300005983 | Bacteria | 17470 |
| 171 | Ga0081540_1033630 | 3300005983 | Bacteria | 2780 |
| 172 | Ga0081540_1034190 | 3300005983 | Bacteria | 2746 |
| 173 | Ga0081539_10020579 | 3300005985 | Bacteria | 4452 |
| 174 | Ga0081539_10069592 | 3300005985 | Bacteria | 1893 |
| 175 | Ga0070717_10000926 | 3300006028 | Bacteria | 19535 |
| 176 | Ga0070717_10317791 | 3300006028 | Bacteria | 1387 |
| 177 | Ga0075365_10019309 | 3300006038 | Bacteria | 4206 |
| 178 | Ga0075365_10020412 | 3300006038 | Bacteria | 4107 |
| 179 | Ga0075365_10121584 | 3300006038 | Bacteria | 1801 |
| 180 | Ga0075365_10146985 | 3300006038 | Bacteria | 1638 |
| 181 | Ga0075368_10008841 | 3300006042 | Bacteria | 3607 |
| 182 | Ga0075368_10058639 | 3300006042 | Bacteria | 1539 |
| 183 | Ga0075363_100009358 | 3300006048 | Bacteria | 4604 |
| 184 | Ga0075363_100044157 | 3300006048 | Bacteria | 2360 |
| 185 | Ga0075363_100078670 | 3300006048 | Bacteria | 1800 |
| 186 | Ga0075364_10002466 | 3300006051 | Bacteria | 10364 |
| 187 | Ga0075364_10006004 | 3300006051 | Bacteria | 7098 |
| 188 | Ga0075364_10009887 | 3300006051 | Bacteria | 5738 |
| 189 | Ga0075364_10030814 | 3300006051 | Bacteria | 3444 |
| 190 | Ga0075364_10059980 | 3300006051 | Bacteria | 2495 |
| 191 | Ga0070715_10089756 | 3300006163 | Bacteria | 1412 |
| 192 | Ga0070715_10095021 | 3300006163 | Bacteria | 1379 |
| 193 | Ga0070716_100075350 | 3300006173 | Bacteria | 1996 |
| 194 | Ga0070716_100076581 | 3300006173 | Bacteria | 1983 |
| 195 | Ga0070716_100130746 | 3300006173 | Bacteria | 1586 |
| 196 | Ga0070716_100200234 | 3300006173 | Bacteria | 1327 |
| 197 | Ga0070712_100000412 | 3300006175 | Bacteria | 24423 |
| 198 | Ga0070712_100006858 | 3300006175 | Bacteria | 7096 |
| 199 | Ga0070712_100028515 | 3300006175 | Bacteria | 3734 |
| 200 | Ga0070712_100028607 | 3300006175 | Bacteria | 3729 |
| 201 | Ga0070712_100060845 | 3300006175 | Bacteria | 2665 |
| 202 | Ga0070712_100092789 | 3300006175 | Bacteria | 2215 |
| 203 | Ga0070712_100099906 | 3300006175 | Bacteria | 2143 |
| 204 | Ga0070712_100105892 | 3300006175 | Bacteria | 2089 |
| 205 | Ga0070712_100148536 | 3300006175 | Bacteria | 1797 |
| 206 | Ga0070712_100353300 | 3300006175 | Bacteria | 1204 |
| 207 | Ga0075362_10000965 | 3300006177 | Bacteria | 8804 |
| 208 | Ga0075362_10008875 | 3300006177 | Bacteria | 3865 |
| 209 | Ga0075362_10046267 | 3300006177 | Bacteria | 1934 |
| 210 | Ga0075367_10000878 | 3300006178 | Bacteria | 12058 |
| 211 | Ga0075367_10001658 | 3300006178 | Bacteria | 9706 |
| 212 | Ga0075367_10004378 | 3300006178 | Bacteria | 6887 |
| 213 | Ga0075367_10011660 | 3300006178 | Bacteria | 4662 |
| 214 | Ga0075367_10038372 | 3300006178 | Bacteria | 2788 |
| 215 | Ga0075367_10041143 | 3300006178 | Bacteria | 2701 |
| 216 | Ga0075367_10076025 | 3300006178 | Bacteria | 2026 |
| 217 | Ga0075369_10026428 | 3300006186 | Bacteria | 2419 |
| 218 | Ga0075366_10006131 | 3300006195 | Bacteria | 6555 |
| 219 | Ga0075366_10029088 | 3300006195 | Bacteria | 3245 |
| 220 | Ga0075366_10081172 | 3300006195 | Bacteria | 1937 |
| 221 | Ga0075366_10107745 | 3300006195 | Bacteria | 1675 |
| 222 | Ga0097621_100089872 | 3300006237 | Bacteria | 2569 |
| 223 | Ga0075370_10015337 | 3300006353 | Bacteria | 4100 |
| 224 | Ga0075370_10134592 | 3300006353 | Bacteria | 1443 |
| 225 | Ga0068871_100149386 | 3300006358 | Bacteria | 1992 |
| 226 | Ga0068871_100152040 | 3300006358 | Bacteria | 1974 |
| 227 | Ga0075428_100140325 | 3300006844 | Bacteria | 2628 |
| 228 | Ga0075428_100422791 | 3300006844 | Bacteria | 1428 |
| 229 | Ga0075430_100004348 | 3300006846 | Bacteria | 11969 |
| 230 | Ga0075431_100005249 | 3300006847 | Bacteria | 12758 |
| 231 | Ga0075433_10011738 | 3300006852 | Bacteria | 7054 |
| 232 | Ga0075434_100005130 | 3300006871 | Bacteria | 11896 |
| 233 | Ga0075434_100006402 | 3300006871 | Bacteria | 10789 |
| 234 | Ga0068865_100073788 | 3300006881 | Bacteria | 2427 |
| 235 | Ga0075436_100001047 | 3300006914 | Bacteria | 18675 |
| 236 | Ga0075436_100105359 | 3300006914 | Bacteria | 1966 |
| 237 | Ga0075436_100274854 | 3300006914 | Bacteria | 1204 |
| 238 | Ga0097620_100006260 | 3300006931 | Bacteria | 12073 |
| 239 | Ga0097620_100011754 | 3300006931 | Bacteria | 8795 |
| 240 | Ga0097620_100018584 | 3300006931 | Bacteria | 6988 |
| 241 | Ga0097620_100182326 | 3300006931 | Bacteria | 2182 |
| 242 | Ga0075435_100019399 | 3300007076 | Bacteria | 5194 |
| 243 | Ga0075435_100315385 | 3300007076 | Bacteria | 1338 |
| 244 | Ga0099794_10029160 | 3300007265 | Bacteria | 2570 |
| 245 | Ga0099794_10061249 | 3300007265 | Bacteria | 1828 |
| 246 | Ga0099794_10093188 | 3300007265 | Bacteria | 1497 |
| 247 | Ga0099795_10030171 | 3300007788 | Bacteria | 1859 |
| 248 | Ga0099795_10034282 | 3300007788 | Bacteria | 1768 |
| 249 | Ga0099795_10062935 | 3300007788 | Bacteria | 1381 |
| 250 | Ga0105240_10006645 | 3300009093 | Bacteria | 16975 |
| 251 | Ga0105240_10007301 | 3300009093 | Bacteria | 16084 |
| 252 | Ga0105240_10070911 | 3300009093 | Bacteria | 4309 |
| 253 | Ga0105240_10088210 | 3300009093 | Bacteria | 3796 |
| 254 | Ga0105240_10330018 | 3300009093 | Bacteria | 1736 |
| 255 | Ga0105240_10410743 | 3300009093 | Bacteria | 1523 |
| 256 | Ga0111539_10004677 | 3300009094 | Bacteria | 17885 |
| 257 | Ga0111539_10009581 | 3300009094 | Bacteria | 12223 |
| 258 | Ga0111539_10013311 | 3300009094 | Bacteria | 10280 |
| 259 | Ga0111539_10151813 | 3300009094 | Bacteria | 2711 |
| 260 | Ga0105245_10004067 | 3300009098 | Bacteria | 12992 |
| 261 | Ga0105245_10006433 | 3300009098 | Bacteria | 10340 |
| 262 | Ga0105245_10031288 | 3300009098 | Bacteria | 4708 |
| 263 | Ga0105245_10038950 | 3300009098 | Bacteria | 4230 |
| 264 | Ga0105245_10065437 | 3300009098 | Bacteria | 3288 |
| 265 | Ga0105245_10088645 | 3300009098 | Bacteria | 2842 |
| 266 | Ga0105247_10021588 | 3300009101 | Bacteria | 3875 |
| 267 | Ga0105247_10036022 | 3300009101 | Bacteria | 3017 |
| 268 | Ga0105247_10070772 | 3300009101 | Bacteria | 2180 |
| 269 | Ga0105247_10108410 | 3300009101 | Bacteria | 1784 |
| 270 | Ga0105247_10116130 | 3300009101 | Bacteria | 1728 |
| 271 | Ga0114129_10082645 | 3300009147 | Bacteria | 4462 |
| 272 | Ga0114129_10203496 | 3300009147 | Bacteria | 2680 |
| 273 | Ga0105241_10018995 | 3300009174 | Bacteria | 5066 |
| 274 | Ga0105241_10038542 | 3300009174 | Bacteria | 3603 |
| 275 | Ga0105241_10074324 | 3300009174 | Bacteria | 2647 |
| 276 | Ga0105241_10097895 | 3300009174 | Bacteria | 2327 |
| 277 | Ga0105242_10037241 | 3300009176 | Bacteria | 3906 |
| 278 | Ga0105242_10061497 | 3300009176 | Bacteria | 3089 |
| 279 | Ga0105242_10189410 | 3300009176 | Bacteria | 1820 |
| 280 | Ga0105242_10262216 | 3300009176 | Bacteria | 1561 |
| 281 | Ga0105242_10311372 | 3300009176 | Bacteria | 1441 |
| 282 | Ga0105242_10313176 | 3300009176 | Bacteria | 1437 |
| 283 | Ga0105248_10007036 | 3300009177 | Bacteria | 12323 |
| 284 | Ga0105237_10005677 | 3300009545 | Bacteria | 14037 |
| 285 | Ga0105237_10070763 | 3300009545 | Bacteria | 3484 |
| 286 | Ga0105237_10082031 | 3300009545 | Bacteria | 3216 |
| 287 | Ga0105237_10103825 | 3300009545 | Bacteria | 2834 |
| 288 | Ga0105237_10131053 | 3300009545 | Bacteria | 2502 |
| 289 | Ga0105237_10164168 | 3300009545 | Bacteria | 2220 |
| 290 | Ga0105237_10474604 | 3300009545 | Bacteria | 1257 |
| 291 | Ga0105238_10025920 | 3300009551 | Bacteria | 5977 |
| 292 | Ga0105238_10031915 | 3300009551 | Bacteria | 5360 |
| 293 | Ga0105238_10078885 | 3300009551 | Bacteria | 3283 |
| 294 | Ga0105238_10136335 | 3300009551 | Bacteria | 2432 |
| 295 | Ga0105238_10194210 | 3300009551 | Bacteria | 2006 |
| 296 | Ga0105238_10445607 | 3300009551 | Bacteria | 1291 |
| 297 | Ga0105238_10463432 | 3300009551 | Bacteria | 1265 |
| 298 | Ga0105238_10496987 | 3300009551 | Bacteria | 1220 |
| 299 | Ga0105249_10009590 | 3300009553 | Bacteria | 8483 |
| 300 | Ga0099796_10000999 | 3300010159 | Bacteria | 5329 |
| 301 | Ga0099796_10010628 | 3300010159 | Bacteria | 2537 |
| 302 | Ga0099796_10014871 | 3300010159 | Bacteria | 2259 |
| 303 | Ga0105239_10013662 | 3300010375 | Bacteria | 9016 |
| 304 | Ga0105239_10035753 | 3300010375 | Bacteria | 5454 |
| 305 | Ga0105239_10092226 | 3300010375 | Bacteria | 3343 |
| 306 | Ga0105239_10243437 | 3300010375 | Bacteria | 2019 |
| 307 | Ga0105239_10281693 | 3300010375 | Bacteria | 1871 |
| 308 | Ga0105239_10411731 | 3300010375 | Bacteria | 1531 |
| 309 | Ga0105246_10010353 | 3300011119 | Bacteria | 5768 |
| 310 | Ga0157373_10054362 | 3300013100 | Bacteria | 2845 |
| 311 | Ga0157371_10012441 | 3300013102 | Bacteria | 6504 |
| 312 | Ga0157370_10034068 | 3300013104 | Bacteria | 4962 |
| 313 | Ga0157370_10070950 | 3300013104 | Bacteria | 3287 |
| 314 | Ga0157369_10004338 | 3300013105 | Bacteria | 16741 |
| 315 | Ga0157369_10010807 | 3300013105 | Bacteria | 10395 |
| 316 | Ga0157374_10012898 | 3300013296 | Bacteria | 7279 |
| 317 | Ga0157374_10149490 | 3300013296 | Bacteria | 2270 |
| 318 | Ga0157374_10171838 | 3300013296 | Bacteria | 2114 |
| 319 | Ga0157378_10001343 | 3300013297 | Bacteria | 22101 |
| 320 | Ga0157378_10086729 | 3300013297 | Bacteria | 2838 |
| 321 | Ga0157378_10249206 | 3300013297 | Bacteria | 1700 |
| 322 | Ga0157378_10318426 | 3300013297 | Bacteria | 1510 |
| 323 | Ga0157378_10324029 | 3300013297 | Bacteria | 1498 |
| 324 | Ga0163162_10007091 | 3300013306 | Bacteria | 10875 |
| 325 | Ga0163162_10024766 | 3300013306 | Bacteria | 5927 |
| 326 | Ga0163162_10060820 | 3300013306 | Bacteria | 3814 |
| 327 | Ga0163162_10153308 | 3300013306 | Bacteria | 2423 |
| 328 | Ga0157372_10049063 | 3300013307 | Bacteria | 4693 |
| 329 | Ga0157372_10104355 | 3300013307 | Bacteria | 3240 |
| 330 | Ga0157372_10265177 | 3300013307 | Bacteria | 1994 |
| 331 | Ga0157375_10003647 | 3300013308 | Bacteria | 13358 |
| 332 | Ga0157375_10260714 | 3300013308 | Bacteria | 1895 |
| 333 | Ga0157375_10434064 | 3300013308 | Bacteria | 1479 |
| 334 | Ga0163163_10009357 | 3300014325 | Bacteria | 8746 |
| 335 | Ga0157380_10089746 | 3300014326 | Bacteria | 2533 |
| 336 | Ga0157380_10193031 | 3300014326 | Bacteria | 1800 |
| 337 | Ga0182008_10054953 | 3300014497 | Bacteria | 1969 |
| 338 | Ga0157379_10000412 | 3300014968 | Bacteria | 34763 |
| 339 | Ga0157376_10017075 | 3300014969 | Bacteria | 5527 |
| 340 | Ga0157376_10249774 | 3300014969 | Bacteria | 1656 |
| 341 | Ga0213874_10004128 | 3300021377 | Bacteria | 3282 |
| 342 | Ga0213874_10049022 | 3300021377 | Bacteria | 1290 |
| 343 | Ga0213876_10005223 | 3300021384 | Bacteria | 7159 |
| 344 | Ga0213876_10076446 | 3300021384 | Bacteria | 1768 |
| 345 | Ga0213875_10000030 | 3300021388 | Bacteria | 178500 |
| 346 | Ga0209563_106750 | 3300025230 | Bacteria | 1946 |
| 347 | Ga0209677_100749 | 3300025253 | Bacteria | 16460 |
| 348 | Ga0209148_1000711 | 3300025254 | Bacteria | 26722 |
| 349 | Ga0209233_1002053 | 3300025261 | Bacteria | 7631 |
| 350 | Ga0209233_1005766 | 3300025261 | Bacteria | 4072 |
| 351 | Ga0209233_1017691 | 3300025261 | Bacteria | 1936 |
| 352 | Ga0209455_1001471 | 3300025272 | Bacteria | 10598 |
| 353 | Ga0209455_1002106 | 3300025272 | Bacteria | 7942 |
| 354 | Ga0209455_1017435 | 3300025272 | Bacteria | 1505 |
| 355 | Ga0209564_1000503 | 3300025295 | Bacteria | 64437 |
| 356 | Ga0209564_1024573 | 3300025295 | Bacteria | 2055 |
| 357 | Ga0209758_1003246 | 3300025297 | Bacteria | 15078 |
| 358 | Ga0209758_1013786 | 3300025297 | Bacteria | 4370 |
| 359 | Ga0207653_10004798 | 3300025885 | Bacteria | 4229 |
| 360 | Ga0207682_10046666 | 3300025893 | Bacteria | 1781 |
| 361 | Ga0207692_10000750 | 3300025898 | Bacteria | 11461 |
| 362 | Ga0207692_10021336 | 3300025898 | Bacteria | 2962 |
| 363 | Ga0207692_10028491 | 3300025898 | Bacteria | 2642 |
| 364 | Ga0207692_10043154 | 3300025898 | Bacteria | 2242 |
| 365 | Ga0207642_10036265 | 3300025899 | Bacteria | 2115 |
| 366 | Ga0207710_10025386 | 3300025900 | Bacteria | 2557 |
| 367 | Ga0207710_10062801 | 3300025900 | Bacteria | 1689 |
| 368 | Ga0207688_10068602 | 3300025901 | Bacteria | 2008 |
| 369 | Ga0207688_10095562 | 3300025901 | Bacteria | 1710 |
| 370 | Ga0207680_10003578 | 3300025903 | Bacteria | 7301 |
| 371 | Ga0207685_10084654 | 3300025905 | Bacteria | 1321 |
| 372 | Ga0207699_10041705 | 3300025906 | Bacteria | 2653 |
| 373 | Ga0207699_10082446 | 3300025906 | Bacteria | 1998 |
| 374 | Ga0207699_10279938 | 3300025906 | Bacteria | 1159 |
| 375 | Ga0207645_10055417 | 3300025907 | Bacteria | 2531 |
| 376 | Ga0207643_10050130 | 3300025908 | Bacteria | 2367 |
| 377 | Ga0207643_10115471 | 3300025908 | Bacteria | 1585 |
| 378 | Ga0207705_10261882 | 3300025909 | Bacteria | 1320 |
| 379 | Ga0207684_10048203 | 3300025910 | Bacteria | 3613 |
| 380 | Ga0207707_10009615 | 3300025912 | Bacteria | 8389 |
| 381 | Ga0207707_10038943 | 3300025912 | Bacteria | 4155 |
| 382 | Ga0207707_10045184 | 3300025912 | Bacteria | 3838 |
| 383 | Ga0207707_10049476 | 3300025912 | Bacteria | 3662 |
| 384 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 385 | Ga0207695_10111957 | 3300025913 | Bacteria | 2708 |
| 386 | Ga0207695_10134869 | 3300025913 | Bacteria | 2423 |
| 387 | Ga0207695_10166253 | 3300025913 | Bacteria | 2134 |
| 388 | Ga0207695_10176901 | 3300025913 | Bacteria | 2056 |
| 389 | Ga0207695_10189865 | 3300025913 | Bacteria | 1972 |
| 390 | Ga0207695_10384490 | 3300025913 | Bacteria | 1289 |
| 391 | Ga0207671_10002337 | 3300025914 | Bacteria | 20455 |
| 392 | Ga0207671_10042369 | 3300025914 | Bacteria | 3369 |
| 393 | Ga0207671_10052329 | 3300025914 | Bacteria | 3026 |
| 394 | Ga0207671_10137655 | 3300025914 | Bacteria | 1879 |
| 395 | Ga0207693_10000969 | 3300025915 | Bacteria | 25801 |
| 396 | Ga0207693_10001536 | 3300025915 | Bacteria | 20416 |
| 397 | Ga0207693_10002407 | 3300025915 | Bacteria | 16244 |
| 398 | Ga0207693_10015794 | 3300025915 | Bacteria | 6049 |
| 399 | Ga0207693_10020767 | 3300025915 | Bacteria | 5223 |
| 400 | Ga0207693_10022603 | 3300025915 | Bacteria | 4996 |
| 401 | Ga0207693_10029915 | 3300025915 | Bacteria | 4298 |
| 402 | Ga0207693_10031820 | 3300025915 | Bacteria | 4168 |
| 403 | Ga0207693_10035068 | 3300025915 | Bacteria | 3957 |
| 404 | Ga0207693_10069433 | 3300025915 | Bacteria | 2757 |
| 405 | Ga0207693_10178367 | 3300025915 | Bacteria | 1671 |
| 406 | Ga0207663_10000225 | 3300025916 | Bacteria | 25184 |
| 407 | Ga0207663_10019032 | 3300025916 | Bacteria | 3859 |
| 408 | Ga0207663_10081597 | 3300025916 | Bacteria | 2118 |
| 409 | Ga0207663_10097744 | 3300025916 | Bacteria | 1964 |
| 410 | Ga0207663_10163793 | 3300025916 | Bacteria | 1573 |
| 411 | Ga0207663_10297012 | 3300025916 | Bacteria | 1205 |
| 412 | Ga0207663_10308822 | 3300025916 | Bacteria | 1184 |
| 413 | Ga0207660_10024703 | 3300025917 | Bacteria | 4071 |
| 414 | Ga0207660_10027553 | 3300025917 | Bacteria | 3879 |
| 415 | Ga0207660_10108645 | 3300025917 | Bacteria | 2083 |
| 416 | Ga0207660_10217939 | 3300025917 | Bacteria | 1497 |
| 417 | Ga0207660_10322887 | 3300025917 | Bacteria | 1233 |
| 418 | Ga0207662_10140382 | 3300025918 | Bacteria | 1530 |
| 419 | Ga0207657_10068585 | 3300025919 | Bacteria | 3012 |
| 420 | Ga0207657_10122290 | 3300025919 | Bacteria | 2141 |
| 421 | Ga0207649_10117838 | 3300025920 | Bacteria | 1785 |
| 422 | Ga0207649_10124143 | 3300025920 | Bacteria | 1745 |
| 423 | Ga0207652_10015556 | 3300025921 | Bacteria | 6189 |
| 424 | Ga0207652_10057386 | 3300025921 | Bacteria | 3353 |
| 425 | Ga0207652_10243145 | 3300025921 | Bacteria | 1623 |
| 426 | Ga0207652_10336385 | 3300025921 | Bacteria | 1363 |
| 427 | Ga0207646_10290149 | 3300025922 | Bacteria | 1478 |
| 428 | Ga0207694_10048261 | 3300025924 | Bacteria | 3294 |
| 429 | Ga0207694_10097763 | 3300025924 | Bacteria | 2323 |
| 430 | Ga0207694_10156368 | 3300025924 | Bacteria | 1839 |
| 431 | Ga0207694_10217054 | 3300025924 | Bacteria | 1559 |
| 432 | Ga0207694_10347220 | 3300025924 | Bacteria | 1228 |
| 433 | Ga0207650_10162045 | 3300025925 | Bacteria | 1773 |
| 434 | Ga0207659_10086397 | 3300025926 | Bacteria | 2332 |
| 435 | Ga0207659_10162476 | 3300025926 | Bacteria | 1755 |
| 436 | Ga0207659_10197627 | 3300025926 | Bacteria | 1604 |
| 437 | Ga0207687_10005601 | 3300025927 | Bacteria | 8301 |
| 438 | Ga0207687_10010336 | 3300025927 | Bacteria | 6100 |
| 439 | Ga0207687_10081405 | 3300025927 | Bacteria | 2340 |
| 440 | Ga0207700_10012696 | 3300025928 | Bacteria | 5445 |
| 441 | Ga0207700_10013786 | 3300025928 | Bacteria | 5274 |
| 442 | Ga0207700_10045624 | 3300025928 | Bacteria | 3235 |
| 443 | Ga0207700_10070128 | 3300025928 | Bacteria | 2693 |
| 444 | Ga0207700_10093357 | 3300025928 | Bacteria | 2381 |
| 445 | Ga0207700_10162139 | 3300025928 | Bacteria | 1858 |
| 446 | Ga0207700_10279601 | 3300025928 | Bacteria | 1435 |
| 447 | Ga0207664_10002384 | 3300025929 | Bacteria | 12422 |
| 448 | Ga0207664_10020293 | 3300025929 | Bacteria | 4922 |
| 449 | Ga0207664_10039165 | 3300025929 | Bacteria | 3679 |
| 450 | Ga0207664_10092565 | 3300025929 | Bacteria | 2481 |
| 451 | Ga0207664_10116449 | 3300025929 | Bacteria | 2230 |
| 452 | Ga0207664_10122745 | 3300025929 | Bacteria | 2176 |
| 453 | Ga0207664_10124832 | 3300025929 | Bacteria | 2160 |
| 454 | Ga0207664_10254575 | 3300025929 | Bacteria | 1533 |
| 455 | Ga0207644_10004181 | 3300025931 | Bacteria | 9365 |
| 456 | Ga0207644_10077380 | 3300025931 | Bacteria | 2450 |
| 457 | Ga0207644_10128624 | 3300025931 | Bacteria | 1936 |
| 458 | Ga0207690_10019392 | 3300025932 | Bacteria | 4187 |
| 459 | Ga0207706_10015114 | 3300025933 | Bacteria | 6985 |
| 460 | Ga0207706_10050826 | 3300025933 | Bacteria | 3662 |
| 461 | Ga0207706_10055534 | 3300025933 | Bacteria | 3492 |
| 462 | Ga0207706_10063408 | 3300025933 | Bacteria | 3254 |
| 463 | Ga0207686_10006380 | 3300025934 | Bacteria | 6346 |
| 464 | Ga0207686_10043238 | 3300025934 | Bacteria | 2759 |
| 465 | Ga0207686_10154173 | 3300025934 | Bacteria | 1603 |
| 466 | Ga0207670_10006134 | 3300025936 | Bacteria | 6648 |
| 467 | Ga0207669_10034219 | 3300025937 | Bacteria | 2877 |
| 468 | Ga0207669_10114508 | 3300025937 | Bacteria | 1815 |
| 469 | Ga0207704_10142974 | 3300025938 | Bacteria | 1677 |
| 470 | Ga0207704_10382641 | 3300025938 | Bacteria | 1105 |
| 471 | Ga0207665_10000243 | 3300025939 | Bacteria | 37399 |
| 472 | Ga0207665_10027338 | 3300025939 | Bacteria | 3769 |
| 473 | Ga0207665_10032689 | 3300025939 | Bacteria | 3445 |
| 474 | Ga0207665_10114189 | 3300025939 | Bacteria | 1901 |
| 475 | Ga0207665_10270736 | 3300025939 | Bacteria | 1261 |
| 476 | Ga0207691_10006249 | 3300025940 | Bacteria | 11505 |
| 477 | Ga0207691_10070297 | 3300025940 | Bacteria | 3161 |
| 478 | Ga0207691_10086046 | 3300025940 | Bacteria | 2821 |
| 479 | Ga0207691_10261679 | 3300025940 | Bacteria | 1491 |
| 480 | Ga0207711_10005199 | 3300025941 | Bacteria | 11021 |
| 481 | Ga0207689_10025104 | 3300025942 | Bacteria | 4996 |
| 482 | Ga0207689_10052282 | 3300025942 | Bacteria | 3366 |
| 483 | Ga0207689_10136032 | 3300025942 | Bacteria | 2023 |
| 484 | Ga0207689_10141898 | 3300025942 | Bacteria | 1979 |
| 485 | Ga0207661_10001465 | 3300025944 | Bacteria | 15950 |
| 486 | Ga0207661_10097163 | 3300025944 | Bacteria | 2466 |
| 487 | Ga0207661_10155469 | 3300025944 | Bacteria | 1980 |
| 488 | Ga0207661_10190835 | 3300025944 | Bacteria | 1796 |
| 489 | Ga0207661_10524653 | 3300025944 | Bacteria | 1083 |
| 490 | Ga0207679_10074164 | 3300025945 | Bacteria | 2577 |
| 491 | Ga0207679_10125731 | 3300025945 | Bacteria | 2049 |
| 492 | Ga0207679_10214564 | 3300025945 | Bacteria | 1616 |
| 493 | Ga0207667_10098999 | 3300025949 | Bacteria | 3008 |
| 494 | Ga0207712_10005744 | 3300025961 | Bacteria | 7821 |
| 495 | Ga0207640_10125890 | 3300025981 | Bacteria | 1845 |
| 496 | Ga0207677_10000152 | 3300026023 | Bacteria | 55261 |
| 497 | Ga0207677_10039784 | 3300026023 | Bacteria | 3094 |
| 498 | Ga0207677_10159676 | 3300026023 | Bacteria | 1750 |
| 499 | Ga0207639_10111884 | 3300026041 | Bacteria | 2227 |
| 500 | Ga0207639_10315654 | 3300026041 | Bacteria | 1386 |
| 501 | Ga0207678_10001761 | 3300026067 | Bacteria | 19821 |
| 502 | Ga0207678_10038587 | 3300026067 | Bacteria | 4149 |
| 503 | Ga0207678_10286843 | 3300026067 | Bacteria | 1413 |
| 504 | Ga0207708_10004485 | 3300026075 | Bacteria | 10286 |
| 505 | Ga0207708_10100101 | 3300026075 | Bacteria | 2242 |
| 506 | Ga0207708_10154577 | 3300026075 | Bacteria | 1808 |
| 507 | Ga0207702_10000044 | 3300026078 | Bacteria | 149419 |
| 508 | Ga0207702_10024967 | 3300026078 | Bacteria | 4958 |
| 509 | Ga0207702_10025069 | 3300026078 | Bacteria | 4947 |
| 510 | Ga0207702_10029073 | 3300026078 | Bacteria | 4597 |
| 511 | Ga0207702_10185087 | 3300026078 | Bacteria | 1920 |
| 512 | Ga0207702_10229012 | 3300026078 | Bacteria | 1736 |
| 513 | Ga0207702_10241583 | 3300026078 | Bacteria | 1692 |
| 514 | Ga0207641_10007382 | 3300026088 | Bacteria | 9149 |
| 515 | Ga0207641_10044711 | 3300026088 | Bacteria | 3725 |
| 516 | Ga0207641_10074448 | 3300026088 | Bacteria | 2929 |
| 517 | Ga0207648_10135873 | 3300026089 | Bacteria | 2166 |
| 518 | Ga0207648_10142309 | 3300026089 | Bacteria | 2114 |
| 519 | Ga0207676_10014486 | 3300026095 | Bacteria | 5675 |
| 520 | Ga0207676_10018694 | 3300026095 | Bacteria | 5044 |
| 521 | Ga0207676_10075567 | 3300026095 | Bacteria | 2718 |
| 522 | Ga0207674_10001070 | 3300026116 | Bacteria | 35647 |
| 523 | Ga0207674_10001334 | 3300026116 | Bacteria | 31998 |
| 524 | Ga0207674_10033029 | 3300026116 | Bacteria | 5422 |
| 525 | Ga0207674_10042363 | 3300026116 | Bacteria | 4702 |
| 526 | Ga0207674_10055622 | 3300026116 | Bacteria | 4022 |
| 527 | Ga0207674_10092025 | 3300026116 | Bacteria | 3022 |
| 528 | Ga0207675_100185749 | 3300026118 | Bacteria | 1992 |
| 529 | Ga0207675_100368702 | 3300026118 | Bacteria | 1410 |
| 530 | Ga0207683_10010764 | 3300026121 | Bacteria | 7798 |
| 531 | Ga0207683_10018922 | 3300026121 | Bacteria | 5876 |
| 532 | Ga0207683_10020117 | 3300026121 | Bacteria | 5706 |
| 533 | Ga0207698_10035554 | 3300026142 | Bacteria | 3646 |
| 534 | Ga0209813_10015031 | 3300027866 | Bacteria | 2091 |
| 535 | Ga0207428_10044709 | 3300027907 | Bacteria | 3571 |
| 536 | Ga0207428_10072180 | 3300027907 | Bacteria | 2710 |
| 537 | Ga0207428_10169532 | 3300027907 | Bacteria | 1654 |
| 538 | Ga0268266_10023001 | 3300028379 | Bacteria | 5304 |
| 539 | Ga0268266_10075373 | 3300028379 | Bacteria | 2930 |
| 540 | Ga0268266_10129370 | 3300028379 | Bacteria | 2256 |
| 541 | Ga0268266_10129620 | 3300028379 | Bacteria | 2254 |
| 542 | Ga0268265_10005167 | 3300028380 | Bacteria | 8941 |
| 543 | Ga0268265_10238919 | 3300028380 | Bacteria | 1602 |
| 544 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 545 | Ga0268264_10008583 | 3300028381 | Bacteria | 8489 |
| 546 | Ga0268264_10017114 | 3300028381 | Bacteria | 5936 |
| 547 | Ga0268264_10193957 | 3300028381 | Bacteria | 1853 |
| 548 | Ga0265337_1006750 | 3300028556 | Bacteria | 4373 |
| 549 | Ga0265326_10038516 | 3300028558 | Bacteria | 1358 |
| 550 | Ga0265334_10002301 | 3300028573 | Bacteria | 8979 |
| 551 | Ga0265318_10005804 | 3300028577 | Bacteria | 5756 |
| 552 | Ga0265323_10000169 | 3300028653 | Bacteria | 38978 |
| 553 | Ga0265322_10004434 | 3300028654 | Bacteria | 4184 |
| 554 | Ga0265336_10000663 | 3300028666 | Bacteria | 18699 |
| 555 | Ga0307517_10000053 | 3300028786 | Bacteria | 155723 |
| 556 | Ga0307515_10060521 | 3300028794 | Bacteria | 5397 |
| 557 | Ga0307515_10199845 | 3300028794 | Bacteria | 1878 |
| 558 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 559 | Ga0265324_10003787 | 3300029957 | Bacteria | 7067 |
| 560 | Ga0265773_1001235 | 3300031018 | Bacteria | 1320 |
| 561 | Ga0265760_10021107 | 3300031090 | Bacteria | 1882 |
| 562 | Ga0265760_10060465 | 3300031090 | Bacteria | 1150 |
| 563 | Ga0265330_10031036 | 3300031235 | Bacteria | 2396 |
| 564 | Ga0265320_10110497 | 3300031240 | Bacteria | 1259 |
| 565 | Ga0265325_10042997 | 3300031241 | Bacteria | 2359 |
| 566 | Ga0265329_10042643 | 3300031242 | Bacteria | 1452 |
| 567 | Ga0265340_10039967 | 3300031247 | Bacteria | 2311 |
| 568 | Ga0265340_10067060 | 3300031247 | Bacteria | 1706 |
| 569 | Ga0265339_10097647 | 3300031249 | Bacteria | 1533 |
| 570 | Ga0265316_10139588 | 3300031344 | Bacteria | 1821 |
| 571 | Ga0307513_10138904 | 3300031456 | Bacteria | 2360 |
| 572 | Ga0307509_10276022 | 3300031507 | Bacteria | 1445 |
| 573 | Ga0265313_10009853 | 3300031595 | Bacteria | 6148 |
| 574 | Ga0307508_10000058 | 3300031616 | Bacteria | 125293 |
| 575 | Ga0307508_10208897 | 3300031616 | Bacteria | 1553 |
| 576 | Ga0265314_10022142 | 3300031711 | Bacteria | 4872 |
| 577 | Ga0265314_10071456 | 3300031711 | Bacteria | 2322 |
| 578 | Ga0265342_10083042 | 3300031712 | Bacteria | 1847 |
| 579 | Ga0307516_10038551 | 3300031730 | Bacteria | 4768 |
| 580 | Ga0307410_10112508 | 3300031852 | Bacteria | 1972 |
| 581 | Ga0307412_10232424 | 3300031911 | Bacteria | 1421 |
| 582 | Ga0307414_10253655 | 3300032004 | Bacteria | 1464 |
| 583 | Ga0307411_10197156 | 3300032005 | Bacteria | 1543 |
| 584 | Ga0316053_101306 | 3300032120 | Bacteria | 1303 |
| 585 | Ga0307510_10165027 | 3300033180 | Bacteria | 1804 |
| 586 | Ga0316215_1001197 | 3300033544 | Bacteria | 2518 |
| 587 | Ga0373926_0013143 | 3300035083 | Bacteria | 2805 |
| 588 | Ga0373926_0034568 | 3300035083 | Bacteria | 1790 |
| 589 | Ga0373929_0006496 | 3300035085 | Bacteria | 2115 |
| 590 | Ga0373934_0074664 | 3300035086 | Bacteria | 1358 |
| 591 | Ga0373944_0013310 | 3300035089 | Bacteria | 2279 |
| 592 | Ga0373944_0020457 | 3300035089 | Bacteria | 1907 |
| 593 | Ga0373923_0029400 | 3300035111 | Bacteria | 2203 |
| 594 | Ga0373936_0077081 | 3300035113 | Bacteria | 1382 |
| 595 | Ga0373945_0030664 | 3300035116 | Bacteria | 1896 |
| 596 | Ga0373945_0041011 | 3300035116 | Bacteria | 1673 |
| 597 | Ga0373945_0101774 | 3300035116 | Bacteria | 1125 |
| 598 | Ga0373953_0045980 | 3300035117 | Bacteria | 1751 |
| 599 | Ga0373954_0015689 | 3300035118 | Bacteria | 3388 |
| 600 | Ga0373943_0000625 | 3300035170 | Bacteria | 15319 |
| 601 | Ga0373943_0046483 | 3300035170 | Bacteria | 2119 |
| 602 | Ga0373943_0111657 | 3300035170 | Bacteria | 1442 |
| 603 | Ga0373943_0117477 | 3300035170 | Bacteria | 1410 |
| 604 | Ga0373924_0026717 | 3300035410 | Bacteria | 2291 |
| 605 | Ga0373924_0035287 | 3300035410 | Bacteria | 2028 |
| 606 | Ga0373931_0012802 | 3300035691 | Bacteria | 4072 |
| 607 | Ga0373935_0050898 | 3300035692 | Bacteria | 2630 |
| 608 | Ga0373935_0085244 | 3300035692 | Bacteria | 2059 |
| 609 | Ga0373935_0139241 | 3300035692 | Bacteria | 1638 |
| 610 | Ga0373935_0246781 | 3300035692 | Bacteria | 1248 |
| 611 | Ga0373927_0000208 | 3300035695 | Bacteria | 46839 |
| 612 | Ga0373927_0005624 | 3300035695 | Bacteria | 8614 |
| 613 | Ga0373927_0007126 | 3300035695 | Bacteria | 7588 |
| 614 | Ga0373927_0010764 | 3300035695 | Bacteria | 6093 |
| 615 | Ga0373927_0034151 | 3300035695 | Bacteria | 3309 |
| 616 | Ga0373927_0036366 | 3300035695 | Bacteria | 3202 |
| 617 | Ga0373927_0102049 | 3300035695 | Bacteria | 1866 |
| 618 | Ga0373927_0151223 | 3300035695 | Bacteria | 1520 |
| 619 | Ga0373927_0193902 | 3300035695 | Bacteria | 1333 |
| 620 | Ga0373933_0000052 | 3300035724 | Bacteria | 70592 |
| 621 | Ga0373933_0043435 | 3300035724 | Bacteria | 2659 |
| 622 | Ga0373933_0052699 | 3300035724 | Bacteria | 2435 |
| 623 | Ga0373947_0000572 | 3300035725 | Bacteria | 21522 |
| 624 | Ga0373947_0019808 | 3300035725 | Bacteria | 3882 |
| 625 | Ga0373947_0106292 | 3300035725 | Bacteria | 1769 |
| 626 | Ga0373947_0109238 | 3300035725 | Bacteria | 1746 |
| 627 | Ga0373937_0003631 | 3300036401 | Bacteria | 13015 |
| 628 | Ga0373937_0035244 | 3300036401 | Bacteria | 4554 |
| 629 | Ga0373937_0047933 | 3300036401 | Bacteria | 3909 |
| 630 | Ga0373937_0065599 | 3300036401 | Bacteria | 3343 |
| 631 | Ga0373937_0128368 | 3300036401 | Bacteria | 2366 |
| 632 | Ga0373937_0179707 | 3300036401 | Bacteria | 1987 |
| 633 | Ga0373925_0002541 | 3300037068 | Bacteria | 14535 |
| 634 | Ga0373925_0019815 | 3300037068 | Bacteria | 4895 |
| 635 | Ga0373925_0026932 | 3300037068 | Bacteria | 4208 |
| 636 | Ga0373925_0029850 | 3300037068 | Bacteria | 4000 |
| 637 | Ga0373925_0047259 | 3300037068 | Bacteria | 3203 |
| 638 | Ga0373925_0134557 | 3300037068 | Bacteria | 1930 |
| 639 | Ga0395900_0029644 | 3300037418 | Bacteria | 5614 |
| 640 | Ga0395898_0008229 | 3300037466 | Bacteria | 11026 |
| 641 | Ga0395905_0417289 | 3300037471 | Bacteria | 1238 |
| 642 | Ga0436364_0207431 | 3300037853 | Bacteria | 52858 |
| 643 | Ga0436364_0716994 | 3300037853 | Bacteria | 1551 |
| 644 | Ga0395901_0602840 | 3300038443 | Bacteria | 1107 |
| 645 | Ga0400483_078811 | 3300039062 | Bacteria | 2073 |
| 646 | Ga0400483_199136 | 3300039062 | Bacteria | 2091 |
| 647 | Ga0400483_281213 | 3300039062 | Unclassified | 1677 |
| 648 | Ga0436365_0086833 | 3300039437 | Bacteria | 3032 |
| 649 | Ga0436365_0220203 | 3300039437 | Bacteria | 19855 |
| 650 | Ga0436365_0289679 | 3300039437 | Bacteria | 2590 |
| 651 | Ga0436365_0338285 | 3300039437 | Bacteria | 3069 |
| 652 | Ga0436365_1165498 | 3300039437 | Bacteria | 1468 |
| 653 | Ga0436365_1289758 | 3300039437 | Bacteria | 2013 |
| 654 | Ga0436365_1742880 | 3300039437 | Bacteria | 1399 |
| 655 | Ga0436365_1873205 | 3300039437 | Bacteria | 55177 |
| 656 | Ga0436360_1354193 | 3300039438 | Bacteria | 2122 |
| 657 | Ga0436361_0248960 | 3300039447 | Bacteria | 2175 |
| 658 | Ga0436361_0324422 | 3300039447 | Bacteria | 3105 |
| 659 | Ga0436361_0559458 | 3300039447 | Bacteria | 1854 |
| 660 | Ga0436361_0963044 | 3300039447 | Bacteria | 2477 |
| 661 | Ga0436363_0800589 | 3300039450 | Bacteria | 7194 |
| 662 | Ga0439453_0000155 | 3300041408 | Bacteria | 6149 |
| 663 | Ga0439465_0061524 | 3300041413 | Bacteria | 1245 |
| 664 | Ga0451789_0018586 | 3300041443 | Bacteria | 1949 |
| 665 | Ga0451800_0830467 | 3300041459 | Bacteria | 1188 |
| 666 | Ga0439441_003763 | 3300042001 | Bacteria | 2261 |
| 667 | Ga0439435_0004722 | 3300042436 | Bacteria | 2953 |
| 668 | Ga0439460_0009225 | 3300042461 | Bacteria | 2503 |
| 669 | Ga0439440_0009586 | 3300042993 | Bacteria | 2009 |
| 670 | Ga0466969_0064388 | 3300044656 | Bacteria | 1775 |
| 671 | Ga0466966_0032661 | 3300044684 | Bacteria | 3372 |
| 672 | Ga0466966_0244635 | 3300044684 | Bacteria | 1081 |
| 673 | Ga0466961_0056721 | 3300044693 | Bacteria | 2496 |
| 674 | Ga0466963_0263441 | 3300044694 | Bacteria | 1210 |
| 675 | Ga0466970_0026255 | 3300044765 | Bacteria | 3053 |
| 676 | Ga0466970_0202672 | 3300044765 | Bacteria | 1104 |
| 677 | Ga0466957_0032036 | 3300044842 | Bacteria | 3146 |
| 678 | Ga0466959_0056634 | 3300045049 | Bacteria | 2860 |
| 679 | Ga0466959_0068328 | 3300045049 | Bacteria | 2575 |
| 680 | Ga0466958_0208703 | 3300045836 | Bacteria | 1244 |
| 681 | Ga0466967_0030956 | 3300045976 | Bacteria | 4498 |
| 682 | Ga0466967_0073667 | 3300045976 | Bacteria | 3064 |
| 683 | Ga0466967_0081586 | 3300045976 | Bacteria | 2921 |
| 684 | Ga0466967_0243783 | 3300045976 | Bacteria | 1715 |
| 685 | Ga0466967_0258382 | 3300045976 | Bacteria | 1666 |
| 686 | Ga0495617_015952 | 3300046452 | Bacteria | 2542 |
| 687 | Ga0495592_0010258 | 3300046454 | Bacteria | 7063 |
| 688 | Ga0495592_0109149 | 3300046454 | Bacteria | 1960 |
| 689 | Ga0495603_0019795 | 3300046455 | Bacteria | 4074 |
| 690 | Ga0495603_0036083 | 3300046455 | Bacteria | 2968 |
| 691 | Ga0495603_0088727 | 3300046455 | Bacteria | 1809 |
| 692 | Ga0495603_0180018 | 3300046455 | Bacteria | 1223 |
| 693 | Ga0495629_0031462 | 3300046459 | Bacteria | 3757 |
| 694 | Ga0495638_0031899 | 3300046460 | Bacteria | 3382 |
| 695 | Ga0495638_0070779 | 3300046460 | Bacteria | 2135 |
| 696 | Ga0495641_0106384 | 3300046461 | Bacteria | 1252 |
| 697 | Ga0495651_0010805 | 3300046462 | Bacteria | 7018 |
| 698 | Ga0495580_0024643 | 3300046472 | Bacteria | 4401 |
| 699 | Ga0495580_0096371 | 3300046472 | Bacteria | 2057 |
| 700 | Ga0495580_0245928 | 3300046472 | Bacteria | 1225 |
| 701 | Ga0495580_0269376 | 3300046472 | Bacteria | 1163 |
| 702 | Ga0495582_0007925 | 3300046473 | Bacteria | 5869 |
| 703 | Ga0495582_0058508 | 3300046473 | Bacteria | 2125 |
| 704 | Ga0495639_0014764 | 3300046475 | Bacteria | 3384 |
| 705 | Ga0495639_0033644 | 3300046475 | Bacteria | 2289 |
| 706 | Ga0495639_0120359 | 3300046475 | Bacteria | 1252 |
| 707 | Ga0495662_0014430 | 3300046476 | Bacteria | 3842 |
| 708 | Ga0495662_0024022 | 3300046476 | Bacteria | 2941 |
| 709 | Ga0495662_0048650 | 3300046476 | Bacteria | 2047 |
| 710 | Ga0495664_0000914 | 3300046477 | Bacteria | 15178 |
| 711 | Ga0495664_0014283 | 3300046477 | Bacteria | 4499 |
| 712 | Ga0495664_0048541 | 3300046477 | Bacteria | 2520 |
| 713 | Ga0495664_0058956 | 3300046477 | Bacteria | 2284 |
| 714 | Ga0495594_0003849 | 3300046499 | Bacteria | 7710 |
| 715 | Ga0495607_0023434 | 3300046501 | Bacteria | 3865 |
| 716 | Ga0495608_0016760 | 3300046511 | Bacteria | 5070 |
| 717 | Ga0495608_0072337 | 3300046511 | Bacteria | 2249 |
| 718 | Ga0495616_0020481 | 3300046513 | Bacteria | 3596 |
| 719 | Ga0495618_0001314 | 3300046514 | Bacteria | 16718 |
| 720 | Ga0495618_0026210 | 3300046514 | Bacteria | 3622 |
| 721 | Ga0495628_0047872 | 3300046516 | Bacteria | 3390 |
| 722 | Ga0495628_0106249 | 3300046516 | Bacteria | 2162 |
| 723 | Ga0495630_0015328 | 3300046517 | Bacteria | 5596 |
| 724 | Ga0495630_0089300 | 3300046517 | Bacteria | 2328 |
| 725 | Ga0495630_0142876 | 3300046517 | Bacteria | 1820 |
| 726 | Ga0495631_0005942 | 3300046518 | Bacteria | 6349 |
| 727 | Ga0495631_0021534 | 3300046518 | Bacteria | 3002 |
| 728 | Ga0495631_0057707 | 3300046518 | Bacteria | 1689 |
| 729 | Ga0495632_0013773 | 3300046519 | Bacteria | 4599 |
| 730 | Ga0495637_0030425 | 3300046520 | Bacteria | 2396 |
| 731 | Ga0495648_0001411 | 3300046524 | Bacteria | 23498 |
| 732 | Ga0495652_0056253 | 3300046529 | Bacteria | 3342 |
| 733 | Ga0495652_0058974 | 3300046529 | Bacteria | 3249 |
| 734 | Ga0495652_0104176 | 3300046529 | Bacteria | 2295 |
| 735 | Ga0495665_0002990 | 3300046531 | Bacteria | 9136 |
| 736 | Ga0495665_0017200 | 3300046531 | Bacteria | 3891 |
| 737 | Ga0495640_0001789 | 3300046533 | Bacteria | 17054 |
| 738 | Ga0495640_0051257 | 3300046533 | Bacteria | 2837 |
| 739 | Ga0495640_0057176 | 3300046533 | Bacteria | 2663 |
| 740 | Ga0495640_0106358 | 3300046533 | Bacteria | 1837 |
| 741 | Ga0495587_0087973 | 3300046536 | Bacteria | 1797 |
| 742 | Ga0495621_0009030 | 3300046539 | Bacteria | 3011 |
| 743 | Ga0495597_0042780 | 3300046542 | Bacteria | 2019 |
| 744 | Ga0495645_0007907 | 3300046543 | Bacteria | 7399 |
| 745 | Ga0495645_0022537 | 3300046543 | Bacteria | 4557 |
| 746 | Ga0495645_0028110 | 3300046543 | Bacteria | 4085 |
| 747 | Ga0495622_0010976 | 3300046557 | Bacteria | 4181 |
| 748 | Ga0495622_0045806 | 3300046557 | Bacteria | 2032 |
| 749 | Ga0495622_0065380 | 3300046557 | Bacteria | 1681 |
| 750 | Ga0495667_0087014 | 3300046559 | Bacteria | 2026 |
| 751 | Ga0495667_0220505 | 3300046559 | Bacteria | 1210 |
| 752 | Ga0495656_0019166 | 3300046615 | Bacteria | 2638 |
| 753 | Ga0495634_0005018 | 3300046642 | Bacteria | 10216 |
| 754 | Ga0495634_0018970 | 3300046642 | Bacteria | 4890 |
| 755 | Ga0495634_0023106 | 3300046642 | Bacteria | 4375 |
| 756 | Ga0495634_0045749 | 3300046642 | Bacteria | 2957 |
| 757 | Ga0495634_0153618 | 3300046642 | Bacteria | 1454 |
| 758 | Ga0495611_0078466 | 3300046648 | Bacteria | 1516 |
| 759 | Ga0495625_0124262 | 3300046660 | Bacteria | 1753 |
| 760 | Ga0495635_0001579 | 3300046663 | Bacteria | 15313 |
| 761 | Ga0495635_0030467 | 3300046663 | Bacteria | 3749 |
| 762 | Ga0495635_0089551 | 3300046663 | Bacteria | 2105 |
| 763 | Ga0495661_0054722 | 3300046665 | Bacteria | 2394 |
| 764 | Ga0495588_0017364 | 3300046674 | Bacteria | 3492 |
| 765 | Ga0495657_0011125 | 3300046675 | Bacteria | 6742 |
| 766 | Ga0495657_0105660 | 3300046675 | Bacteria | 1789 |
| 767 | Ga0495657_0241944 | 3300046675 | Bacteria | 1089 |
| 768 | Ga0495599_0093896 | 3300046678 | Bacteria | 1871 |
| 769 | Ga0495623_0054488 | 3300046679 | Bacteria | 2523 |
| 770 | Ga0495647_0004216 | 3300046681 | Bacteria | 4655 |
| 771 | Ga0495647_0017755 | 3300046681 | Bacteria | 2522 |
| 772 | Ga0495658_0005488 | 3300046683 | Bacteria | 6233 |
| 773 | Ga0495658_0007978 | 3300046683 | Bacteria | 5244 |
| 774 | Ga0495613_0015165 | 3300046689 | Bacteria | 5726 |
| 775 | Ga0495613_0061127 | 3300046689 | Bacteria | 2759 |
| 776 | Ga0495613_0091325 | 3300046689 | Bacteria | 2205 |
| 777 | Ga0495624_0006069 | 3300046690 | Bacteria | 8612 |
| 778 | Ga0495624_0022696 | 3300046690 | Bacteria | 4144 |
| 779 | Ga0495624_0058575 | 3300046690 | Bacteria | 2418 |
| 780 | Ga0495670_0164870 | 3300046691 | Bacteria | 1165 |
| 781 | Ga0495671_0011887 | 3300046692 | Bacteria | 4771 |
| 782 | Ga0495600_0022342 | 3300046809 | Bacteria | 4060 |
| 783 | Ga0495600_0084531 | 3300046809 | Bacteria | 2071 |
| 784 | Ga0495600_0146293 | 3300046809 | Bacteria | 1531 |
| 785 | Ga0495660_0154108 | 3300046810 | Bacteria | 1132 |
| 786 | Ga0495581_0009664 | 3300047315 | Bacteria | 5580 |
| 787 | Ga0495581_0013235 | 3300047315 | Bacteria | 4784 |
| 788 | Ga0495581_0016397 | 3300047315 | Bacteria | 4308 |
| 789 | Ga0495581_0051065 | 3300047315 | Bacteria | 2388 |
| 790 | Ga0495581_0174289 | 3300047315 | Bacteria | 1258 |
| 791 | Ga0495604_0025374 | 3300047317 | Bacteria | 4723 |
| 792 | Ga0495674_0000765 | 3300047319 | Bacteria | 30490 |
| 793 | Ga0495674_0151554 | 3300047319 | Bacteria | 1944 |
| 794 | Ga0495672_0043987 | 3300047320 | Bacteria | 2681 |
| 795 | Ga0495684_0002602 | 3300047471 | Bacteria | 14334 |
| 796 | Ga0495684_0005012 | 3300047471 | Bacteria | 10329 |
| 797 | Ga0495684_0015044 | 3300047471 | Bacteria | 5958 |
| 798 | Ga0495684_0254138 | 3300047471 | Bacteria | 1277 |
| 799 | Ga0495686_0024993 | 3300047472 | Bacteria | 3917 |
| 800 | Ga0495593_0009145 | 3300047673 | Bacteria | 5747 |
| 801 | Ga0495593_0012996 | 3300047673 | Bacteria | 4755 |
| 802 | Ga0495593_0110405 | 3300047673 | Bacteria | 1405 |
| 803 | Ga0495602_0257901 | 3300048088 | Bacteria | 1295 |
| 804 | Ga0496100_0127860 | 3300048903 | Bacteria | 1786 |
| 805 | Ga0496101_0008690 | 3300048904 | Bacteria | 6641 |
| 806 | Ga0496101_0129827 | 3300048904 | Bacteria | 1913 |
| 807 | Ga0496101_0259908 | 3300048904 | Bacteria | 1354 |
| 808 | Ga0496102_0232981 | 3300048905 | Bacteria | 1736 |
| 809 | Ga0496103_0280663 | 3300048906 | Bacteria | 1071 |
| 810 | Ga0496104_0018406 | 3300048907 | Bacteria | 6372 |
| 811 | Ga0496104_0064651 | 3300048907 | Bacteria | 3470 |
| 812 | Ga0496104_0084486 | 3300048907 | Bacteria | 3029 |
| 813 | Ga0496104_0451287 | 3300048907 | Bacteria | 1197 |
| 814 | Ga0496105_0010974 | 3300048908 | Bacteria | 7138 |
| 815 | Ga0496105_0018379 | 3300048908 | Bacteria | 5617 |
| 816 | Ga0496105_0056259 | 3300048908 | Bacteria | 3247 |
| 817 | Ga0496106_0002130 | 3300048909 | Bacteria | 14795 |
| 818 | Ga0496106_0089259 | 3300048909 | Bacteria | 2377 |
| 819 | Ga0496106_0451141 | 3300048909 | Bacteria | 1033 |
| 820 | Ga0496107_0039259 | 3300048910 | Bacteria | 3395 |
| 821 | Ga0496107_0199838 | 3300048910 | Bacteria | 1486 |
| 822 | Ga0496107_0208951 | 3300048910 | Bacteria | 1451 |
| 823 | Ga0496108_0017925 | 3300048911 | Bacteria | 5792 |
| 824 | Ga0496108_0057356 | 3300048911 | Bacteria | 3272 |
| 825 | Ga0496108_0165235 | 3300048911 | Bacteria | 1913 |
| 826 | Ga0496108_0229516 | 3300048911 | Bacteria | 1614 |
| 827 | Ga0496109_0047750 | 3300048912 | Bacteria | 3893 |
| 828 | Ga0496109_0096794 | 3300048912 | Bacteria | 2735 |
| 829 | Ga0496109_0214059 | 3300048912 | Bacteria | 1812 |
| 830 | Ga0496110_0053914 | 3300048913 | Bacteria | 3536 |
| 831 | Ga0496110_0132174 | 3300048913 | Bacteria | 2254 |
| 832 | Ga0496110_0178065 | 3300048913 | Bacteria | 1930 |
| 833 | Ga0496111_0044940 | 3300048914 | Bacteria | 3176 |
| 834 | Ga0496111_0162982 | 3300048914 | Bacteria | 1656 |
| 835 | Ga0496111_0206276 | 3300048914 | Bacteria | 1460 |
| 836 | Ga0496112_0005365 | 3300048915 | Bacteria | 11074 |
| 837 | Ga0496112_0015998 | 3300048915 | Bacteria | 7013 |
| 838 | Ga0496112_0037314 | 3300048915 | Bacteria | 4743 |
| 839 | Ga0496112_0209782 | 3300048915 | Bacteria | 1905 |
| 840 | Ga0496112_0213614 | 3300048915 | Bacteria | 1886 |
| 841 | Ga0496112_0307888 | 3300048915 | Bacteria | 1529 |
| 842 | Ga0496112_0525563 | 3300048915 | Bacteria | 1118 |
| 843 | Ga0496113_0026191 | 3300048916 | Bacteria | 4166 |
| 844 | Ga0496113_0199367 | 3300048916 | Bacteria | 1591 |
| 845 | Ga0496114_0043870 | 3300048917 | Bacteria | 3708 |
| 846 | Ga0496114_0314240 | 3300048917 | Bacteria | 1384 |
| 847 | Ga0496114_0319810 | 3300048917 | Bacteria | 1371 |
| 848 | Ga0496114_0394090 | 3300048917 | Bacteria | 1226 |
| 849 | Ga0496115_0025874 | 3300048918 | Bacteria | 4573 |
| 850 | Ga0496115_0026963 | 3300048918 | Bacteria | 4491 |
| 851 | Ga0496115_0232569 | 3300048918 | Bacteria | 1520 |
| 852 | Ga0496116_0005902 | 3300048919 | Bacteria | 11240 |
| 853 | Ga0496118_0017640 | 3300048921 | Bacteria | 6484 |
| 854 | Ga0496118_0018267 | 3300048921 | Bacteria | 6333 |
| 855 | Ga0496118_0030143 | 3300048921 | Bacteria | 4534 |
| 856 | Ga0496119_0135845 | 3300048922 | Bacteria | 1334 |
| 857 | Ga0496120_0072379 | 3300048923 | Bacteria | 1889 |
| 858 | Ga0496121_0008659 | 3300048924 | Bacteria | 11890 |
| 859 | Ga0496121_0018301 | 3300048924 | Bacteria | 7074 |
| 860 | Ga0496121_0040068 | 3300048924 | Bacteria | 4115 |
| 861 | Ga0496121_0119074 | 3300048924 | Bacteria | 1997 |
| 862 | Ga0496123_0102813 | 3300048926 | Bacteria | 1657 |
| 863 | Ga0496124_0009222 | 3300048927 | Bacteria | 10177 |
| 864 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 865 | Ga0496125_0004213 | 3300048928 | Bacteria | 16756 |
| 866 | Ga0496125_0007383 | 3300048928 | Bacteria | 11700 |
| 867 | Ga0496125_0051008 | 3300048928 | Bacteria | 3417 |
| 868 | Ga0496125_0071950 | 3300048928 | Bacteria | 2698 |
| 869 | Ga0496126_0020239 | 3300048929 | Bacteria | 6530 |
| 870 | Ga0496126_0060859 | 3300048929 | Bacteria | 3394 |
| 871 | Ga0496126_0086590 | 3300048929 | Bacteria | 2761 |
| 872 | Ga0496126_0199483 | 3300048929 | Bacteria | 1690 |
| 873 | Ga0496126_0295711 | 3300048929 | Bacteria | 1338 |
| 874 | Ga0496126_0347728 | 3300048929 | Bacteria | 1213 |
| 875 | Ga0495682_0069480 | 3300049460 | Bacteria | 1268 |
| 876 | Ga0501036_0011182 | 3300049572 | Bacteria | 7427 |
| 877 | Ga0501038_0029094 | 3300049574 | Bacteria | 4900 |
| 878 | Ga0501040_0060914 | 3300049576 | Bacteria | 2594 |
| 879 | Ga0501041_0024261 | 3300049577 | Bacteria | 3640 |
| 880 | Ga0501047_0003837 | 3300049581 | Bacteria | 14131 |
| 881 | Ga0501047_0013032 | 3300049581 | Bacteria | 7875 |
| 882 | Ga0501068_0157910 | 3300049584 | Bacteria | 1428 |
| 883 | Ga0501071_0069071 | 3300049587 | Bacteria | 2572 |
| 884 | Ga0501072_0067598 | 3300049588 | Bacteria | 2819 |
| 885 | Ga0501073_0006350 | 3300049589 | Bacteria | 8799 |
| 886 | Ga0501075_0000021 | 3300049591 | Bacteria | 66125 |
| 887 | Ga0501076_0000070 | 3300049592 | Bacteria | 50841 |
| 888 | Ga0501077_0101368 | 3300049593 | Bacteria | 1824 |
| 889 | Ga0501077_0169623 | 3300049593 | Bacteria | 1386 |
| 890 | Ga0501077_0223160 | 3300049593 | Bacteria | 1198 |
| 891 | Ga0501080_0025522 | 3300049742 | Bacteria | 5485 |
| 892 | Ga0501080_0121729 | 3300049742 | Bacteria | 2417 |
| 893 | Ga0501081_0007271 | 3300049743 | Bacteria | 7198 |
| 894 | Ga0501081_0058954 | 3300049743 | Bacteria | 2657 |
| 895 | Ga0501083_0008206 | 3300049744 | Bacteria | 7384 |
| 896 | Ga0501083_0115603 | 3300049744 | Bacteria | 1761 |
| 897 | Ga0501044_0012923 | 3300049823 | Bacteria | 9037 |
| 898 | Ga0501044_0019733 | 3300049823 | Bacteria | 7203 |
| 899 | Ga0501044_0024908 | 3300049823 | Bacteria | 6346 |
| 900 | nmdc:mga03683_11274_c1 | 3300050489 | Bacteria | 3231 |
| 901 | nmdc:mga03683_1348_c1 | 3300050489 | Bacteria | 7276 |
| 902 | nmdc:mga03683_7273_c1 | 3300050489 | Bacteria | 3835 |
| 903 | nmdc:mga03n38_4669_c1 | 3300050490 | Bacteria | 4570 |
| 904 | nmdc:mga03n38_50005_c1 | 3300050490 | Bacteria | 1861 |
| 905 | nmdc:mga00v17_2774_c2 | 3300050491 | Bacteria | 6938 |
| 906 | nmdc:mga00v17_74975_c1 | 3300050491 | Bacteria | 2103 |
| 907 | nmdc:mga00v17_8048_c1 | 3300050491 | Bacteria | 5658 |
| 908 | nmdc:mga0yw44_111149_c1 | 3300050492 | Bacteria | 1756 |
| 909 | nmdc:mga0yw44_14847_c1 | 3300050492 | Bacteria | 4151 |
| 910 | nmdc:mga0yw44_38117_c1 | 3300050492 | Bacteria | 2842 |
| 911 | nmdc:mga0yw44_61057_c1 | 3300050492 | Bacteria | 2311 |
| 912 | nmdc:mga0yw44_66216_c1 | 3300050492 | Bacteria | 2229 |
| 913 | nmdc:mga0k408_62446_c1 | 3300050493 | Bacteria | 2166 |
| 914 | nmdc:mga0k408_8709_c1 | 3300050493 | Bacteria | 5458 |
| 915 | nmdc:mga06z11_11396_c1 | 3300050494 | Bacteria | 3833 |
| 916 | nmdc:mga06z11_11953_c1 | 3300050494 | Bacteria | 3761 |
| 917 | nmdc:mga06z11_1471_c1 | 3300050494 | Bacteria | 8772 |
| 918 | nmdc:mga06z11_200988_c1 | 3300050494 | Bacteria | 1158 |
| 919 | nmdc:mga06z11_28496_c1 | 3300050494 | Bacteria | 2680 |
| 920 | nmdc:mga06z11_6700_c1 | 3300050494 | Bacteria | 4708 |
| 921 | nmdc:mga06z11_75136_c1 | 3300050494 | Bacteria | 1798 |
| 922 | nmdc:mga06z11_88105_c1 | 3300050494 | Bacteria | 1680 |
| 923 | nmdc:mga04h51_13363_c1 | 3300050495 | Bacteria | 2323 |
| 924 | nmdc:mga04h51_21905_c1 | 3300050495 | Bacteria | 1927 |
| 925 | nmdc:mga04h51_3038_c1 | 3300050495 | Bacteria | 2624 |
| 926 | nmdc:mga07m45_19228_c1 | 3300050496 | Bacteria | 3699 |
| 927 | nmdc:mga07m45_31253_c1 | 3300050496 | Bacteria | 2950 |
| 928 | nmdc:mga07m45_58102_c1 | 3300050496 | Bacteria | 2188 |
| 929 | nmdc:mga07m45_63417_c1 | 3300050496 | Bacteria | 2096 |
| 930 | nmdc:mga05p37_365781_c1 | 3300050507 | Bacteria | 1694 |
| 931 | nmdc:mga06r32_125085_c1 | 3300050510 | Bacteria | 2539 |
| 932 | nmdc:mga08y16_1102_c1 | 3300050511 | Bacteria | 26611 |
| 933 | nmdc:mga08y16_156751_c1 | 3300050511 | Bacteria | 2366 |
| 934 | nmdc:mga08y16_18538_c1 | 3300050511 | Bacteria | 7333 |
| 935 | nmdc:mga08y16_246129_c1 | 3300050511 | Bacteria | 1848 |
| 936 | nmdc:mga08y16_522386_c1 | 3300050511 | Bacteria | 1204 |
| 937 | nmdc:mga0n895_22807_c1 | 3300050512 | Bacteria | 5873 |
| 938 | nmdc:mga0n895_3720_c1 | 3300050512 | Bacteria | 12340 |
| 939 | nmdc:mga0rr50_34020_c1 | 3300050513 | Bacteria | 3646 |
| 940 | nmdc:mga0rr50_76248_c1 | 3300050513 | Bacteria | 2573 |
| 941 | nmdc:mga08x19_10922_c1 | 3300050514 | Bacteria | 5462 |
| 942 | nmdc:mga08x19_234460_c1 | 3300050514 | Bacteria | 1264 |
| 943 | nmdc:mga08x19_41071_c1 | 3300050514 | Bacteria | 2946 |
| 944 | nmdc:mga0a205_488180_c1 | 3300050515 | Bacteria | 1089 |
| 945 | nmdc:mga0sz30_12388_c1 | 3300050516 | Bacteria | 3318 |
| 946 | Ga0495601_0001037 | 3300053077 | Bacteria | 15167 |
| 947 | Ga0495601_0266999 | 3300053077 | Bacteria | 1116 |
| 948 | Ga0495612_0030096 | 3300053078 | Bacteria | 2187 |
| 949 | Ga0495655_0010393 | 3300053083 | Bacteria | 1837 |
| 950 | Ga0495595_0044491 | 3300053084 | Bacteria | 2040 |
| 951 | Ga0495619_0003331 | 3300053085 | Bacteria | 10388 |
| 952 | Ga0495619_0009743 | 3300053085 | Bacteria | 6056 |
| 953 | Ga0495619_0038726 | 3300053085 | Bacteria | 3110 |
| 954 | Ga0500578_0082765 | 3300053086 | Bacteria | 2040 |
| 955 | Ga0500647_0016038 | 3300053091 | Bacteria | 3436 |
| 956 | Ga0500647_0023286 | 3300053091 | Bacteria | 2904 |
| 957 | Ga0500651_0030239 | 3300053093 | Bacteria | 3407 |
| 958 | Ga0500651_0066248 | 3300053093 | Bacteria | 2249 |
| 959 | Ga0500566_0000097 | 3300053094 | Bacteria | 43920 |
| 960 | Ga0500566_0000422 | 3300053094 | Bacteria | 23611 |
| 961 | Ga0500641_0012123 | 3300053096 | Bacteria | 3142 |
| 962 | Ga0500641_0034453 | 3300053096 | Bacteria | 2015 |
| 963 | Ga0500641_0113167 | 3300053096 | Bacteria | 1169 |
| 964 | Ga0500650_0014093 | 3300053098 | Bacteria | 3373 |
| 965 | Ga0500554_020777 | 3300053102 | Bacteria | 1810 |
| 966 | Ga0500556_0000045 | 3300053104 | Bacteria | 130653 |
| 967 | Ga0500562_011206 | 3300053108 | Bacteria | 2276 |
| 968 | Ga0500572_000375 | 3300053111 | Bacteria | 15925 |
| 969 | Ga0500593_085577 | 3300053117 | Bacteria | 1343 |
| 970 | Ga0500595_000467 | 3300053119 | Bacteria | 25049 |
| 971 | Ga0500595_003181 | 3300053119 | Bacteria | 7772 |
| 972 | Ga0500595_008173 | 3300053119 | Bacteria | 4292 |
| 973 | Ga0500595_014078 | 3300053119 | Bacteria | 3045 |
| 974 | Ga0500595_014515 | 3300053119 | Bacteria | 2986 |
| 975 | Ga0500607_083825 | 3300053121 | Bacteria | 1619 |
| 976 | Ga0500608_010599 | 3300053122 | Bacteria | 3962 |
| 977 | Ga0500608_071849 | 3300053122 | Bacteria | 1645 |
| 978 | Ga0500614_030577 | 3300053123 | Bacteria | 1314 |
| 979 | Ga0500642_0000024 | 3300053130 | Bacteria | 134373 |
| 980 | Ga0500642_0006124 | 3300053130 | Bacteria | 3937 |
| 981 | Ga0500642_0056077 | 3300053130 | Bacteria | 1754 |
| 982 | Ga0500652_069113 | 3300053131 | Bacteria | 1461 |
| 983 | Ga0500559_0000051 | 3300053136 | Bacteria | 91468 |
| 984 | Ga0500559_0000553 | 3300053136 | Bacteria | 25900 |
| 985 | Ga0500568_0003653 | 3300053139 | Bacteria | 8466 |
| 986 | Ga0500568_0063626 | 3300053139 | Bacteria | 1423 |
| 987 | Ga0500577_0018255 | 3300053142 | Bacteria | 2251 |
| 988 | Ga0500588_0071183 | 3300053146 | Bacteria | 1141 |
| 989 | Ga0500603_000285 | 3300053150 | Bacteria | 13430 |
| 990 | Ga0500603_000511 | 3300053150 | Bacteria | 9856 |
| 991 | Ga0500604_0031281 | 3300053151 | Bacteria | 1561 |
| 992 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 993 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 994 | Ga0500616_0036200 | 3300053153 | Bacteria | 2679 |
| 995 | Ga0500622_0004533 | 3300053156 | Bacteria | 8676 |
| 996 | Ga0500627_0054820 | 3300053158 | Bacteria | 1744 |
| 997 | Ga0500630_009189 | 3300053159 | Bacteria | 4852 |
| 998 | Ga0500633_0007617 | 3300053160 | Bacteria | 2738 |
| 999 | Ga0500638_016255 | 3300053162 | Bacteria | 3430 |
| 1000 | Ga0500638_033937 | 3300053162 | Bacteria | 2468 |
| 1001 | Ga0500639_019063 | 3300053163 | Bacteria | 3619 |
| 1002 | Ga0500636_0009532 | 3300053177 | Bacteria | 5648 |
| 1003 | Ga0500637_0000660 | 3300053178 | Bacteria | 13684 |
| 1004 | Ga0500637_0000984 | 3300053178 | Bacteria | 11627 |
| 1005 | Ga0500567_084559 | 3300053723 | Bacteria | 1360 |
| 1006 | Ga0500645_001737 | 3300053730 | Bacteria | 10567 |
| 1007 | Ga0500552_008246 | 3300053733 | Bacteria | 1225 |
| 1008 | Ga0501084_0021469 | 3300054114 | Bacteria | 5382 |
| 1009 | Ga0501084_0087962 | 3300054114 | Bacteria | 2608 |
| 1010 | Ga0500661_000043 | 3300055283 | Bacteria | 19291 |
| 1011 | Ga0587076_013563 | 3300059645 | Bacteria | 1238 |
| 1012 | Ga0501082_0016934 | 3300060353 | Bacteria | 6275 |
| 1013 | Ga0501082_0034247 | 3300060353 | Bacteria | 4380 |
| 1014 | Ga0530510_0000012 | 3300061734 | Bacteria | 115789 |
| 1015 | Ga0530510_0011559 | 3300061734 | Bacteria | 6195 |
| 1016 | 2513693610 | 2513237101 | Bacteria | 7952346 |
| 1017 | 2513888433 | 2513237141 | Bacteria | 8496279 |
| 1018 | 2603860563 | 2602042107 | Bacteria | 6226103 |
| 1019 | 2723847510 | 2721755755 | Bacteria | 8322773 |
| 1020 | 2793081334 | |||
| 1021 | 2841916019 | 2841911363 | Bacteria | 6173697 |
| 1022 | 2841921601 | 2841917233 | Bacteria | 6173500 |
| 1023 | 2844317352 | 2844315083 | Bacteria | 8138177 |
| 1024 | 2857525519 | 2857524615 | Bacteria | 6615449 |
| 1025 | 2874611471 | 2874604998 | Bacteria | 7834745 |
| 1026 | 2876817066 | 2876808645 | Bacteria | 8824342 |
| 1027 | 2879117549 | 2879110137 | Bacteria | 8907982 |
| 1028 | 2885389481 | 2885383462 | Bacteria | 9473874 |
| 1029 | 2889042264 | 2889033259 | Bacteria | 9099371 |
| 1030 | 2893070759 | 2893066018 | Bacteria | 6158120 |
| 1031 | 2903733262 | 2903727486 | Bacteria | 8281579 |
| 1032 | 2903757236 | 2903748898 | Bacteria | 9972761 |
| 1033 | 2906606228 | 2906602504 | Bacteria | 8295279 |
| 1034 | 2908744623 | 2908739725 | Bacteria | 8628932 |
| 1035 | 2908762220 | 2908756301 | Bacteria | 8864324 |
| 1036 | 2919074672 | 2919073203 | Bacteria | 6531949 |
| 1037 | 2919706538 | 2919704043 | Bacteria | 5560311 |
| 1038 | 2922362922 | 2922361189 | Bacteria | 7436256 |
| 1039 | 2922428207 | |||
| 1040 | 2935631894 | 2935630451 | Bacteria | 8169952 |
| 1041 | 2935963626 | 2935959822 | Bacteria | 7869783 |
| 1042 | 2941507842 | 2941507105 | Bacteria | 8166816 |
| 1043 | 2941515653 | 2941515067 | Bacteria | 8166720 |
| 1044 | 2941523772 | 2941523033 | Bacteria | 8169134 |
| 1045 | 2941535166 | 2941531003 | Bacteria | 7653939 |
| 1046 | 3005478192 | 3005474847 | Bacteria | 9259049 |
| 1047 | 3005597050 | 3005594810 | Bacteria | 8716512 |
| 1048 | 3005713114 | 3005710791 | Bacteria | 7622528 |
| 1049 | 3005720481 | 3005718088 | Bacteria | 8283608 |
| 1050 | 8006970168 | 8006964411 | Bacteria | 8966052 |
| 1051 | 8006985456 | 8006984368 | Bacteria | 9651211 |
| 1052 | 8006994495 | 8006994254 | Bacteria | 8309700 |
| 1053 | 8019558866 | 8019555841 | Bacteria | 9642137 |
| 1054 | 8019566443 | 8019565922 | Bacteria | 9639779 |
| 1055 | 8056681227 | 8056673599 | Bacteria | 7871253 |
| 1056 | 8056694424 | 8056689827 | Bacteria | 6712655 |
| 1057 | 8056971937 | 8056967851 | Bacteria | 9038162 |
| 1058 | Ga0075365_10219233 | |||
| 1059 | rootH2_10076215 | |||
| 1060 | Ga0065165_1031353 | |||
| 1061 | Ga0065712_10010742 | |||
| 1062 | Ga0070658_10134615 | |||
| 1063 | Ga0070658_10166078 | |||
| 1064 | Ga0070683_100010779 | |||
| 1065 | Ga0070683_100033581 | |||
| 1066 | Ga0068869_100161773 | |||
| 1067 | Ga0070666_10007550 | |||
| 1068 | Ga0070680_100003232 | |||
| 1069 | Ga0070680_100023993 | |||
| 1070 | Ga0070680_100111433 | |||
| 1071 | Ga0068868_100006674 | |||
| 1072 | Ga0070660_100054851 | |||
| 1073 | Ga0070689_100018748 | |||
| 1074 | Ga0070661_100031364 | |||
| 1075 | Ga0070661_100047804 | |||
| 1076 | Ga0070661_100374093 | |||
| 1077 | Ga0070692_10177951 | |||
| 1078 | Ga0070668_100063107 | |||
| 1079 | Ga0070668_100282663 | |||
| 1080 | Ga0070675_100282785 | |||
| 1081 | Ga0070671_100074767 | |||
| 1082 | Ga0070671_100102394 | |||
| 1083 | Ga0070671_100439400 | |||
| 1084 | Ga0070674_100005057 | |||
| 1085 | Ga0070674_100240705 | |||
| 1086 | Ga0070674_100247513 | |||
| 1087 | Ga0070673_100092917 | |||
| 1088 | Ga0070673_100127565 | |||
| 1089 | Ga0070673_100333033 | |||
| 1090 | Ga0070688_100018632 | |||
| 1091 | Ga0070659_100055656 | |||
| 1092 | Ga0070667_100007371 | |||
| 1093 | Ga0070667_100150126 | |||
| 1094 | Ga0070703_10000651 | |||
| 1095 | Ga0070709_10029048 | |||
| 1096 | Ga0070709_10077546 | |||
| 1097 | Ga0070709_10111416 | |||
| 1098 | Ga0070714_100022197 | |||
| 1099 | Ga0070714_100027863 | |||
| 1100 | Ga0070714_100061698 | |||
| 1101 | Ga0070714_100071718 | |||
| 1102 | Ga0070714_100132616 | |||
| 1103 | Ga0070714_100226567 | |||
| 1104 | Ga0070714_100524121 | |||
| 1105 | Ga0070713_100004734 | |||
| 1106 | Ga0070713_100014299 | |||
| 1107 | Ga0070713_100065457 | |||
| 1108 | Ga0070713_100068131 | |||
| 1109 | Ga0070713_100152241 | |||
| 1110 | Ga0070713_100232694 | |||
| 1111 | Ga0070713_100316426 | |||
| 1112 | Ga0070710_10000586 | |||
| 1113 | Ga0070710_10003922 | |||
| 1114 | Ga0070710_10014356 | |||
| 1115 | Ga0070710_10019605 | |||
| 1116 | Ga0070710_10136760 | |||
| 1117 | Ga0070701_10064051 | |||
| 1118 | Ga0070701_10119509 | |||
| 1119 | Ga0070711_100005860 | |||
| 1120 | Ga0070711_100009005 | |||
| 1121 | Ga0070711_100017661 | |||
| 1122 | Ga0070711_100024621 | |||
| 1123 | Ga0070711_100048425 | |||
| 1124 | Ga0070705_100000101 | |||
| 1125 | Ga0070705_100116207 | |||
| 1126 | Ga0070705_100162470 | |||
| 1127 | Ga0070700_100150960 | |||
| 1128 | Ga0070694_100000321 | |||
| 1129 | Ga0070694_100022228 | |||
| 1130 | Ga0070694_100160533 | |||
| 1131 | Ga0070708_100000726 | |||
| 1132 | Ga0070708_100011955 | |||
| 1133 | Ga0070708_100195848 | |||
| 1134 | Ga0070708_100267045 | |||
| 1135 | Ga0070663_100007449 | |||
| 1136 | Ga0070663_100023527 | |||
| 1137 | Ga0070663_100144753 | |||
| 1138 | Ga0070678_100027852 | |||
| 1139 | Ga0070678_100289694 | |||
| 1140 | Ga0070662_100013385 | |||
| 1141 | Ga0070662_100255726 | |||
| 1142 | Ga0070662_100281124 | |||
| 1143 | Ga0070681_10025308 | |||
| 1144 | Ga0070681_10106355 | |||
| 1145 | Ga0070681_10128227 | |||
| 1146 | Ga0068867_100026332 | |||
| 1147 | Ga0068867_100036340 | |||
| 1148 | Ga0068867_100243206 | |||
| 1149 | Ga0070685_10030190 | |||
| 1150 | Ga0070706_100021627 | |||
| 1151 | Ga0070706_100431953 | |||
| 1152 | Ga0070707_100330174 | |||
| 1153 | Ga0070698_100264832 | |||
| 1154 | Ga0070699_100000281 | |||
| 1155 | Ga0070679_100045232 | |||
| 1156 | Ga0070679_100232077 | |||
| 1157 | Ga0070684_100006541 | |||
| 1158 | Ga0070684_100250818 | |||
| 1159 | Ga0070697_100008863 | |||
| 1160 | Ga0070697_100028285 | |||
| 1161 | Ga0068853_100155935 | |||
| 1162 | Ga0070672_100010256 | |||
| 1163 | Ga0070672_100075256 | |||
| 1164 | Ga0070672_100371081 | |||
| 1165 | Ga0070695_100004104 | |||
| 1166 | Ga0070695_100014438 | |||
| 1167 | Ga0070695_100214542 | |||
| 1168 | Ga0070696_100000811 | |||
| 1169 | Ga0070696_100175334 | |||
| 1170 | Ga0070696_100193126 | |||
| 1171 | Ga0070693_100007751 | |||
| 1172 | Ga0070693_100022290 | |||
| 1173 | Ga0070665_100141231 | |||
| 1174 | Ga0070704_100099583 | |||
| 1175 | Ga0068855_100022696 | |||
| 1176 | Ga0068855_100064892 | |||
| 1177 | Ga0068855_100174539 | |||
| 1178 | Ga0068855_100600849 | |||
| 1179 | Ga0070664_100046730 | |||
| 1180 | Ga0070664_100109474 | |||
| 1181 | Ga0070664_100113488 | |||
| 1182 | Ga0068857_100003319 | |||
| 1183 | Ga0068857_100075134 | |||
| 1184 | Ga0068857_100154781 | |||
| 1185 | Ga0068857_100170743 | |||
| 1186 | Ga0068857_100317361 | |||
| 1187 | Ga0068854_100019516 | |||
| 1188 | Ga0068854_100090515 | |||
| 1189 | Ga0068856_100000066 | |||
| 1190 | Ga0068856_100023411 | |||
| 1191 | Ga0068856_100033294 | |||
| 1192 | Ga0068856_100110066 | |||
| 1193 | Ga0068856_100376605 | |||
| 1194 | Ga0070702_100065280 | |||
| 1195 | Ga0070702_100096815 | |||
| 1196 | Ga0070702_100121592 | |||
| 1197 | Ga0068852_100002462 | |||
| 1198 | Ga0068852_100010672 | |||
| 1199 | Ga0068852_100119821 | |||
| 1200 | Ga0068859_100006260 | |||
| 1201 | Ga0068859_100011754 | |||
| 1202 | Ga0068859_100018584 | |||
| 1203 | Ga0068859_100182333 | |||
| 1204 | Ga0068864_100089468 | |||
| 1205 | Ga0068864_100416446 | |||
| 1206 | Ga0068864_100499749 | |||
| 1207 | Ga0068866_10022649 | |||
| 1208 | Ga0068866_10158523 | |||
| 1209 | Ga0068861_100035422 | |||
| 1210 | Ga0068861_100037067 | |||
| 1211 | Ga0068861_100351674 | |||
| 1212 | Ga0068870_10143662 | |||
| 1213 | Ga0068863_100005165 | |||
| 1214 | Ga0068863_100074770 | |||
| 1215 | Ga0068863_100169221 | |||
| 1216 | Ga0068858_100016247 | |||
| 1217 | Ga0068858_100022839 | |||
| 1218 | Ga0068858_100255861 | |||
| 1219 | Ga0068858_100258420 | |||
| 1220 | Ga0068860_100001582 | |||
| 1221 | Ga0068860_100004600 | |||
| 1222 | Ga0068860_100030287 | |||
| 1223 | Ga0081455_10000014 | |||
| 1224 | Ga0081455_10003956 | |||
| 1225 | Ga0081455_10004726 | |||
| 1226 | Ga0081455_10041561 | |||
| 1227 | Ga0081540_1001902 | |||
| 1228 | Ga0081540_1033630 | |||
| 1229 | Ga0081540_1034190 | |||
| 1230 | Ga0081539_10020579 | |||
| 1231 | Ga0081539_10069592 | |||
| 1232 | Ga0070717_10000926 | |||
| 1233 | Ga0070717_10317791 | |||
| 1234 | Ga0075365_10019309 | |||
| 1235 | Ga0075365_10020412 | |||
| 1236 | Ga0075365_10121584 | |||
| 1237 | Ga0075365_10146985 | |||
| 1238 | Ga0075368_10008841 | |||
| 1239 | Ga0075368_10058639 | |||
| 1240 | Ga0075363_100009358 | |||
| 1241 | Ga0075363_100044157 | |||
| 1242 | Ga0075363_100078670 | |||
| 1243 | Ga0075364_10002466 | |||
| 1244 | Ga0075364_10006004 | |||
| 1245 | Ga0075364_10009887 | |||
| 1246 | Ga0075364_10030814 | |||
| 1247 | Ga0075364_10059980 | |||
| 1248 | Ga0070715_10089756 | |||
| 1249 | Ga0070715_10095021 | |||
| 1250 | Ga0070716_100075350 | |||
| 1251 | Ga0070716_100076581 | |||
| 1252 | Ga0070716_100130746 | |||
| 1253 | Ga0070716_100200234 | |||
| 1254 | Ga0070712_100000412 | |||
| 1255 | Ga0070712_100006858 | |||
| 1256 | Ga0070712_100028515 | |||
| 1257 | Ga0070712_100028607 | |||
| 1258 | Ga0070712_100060845 | |||
| 1259 | Ga0070712_100092789 | |||
| 1260 | Ga0070712_100099906 | |||
| 1261 | Ga0070712_100105892 | |||
| 1262 | Ga0070712_100148536 | |||
| 1263 | Ga0070712_100353300 | |||
| 1264 | Ga0075362_10000965 | |||
| 1265 | Ga0075362_10008875 | |||
| 1266 | Ga0075362_10046267 | |||
| 1267 | Ga0075367_10000878 | |||
| 1268 | Ga0075367_10001658 | |||
| 1269 | Ga0075367_10004378 | |||
| 1270 | Ga0075367_10011660 | |||
| 1271 | Ga0075367_10038372 | |||
| 1272 | Ga0075367_10041143 | |||
| 1273 | Ga0075367_10076025 | |||
| 1274 | Ga0075369_10026428 | |||
| 1275 | Ga0075366_10006131 | |||
| 1276 | Ga0075366_10029088 | |||
| 1277 | Ga0075366_10081172 | |||
| 1278 | Ga0075366_10107745 | |||
| 1279 | Ga0097621_100089872 | |||
| 1280 | Ga0075370_10015337 | |||
| 1281 | Ga0075370_10134592 | |||
| 1282 | Ga0068871_100149386 | |||
| 1283 | Ga0068871_100152040 | |||
| 1284 | Ga0075428_100140325 | |||
| 1285 | Ga0075428_100422791 | |||
| 1286 | Ga0075430_100004348 | |||
| 1287 | Ga0075431_100005249 | |||
| 1288 | Ga0075433_10011738 | |||
| 1289 | Ga0075434_100005130 | |||
| 1290 | Ga0075434_100006402 | |||
| 1291 | Ga0068865_100073788 | |||
| 1292 | Ga0075436_100001047 | |||
| 1293 | Ga0075436_100105359 | |||
| 1294 | Ga0075436_100274854 | |||
| 1295 | Ga0097620_100006260 | |||
| 1296 | Ga0097620_100011754 | |||
| 1297 | Ga0097620_100018584 | |||
| 1298 | Ga0097620_100182326 | |||
| 1299 | Ga0075435_100019399 | |||
| 1300 | Ga0075435_100315385 | |||
| 1301 | Ga0099794_10029160 | |||
| 1302 | Ga0099794_10061249 | |||
| 1303 | Ga0099794_10093188 | |||
| 1304 | Ga0099795_10030171 | |||
| 1305 | Ga0099795_10034282 | |||
| 1306 | Ga0099795_10062935 | |||
| 1307 | Ga0105240_10006645 | |||
| 1308 | Ga0105240_10007301 | |||
| 1309 | Ga0105240_10070911 | |||
| 1310 | Ga0105240_10088210 | |||
| 1311 | Ga0105240_10330018 | |||
| 1312 | Ga0105240_10410743 | |||
| 1313 | Ga0111539_10004677 | |||
| 1314 | Ga0111539_10009581 | |||
| 1315 | Ga0111539_10013311 | |||
| 1316 | Ga0111539_10151813 | |||
| 1317 | Ga0105245_10004067 | |||
| 1318 | Ga0105245_10006433 | |||
| 1319 | Ga0105245_10031288 | |||
| 1320 | Ga0105245_10038950 | |||
| 1321 | Ga0105245_10065437 | |||
| 1322 | Ga0105245_10088645 | |||
| 1323 | Ga0105247_10021588 | |||
| 1324 | Ga0105247_10036022 | |||
| 1325 | Ga0105247_10070772 | |||
| 1326 | Ga0105247_10108410 | |||
| 1327 | Ga0105247_10116130 | |||
| 1328 | Ga0114129_10082645 | |||
| 1329 | Ga0114129_10203496 | |||
| 1330 | Ga0105241_10018995 | |||
| 1331 | Ga0105241_10038542 | |||
| 1332 | Ga0105241_10074324 | |||
| 1333 | Ga0105241_10097895 | |||
| 1334 | Ga0105242_10037241 | |||
| 1335 | Ga0105242_10061497 | |||
| 1336 | Ga0105242_10189410 | |||
| 1337 | Ga0105242_10262216 | |||
| 1338 | Ga0105242_10311372 | |||
| 1339 | Ga0105242_10313176 | |||
| 1340 | Ga0105248_10007036 | |||
| 1341 | Ga0105237_10005677 | |||
| 1342 | Ga0105237_10070763 | |||
| 1343 | Ga0105237_10082031 | |||
| 1344 | Ga0105237_10103825 | |||
| 1345 | Ga0105237_10131053 | |||
| 1346 | Ga0105237_10164168 | |||
| 1347 | Ga0105237_10474604 | |||
| 1348 | Ga0105238_10025920 | |||
| 1349 | Ga0105238_10031915 | |||
| 1350 | Ga0105238_10078885 | |||
| 1351 | Ga0105238_10136335 | |||
| 1352 | Ga0105238_10194210 | |||
| 1353 | Ga0105238_10445607 | |||
| 1354 | Ga0105238_10463432 | |||
| 1355 | Ga0105238_10496987 | |||
| 1356 | Ga0105249_10009590 | |||
| 1357 | Ga0099796_10000999 | |||
| 1358 | Ga0099796_10010628 | |||
| 1359 | Ga0099796_10014871 | |||
| 1360 | Ga0105239_10013662 | |||
| 1361 | Ga0105239_10035753 | |||
| 1362 | Ga0105239_10092226 | |||
| 1363 | Ga0105239_10243437 | |||
| 1364 | Ga0105239_10281693 | |||
| 1365 | Ga0105239_10411731 | |||
| 1366 | Ga0105246_10010353 | |||
| 1367 | Ga0157373_10054362 | |||
| 1368 | Ga0157371_10012441 | |||
| 1369 | Ga0157370_10034068 | |||
| 1370 | Ga0157370_10070950 | |||
| 1371 | Ga0157369_10004338 | |||
| 1372 | Ga0157369_10010807 | |||
| 1373 | Ga0157374_10012898 | |||
| 1374 | Ga0157374_10149490 | |||
| 1375 | Ga0157374_10171838 | |||
| 1376 | Ga0157378_10001343 | |||
| 1377 | Ga0157378_10086729 | |||
| 1378 | Ga0157378_10249206 | |||
| 1379 | Ga0157378_10318426 | |||
| 1380 | Ga0157378_10324029 | |||
| 1381 | Ga0163162_10007091 | |||
| 1382 | Ga0163162_10024766 | |||
| 1383 | Ga0163162_10060820 | |||
| 1384 | Ga0163162_10153308 | |||
| 1385 | Ga0157372_10049063 | |||
| 1386 | Ga0157372_10104355 | |||
| 1387 | Ga0157372_10265177 | |||
| 1388 | Ga0157375_10003647 | |||
| 1389 | Ga0157375_10260714 | |||
| 1390 | Ga0157375_10434064 | |||
| 1391 | Ga0163163_10009357 | |||
| 1392 | Ga0157380_10089746 | |||
| 1393 | Ga0157380_10193031 | |||
| 1394 | Ga0182008_10054953 | |||
| 1395 | Ga0157379_10000412 | |||
| 1396 | Ga0157376_10017075 | |||
| 1397 | Ga0157376_10249774 | |||
| 1398 | Ga0213874_10004128 | |||
| 1399 | Ga0213874_10049022 | |||
| 1400 | Ga0213876_10005223 | |||
| 1401 | Ga0213876_10076446 | |||
| 1402 | Ga0213875_10000030 | |||
| 1403 | Ga0209563_106750 | |||
| 1404 | Ga0209677_100749 | |||
| 1405 | Ga0209148_1000711 | |||
| 1406 | Ga0209233_1002053 | |||
| 1407 | Ga0209233_1005766 | |||
| 1408 | Ga0209233_1017691 | |||
| 1409 | Ga0209455_1001471 | |||
| 1410 | Ga0209455_1002106 | |||
| 1411 | Ga0209455_1017435 | |||
| 1412 | Ga0209564_1000503 | |||
| 1413 | Ga0209564_1024573 | |||
| 1414 | Ga0209758_1003246 | |||
| 1415 | Ga0209758_1013786 | |||
| 1416 | Ga0207653_10004798 | |||
| 1417 | Ga0207682_10046666 | |||
| 1418 | Ga0207692_10000750 | |||
| 1419 | Ga0207692_10021336 | |||
| 1420 | Ga0207692_10028491 | |||
| 1421 | Ga0207692_10043154 | |||
| 1422 | Ga0207642_10036265 | |||
| 1423 | Ga0207710_10025386 | |||
| 1424 | Ga0207710_10062801 | |||
| 1425 | Ga0207688_10068602 | |||
| 1426 | Ga0207688_10095562 | |||
| 1427 | Ga0207680_10003578 | |||
| 1428 | Ga0207685_10084654 | |||
| 1429 | Ga0207699_10041705 | |||
| 1430 | Ga0207699_10082446 | |||
| 1431 | Ga0207699_10279938 | |||
| 1432 | Ga0207645_10055417 | |||
| 1433 | Ga0207643_10050130 | |||
| 1434 | Ga0207643_10115471 | |||
| 1435 | Ga0207705_10261882 | |||
| 1436 | Ga0207684_10048203 | |||
| 1437 | Ga0207707_10009615 | |||
| 1438 | Ga0207707_10038943 | |||
| 1439 | Ga0207707_10045184 | |||
| 1440 | Ga0207707_10049476 | |||
| 1441 | Ga0207695_10000029 | |||
| 1442 | Ga0207695_10111957 | |||
| 1443 | Ga0207695_10134869 | |||
| 1444 | Ga0207695_10166253 | |||
| 1445 | Ga0207695_10176901 | |||
| 1446 | Ga0207695_10189865 | |||
| 1447 | Ga0207695_10384490 | |||
| 1448 | Ga0207671_10002337 | |||
| 1449 | Ga0207671_10042369 | |||
| 1450 | Ga0207671_10052329 | |||
| 1451 | Ga0207671_10137655 | |||
| 1452 | Ga0207693_10000969 | |||
| 1453 | Ga0207693_10001536 | |||
| 1454 | Ga0207693_10002407 | |||
| 1455 | Ga0207693_10015794 | |||
| 1456 | Ga0207693_10020767 | |||
| 1457 | Ga0207693_10022603 | |||
| 1458 | Ga0207693_10029915 | |||
| 1459 | Ga0207693_10031820 | |||
| 1460 | Ga0207693_10035068 | |||
| 1461 | Ga0207693_10069433 | |||
| 1462 | Ga0207693_10178367 | |||
| 1463 | Ga0207663_10000225 | |||
| 1464 | Ga0207663_10019032 | |||
| 1465 | Ga0207663_10081597 | |||
| 1466 | Ga0207663_10097744 | |||
| 1467 | Ga0207663_10163793 | |||
| 1468 | Ga0207663_10297012 | |||
| 1469 | Ga0207663_10308822 | |||
| 1470 | Ga0207660_10024703 | |||
| 1471 | Ga0207660_10027553 | |||
| 1472 | Ga0207660_10108645 | |||
| 1473 | Ga0207660_10217939 | |||
| 1474 | Ga0207660_10322887 | |||
| 1475 | Ga0207662_10140382 | |||
| 1476 | Ga0207657_10068585 | |||
| 1477 | Ga0207657_10122290 | |||
| 1478 | Ga0207649_10117838 | |||
| 1479 | Ga0207649_10124143 | |||
| 1480 | Ga0207652_10015556 | |||
| 1481 | Ga0207652_10057386 | |||
| 1482 | Ga0207652_10243145 | |||
| 1483 | Ga0207652_10336385 | |||
| 1484 | Ga0207646_10290149 | |||
| 1485 | Ga0207694_10048261 | |||
| 1486 | Ga0207694_10097763 | |||
| 1487 | Ga0207694_10156368 | |||
| 1488 | Ga0207694_10217054 | |||
| 1489 | Ga0207694_10347220 | |||
| 1490 | Ga0207650_10162045 | |||
| 1491 | Ga0207659_10086397 | |||
| 1492 | Ga0207659_10162476 | |||
| 1493 | Ga0207659_10197627 | |||
| 1494 | Ga0207687_10005601 | |||
| 1495 | Ga0207687_10010336 | |||
| 1496 | Ga0207687_10081405 | |||
| 1497 | Ga0207700_10012696 | |||
| 1498 | Ga0207700_10013786 | |||
| 1499 | Ga0207700_10045624 | |||
| 1500 | Ga0207700_10070128 | |||
| 1501 | Ga0207700_10093357 | |||
| 1502 | Ga0207700_10162139 | |||
| 1503 | Ga0207700_10279601 | |||
| 1504 | Ga0207664_10002384 | |||
| 1505 | Ga0207664_10020293 | |||
| 1506 | Ga0207664_10039165 | |||
| 1507 | Ga0207664_10092565 | |||
| 1508 | Ga0207664_10116449 | |||
| 1509 | Ga0207664_10122745 | |||
| 1510 | Ga0207664_10124832 | |||
| 1511 | Ga0207664_10254575 | |||
| 1512 | Ga0207644_10004181 | |||
| 1513 | Ga0207644_10077380 | |||
| 1514 | Ga0207644_10128624 | |||
| 1515 | Ga0207690_10019392 | |||
| 1516 | Ga0207706_10015114 | |||
| 1517 | Ga0207706_10050826 | |||
| 1518 | Ga0207706_10055534 | |||
| 1519 | Ga0207706_10063408 | |||
| 1520 | Ga0207686_10006380 | |||
| 1521 | Ga0207686_10043238 | |||
| 1522 | Ga0207686_10154173 | |||
| 1523 | Ga0207670_10006134 | |||
| 1524 | Ga0207669_10034219 | |||
| 1525 | Ga0207669_10114508 | |||
| 1526 | Ga0207704_10142974 | |||
| 1527 | Ga0207704_10382641 | |||
| 1528 | Ga0207665_10000243 | |||
| 1529 | Ga0207665_10027338 | |||
| 1530 | Ga0207665_10032689 | |||
| 1531 | Ga0207665_10114189 | |||
| 1532 | Ga0207665_10270736 | |||
| 1533 | Ga0207691_10006249 | |||
| 1534 | Ga0207691_10070297 | |||
| 1535 | Ga0207691_10086046 | |||
| 1536 | Ga0207691_10261679 | |||
| 1537 | Ga0207711_10005199 | |||
| 1538 | Ga0207689_10025104 | |||
| 1539 | Ga0207689_10052282 | |||
| 1540 | Ga0207689_10136032 | |||
| 1541 | Ga0207689_10141898 | |||
| 1542 | Ga0207661_10001465 | |||
| 1543 | Ga0207661_10097163 | |||
| 1544 | Ga0207661_10155469 | |||
| 1545 | Ga0207661_10190835 | |||
| 1546 | Ga0207661_10524653 | |||
| 1547 | Ga0207679_10074164 | |||
| 1548 | Ga0207679_10125731 | |||
| 1549 | Ga0207679_10214564 | |||
| 1550 | Ga0207667_10098999 | |||
| 1551 | Ga0207712_10005744 | |||
| 1552 | Ga0207640_10125890 | |||
| 1553 | Ga0207677_10000152 | |||
| 1554 | Ga0207677_10039784 | |||
| 1555 | Ga0207677_10159676 | |||
| 1556 | Ga0207639_10111884 | |||
| 1557 | Ga0207639_10315654 | |||
| 1558 | Ga0207678_10001761 | |||
| 1559 | Ga0207678_10038587 | |||
| 1560 | Ga0207678_10286843 | |||
| 1561 | Ga0207708_10004485 | |||
| 1562 | Ga0207708_10100101 | |||
| 1563 | Ga0207708_10154577 | |||
| 1564 | Ga0207702_10000044 | |||
| 1565 | Ga0207702_10024967 | |||
| 1566 | Ga0207702_10025069 | |||
| 1567 | Ga0207702_10029073 | |||
| 1568 | Ga0207702_10185087 | |||
| 1569 | Ga0207702_10229012 | |||
| 1570 | Ga0207702_10241583 | |||
| 1571 | Ga0207641_10007382 | |||
| 1572 | Ga0207641_10044711 | |||
| 1573 | Ga0207641_10074448 | |||
| 1574 | Ga0207648_10135873 | |||
| 1575 | Ga0207648_10142309 | |||
| 1576 | Ga0207676_10014486 | |||
| 1577 | Ga0207676_10018694 | |||
| 1578 | Ga0207676_10075567 | |||
| 1579 | Ga0207674_10001070 | |||
| 1580 | Ga0207674_10001334 | |||
| 1581 | Ga0207674_10033029 | |||
| 1582 | Ga0207674_10042363 | |||
| 1583 | Ga0207674_10055622 | |||
| 1584 | Ga0207674_10092025 | |||
| 1585 | Ga0207675_100185749 | |||
| 1586 | Ga0207675_100368702 | |||
| 1587 | Ga0207683_10010764 | |||
| 1588 | Ga0207683_10018922 | |||
| 1589 | Ga0207683_10020117 | |||
| 1590 | Ga0207698_10035554 | |||
| 1591 | Ga0209813_10015031 | |||
| 1592 | Ga0207428_10044709 | |||
| 1593 | Ga0207428_10072180 | |||
| 1594 | Ga0207428_10169532 | |||
| 1595 | Ga0268266_10023001 | |||
| 1596 | Ga0268266_10075373 | |||
| 1597 | Ga0268266_10129370 | |||
| 1598 | Ga0268266_10129620 | |||
| 1599 | Ga0268265_10005167 | |||
| 1600 | Ga0268265_10238919 | |||
| 1601 | Ga0268264_10000020 | |||
| 1602 | Ga0268264_10008583 | |||
| 1603 | Ga0268264_10017114 | |||
| 1604 | Ga0268264_10193957 | |||
| 1605 | Ga0265337_1006750 | |||
| 1606 | Ga0265326_10038516 | |||
| 1607 | Ga0265334_10002301 | |||
| 1608 | Ga0265318_10005804 | |||
| 1609 | Ga0265323_10000169 | |||
| 1610 | Ga0265322_10004434 | |||
| 1611 | Ga0265336_10000663 | |||
| 1612 | Ga0307517_10000053 | |||
| 1613 | Ga0307515_10060521 | |||
| 1614 | Ga0307515_10199845 | |||
| 1615 | Ga0265338_10000013 | |||
| 1616 | Ga0265324_10003787 | |||
| 1617 | Ga0265773_1001235 | |||
| 1618 | Ga0265760_10021107 | |||
| 1619 | Ga0265760_10060465 | |||
| 1620 | Ga0265330_10031036 | |||
| 1621 | Ga0265320_10110497 | |||
| 1622 | Ga0265325_10042997 | |||
| 1623 | Ga0265329_10042643 | |||
| 1624 | Ga0265340_10039967 | |||
| 1625 | Ga0265340_10067060 | |||
| 1626 | Ga0265339_10097647 | |||
| 1627 | Ga0265316_10139588 | |||
| 1628 | Ga0307513_10138904 | |||
| 1629 | Ga0307509_10276022 | |||
| 1630 | Ga0265313_10009853 | |||
| 1631 | Ga0307508_10000058 | |||
| 1632 | Ga0307508_10208897 | |||
| 1633 | Ga0265314_10022142 | |||
| 1634 | Ga0265314_10071456 | |||
| 1635 | Ga0265342_10083042 | |||
| 1636 | Ga0307516_10038551 | |||
| 1637 | Ga0307410_10112508 | |||
| 1638 | Ga0307412_10232424 | |||
| 1639 | Ga0307414_10253655 | |||
| 1640 | Ga0307411_10197156 | |||
| 1641 | Ga0316053_101306 | |||
| 1642 | Ga0307510_10165027 | |||
| 1643 | Ga0316215_1001197 | |||
| 1644 | Ga0373926_0013143 | |||
| 1645 | Ga0373926_0034568 | |||
| 1646 | Ga0373929_0006496 | |||
| 1647 | Ga0373934_0074664 | |||
| 1648 | Ga0373944_0013310 | |||
| 1649 | Ga0373944_0020457 | |||
| 1650 | Ga0373923_0029400 | |||
| 1651 | Ga0373936_0077081 | |||
| 1652 | Ga0373945_0030664 | |||
| 1653 | Ga0373945_0041011 | |||
| 1654 | Ga0373945_0101774 | |||
| 1655 | Ga0373953_0045980 | |||
| 1656 | Ga0373954_0015689 | |||
| 1657 | Ga0373943_0000625 | |||
| 1658 | Ga0373943_0046483 | |||
| 1659 | Ga0373943_0111657 | |||
| 1660 | Ga0373943_0117477 | |||
| 1661 | Ga0373924_0026717 | |||
| 1662 | Ga0373924_0035287 | |||
| 1663 | Ga0373931_0012802 | |||
| 1664 | Ga0373935_0050898 | |||
| 1665 | Ga0373935_0085244 | |||
| 1666 | Ga0373935_0139241 | |||
| 1667 | Ga0373935_0246781 | |||
| 1668 | Ga0373927_0000208 | |||
| 1669 | Ga0373927_0005624 | |||
| 1670 | Ga0373927_0007126 | |||
| 1671 | Ga0373927_0010764 | |||
| 1672 | Ga0373927_0034151 | |||
| 1673 | Ga0373927_0036366 | |||
| 1674 | Ga0373927_0102049 | |||
| 1675 | Ga0373927_0151223 | |||
| 1676 | Ga0373927_0193902 | |||
| 1677 | Ga0373933_0000052 | |||
| 1678 | Ga0373933_0043435 | |||
| 1679 | Ga0373933_0052699 | |||
| 1680 | Ga0373947_0000572 | |||
| 1681 | Ga0373947_0019808 | |||
| 1682 | Ga0373947_0106292 | |||
| 1683 | Ga0373947_0109238 | |||
| 1684 | Ga0373937_0003631 | |||
| 1685 | Ga0373937_0035244 | |||
| 1686 | Ga0373937_0047933 | |||
| 1687 | Ga0373937_0065599 | |||
| 1688 | Ga0373937_0128368 | |||
| 1689 | Ga0373937_0179707 | |||
| 1690 | Ga0373925_0002541 | |||
| 1691 | Ga0373925_0019815 | |||
| 1692 | Ga0373925_0026932 | |||
| 1693 | Ga0373925_0029850 | |||
| 1694 | Ga0373925_0047259 | |||
| 1695 | Ga0373925_0134557 | |||
| 1696 | Ga0395900_0029644 | |||
| 1697 | Ga0395898_0008229 | |||
| 1698 | Ga0395905_0417289 | |||
| 1699 | Ga0436364_0207431 | |||
| 1700 | Ga0436364_0716994 | |||
| 1701 | Ga0395901_0602840 | |||
| 1702 | Ga0400483_078811 | |||
| 1703 | Ga0400483_199136 | |||
| 1704 | Ga0400483_281213 | |||
| 1705 | Ga0436365_0086833 | |||
| 1706 | Ga0436365_0220203 | |||
| 1707 | Ga0436365_0289679 | |||
| 1708 | Ga0436365_0338285 | |||
| 1709 | Ga0436365_1165498 | |||
| 1710 | Ga0436365_1289758 | |||
| 1711 | Ga0436365_1742880 | |||
| 1712 | Ga0436365_1873205 | |||
| 1713 | Ga0436360_1354193 | |||
| 1714 | Ga0436361_0248960 | |||
| 1715 | Ga0436361_0324422 | |||
| 1716 | Ga0436361_0559458 | |||
| 1717 | Ga0436361_0963044 | |||
| 1718 | Ga0436363_0800589 | |||
| 1719 | Ga0439453_0000155 | |||
| 1720 | Ga0439465_0061524 | |||
| 1721 | Ga0451789_0018586 | |||
| 1722 | Ga0451800_0830467 | |||
| 1723 | Ga0439441_003763 | |||
| 1724 | Ga0439435_0004722 | |||
| 1725 | Ga0439460_0009225 | |||
| 1726 | Ga0439440_0009586 | |||
| 1727 | Ga0466969_0064388 | |||
| 1728 | Ga0466966_0032661 | |||
| 1729 | Ga0466966_0244635 | |||
| 1730 | Ga0466961_0056721 | |||
| 1731 | Ga0466963_0263441 | |||
| 1732 | Ga0466970_0026255 | |||
| 1733 | Ga0466970_0202672 | |||
| 1734 | Ga0466957_0032036 | |||
| 1735 | Ga0466959_0056634 | |||
| 1736 | Ga0466959_0068328 | |||
| 1737 | Ga0466958_0208703 | |||
| 1738 | Ga0466967_0030956 | |||
| 1739 | Ga0466967_0073667 | |||
| 1740 | Ga0466967_0081586 | |||
| 1741 | Ga0466967_0243783 | |||
| 1742 | Ga0466967_0258382 | |||
| 1743 | Ga0495617_015952 | |||
| 1744 | Ga0495592_0010258 | |||
| 1745 | Ga0495592_0109149 | |||
| 1746 | Ga0495603_0019795 | |||
| 1747 | Ga0495603_0036083 | |||
| 1748 | Ga0495603_0088727 | |||
| 1749 | Ga0495603_0180018 | |||
| 1750 | Ga0495629_0031462 | |||
| 1751 | Ga0495638_0031899 | |||
| 1752 | Ga0495638_0070779 | |||
| 1753 | Ga0495641_0106384 | |||
| 1754 | Ga0495651_0010805 | |||
| 1755 | Ga0495580_0024643 | |||
| 1756 | Ga0495580_0096371 | |||
| 1757 | Ga0495580_0245928 | |||
| 1758 | Ga0495580_0269376 | |||
| 1759 | Ga0495582_0007925 | |||
| 1760 | Ga0495582_0058508 | |||
| 1761 | Ga0495639_0014764 | |||
| 1762 | Ga0495639_0033644 | |||
| 1763 | Ga0495639_0120359 | |||
| 1764 | Ga0495662_0014430 | |||
| 1765 | Ga0495662_0024022 | |||
| 1766 | Ga0495662_0048650 | |||
| 1767 | Ga0495664_0000914 | |||
| 1768 | Ga0495664_0014283 | |||
| 1769 | Ga0495664_0048541 | |||
| 1770 | Ga0495664_0058956 | |||
| 1771 | Ga0495594_0003849 | |||
| 1772 | Ga0495607_0023434 | |||
| 1773 | Ga0495608_0016760 | |||
| 1774 | Ga0495608_0072337 | |||
| 1775 | Ga0495616_0020481 | |||
| 1776 | Ga0495618_0001314 | |||
| 1777 | Ga0495618_0026210 | |||
| 1778 | Ga0495628_0047872 | |||
| 1779 | Ga0495628_0106249 | |||
| 1780 | Ga0495630_0015328 | |||
| 1781 | Ga0495630_0089300 | |||
| 1782 | Ga0495630_0142876 | |||
| 1783 | Ga0495631_0005942 | |||
| 1784 | Ga0495631_0021534 | |||
| 1785 | Ga0495631_0057707 | |||
| 1786 | Ga0495632_0013773 | |||
| 1787 | Ga0495637_0030425 | |||
| 1788 | Ga0495648_0001411 | |||
| 1789 | Ga0495652_0056253 | |||
| 1790 | Ga0495652_0058974 | |||
| 1791 | Ga0495652_0104176 | |||
| 1792 | Ga0495665_0002990 | |||
| 1793 | Ga0495665_0017200 | |||
| 1794 | Ga0495640_0001789 | |||
| 1795 | Ga0495640_0051257 | |||
| 1796 | Ga0495640_0057176 | |||
| 1797 | Ga0495640_0106358 | |||
| 1798 | Ga0495587_0087973 | |||
| 1799 | Ga0495621_0009030 | |||
| 1800 | Ga0495597_0042780 | |||
| 1801 | Ga0495645_0007907 | |||
| 1802 | Ga0495645_0022537 | |||
| 1803 | Ga0495645_0028110 | |||
| 1804 | Ga0495622_0010976 | |||
| 1805 | Ga0495622_0045806 | |||
| 1806 | Ga0495622_0065380 | |||
| 1807 | Ga0495667_0087014 | |||
| 1808 | Ga0495667_0220505 | |||
| 1809 | Ga0495656_0019166 | |||
| 1810 | Ga0495634_0005018 | |||
| 1811 | Ga0495634_0018970 | |||
| 1812 | Ga0495634_0023106 | |||
| 1813 | Ga0495634_0045749 | |||
| 1814 | Ga0495634_0153618 | |||
| 1815 | Ga0495611_0078466 | |||
| 1816 | Ga0495625_0124262 | |||
| 1817 | Ga0495635_0001579 | |||
| 1818 | Ga0495635_0030467 | |||
| 1819 | Ga0495635_0089551 | |||
| 1820 | Ga0495661_0054722 | |||
| 1821 | Ga0495588_0017364 | |||
| 1822 | Ga0495657_0011125 | |||
| 1823 | Ga0495657_0105660 | |||
| 1824 | Ga0495657_0241944 | |||
| 1825 | Ga0495599_0093896 | |||
| 1826 | Ga0495623_0054488 | |||
| 1827 | Ga0495647_0004216 | |||
| 1828 | Ga0495647_0017755 | |||
| 1829 | Ga0495658_0005488 | |||
| 1830 | Ga0495658_0007978 | |||
| 1831 | Ga0495613_0015165 | |||
| 1832 | Ga0495613_0061127 | |||
| 1833 | Ga0495613_0091325 | |||
| 1834 | Ga0495624_0006069 | |||
| 1835 | Ga0495624_0022696 | |||
| 1836 | Ga0495624_0058575 | |||
| 1837 | Ga0495670_0164870 | |||
| 1838 | Ga0495671_0011887 | |||
| 1839 | Ga0495600_0022342 | |||
| 1840 | Ga0495600_0084531 | |||
| 1841 | Ga0495600_0146293 | |||
| 1842 | Ga0495660_0154108 | |||
| 1843 | Ga0495581_0009664 | |||
| 1844 | Ga0495581_0013235 | |||
| 1845 | Ga0495581_0016397 | |||
| 1846 | Ga0495581_0051065 | |||
| 1847 | Ga0495581_0174289 | |||
| 1848 | Ga0495604_0025374 | |||
| 1849 | Ga0495674_0000765 | |||
| 1850 | Ga0495674_0151554 | |||
| 1851 | Ga0495672_0043987 | |||
| 1852 | Ga0495684_0002602 | |||
| 1853 | Ga0495684_0005012 | |||
| 1854 | Ga0495684_0015044 | |||
| 1855 | Ga0495684_0254138 | |||
| 1856 | Ga0495686_0024993 | |||
| 1857 | Ga0495593_0009145 | |||
| 1858 | Ga0495593_0012996 | |||
| 1859 | Ga0495593_0110405 | |||
| 1860 | Ga0495602_0257901 | |||
| 1861 | Ga0496100_0127860 | |||
| 1862 | Ga0496101_0008690 | |||
| 1863 | Ga0496101_0129827 | |||
| 1864 | Ga0496101_0259908 | |||
| 1865 | Ga0496102_0232981 | |||
| 1866 | Ga0496103_0280663 | |||
| 1867 | Ga0496104_0018406 | |||
| 1868 | Ga0496104_0064651 | |||
| 1869 | Ga0496104_0084486 | |||
| 1870 | Ga0496104_0451287 | |||
| 1871 | Ga0496105_0010974 | |||
| 1872 | Ga0496105_0018379 | |||
| 1873 | Ga0496105_0056259 | |||
| 1874 | Ga0496106_0002130 | |||
| 1875 | Ga0496106_0089259 | |||
| 1876 | Ga0496106_0451141 | |||
| 1877 | Ga0496107_0039259 | |||
| 1878 | Ga0496107_0199838 | |||
| 1879 | Ga0496107_0208951 | |||
| 1880 | Ga0496108_0017925 | |||
| 1881 | Ga0496108_0057356 | |||
| 1882 | Ga0496108_0165235 | |||
| 1883 | Ga0496108_0229516 | |||
| 1884 | Ga0496109_0047750 | |||
| 1885 | Ga0496109_0096794 | |||
| 1886 | Ga0496109_0214059 | |||
| 1887 | Ga0496110_0053914 | |||
| 1888 | Ga0496110_0132174 | |||
| 1889 | Ga0496110_0178065 | |||
| 1890 | Ga0496111_0044940 | |||
| 1891 | Ga0496111_0162982 | |||
| 1892 | Ga0496111_0206276 | |||
| 1893 | Ga0496112_0005365 | |||
| 1894 | Ga0496112_0015998 | |||
| 1895 | Ga0496112_0037314 | |||
| 1896 | Ga0496112_0209782 | |||
| 1897 | Ga0496112_0213614 | |||
| 1898 | Ga0496112_0307888 | |||
| 1899 | Ga0496112_0525563 | |||
| 1900 | Ga0496113_0026191 | |||
| 1901 | Ga0496113_0199367 | |||
| 1902 | Ga0496114_0043870 | |||
| 1903 | Ga0496114_0314240 | |||
| 1904 | Ga0496114_0319810 | |||
| 1905 | Ga0496114_0394090 | |||
| 1906 | Ga0496115_0025874 | |||
| 1907 | Ga0496115_0026963 | |||
| 1908 | Ga0496115_0232569 | |||
| 1909 | Ga0496116_0005902 | |||
| 1910 | Ga0496118_0017640 | |||
| 1911 | Ga0496118_0018267 | |||
| 1912 | Ga0496118_0030143 | |||
| 1913 | Ga0496119_0135845 | |||
| 1914 | Ga0496120_0072379 | |||
| 1915 | Ga0496121_0008659 | |||
| 1916 | Ga0496121_0018301 | |||
| 1917 | Ga0496121_0040068 | |||
| 1918 | Ga0496121_0119074 | |||
| 1919 | Ga0496123_0102813 | |||
| 1920 | Ga0496124_0009222 | |||
| 1921 | Ga0496125_0000099 | |||
| 1922 | Ga0496125_0004213 | |||
| 1923 | Ga0496125_0007383 | |||
| 1924 | Ga0496125_0051008 | |||
| 1925 | Ga0496125_0071950 | |||
| 1926 | Ga0496126_0020239 | |||
| 1927 | Ga0496126_0060859 | |||
| 1928 | Ga0496126_0086590 | |||
| 1929 | Ga0496126_0199483 | |||
| 1930 | Ga0496126_0295711 | |||
| 1931 | Ga0496126_0347728 | |||
| 1932 | Ga0495682_0069480 | |||
| 1933 | Ga0501036_0011182 | |||
| 1934 | Ga0501038_0029094 | |||
| 1935 | Ga0501040_0060914 | |||
| 1936 | Ga0501041_0024261 | |||
| 1937 | Ga0501047_0003837 | |||
| 1938 | Ga0501047_0013032 | |||
| 1939 | Ga0501068_0157910 | |||
| 1940 | Ga0501071_0069071 | |||
| 1941 | Ga0501072_0067598 | |||
| 1942 | Ga0501073_0006350 | |||
| 1943 | Ga0501075_0000021 | |||
| 1944 | Ga0501076_0000070 | |||
| 1945 | Ga0501077_0101368 | |||
| 1946 | Ga0501077_0169623 | |||
| 1947 | Ga0501077_0223160 | |||
| 1948 | Ga0501080_0025522 | |||
| 1949 | Ga0501080_0121729 | |||
| 1950 | Ga0501081_0007271 | |||
| 1951 | Ga0501081_0058954 | |||
| 1952 | Ga0501083_0008206 | |||
| 1953 | Ga0501083_0115603 | |||
| 1954 | Ga0501044_0012923 | |||
| 1955 | Ga0501044_0019733 | |||
| 1956 | Ga0501044_0024908 | |||
| 1957 | nmdc:mga03683_11274_c1 | |||
| 1958 | nmdc:mga03683_1348_c1 | |||
| 1959 | nmdc:mga03683_7273_c1 | |||
| 1960 | nmdc:mga03n38_4669_c1 | |||
| 1961 | nmdc:mga03n38_50005_c1 | |||
| 1962 | nmdc:mga00v17_2774_c2 | |||
| 1963 | nmdc:mga00v17_74975_c1 | |||
| 1964 | nmdc:mga00v17_8048_c1 | |||
| 1965 | nmdc:mga0yw44_111149_c1 | |||
| 1966 | nmdc:mga0yw44_14847_c1 | |||
| 1967 | nmdc:mga0yw44_38117_c1 | |||
| 1968 | nmdc:mga0yw44_61057_c1 | |||
| 1969 | nmdc:mga0yw44_66216_c1 | |||
| 1970 | nmdc:mga0k408_62446_c1 | |||
| 1971 | nmdc:mga0k408_8709_c1 | |||
| 1972 | nmdc:mga06z11_11396_c1 | |||
| 1973 | nmdc:mga06z11_11953_c1 | |||
| 1974 | nmdc:mga06z11_1471_c1 | |||
| 1975 | nmdc:mga06z11_200988_c1 | |||
| 1976 | nmdc:mga06z11_28496_c1 | |||
| 1977 | nmdc:mga06z11_6700_c1 | |||
| 1978 | nmdc:mga06z11_75136_c1 | |||
| 1979 | nmdc:mga06z11_88105_c1 | |||
| 1980 | nmdc:mga04h51_13363_c1 | |||
| 1981 | nmdc:mga04h51_21905_c1 | |||
| 1982 | nmdc:mga04h51_3038_c1 | |||
| 1983 | nmdc:mga07m45_19228_c1 | |||
| 1984 | nmdc:mga07m45_31253_c1 | |||
| 1985 | nmdc:mga07m45_58102_c1 | |||
| 1986 | nmdc:mga07m45_63417_c1 | |||
| 1987 | nmdc:mga05p37_365781_c1 | |||
| 1988 | nmdc:mga06r32_125085_c1 | |||
| 1989 | nmdc:mga08y16_1102_c1 | |||
| 1990 | nmdc:mga08y16_156751_c1 | |||
| 1991 | nmdc:mga08y16_18538_c1 | |||
| 1992 | nmdc:mga08y16_246129_c1 | |||
| 1993 | nmdc:mga08y16_522386_c1 | |||
| 1994 | nmdc:mga0n895_22807_c1 | |||
| 1995 | nmdc:mga0n895_3720_c1 | |||
| 1996 | nmdc:mga0rr50_34020_c1 | |||
| 1997 | nmdc:mga0rr50_76248_c1 | |||
| 1998 | nmdc:mga08x19_10922_c1 | |||
| 1999 | nmdc:mga08x19_234460_c1 | |||
| 2000 | nmdc:mga08x19_41071_c1 | |||
| 2001 | nmdc:mga0a205_488180_c1 | |||
| 2002 | nmdc:mga0sz30_12388_c1 | |||
| 2003 | Ga0495601_0001037 | |||
| 2004 | Ga0495601_0266999 | |||
| 2005 | Ga0495612_0030096 | |||
| 2006 | Ga0495655_0010393 | |||
| 2007 | Ga0495595_0044491 | |||
| 2008 | Ga0495619_0003331 | |||
| 2009 | Ga0495619_0009743 | |||
| 2010 | Ga0495619_0038726 | |||
| 2011 | Ga0500578_0082765 | |||
| 2012 | Ga0500647_0016038 | |||
| 2013 | Ga0500647_0023286 | |||
| 2014 | Ga0500651_0030239 | |||
| 2015 | Ga0500651_0066248 | |||
| 2016 | Ga0500566_0000097 | |||
| 2017 | Ga0500566_0000422 | |||
| 2018 | Ga0500641_0012123 | |||
| 2019 | Ga0500641_0034453 | |||
| 2020 | Ga0500641_0113167 | |||
| 2021 | Ga0500650_0014093 | |||
| 2022 | Ga0500554_020777 | |||
| 2023 | Ga0500556_0000045 | |||
| 2024 | Ga0500562_011206 | |||
| 2025 | Ga0500572_000375 | |||
| 2026 | Ga0500593_085577 | |||
| 2027 | Ga0500595_000467 | |||
| 2028 | Ga0500595_003181 | |||
| 2029 | Ga0500595_008173 | |||
| 2030 | Ga0500595_014078 | |||
| 2031 | Ga0500595_014515 | |||
| 2032 | Ga0500607_083825 | |||
| 2033 | Ga0500608_010599 | |||
| 2034 | Ga0500608_071849 | |||
| 2035 | Ga0500614_030577 | |||
| 2036 | Ga0500642_0000024 | |||
| 2037 | Ga0500642_0006124 | |||
| 2038 | Ga0500642_0056077 | |||
| 2039 | Ga0500652_069113 | |||
| 2040 | Ga0500559_0000051 | |||
| 2041 | Ga0500559_0000553 | |||
| 2042 | Ga0500568_0003653 | |||
| 2043 | Ga0500568_0063626 | |||
| 2044 | Ga0500577_0018255 | |||
| 2045 | Ga0500588_0071183 | |||
| 2046 | Ga0500603_000285 | |||
| 2047 | Ga0500603_000511 | |||
| 2048 | Ga0500604_0031281 | |||
| 2049 | Ga0500616_0000002 | |||
| 2050 | Ga0500616_0000054 | |||
| 2051 | Ga0500616_0036200 | |||
| 2052 | Ga0500622_0004533 | |||
| 2053 | Ga0500627_0054820 | |||
| 2054 | Ga0500630_009189 | |||
| 2055 | Ga0500633_0007617 | |||
| 2056 | Ga0500638_016255 | |||
| 2057 | Ga0500638_033937 | |||
| 2058 | Ga0500639_019063 | |||
| 2059 | Ga0500636_0009532 | |||
| 2060 | Ga0500637_0000660 | |||
| 2061 | Ga0500637_0000984 | |||
| 2062 | Ga0500567_084559 | |||
| 2063 | Ga0500645_001737 | |||
| 2064 | Ga0500552_008246 | |||
| 2065 | Ga0501084_0021469 | |||
| 2066 | Ga0501084_0087962 | |||
| 2067 | Ga0500661_000043 | |||
| 2068 | Ga0587076_013563 | |||
| 2069 | Ga0501082_0016934 | |||
| 2070 | Ga0501082_0034247 | |||
| 2071 | Ga0530510_0000012 | |||
| 2072 | Ga0530510_0011559 | |||
| 2073 | 2513693610 | |||
| 2074 | 2513888433 | |||
| 2075 | 2603860563 | |||
| 2076 | 2723847510 | |||
| 2077 | 2793081334 | |||
| 2078 | 2841916019 | |||
| 2079 | 2841921601 | |||
| 2080 | 2844317352 | |||
| 2081 | 2857525519 | |||
| 2082 | 2874611471 | |||
| 2083 | 2876817066 | |||
| 2084 | 2879117549 | |||
| 2085 | 2885389481 | |||
| 2086 | 2889042264 | |||
| 2087 | 2893070759 | |||
| 2088 | 2903733262 | |||
| 2089 | 2903757236 | |||
| 2090 | 2906606228 | |||
| 2091 | 2908744623 | |||
| 2092 | 2908762220 | |||
| 2093 | 2919074672 | |||
| 2094 | 2919706538 | |||
| 2095 | 2922362922 | |||
| 2096 | 2922428207 | |||
| 2097 | 2935631894 | |||
| 2098 | 2935963626 | |||
| 2099 | 2941507842 | |||
| 2100 | 2941515653 | |||
| 2101 | 2941523772 | |||
| 2102 | 2941535166 | |||
| 2103 | 3005478192 | |||
| 2104 | 3005597050 | |||
| 2105 | 3005713114 | |||
| 2106 | 3005720481 | |||
| 2107 | 8006970168 | |||
| 2108 | 8006985456 | |||
| 2109 | 8006994495 | |||
| 2110 | 8019558866 | |||
| 2111 | 8019566443 | |||
| 2112 | 8056681227 | |||
| 2113 | 8056694424 | |||
| 2114 | 8056971937 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xfe-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d-glucuronate | 0.99 | 30 | 329 |
| 4x04-assembly1.cif.gz_D | crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d-glucuronate | 0.9841 | 30 | 328 |
| 4x8r-assembly2.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate | 0.9735 | 31 | 328 |
| 4n8y-assembly2.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate | 0.9713 | 30 | 328 |
| 4ovr-assembly2.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d-galacturonate | 0.97 | 32 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n8yB00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9713 | 30 | 328 | 3.40.190.170 |
| 4x8rB00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9706 | 31 | 328 | 3.40.190.170 |
| 4n8yB00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9618 | 30 | 328 | 3.40.190.170 |
| af_P37676_23_328_3.40.190.170 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9591 | 29 | 328 | 3.40.190.170 |
| 4pf8A00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9546 | 32 | 324 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656JY05-F1-model_v4 | TRAP dicarboxylate transporter subunit DctP | 0.992 | 108 | 284 |
GO:0030246
GO:0055085 |
| AF-A0A6D0EIF7-F1-model_v4 | deleted | 0.9871 | 28 | 328 |
|
| AF-A0A1I7FN40-F1-model_v4 | Tripartite ATP-independent transporter solute receptor, DctP family | 0.9866 | 30 | 329 |
GO:0030246
GO:0030288 GO:0055085 |
| AF-A0A519ME77-F1-model_v4 | TRAP transporter substrate-binding protein | 0.977 | 32 | 329 |
GO:0030246
GO:0030288 GO:0055085 |
| AF-A0A1I7FN40-F1-model_v4 | Tripartite ATP-independent transporter solute receptor, DctP family | 0.9768 | 30 | 329 |
GO:0030246
GO:0030288 GO:0055085 |