F489202

General Info

Members Datasets Scaffolds Average Seq Length
1057 420 2114 255

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10160971|Ga0105238_101609712
Length 282
Sequence VGGCPPDRDHLDSRSARPGDDKVWGNFMAKGHKDKVAVITGAAGGIGQAFARRLAEDGVHVAIADLSDGAATVKMVQAAGREAIAVKCDVSSEDSVAALAKEVNAKFSHVDIVVNCAGIFPQKDFSEMTFADWRKVLSINLDGTFLVTAAFVPGMRARKWGRVVNMASSTLGSVVTGFAHYVASKGGIVGFTRALATDLAGDGITVNAIAPGLTRSPGTVVRAPRPTFKTMDEEFEAVAQMQAIKRVEVPDDLVGAISFLTSDDASFITGQTLNVDGGRVRS

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
235 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
239 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
240 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
254 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
259 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
272 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
273 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
274 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
275 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
276 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
277 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
278 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
279 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
280 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
281 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
282 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
333 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
405 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
408 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
409 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
410 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
411 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
412 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
413 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
414 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
415 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
419 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
420 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.09
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 8.42
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10160971 3300009551 Bacteria 2220
2 ARcpr5oldR_c000008 3300000041 Bacteria 40651
3 ARSoilYngRDRAFT_c00170 3300000042 Bacteria 11114
4 ARcpr5yngRDRAFT_c000152 3300000043 Bacteria 11173
5 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
6 ARCol0oldRDRAFT_c00123 3300000045 Bacteria 6884
7 ARCol0yngRDRAFT_1000172 3300000652 Bacteria 11045
8 JGI24739J22299_10002554 3300001989 Bacteria 7020
9 JGI24737J22298_10000781 3300001990 Bacteria 11263
10 JGI24737J22298_10010031 3300001990 Bacteria 3136
11 JGI24738J21930_10000064 3300002075 Bacteria 22266
12 JGI24035J26624_1000003 3300002126 Bacteria 16650
13 JGI24034J26672_10000179 3300002239 Bacteria 8708
14 JGI24742J22300_10000052 3300002244 Bacteria 17010
15 JGI24751J29686_10005666 3300002459 Bacteria 2544
16 JGI25153J46596_10001534 3300003215 Bacteria 13705
17 Ga0065704_10002758 3300005289 Bacteria 4914
18 Ga0065712_10076040 3300005290 Bacteria 3744
19 Ga0065712_10098531 3300005290 Bacteria 2116
20 Ga0065715_10001538 3300005293 Bacteria 10123
21 Ga0065715_10169460 3300005293 Bacteria 1559
22 Ga0065707_10268990 3300005295 Bacteria 1076
23 Ga0070676_10000449 3300005328 Bacteria 19642
24 Ga0070683_100209776 3300005329 Bacteria 1850
25 Ga0070690_100000670 3300005330 Bacteria 17462
26 Ga0070690_100201569 3300005330 Bacteria 1385
27 Ga0070690_100265063 3300005330 Bacteria 1220
28 Ga0070690_100269480 3300005330 Bacteria 1211
29 Ga0070670_100002498 3300005331 Bacteria 15168
30 Ga0070677_10000651 3300005333 Bacteria 11608
31 Ga0068869_100049914 3300005334 Bacteria 3031
32 Ga0070666_10005435 3300005335 Bacteria 7812
33 Ga0070666_10055057 3300005335 Bacteria 2684
34 Ga0070680_100075832 3300005336 Bacteria 2768
35 Ga0070680_100117896 3300005336 Bacteria 2214
36 Ga0070680_100162887 3300005336 Bacteria 1874
37 Ga0070682_100011539 3300005337 Bacteria 5052
38 Ga0070682_100134080 3300005337 Bacteria 1680
39 Ga0068868_100005589 3300005338 Bacteria 8840
40 Ga0070660_100027690 3300005339 Bacteria 4232
41 Ga0070660_100033054 3300005339 Bacteria 3896
42 Ga0070689_100000270 3300005340 Bacteria 30009
43 Ga0070689_100003632 3300005340 Bacteria 10290
44 Ga0070689_100016370 3300005340 Bacteria 5426
45 Ga0070689_100026944 3300005340 Bacteria 4331
46 Ga0070689_100290204 3300005340 Bacteria 1359
47 Ga0070691_10000446 3300005341 Bacteria 15275
48 Ga0070691_10017126 3300005341 Bacteria 3335
49 Ga0070691_10053564 3300005341 Bacteria 1930
50 Ga0070687_100000211 3300005343 Bacteria 20314
51 Ga0070687_100056512 3300005343 Bacteria 2053
52 Ga0070661_100000642 3300005344 Bacteria 25881
53 Ga0070692_10061367 3300005345 Bacteria 1981
54 Ga0070668_100559006 3300005347 Unclassified 997
55 Ga0070668_100677934 3300005347 Bacteria 907
56 Ga0070669_100010124 3300005353 Bacteria 6707
57 Ga0070675_100073059 3300005354 Bacteria 2847
58 Ga0070671_100002503 3300005355 Bacteria 14229
59 Ga0070674_100004794 3300005356 Bacteria 7748
60 Ga0070674_100014229 3300005356 Bacteria 4942
61 Ga0070674_100142533 3300005356 Bacteria 1800
62 Ga0070673_100001089 3300005364 Bacteria 15535
63 Ga0070673_100021948 3300005364 Bacteria 4639
64 Ga0070673_100051488 3300005364 Bacteria 3225
65 Ga0070688_100000288 3300005365 Bacteria 25809
66 Ga0070688_100003398 3300005365 Bacteria 8176
67 Ga0070688_100107833 3300005365 Bacteria 1847
68 Ga0070688_100124677 3300005365 Bacteria 1730
69 Ga0070667_100022673 3300005367 Bacteria 5206
70 Ga0070667_100076926 3300005367 Bacteria 2849
71 Ga0070667_100221122 3300005367 Bacteria 1686
72 Ga0070709_10009286 3300005434 Bacteria 5419
73 Ga0070709_10157101 3300005434 Bacteria 1577
74 Ga0070714_100015452 3300005435 Bacteria 6143
75 Ga0070714_100268166 3300005435 Bacteria 1582
76 Ga0070713_100001029 3300005436 Bacteria 17824
77 Ga0070713_100007302 3300005436 Bacteria 7738
78 Ga0070713_100089481 3300005436 Bacteria 2644
79 Ga0070713_100200846 3300005436 Bacteria 1800
80 Ga0070710_10048048 3300005437 Bacteria 2382
81 Ga0070710_10049988 3300005437 Bacteria 2341
82 Ga0070710_10113377 3300005437 Bacteria 1631
83 Ga0070710_10114412 3300005437 Bacteria 1625
84 Ga0070710_10403158 3300005437 Bacteria 917
85 Ga0070701_10000069 3300005438 Bacteria 27989
86 Ga0070711_100064384 3300005439 Bacteria 2562
87 Ga0070711_100216889 3300005439 Bacteria 1485
88 Ga0070711_100375279 3300005439 Bacteria 1148
89 Ga0070705_100002117 3300005440 Bacteria 10108
90 Ga0070705_100014222 3300005440 Bacteria 4090
91 Ga0070700_100074336 3300005441 Bacteria 2177
92 Ga0070700_100103892 3300005441 Bacteria 1877
93 Ga0070700_100112520 3300005441 Bacteria 1812
94 Ga0070708_100173847 3300005445 Bacteria 2012
95 Ga0070663_100008152 3300005455 Bacteria 6426
96 Ga0070663_100040563 3300005455 Bacteria 3260
97 Ga0070663_100116801 3300005455 Bacteria 2011
98 Ga0070678_100023591 3300005456 Bacteria 4102
99 Ga0070678_100113115 3300005456 Bacteria 2127
100 Ga0070662_100057158 3300005457 Bacteria 2834
101 Ga0070662_100189192 3300005457 Bacteria 1627
102 Ga0070681_10006773 3300005458 Bacteria 11154
103 Ga0070681_10030347 3300005458 Bacteria 5424
104 Ga0070681_10144979 3300005458 Bacteria 2304
105 Ga0068867_100003827 3300005459 Bacteria 10576
106 Ga0068867_100048713 3300005459 Bacteria 3118
107 Ga0070685_10001066 3300005466 Bacteria 14712
108 Ga0070685_10010683 3300005466 Bacteria 4778
109 Ga0070685_10419467 3300005466 Bacteria 931
110 Ga0070707_100181158 3300005468 Bacteria 2054
111 Ga0070699_100333566 3300005518 Unclassified 1364
112 Ga0070679_100251411 3300005530 Bacteria 1724
113 Ga0070679_100577671 3300005530 Bacteria 1067
114 Ga0070684_100003138 3300005535 Bacteria 12335
115 Ga0070684_100309145 3300005535 Bacteria 1451
116 Ga0068853_100001831 3300005539 Bacteria 15636
117 Ga0070672_100000546 3300005543 Bacteria 22105
118 Ga0070672_100068334 3300005543 Bacteria 2818
119 Ga0070672_100126920 3300005543 Bacteria 2093
120 Ga0070686_100001242 3300005544 Bacteria 14478
121 Ga0070686_100060198 3300005544 Bacteria 2449
122 Ga0070686_100109624 3300005544 Bacteria 1878
123 Ga0070686_100164060 3300005544 Bacteria 1567
124 Ga0070686_100206925 3300005544 Bacteria 1410
125 Ga0070695_100004462 3300005545 Bacteria 8222
126 Ga0070695_100259951 3300005545 Bacteria 1267
127 Ga0070696_100190102 3300005546 Bacteria 1528
128 Ga0070696_100261075 3300005546 Bacteria 1313
129 Ga0070696_100322220 3300005546 Bacteria 1190
130 Ga0070696_100422743 3300005546 Bacteria 1047
131 Ga0070693_100012264 3300005547 Bacteria 4335
132 Ga0070693_100015493 3300005547 Bacteria 3927
133 Ga0070693_100087024 3300005547 Bacteria 1876
134 Ga0070665_100114728 3300005548 Bacteria 2696
135 Ga0070665_100245355 3300005548 Bacteria 1791
136 Ga0070704_100074296 3300005549 Bacteria 2479
137 Ga0068855_100149814 3300005563 Bacteria 2653
138 Ga0068855_100222171 3300005563 Bacteria 2117
139 Ga0070664_100122138 3300005564 Bacteria 2281
140 Ga0068854_100063460 3300005578 Bacteria 2682
141 Ga0068856_100059506 3300005614 Bacteria 3773
142 Ga0070702_100017944 3300005615 Bacteria 3660
143 Ga0070702_100037599 3300005615 Bacteria 2689
144 Ga0070702_100065842 3300005615 Bacteria 2123
145 Ga0068852_100013641 3300005616 Bacteria 6223
146 Ga0068859_100001888 3300005617 Bacteria 21352
147 Ga0068859_100087315 3300005617 Bacteria 3167
148 Ga0068859_100279963 3300005617 Bacteria 1761
149 Ga0068864_100000756 3300005618 Bacteria 27190
150 Ga0068864_100044294 3300005618 Bacteria 3813
151 Ga0068866_10002380 3300005718 Bacteria 7798
152 Ga0068861_100008028 3300005719 Bacteria 7261
153 Ga0068861_100055029 3300005719 Bacteria 3033
154 Ga0068861_100318327 3300005719 Bacteria 1354
155 Ga0068851_10025383 3300005834 Bacteria 2907
156 Ga0068870_10000946 3300005840 Bacteria 11387
157 Ga0068863_100002620 3300005841 Bacteria 17829
158 Ga0068863_100458830 3300005841 Bacteria 1251
159 Ga0068858_100003321 3300005842 Bacteria 16019
160 Ga0068858_100137583 3300005842 Bacteria 2292
161 Ga0068860_100056400 3300005843 Bacteria 3735
162 Ga0068860_100227594 3300005843 Bacteria 1812
163 Ga0068860_100393079 3300005843 Bacteria 1370
164 Ga0068860_100689551 3300005843 Bacteria 1031
165 Ga0068860_100699128 3300005843 Bacteria 1023
166 Ga0068862_100106693 3300005844 Bacteria 2456
167 Ga0081455_10000002 3300005937 Bacteria 460472
168 Ga0081455_10023181 3300005937 Bacteria 5782
169 Ga0081455_10071658 3300005937 Bacteria 2872
170 Ga0081540_1015680 3300005983 Bacteria 4783
171 Ga0070717_10001350 3300006028 Bacteria 16869
172 Ga0070717_10261478 3300006028 Bacteria 1531
173 Ga0075365_10328233 3300006038 Bacteria 1078
174 Ga0075365_10430488 3300006038 Bacteria 932
175 Ga0075363_100298706 3300006048 Bacteria 934
176 Ga0075364_10234810 3300006051 Bacteria 1245
177 Ga0075432_10023329 3300006058 Bacteria 2119
178 Ga0070715_10066390 3300006163 Bacteria 1599
179 Ga0070716_100114858 3300006173 Bacteria 1675
180 Ga0070716_100186558 3300006173 Bacteria 1366
181 Ga0070712_100093831 3300006175 Bacteria 2204
182 Ga0070712_100376557 3300006175 Bacteria 1168
183 Ga0070712_100377362 3300006175 Bacteria 1166
184 Ga0075367_10034696 3300006178 Bacteria 2916
185 Ga0075367_10036510 3300006178 Bacteria 2850
186 Ga0075367_10079230 3300006178 Bacteria 1985
187 Ga0075367_10079889 3300006178 Bacteria 1977
188 Ga0075367_10147459 3300006178 Bacteria 1459
189 Ga0075427_10000124 3300006194 Bacteria 6888
190 Ga0075366_10006199 3300006195 Bacteria 6527
191 Ga0075366_10044597 3300006195 Bacteria 2628
192 Ga0097621_100001960 3300006237 Bacteria 14039
193 Ga0097621_100056292 3300006237 Bacteria 3212
194 Ga0068871_100000443 3300006358 Bacteria 28545
195 Ga0068871_100003970 3300006358 Bacteria 10218
196 Ga0068871_100032465 3300006358 Bacteria 4125
197 Ga0075428_100001993 3300006844 Bacteria 22014
198 Ga0075428_100108391 3300006844 Bacteria 3027
199 Ga0075430_100001036 3300006846 Bacteria 21971
200 Ga0075430_100001212 3300006846 Bacteria 20739
201 Ga0075430_100001234 3300006846 Bacteria 20572
202 Ga0075430_100001401 3300006846 Bacteria 19600
203 Ga0075430_100002889 3300006846 Bacteria 14385
204 Ga0075430_100020954 3300006846 Bacteria 5557
205 Ga0075430_100060941 3300006846 Bacteria 3171
206 Ga0075431_100004308 3300006847 Bacteria 13946
207 Ga0075431_100522540 3300006847 Bacteria 1176
208 Ga0075433_10000231 3300006852 Bacteria 31958
209 Ga0075433_10083977 3300006852 Bacteria 2811
210 Ga0075434_100000271 3300006871 Bacteria 36857
211 Ga0075434_100015400 3300006871 Bacteria 7329
212 Ga0075434_100137581 3300006871 Bacteria 2462
213 Ga0075434_100164590 3300006871 Bacteria 2238
214 Ga0075434_100169058 3300006871 Bacteria 2206
215 Ga0075434_100409772 3300006871 Bacteria 1377
216 Ga0075429_100003189 3300006880 Bacteria 13946
217 Ga0075429_100044202 3300006880 Bacteria 3875
218 Ga0075429_100426131 3300006880 Bacteria 1162
219 Ga0068865_100065756 3300006881 Bacteria 2556
220 Ga0068865_100206072 3300006881 Bacteria 1530
221 Ga0075436_100318703 3300006914 Bacteria 1117
222 Ga0075436_100397801 3300006914 Bacteria 998
223 Ga0097620_100001888 3300006931 Bacteria 21352
224 Ga0097620_100087318 3300006931 Bacteria 3167
225 Ga0097620_100279946 3300006931 Bacteria 1761
226 Ga0075435_100003631 3300007076 Bacteria 10504
227 Ga0075435_100152449 3300007076 Bacteria 1944
228 Ga0075435_100239259 3300007076 Bacteria 1544
229 Ga0075435_100361959 3300007076 Bacteria 1244
230 Ga0105251_10075569 3300009011 Bacteria 1564
231 Ga0105244_10160577 3300009036 Bacteria 1073
232 Ga0105240_10121417 3300009093 Bacteria 3146
233 Ga0105240_10465691 3300009093 Bacteria 1411
234 Ga0111539_10001391 3300009094 Bacteria 32180
235 Ga0111539_10002666 3300009094 Bacteria 23636
236 Ga0111539_10011778 3300009094 Bacteria 10964
237 Ga0111539_10041685 3300009094 Bacteria 5517
238 Ga0111539_10068770 3300009094 Bacteria 4181
239 Ga0105245_10028914 3300009098 Bacteria 4893
240 Ga0105245_10031665 3300009098 Bacteria 4681
241 Ga0105245_10196650 3300009098 Bacteria 1934
242 Ga0105245_10340992 3300009098 Bacteria 1482
243 Ga0105245_10420733 3300009098 Bacteria 1339
244 Ga0105247_10002444 3300009101 Bacteria 12635
245 Ga0105247_10006559 3300009101 Bacteria 7196
246 Ga0105247_10026832 3300009101 Bacteria 3481
247 Ga0114129_10006834 3300009147 Bacteria 16211
248 Ga0114129_10031007 3300009147 Bacteria 7562
249 Ga0105243_10018909 3300009148 Bacteria 5224
250 Ga0105243_10097166 3300009148 Bacteria 2438
251 Ga0105243_10223036 3300009148 Bacteria 1667
252 Ga0105243_10358009 3300009148 Bacteria 1342
253 Ga0105243_10593591 3300009148 Bacteria 1065
254 Ga0105241_10008877 3300009174 Bacteria 7394
255 Ga0105241_10024212 3300009174 Bacteria 4508
256 Ga0105241_10057628 3300009174 Bacteria 2981
257 Ga0105241_10506351 3300009174 Bacteria 1077
258 Ga0105242_10029260 3300009176 Bacteria 4392
259 Ga0105242_10067974 3300009176 Plasmid 2947
260 Ga0105242_10092583 3300009176 Bacteria 2547
261 Ga0105242_10142189 3300009176 Bacteria 2083
262 Ga0105248_10003359 3300009177 Bacteria 17784
263 Ga0105248_10046907 3300009177 Bacteria 4845
264 Ga0105248_10053410 3300009177 Bacteria 4534
265 Ga0105248_10085000 3300009177 Bacteria 3560
266 Ga0105248_10092497 3300009177 Bacteria 3406
267 Ga0105248_10866089 3300009177 Bacteria 1020
268 Ga0105237_10118774 3300009545 Bacteria 2638
269 Ga0105237_10207466 3300009545 Bacteria 1960
270 Ga0105238_10093664 3300009551 Bacteria 2992
271 Ga0105238_10311092 3300009551 Bacteria 1560
272 Ga0105249_10058734 3300009553 Bacteria 3526
273 Ga0105249_10306742 3300009553 Unclassified 1594
274 Ga0105239_10068260 3300010375 Bacteria 3907
275 Ga0105239_10643689 3300010375 Bacteria 1210
276 Ga0105246_10011703 3300011119 Bacteria 5452
277 Ga0105246_10061553 3300011119 Bacteria 2612
278 Ga0105246_10155259 3300011119 Bacteria 1737
279 Ga0157342_1000261 3300012507 Bacteria 2932
280 Ga0157370_10015185 3300013104 Bacteria 7843
281 Ga0157370_10203222 3300013104 Bacteria 1838
282 Ga0157369_10246042 3300013105 Bacteria 1867
283 Ga0157374_10036560 3300013296 Bacteria 4499
284 Ga0157374_10055041 3300013296 Bacteria 3712
285 Ga0157378_10044464 3300013297 Bacteria 3944
286 Ga0157378_10667043 3300013297 Bacteria 1057
287 Ga0163162_10134460 3300013306 Bacteria 2583
288 Ga0163162_10205606 3300013306 Bacteria 2098
289 Ga0163162_10320401 3300013306 Bacteria 1683
290 Ga0157372_10019847 3300013307 Bacteria 7242
291 Ga0157372_10157813 3300013307 Bacteria 2621
292 Ga0157372_10569154 3300013307 Bacteria 1321
293 Ga0157375_10051725 3300013308 Bacteria 4036
294 Ga0157375_10061780 3300013308 Bacteria 3721
295 Ga0157375_10074094 3300013308 Bacteria 3424
296 Ga0157375_10121010 3300013308 Bacteria 2727
297 Ga0157375_10437848 3300013308 Bacteria 1473
298 Ga0163163_10038545 3300014325 Bacteria 4659
299 Ga0163163_10053639 3300014325 Bacteria 3980
300 Ga0157380_10075434 3300014326 Bacteria 2740
301 Ga0157380_10134839 3300014326 Bacteria 2112
302 Ga0157380_10237040 3300014326 Bacteria 1642
303 Ga0157380_10283496 3300014326 Bacteria 1517
304 Ga0157380_10842916 3300014326 Bacteria 938
305 Ga0182008_10025921 3300014497 Bacteria 2974
306 Ga0157379_10000836 3300014968 Bacteria 24921
307 Ga0157379_10039347 3300014968 Bacteria 4218
308 Ga0157379_10048344 3300014968 Bacteria 3796
309 Ga0157379_10506292 3300014968 Bacteria 1120
310 Ga0157379_10546068 3300014968 Bacteria 1078
311 Ga0157376_10025740 3300014969 Bacteria 4637
312 Ga0157376_10096060 3300014969 Bacteria 2578
313 Ga0157376_10190334 3300014969 Bacteria 1881
314 Ga0206353_10283231 3300020082 Bacteria 1382
315 Ga0213876_10024089 3300021384 Bacteria 3214
316 Ga0224572_1008822 3300024225 Bacteria 1871
317 Ga0207666_1000023 3300025271 Bacteria 37093
318 Ga0207666_1000703 3300025271 Bacteria 4014
319 Ga0207673_1000096 3300025290 Bacteria 7770
320 Ga0209758_1000469 3300025297 Bacteria 66568
321 Ga0209758_1013194 3300025297 Bacteria 4537
322 Ga0207697_10000627 3300025315 Bacteria 20084
323 Ga0207697_10076958 3300025315 Bacteria 1403
324 Ga0207656_10055069 3300025321 Bacteria 1730
325 Ga0207653_10002616 3300025885 Bacteria 5715
326 Ga0207682_10000011 3300025893 Bacteria 85533
327 Ga0207692_10138403 3300025898 Bacteria 1382
328 Ga0207642_10200275 3300025899 Bacteria 1102
329 Ga0207710_10022883 3300025900 Bacteria 2682
330 Ga0207688_10000212 3300025901 Bacteria 25999
331 Ga0207688_10226994 3300025901 Bacteria 1126
332 Ga0207680_10002872 3300025903 Bacteria 8068
333 Ga0207680_10009784 3300025903 Bacteria 4771
334 Ga0207680_10011476 3300025903 Bacteria 4479
335 Ga0207647_10011482 3300025904 Bacteria 6210
336 Ga0207647_10265665 3300025904 Bacteria 982
337 Ga0207685_10002484 3300025905 Bacteria 4242
338 Ga0207685_10011029 3300025905 Bacteria 2699
339 Ga0207699_10046026 3300025906 Bacteria 2549
340 Ga0207699_10048513 3300025906 Bacteria 2495
341 Ga0207645_10002046 3300025907 Bacteria 16168
342 Ga0207645_10016084 3300025907 Bacteria 4954
343 Ga0207645_10051736 3300025907 Bacteria 2624
344 Ga0207643_10003537 3300025908 Bacteria 8409
345 Ga0207654_10231793 3300025911 Bacteria 1230
346 Ga0207707_10156030 3300025912 Bacteria 1996
347 Ga0207707_10243690 3300025912 Bacteria 1562
348 Ga0207707_10510379 3300025912 Unclassified 1025
349 Ga0207671_10145020 3300025914 Bacteria 1831
350 Ga0207693_10001510 3300025915 Bacteria 20547
351 Ga0207693_10007846 3300025915 Bacteria 8763
352 Ga0207693_10149863 3300025915 Bacteria 1834
353 Ga0207663_10011095 3300025916 Bacteria 4825
354 Ga0207663_10026370 3300025916 Bacteria 3372
355 Ga0207663_10029293 3300025916 Bacteria 3232
356 Ga0207663_10060805 3300025916 Unclassified 2395
357 Ga0207663_10147729 3300025916 Bacteria 1645
358 Ga0207660_10001331 3300025917 Bacteria 16522
359 Ga0207660_10041878 3300025917 Bacteria 3212
360 Ga0207660_10090345 3300025917 Bacteria 2269
361 Ga0207660_10394341 3300025917 Bacteria 1114
362 Ga0207662_10000370 3300025918 Bacteria 20235
363 Ga0207662_10040020 3300025918 Bacteria 2753
364 Ga0207662_10048451 3300025918 Bacteria 2517
365 Ga0207662_10081911 3300025918 Bacteria 1971
366 Ga0207662_10245452 3300025918 Bacteria 1173
367 Ga0207657_10003563 3300025919 Bacteria 16610
368 Ga0207657_10020389 3300025919 Bacteria 6265
369 Ga0207657_10023586 3300025919 Bacteria 5725
370 Ga0207694_10373956 3300025924 Unclassified 1182
371 Ga0207650_10052664 3300025925 Bacteria 3015
372 Ga0207650_10147926 3300025925 Bacteria 1851
373 Ga0207659_10000028 3300025926 Bacteria 130804
374 Ga0207659_10069445 3300025926 Bacteria 2566
375 Ga0207659_10100975 3300025926 Bacteria 2175
376 Ga0207687_10004134 3300025927 Bacteria 9720
377 Ga0207687_10042557 3300025927 Bacteria 3126
378 Ga0207687_10061649 3300025927 Bacteria 2649
379 Ga0207687_10346536 3300025927 Bacteria 1209
380 Ga0207700_10000590 3300025928 Bacteria 21178
381 Ga0207700_10132628 3300025928 Bacteria 2036
382 Ga0207700_10254216 3300025928 Bacteria 1502
383 Ga0207664_10423808 3300025929 Bacteria 1186
384 Ga0207644_10006109 3300025931 Bacteria 7852
385 Ga0207690_10000758 3300025932 Bacteria 20840
386 Ga0207706_10004191 3300025933 Bacteria 13575
387 Ga0207706_10064878 3300025933 Bacteria 3215
388 Ga0207706_10096182 3300025933 Unclassified 2604
389 Ga0207706_10357878 3300025933 Bacteria 1268
390 Ga0207686_10004502 3300025934 Bacteria 7466
391 Ga0207686_10082329 3300025934 Bacteria 2104
392 Ga0207686_10174003 3300025934 Bacteria 1521
393 Ga0207709_10124871 3300025935 Bacteria 1744
394 Ga0207709_10165663 3300025935 Bacteria 1546
395 Ga0207670_10000358 3300025936 Bacteria 26775
396 Ga0207670_10052418 3300025936 Bacteria 2743
397 Ga0207670_10226278 3300025936 Bacteria 1434
398 Ga0207670_10421094 3300025936 Bacteria 1071
399 Ga0207670_10511804 3300025936 Bacteria 976
400 Ga0207669_10012840 3300025937 Bacteria 4134
401 Ga0207669_10016340 3300025937 Bacteria 3768
402 Ga0207669_10070612 3300025937 Bacteria 2190
403 Ga0207704_10001593 3300025938 Bacteria 10195
404 Ga0207704_10037420 3300025938 Bacteria 2803
405 Ga0207665_10004996 3300025939 Bacteria 8849
406 Ga0207665_10076827 3300025939 Bacteria 2291
407 Ga0207665_10445308 3300025939 Bacteria 993
408 Ga0207691_10003120 3300025940 Bacteria 16182
409 Ga0207691_10285112 3300025940 Bacteria 1421
410 Ga0207691_10571794 3300025940 Bacteria 958
411 Ga0207711_10003815 3300025941 Bacteria 12963
412 Ga0207711_10011321 3300025941 Bacteria 7410
413 Ga0207711_10029896 3300025941 Bacteria 4595
414 Ga0207711_10209736 3300025941 Bacteria 1779
415 Ga0207711_10481379 3300025941 Bacteria 1156
416 Ga0207689_10002572 3300025942 Bacteria 16806
417 Ga0207689_10022090 3300025942 Bacteria 5351
418 Ga0207661_10025019 3300025944 Bacteria 4533
419 Ga0207661_10139415 3300025944 Bacteria 2086
420 Ga0207679_10000026 3300025945 Bacteria 200073
421 Ga0207679_10032446 3300025945 Bacteria 3666
422 Ga0207667_10120678 3300025949 Bacteria 2701
423 Ga0207651_10000487 3300025960 Bacteria 16704
424 Ga0207712_10001407 3300025961 Bacteria 16410
425 Ga0207668_10000474 3300025972 Bacteria 25172
426 Ga0207668_10033807 3300025972 Bacteria 3390
427 Ga0207668_10472303 3300025972 Bacteria 1074
428 Ga0207668_10648162 3300025972 Bacteria 924
429 Ga0207640_10010302 3300025981 Bacteria 5261
430 Ga0207640_10108903 3300025981 Bacteria 1959
431 Ga0207658_10011216 3300025986 Bacteria 6105
432 Ga0207658_10144371 3300025986 Bacteria 1930
433 Ga0207658_10178968 3300025986 Bacteria 1753
434 Ga0207658_10192792 3300025986 Bacteria 1695
435 Ga0207677_10001084 3300026023 Bacteria 14821
436 Ga0207677_10012758 3300026023 Bacteria 4847
437 Ga0207703_10073479 3300026035 Bacteria 2829
438 Ga0207703_10181091 3300026035 Bacteria 1860
439 Ga0207703_10183525 3300026035 Bacteria 1848
440 Ga0207639_10106561 3300026041 Bacteria 2275
441 Ga0207639_10213131 3300026041 Bacteria 1664
442 Ga0207678_10009141 3300026067 Bacteria 8728
443 Ga0207678_10028553 3300026067 Bacteria 4869
444 Ga0207678_10070433 3300026067 Bacteria 2998
445 Ga0207678_10086479 3300026067 Bacteria 2679
446 Ga0207678_10160242 3300026067 Bacteria 1922
447 Ga0207708_10001391 3300026075 Bacteria 18182
448 Ga0207708_10002206 3300026075 Bacteria 14391
449 Ga0207708_10049977 3300026075 Bacteria 3184
450 Ga0207708_10238382 3300026075 Bacteria 1462
451 Ga0207702_10009283 3300026078 Bacteria 8262
452 Ga0207702_10506606 3300026078 Bacteria 1177
453 Ga0207641_10007214 3300026088 Bacteria 9264
454 Ga0207641_10277390 3300026088 Bacteria 1575
455 Ga0207648_10002405 3300026089 Bacteria 20161
456 Ga0207648_10033311 3300026089 Bacteria 4544
457 Ga0207676_10001364 3300026095 Bacteria 18171
458 Ga0207676_10042727 3300026095 Bacteria 3486
459 Ga0207676_10091959 3300026095 Bacteria 2494
460 Ga0207674_10004931 3300026116 Bacteria 15954
461 Ga0207675_100004770 3300026118 Bacteria 13063
462 Ga0207675_100301568 3300026118 Bacteria 1560
463 Ga0207675_100424161 3300026118 Bacteria 1314
464 Ga0207683_10000034 3300026121 Bacteria 101817
465 Ga0207683_10009986 3300026121 Bacteria 8101
466 Ga0207683_10087706 3300026121 Bacteria 2767
467 Ga0207683_10139729 3300026121 Bacteria 2182
468 Ga0207698_10371970 3300026142 Bacteria 1357
469 Ga0209967_1002937 3300027364 Bacteria 2231
470 Ga0209981_1000449 3300027378 Bacteria 5207
471 Ga0210000_1000242 3300027462 Bacteria 7786
472 Ga0209995_1013080 3300027471 Bacteria 1358
473 Ga0209983_1009445 3300027665 Bacteria 1995
474 Ga0209983_1018033 3300027665 Bacteria 1464
475 Ga0209971_1011217 3300027682 Bacteria 2122
476 Ga0209966_1002165 3300027695 Bacteria 3275
477 Ga0209966_1003074 3300027695 Bacteria 2799
478 Ga0209966_1005605 3300027695 Bacteria 2158
479 Ga0209966_1013971 3300027695 Bacteria 1494
480 Ga0209974_10066311 3300027876 Bacteria 1227
481 Ga0209974_10102865 3300027876 Bacteria 999
482 Ga0207428_10000082 3300027907 Bacteria 133684
483 Ga0207428_10000851 3300027907 Bacteria 34354
484 Ga0207428_10001235 3300027907 Bacteria 27417
485 Ga0207428_10306142 3300027907 Bacteria 1175
486 Ga0265357_1000593 3300028023 Bacteria 2218
487 Ga0268266_10039685 3300028379 Bacteria 4010
488 Ga0268266_10847344 3300028379 Bacteria 883
489 Ga0268265_10001023 3300028380 Bacteria 25231
490 Ga0268265_10064443 3300028380 Bacteria 2823
491 Ga0268264_10001465 3300028381 Bacteria 22046
492 Ga0268264_10073361 3300028381 Bacteria 2904
493 Ga0265337_1000345 3300028556 Bacteria 24838
494 Ga0265338_10024461 3300028800 Bacteria 6168
495 Ga0265325_10000043 3300031241 Bacteria 89158
496 Ga0265325_10002436 3300031241 Bacteria 12563
497 Ga0265325_10005946 3300031241 Bacteria 7475
498 Ga0265325_10007742 3300031241 Bacteria 6400
499 Ga0265325_10136468 3300031241 Bacteria 1170
500 Ga0265325_10136722 3300031241 Bacteria 1169
501 Ga0265339_10000085 3300031249 Bacteria 79483
502 Ga0265339_10017208 3300031249 Bacteria 4285
503 Ga0265331_10015805 3300031250 Bacteria 3976
504 Ga0265313_10000505 3300031595 Bacteria 40966
505 Ga0265313_10003283 3300031595 Bacteria 13282
506 Ga0265313_10008462 3300031595 Bacteria 6826
507 Ga0265313_10044426 3300031595 Bacteria 2168
508 Ga0265314_10001067 3300031711 Bacteria 31824
509 Ga0265314_10022307 3300031711 Bacteria 4851
510 Ga0307406_10146104 3300031901 Bacteria 1681
511 Ga0307416_100071702 3300032002 Bacteria 2879
512 Ga0307411_10305276 3300032005 Bacteria 1278
513 Ga0307415_100860322 3300032126 Bacteria 833
514 Ga0373948_0002778 3300034817 Bacteria 2626
515 Ga0373948_0042211 3300034817 Unclassified 957
516 Ga0373948_0060197 3300034817 Bacteria 833
517 Ga0373950_0000279 3300034818 Bacteria 6447
518 Ga0373950_0008864 3300034818 Unclassified 1593
519 Ga0373958_0000746 3300034819 Bacteria 4152
520 Ga0373959_0000072 3300034820 Bacteria 22681
521 Ga0373938_0000378 3300034957 Bacteria 7139
522 Ga0373926_0002906 3300035083 Bacteria 5495
523 Ga0373926_0015860 3300035083 Bacteria 2571
524 Ga0373926_0086622 3300035083 Bacteria 1162
525 Ga0373928_0003260 3300035084 Bacteria 3109
526 Ga0373928_0007693 3300035084 Bacteria 2082
527 Ga0373928_0044178 3300035084 Bacteria 1033
528 Ga0373929_0000199 3300035085 Bacteria 10691
529 Ga0373940_0065915 3300035088 Bacteria 1045
530 Ga0373944_0007051 3300035089 Bacteria 3003
531 Ga0373949_0000406 3300035090 Bacteria 15004
532 Ga0373949_0041392 3300035090 Bacteria 1134
533 Ga0373951_0000404 3300035091 Bacteria 12744
534 Ga0373951_0027676 3300035091 Bacteria 1324
535 Ga0373952_0000261 3300035092 Bacteria 8645
536 Ga0373952_0007588 3300035092 Bacteria 2037
537 Ga0373952_0026843 3300035092 Bacteria 1253
538 Ga0373952_0075326 3300035092 Bacteria 851
539 Ga0373923_0002366 3300035111 Bacteria 5786
540 Ga0373923_0006572 3300035111 Bacteria 4028
541 Ga0373923_0054899 3300035111 Bacteria 1678
542 Ga0373923_0089582 3300035111 Bacteria 1344
543 Ga0373932_0001164 3300035112 Bacteria 7562
544 Ga0373932_0130568 3300035112 Bacteria 846
545 Ga0373936_0004145 3300035113 Bacteria 5465
546 Ga0373936_0034730 3300035113 Bacteria 2005
547 Ga0373936_0040150 3300035113 Bacteria 1874
548 Ga0373939_0035442 3300035114 Bacteria 1470
549 Ga0373939_0086951 3300035114 Unclassified 1049
550 Ga0373941_0010011 3300035115 Bacteria 2407
551 Ga0373941_0027580 3300035115 Bacteria 1659
552 Ga0373945_0000668 3300035116 Bacteria 9919
553 Ga0373945_0028747 3300035116 Bacteria 1949
554 Ga0373953_0001620 3300035117 Bacteria 6588
555 Ga0373953_0005144 3300035117 Bacteria 4227
556 Ga0373954_0001884 3300035118 Bacteria 8661
557 Ga0373954_0009096 3300035118 Bacteria 4368
558 Ga0373954_0085116 3300035118 Bacteria 1514
559 Ga0373954_0138474 3300035118 Bacteria 1187
560 Ga0373956_0010440 3300035119 Bacteria 3807
561 Ga0373956_0050889 3300035119 Bacteria 1861
562 Ga0373956_0055781 3300035119 Bacteria 1782
563 Ga0373957_0026192 3300035120 Bacteria 2107
564 Ga0373960_0042814 3300035121 Bacteria 1316
565 Ga0373960_0074755 3300035121 Bacteria 1055
566 Ga0373960_0075204 3300035121 Bacteria 1052
567 Ga0373943_0004499 3300035170 Bacteria 6307
568 Ga0373943_0013973 3300035170 Bacteria 3630
569 Ga0373943_0018512 3300035170 Bacteria 3201
570 Ga0373943_0060346 3300035170 Bacteria 1893
571 Ga0373946_0111196 3300035171 Bacteria 1240
572 Ga0373946_0133050 3300035171 Bacteria 1146
573 Ga0373946_0136105 3300035171 Bacteria 1134
574 Ga0373955_0003830 3300035172 Bacteria 6630
575 Ga0373955_0012329 3300035172 Bacteria 4108
576 Ga0373955_0054861 3300035172 Bacteria 2181
577 Ga0373942_0011809 3300035207 Bacteria 2076
578 Ga0373942_0022526 3300035207 Bacteria 1599
579 Ga0373961_0004521 3300035241 Bacteria 3361
580 Ga0373961_0019638 3300035241 Bacteria 1777
581 Ga0373962_0069552 3300035242 Unclassified 1049
582 Ga0373924_0005992 3300035410 Bacteria 4335
583 Ga0373924_0026106 3300035410 Bacteria 2314
584 Ga0373931_0004664 3300035691 Bacteria 6272
585 Ga0373931_0006426 3300035691 Bacteria 5491
586 Ga0373931_0006940 3300035691 Bacteria 5328
587 Ga0373931_0007446 3300035691 Bacteria 5157
588 Ga0373931_0134094 3300035691 Bacteria 1428
589 Ga0373935_0010928 3300035692 Bacteria 5449
590 Ga0373935_0033150 3300035692 Bacteria 3213
591 Ga0373935_0059195 3300035692 Bacteria 2448
592 Ga0373935_0059945 3300035692 Bacteria 2434
593 Ga0373935_0184413 3300035692 Bacteria 1434
594 Ga0373935_0196912 3300035692 Bacteria 1390
595 Ga0373927_0006334 3300035695 Bacteria 8063
596 Ga0373927_0014865 3300035695 Bacteria 5148
597 Ga0373927_0174768 3300035695 Bacteria 1408
598 Ga0373927_0282185 3300035695 Bacteria 1092
599 Ga0373927_0304394 3300035695 Bacteria 1049
600 Ga0373933_0002425 3300035724 Bacteria 10522
601 Ga0373933_0013860 3300035724 Bacteria 4472
602 Ga0373933_0020733 3300035724 Bacteria 3726
603 Ga0373933_0044752 3300035724 Bacteria 2623
604 Ga0373933_0047216 3300035724 Bacteria 2560
605 Ga0373947_0004414 3300035725 Bacteria 8250
606 Ga0373947_0132550 3300035725 Bacteria 1592
607 Ga0373937_0003517 3300036401 Bacteria 13178
608 Ga0373937_0005472 3300036401 Bacteria 10876
609 Ga0373937_0006936 3300036401 Bacteria 9782
610 Ga0373937_0007990 3300036401 Bacteria 9172
611 Ga0373937_0340674 3300036401 Bacteria 1420
612 Ga0373937_0683867 3300036401 Unclassified 972
613 Ga0373925_0003383 3300037068 Bacteria 12366
614 Ga0373925_0007098 3300037068 Bacteria 8188
615 Ga0373925_0032046 3300037068 Bacteria 3866
616 Ga0373925_0042882 3300037068 Bacteria 3357
617 Ga0373925_0044048 3300037068 Bacteria 3313
618 Ga0373925_0095121 3300037068 Bacteria 2281
619 Ga0242420_006937 3300038996 Bacteria 1805
620 Ga0436365_0590730 3300039437 Bacteria 1250
621 Ga0436365_0630398 3300039437 Bacteria 2315
622 Ga0436365_1800837 3300039437 Bacteria 1547
623 Ga0436363_0033271 3300039450 Bacteria 1821
624 Ga0439453_0003678 3300041408 Bacteria 2225
625 Ga0439461_0032404 3300041410 Bacteria 1095
626 Ga0439441_003340 3300042001 Bacteria 2360
627 Ga0439450_050911 3300042008 Bacteria 983
628 Ga0439451_033953 3300042009 Bacteria 1026
629 Ga0450923_005649 3300042125 Bacteria 2033
630 Ga0439446_0054272 3300042156 Bacteria 1202
631 Ga0439435_0000162 3300042436 Bacteria 9223
632 Ga0439435_0001286 3300042436 Bacteria 4558
633 Ga0439444_0001368 3300042437 Bacteria 3136
634 Ga0439444_0005809 3300042437 Bacteria 1842
635 Ga0439464_0031411 3300042439 Bacteria 1490
636 Ga0439460_0003474 3300042461 Bacteria 3813
637 Ga0453684_0181456 3300044712 Bacteria 2471
638 Ga0451576_0079606 3300045051 Bacteria 3409
639 Ga0495592_0004212 3300046454 Bacteria 10505
640 Ga0495592_0007097 3300046454 Bacteria 8383
641 Ga0495592_0008484 3300046454 Bacteria 7711
642 Ga0495592_0061291 3300046454 Bacteria 2765
643 Ga0495592_0293514 3300046454 Bacteria 1059
644 Ga0495603_0115615 3300046455 Bacteria 1564
645 Ga0495629_0000062 3300046459 Bacteria 97169
646 Ga0495629_0013668 3300046459 Bacteria 5857
647 Ga0495629_0156299 3300046459 Bacteria 1584
648 Ga0495629_0367284 3300046459 Bacteria 980
649 Ga0495641_0005773 3300046461 Bacteria 8219
650 Ga0495641_0058068 3300046461 Bacteria 1752
651 Ga0495651_0000198 3300046462 Bacteria 45766
652 Ga0495651_0000786 3300046462 Bacteria 24616
653 Ga0495651_0001525 3300046462 Bacteria 17903
654 Ga0495651_0044602 3300046462 Bacteria 3436
655 Ga0495651_0115195 3300046462 Bacteria 1982
656 Ga0495653_0000637 3300046463 Bacteria 26722
657 Ga0495653_0004143 3300046463 Bacteria 11728
658 Ga0495653_0013367 3300046463 Bacteria 6690
659 Ga0495580_0025191 3300046472 Bacteria 4348
660 Ga0495580_0099274 3300046472 Bacteria 2025
661 Ga0495582_0006436 3300046473 Bacteria 6524
662 Ga0495605_0067416 3300046474 Bacteria 1698
663 Ga0495639_0011168 3300046475 Bacteria 3868
664 Ga0495639_0109778 3300046475 Bacteria 1308
665 Ga0495662_0018392 3300046476 Bacteria 3382
666 Ga0495662_0023349 3300046476 Bacteria 2986
667 Ga0495662_0124313 3300046476 Bacteria 1267
668 Ga0495664_0003341 3300046477 Bacteria 8722
669 Ga0495664_0026814 3300046477 Bacteria 3357
670 Ga0495664_0101867 3300046477 Bacteria 1730
671 Ga0495664_0173006 3300046477 Bacteria 1310
672 Ga0495585_0010974 3300046492 Bacteria 5381
673 Ga0495594_0001170 3300046499 Bacteria 13725
674 Ga0495594_0016090 3300046499 Bacteria 3935
675 Ga0495607_0085826 3300046501 Bacteria 1718
676 Ga0495608_0000129 3300046511 Bacteria 53862
677 Ga0495608_0001490 3300046511 Bacteria 16661
678 Ga0495608_0006737 3300046511 Bacteria 8146
679 Ga0495608_0126167 3300046511 Bacteria 1639
680 Ga0495608_0366716 3300046511 Bacteria 884
681 Ga0495618_0001889 3300046514 Bacteria 13794
682 Ga0495618_0003324 3300046514 Bacteria 10055
683 Ga0495618_0019734 3300046514 Bacteria 4148
684 Ga0495618_0108429 3300046514 Bacteria 1778
685 Ga0495618_0168749 3300046514 Bacteria 1393
686 Ga0495618_0190180 3300046514 Bacteria 1302
687 Ga0495618_0216421 3300046514 Bacteria 1210
688 Ga0495628_0002820 3300046516 Bacteria 15591
689 Ga0495628_0003583 3300046516 Bacteria 13897
690 Ga0495628_0042233 3300046516 Bacteria 3638
691 Ga0495628_0049548 3300046516 Bacteria 3326
692 Ga0495630_0016604 3300046517 Bacteria 5384
693 Ga0495630_0079439 3300046517 Bacteria 2474
694 Ga0495630_0121617 3300046517 Bacteria 1980
695 Ga0495630_0425377 3300046517 Bacteria 1018
696 Ga0495644_0003944 3300046523 Bacteria 5832
697 Ga0495652_0002132 3300046529 Bacteria 20866
698 Ga0495652_0005898 3300046529 Bacteria 11458
699 Ga0495652_0006193 3300046529 Bacteria 11162
700 Ga0495652_0022579 3300046529 Bacteria 5583
701 Ga0495652_0102520 3300046529 Bacteria 2318
702 Ga0495652_0135173 3300046529 Bacteria 1947
703 Ga0495665_0000858 3300046531 Bacteria 15925
704 Ga0495665_0125460 3300046531 Bacteria 1344
705 Ga0495640_0008539 3300046533 Bacteria 8030
706 Ga0495640_0020078 3300046533 Bacteria 4924
707 Ga0495640_0036202 3300046533 Bacteria 3487
708 Ga0495640_0170276 3300046533 Bacteria 1392
709 Ga0495586_0023273 3300046535 Bacteria 3307
710 Ga0495586_0024166 3300046535 Bacteria 3246
711 Ga0495587_0001240 3300046536 Bacteria 16941
712 Ga0495587_0002939 3300046536 Bacteria 11399
713 Ga0495587_0007485 3300046536 Bacteria 7071
714 Ga0495609_0126862 3300046538 Bacteria 1095
715 Ga0495645_0004147 3300046543 Bacteria 9901
716 Ga0495645_0005941 3300046543 Bacteria 8435
717 Ga0495645_0200276 3300046543 Bacteria 1355
718 Ga0495622_0003230 3300046557 Bacteria 7725
719 Ga0495622_0049083 3300046557 Bacteria 1960
720 Ga0495633_0004354 3300046558 Bacteria 9041
721 Ga0495667_0005015 3300046559 Bacteria 8945
722 Ga0495667_0008282 3300046559 Bacteria 7049
723 Ga0495667_0027384 3300046559 Bacteria 3842
724 Ga0495667_0089540 3300046559 Bacteria 1994
725 Ga0495667_0108197 3300046559 Bacteria 1796
726 Ga0495667_0138784 3300046559 Bacteria 1567
727 Ga0495656_0001803 3300046615 Bacteria 7042
728 Ga0495634_0055095 3300046642 Bacteria 2659
729 Ga0495634_0056584 3300046642 Bacteria 2619
730 Ga0495634_0074562 3300046642 Bacteria 2229
731 Ga0495634_0077844 3300046642 Bacteria 2173
732 Ga0495634_0103057 3300046642 Bacteria 1842
733 Ga0495611_0040555 3300046648 Bacteria 2076
734 Ga0495635_0001121 3300046663 Bacteria 17818
735 Ga0495635_0001404 3300046663 Bacteria 16066
736 Ga0495635_0001797 3300046663 Bacteria 14500
737 Ga0495635_0021629 3300046663 Bacteria 4484
738 Ga0495635_0046504 3300046663 Bacteria 2994
739 Ga0495635_0286102 3300046663 Bacteria 1107
740 Ga0495659_0002049 3300046664 Bacteria 6592
741 Ga0495661_0043906 3300046665 Bacteria 2744
742 Ga0495588_0010862 3300046674 Bacteria 4254
743 Ga0495588_0099136 3300046674 Bacteria 1530
744 Ga0495657_0008038 3300046675 Bacteria 8088
745 Ga0495657_0085864 3300046675 Bacteria 2028
746 Ga0495657_0101438 3300046675 Bacteria 1833
747 Ga0495657_0167156 3300046675 Bacteria 1357
748 Ga0495657_0185835 3300046675 Bacteria 1272
749 Ga0495599_0000871 3300046678 Bacteria 16887
750 Ga0495599_0031212 3300046678 Bacteria 3344
751 Ga0495599_0034449 3300046678 Bacteria 3181
752 Ga0495623_0000055 3300046679 Bacteria 69548
753 Ga0495623_0001077 3300046679 Bacteria 18487
754 Ga0495623_0008134 3300046679 Bacteria 6817
755 Ga0495623_0257076 3300046679 Bacteria 980
756 Ga0495646_0002042 3300046680 Bacteria 12239
757 Ga0495646_0003544 3300046680 Bacteria 9724
758 Ga0495646_0029495 3300046680 Bacteria 3429
759 Ga0495646_0170459 3300046680 Bacteria 1200
760 Ga0495647_0006994 3300046681 Bacteria 3760
761 Ga0495647_0016227 3300046681 Bacteria 2619
762 Ga0495647_0099726 3300046681 Bacteria 1201
763 Ga0495658_0004161 3300046683 Bacteria 7127
764 Ga0495669_0047021 3300046684 Bacteria 1927
765 Ga0495613_0003377 3300046689 Bacteria 11931
766 Ga0495613_0004171 3300046689 Bacteria 10816
767 Ga0495613_0414481 3300046689 Bacteria 917
768 Ga0495624_0026573 3300046690 Bacteria 3792
769 Ga0495624_0081712 3300046690 Bacteria 2001
770 Ga0495624_0087763 3300046690 Bacteria 1921
771 Ga0495624_0196918 3300046690 Bacteria 1225
772 Ga0495670_0004753 3300046691 Bacteria 6671
773 Ga0495600_0000293 3300046809 Bacteria 26819
774 Ga0495600_0017754 3300046809 Bacteria 4529
775 Ga0495600_0018500 3300046809 Bacteria 4439
776 Ga0495600_0049234 3300046809 Bacteria 2749
777 Ga0495600_0055719 3300046809 Bacteria 2582
778 Ga0495581_0011015 3300047315 Bacteria 5226
779 Ga0495581_0064889 3300047315 Bacteria 2110
780 Ga0495604_0001806 3300047317 Bacteria 17433
781 Ga0495604_0002503 3300047317 Bacteria 14670
782 Ga0495604_0005734 3300047317 Bacteria 9845
783 Ga0495604_0007487 3300047317 Bacteria 8640
784 Ga0495604_0071368 3300047317 Bacteria 2627
785 Ga0495604_0100000 3300047317 Bacteria 2133
786 Ga0495674_0009382 3300047319 Bacteria 9302
787 Ga0495674_0048385 3300047319 Bacteria 3763
788 Ga0495674_0068175 3300047319 Bacteria 3079
789 Ga0495674_0076095 3300047319 Bacteria 2887
790 Ga0495674_0145656 3300047319 Bacteria 1988
791 Ga0495676_0029654 3300047321 Bacteria 4656
792 Ga0495680_0001199 3300047322 Bacteria 28457
793 Ga0495680_0001339 3300047322 Bacteria 26787
794 Ga0495680_0007362 3300047322 Bacteria 10111
795 Ga0495680_0021607 3300047322 Bacteria 5385
796 Ga0495680_0033484 3300047322 Bacteria 4159
797 Ga0495680_0042824 3300047322 Bacteria 3589
798 Ga0495680_0268767 3300047322 Bacteria 1204
799 Ga0495675_0000602 3300047444 Bacteria 23167
800 Ga0495675_0032070 3300047444 Bacteria 3354
801 Ga0495675_0135322 3300047444 Bacteria 1530
802 Ga0495675_0203066 3300047444 Bacteria 1206
803 Ga0495685_086188 3300047447 Bacteria 1043
804 Ga0495684_0000443 3300047471 Bacteria 33877
805 Ga0495684_0006864 3300047471 Bacteria 8844
806 Ga0495684_0039619 3300047471 Bacteria 3612
807 Ga0495684_0079887 3300047471 Bacteria 2483
808 Ga0495684_0122125 3300047471 Bacteria 1961
809 Ga0495593_0017797 3300047673 Bacteria 4002
810 Ga0495593_0250126 3300047673 Bacteria 887
811 Ga0495602_0003288 3300048088 Bacteria 16685
812 Ga0495602_0008217 3300048088 Bacteria 10900
813 Ga0495602_0065000 3300048088 Bacteria 3151
814 Ga0495602_0183986 3300048088 Bacteria 1608
815 Ga0495614_0025301 3300048089 Bacteria 2560
816 Ga0496100_0002411 3300048903 Bacteria 9473
817 Ga0496100_0004426 3300048903 Bacteria 7445
818 Ga0496100_0015342 3300048903 Bacteria 4473
819 Ga0496100_0224882 3300048903 Bacteria 1378
820 Ga0496101_0010365 3300048904 Bacteria 6154
821 Ga0496101_0017690 3300048904 Bacteria 4834
822 Ga0496101_0046872 3300048904 Unclassified 3101
823 Ga0496101_0049120 3300048904 Bacteria 3033
824 Ga0496101_0111520 3300048904 Bacteria 2059
825 Ga0496102_0021320 3300048905 Bacteria 5730
826 Ga0496102_0024394 3300048905 Bacteria 5376
827 Ga0496102_0027063 3300048905 Bacteria 5120
828 Ga0496102_0043560 3300048905 Bacteria 4070
829 Ga0496102_0045830 3300048905 Bacteria 3970
830 Ga0496102_0071633 3300048905 Unclassified 3183
831 Ga0496102_0108614 3300048905 Bacteria 2584
832 Ga0496102_0203502 3300048905 Bacteria 1866
833 Ga0496103_0008536 3300048906 Bacteria 6088
834 Ga0496103_0065314 3300048906 Bacteria 2269
835 Ga0496103_0067906 3300048906 Bacteria 2227
836 Ga0496103_0203349 3300048906 Bacteria 1274
837 Ga0496104_0000903 3300048907 Bacteria 25453
838 Ga0496104_0020437 3300048907 Bacteria 6070
839 Ga0496104_0022869 3300048907 Bacteria 5743
840 Ga0496104_0059161 3300048907 Bacteria 3627
841 Ga0496104_0122802 3300048907 Bacteria 2493
842 Ga0496105_0000890 3300048908 Bacteria 20426
843 Ga0496105_0022479 3300048908 Bacteria 5107
844 Ga0496105_0042530 3300048908 Bacteria 3745
845 Ga0496105_0060056 3300048908 Bacteria 3136
846 Ga0496105_0145830 3300048908 Bacteria 1946
847 Ga0496105_0192712 3300048908 Bacteria 1666
848 Ga0496106_0027494 3300048909 Bacteria 4237
849 Ga0496106_0051581 3300048909 Bacteria 3102
850 Ga0496106_0074929 3300048909 Bacteria 2591
851 Ga0496106_0547506 3300048909 Bacteria 928
852 Ga0496107_0001196 3300048910 Bacteria 15811
853 Ga0496107_0009752 3300048910 Bacteria 6658
854 Ga0496107_0072308 3300048910 Bacteria 2507
855 Ga0496107_0223030 3300048910 Bacteria 1402
856 Ga0496108_0051311 3300048911 Bacteria 3455
857 Ga0496108_0071528 3300048911 Bacteria 2927
858 Ga0496108_0105101 3300048911 Bacteria 2410
859 Ga0496108_0119067 3300048911 Bacteria 2264
860 Ga0496108_0147458 3300048911 Bacteria 2029
861 Ga0496108_0499438 3300048911 Bacteria 1062
862 Ga0496109_0000984 3300048912 Bacteria 23543
863 Ga0496109_0013882 3300048912 Bacteria 7002
864 Ga0496109_0018945 3300048912 Bacteria 6060
865 Ga0496109_0048301 3300048912 Bacteria 3872
866 Ga0496109_0068963 3300048912 Bacteria 3242
867 Ga0496109_0071605 3300048912 Bacteria 3183
868 Ga0496109_0079040 3300048912 Bacteria 3030
869 Ga0496109_0375703 3300048912 Bacteria 1342
870 Ga0496109_0563768 3300048912 Unclassified 1074
871 Ga0496110_0013940 3300048913 Bacteria 6660
872 Ga0496110_0031256 3300048913 Bacteria 4593
873 Ga0496110_0063767 3300048913 Bacteria 3256
874 Ga0496110_0138233 3300048913 Bacteria 2202
875 Ga0496110_0255431 3300048913 Bacteria 1595
876 Ga0496110_0320822 3300048913 Bacteria 1411
877 Ga0496111_0049428 3300048914 Bacteria 3032
878 Ga0496111_0077053 3300048914 Bacteria 2431
879 Ga0496111_0088248 3300048914 Bacteria 2271
880 Ga0496111_0140275 3300048914 Bacteria 1791
881 Ga0496112_0002341 3300048915 Bacteria 15215
882 Ga0496112_0015511 3300048915 Bacteria 7115
883 Ga0496112_0156680 3300048915 Bacteria 2244
884 Ga0496112_0166088 3300048915 Bacteria 2173
885 Ga0496112_0304161 3300048915 Bacteria 1540
886 Ga0496112_0431395 3300048915 Bacteria 1256
887 Ga0496112_0728028 3300048915 Bacteria 919
888 Ga0496113_0004428 3300048916 Bacteria 8632
889 Ga0496113_0081346 3300048916 Bacteria 2482
890 Ga0496113_0086052 3300048916 Bacteria 2415
891 Ga0496113_0095004 3300048916 Bacteria 2303
892 Ga0496113_0241129 3300048916 Bacteria 1442
893 Ga0496114_0015669 3300048917 Bacteria 6099
894 Ga0496114_0116347 3300048917 Bacteria 2295
895 Ga0496114_0247428 3300048917 Bacteria 1568
896 Ga0496114_0684591 3300048917 Bacteria 900
897 Ga0496115_0005902 3300048918 Bacteria 8926
898 Ga0496115_0009672 3300048918 Bacteria 7174
899 Ga0496115_0033229 3300048918 Bacteria 4071
900 Ga0496115_0037850 3300048918 Bacteria 3824
901 Ga0496115_0041233 3300048918 Bacteria 3672
902 Ga0496115_0085733 3300048918 Bacteria 2569
903 Ga0496115_0436142 3300048918 Bacteria 1060
904 Ga0496115_0511372 3300048918 Bacteria 964
905 Ga0496119_0173936 3300048922 Bacteria 1135
906 Ga0496126_0072636 3300048929 Bacteria 3060
907 Ga0501034_0020588 3300049571 Bacteria 6738
908 Ga0501034_0105023 3300049571 Bacteria 2818
909 Ga0501036_0004228 3300049572 Bacteria 11574
910 Ga0501036_0068203 3300049572 Bacteria 3010
911 Ga0501037_0226075 3300049573 Bacteria 1315
912 Ga0501038_0010884 3300049574 Bacteria 8307
913 Ga0501038_0158781 3300049574 Bacteria 1839
914 Ga0501038_0470370 3300049574 Bacteria 964
915 Ga0501039_0034206 3300049575 Bacteria 3922
916 Ga0501039_0211949 3300049575 Bacteria 1523
917 Ga0501040_0007536 3300049576 Bacteria 7036
918 Ga0501040_0007601 3300049576 Bacteria 7013
919 Ga0501040_0063569 3300049576 Bacteria 2540
920 Ga0501041_0006949 3300049577 Bacteria 6639
921 Ga0501041_0010945 3300049577 Bacteria 5355
922 Ga0501042_0000898 3300049578 Bacteria 16655
923 Ga0501042_0019407 3300049578 Bacteria 4720
924 Ga0501047_0029848 3300049581 Bacteria 5255
925 Ga0501048_0019501 3300049582 Bacteria 4975
926 Ga0501048_0381971 3300049582 Bacteria 1006
927 Ga0501069_0157482 3300049585 Bacteria 1307
928 Ga0501071_0041928 3300049587 Bacteria 3278
929 Ga0501071_0165230 3300049587 Bacteria 1656
930 Ga0501071_0201599 3300049587 Bacteria 1495
931 Ga0501072_0002223 3300049588 Bacteria 14493
932 Ga0501072_0105091 3300049588 Bacteria 2245
933 Ga0501072_0162028 3300049588 Bacteria 1784
934 Ga0501072_0489483 3300049588 Bacteria 973
935 Ga0501073_0022874 3300049589 Bacteria 4496
936 Ga0501075_0011470 3300049591 Bacteria 6272
937 Ga0501076_0000393 3300049592 Bacteria 27377
938 Ga0501076_0217920 3300049592 Bacteria 1560
939 Ga0501076_0225082 3300049592 Bacteria 1533
940 Ga0501076_0311599 3300049592 Bacteria 1291
941 Ga0501077_0014343 3300049593 Bacteria 4979
942 Ga0501077_0292027 3300049593 Bacteria 1038
943 Ga0501077_0368490 3300049593 Bacteria 917
944 Ga0501079_0054329 3300049741 Bacteria 3089
945 Ga0501080_0359586 3300049742 Bacteria 1314
946 Ga0501080_0664530 3300049742 Bacteria 921
947 Ga0501081_0003515 3300049743 Bacteria 10023
948 Ga0501081_0477126 3300049743 Bacteria 928
949 Ga0501044_0062793 3300049823 Bacteria 3796
950 Ga0501044_0075858 3300049823 Bacteria 3414
951 Ga0501044_0198364 3300049823 Bacteria 1966
952 Ga0501045_0002603 3300049824 Bacteria 12303
953 Ga0501045_0032523 3300049824 Bacteria 3780
954 Ga0501045_0321343 3300049824 Bacteria 1152
955 nmdc:mga03n38_201943_c1 3300050490 Bacteria 1029
956 nmdc:mga0yw44_299177_c1 3300050492 Bacteria 1078
957 nmdc:mga0yw44_320042_c1 3300050492 Bacteria 1041
958 nmdc:mga0k408_17841_c1 3300050493 Bacteria 3956
959 nmdc:mga0k408_4845_c1 3300050493 Bacteria 7139
960 nmdc:mga06z11_214369_c1 3300050494 Bacteria 1123
961 nmdc:mga06z11_308646_c1 3300050494 Bacteria 942
962 nmdc:mga06z11_364234_c1 3300050494 Bacteria 867
963 nmdc:mga06z11_42307_c1 3300050494 Bacteria 2284
964 nmdc:mga06z11_7235_c1 3300050494 Bacteria 4557
965 nmdc:mga04h51_28784_c1 3300050495 Bacteria 1735
966 nmdc:mga05p37_179232_c1 3300050507 Bacteria 2579
967 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
968 nmdc:mga05p37_52088_c1 3300050507 Bacteria 5034
969 nmdc:mga09592_1401_c1 3300050508 Bacteria 19291
970 nmdc:mga0qj67_108468_c1 3300050509 Bacteria 2240
971 nmdc:mga0qj67_12481_c1 3300050509 Bacteria 6400
972 nmdc:mga0qj67_142906_c1 3300050509 Bacteria 1940
973 nmdc:mga0qj67_18_c1 3300050509 Bacteria 120268
974 nmdc:mga0qj67_21064_c1 3300050509 Bacteria 4998
975 nmdc:mga0qj67_3298_c1 3300050509 Bacteria 11627
976 nmdc:mga0qj67_351_c1 3300050509 Bacteria 31725
977 nmdc:mga0qj67_35278_c1 3300050509 Bacteria 3909
978 nmdc:mga0qj67_7844_c1 3300050509 Bacteria 7885
979 nmdc:mga0qj67_79145_c1 3300050509 Bacteria 2632
980 nmdc:mga06r32_141649_c1 3300050510 Bacteria 2381
981 nmdc:mga06r32_641_c1 3300050510 Bacteria 30442
982 nmdc:mga08y16_131978_c1 3300050511 Bacteria 2597
983 nmdc:mga08y16_354_c1 3300050511 Bacteria 41427
984 nmdc:mga08y16_41752_c1 3300050511 Bacteria 4804
985 nmdc:mga08y16_8687_c1 3300050511 Bacteria 10656
986 nmdc:mga0n895_116821_c1 3300050512 Bacteria 2687
987 nmdc:mga0n895_14310_c1 3300050512 Bacteria 7199
988 nmdc:mga0n895_158848_c1 3300050512 Bacteria 2292
989 nmdc:mga0n895_436379_c1 3300050512 Bacteria 1323
990 nmdc:mga0n895_55437_c1 3300050512 Bacteria 3901
991 nmdc:mga0n895_666_c1 3300050512 Bacteria 24033
992 nmdc:mga0n895_6909_c1 3300050512 Bacteria 9696
993 nmdc:mga0n895_88954_c1 3300050512 Bacteria 3089
994 nmdc:mga0rr50_105337_c1 3300050513 Bacteria 2224
995 nmdc:mga0rr50_1874_c1 3300050513 Bacteria 11669
996 nmdc:mga0rr50_274898_c1 3300050513 Bacteria 1404
997 nmdc:mga08x19_128206_c1 3300050514 Bacteria 1705
998 nmdc:mga08x19_211410_c1 3300050514 Bacteria 1331
999 nmdc:mga0a205_121144_c1 3300050515 Bacteria 2515
1000 nmdc:mga0a205_130043_c1 3300050515 Bacteria 2418
1001 nmdc:mga0a205_1663_c1 3300050515 Bacteria 19148
1002 nmdc:mga0a205_25880_c1 3300050515 Bacteria 5589
1003 nmdc:mga0sz30_69818_c1 3300050516 Bacteria 1511
1004 Ga0495601_0000434 3300053077 Bacteria 21883
1005 Ga0495601_0001541 3300053077 Bacteria 12733
1006 Ga0495601_0006068 3300053077 Bacteria 7046
1007 Ga0495601_0009504 3300053077 Bacteria 5756
1008 Ga0495601_0010246 3300053077 Bacteria 5574
1009 Ga0495601_0050519 3300053077 Bacteria 2622
1010 Ga0495601_0052766 3300053077 Bacteria 2568
1011 Ga0495601_0065453 3300053077 Bacteria 2313
1012 Ga0495601_0180190 3300053077 Bacteria 1381
1013 Ga0495601_0473493 3300053077 Bacteria 809
1014 Ga0495612_0000635 3300053078 Bacteria 14101
1015 Ga0495612_0000752 3300053078 Bacteria 13204
1016 Ga0495612_0001002 3300053078 Bacteria 11612
1017 Ga0495612_0028173 3300053078 Bacteria 2261
1018 Ga0495612_0050351 3300053078 Bacteria 1710
1019 Ga0495655_0094607 3300053083 Bacteria 876
1020 Ga0495595_0000382 3300053084 Bacteria 16787
1021 Ga0495595_0001690 3300053084 Bacteria 8647
1022 Ga0495595_0002041 3300053084 Bacteria 7849
1023 Ga0495595_0002412 3300053084 Bacteria 7299
1024 Ga0495595_0006648 3300053084 Bacteria 4720
1025 Ga0495595_0014696 3300053084 Bacteria 3325
1026 Ga0495595_0057570 3300053084 Bacteria 1813
1027 Ga0495595_0083068 3300053084 Bacteria 1528
1028 Ga0495595_0210001 3300053084 Bacteria 970
1029 Ga0495619_0000052 3300053085 Bacteria 98882
1030 Ga0495619_0000078 3300053085 Bacteria 72749
1031 Ga0495619_0001197 3300053085 Bacteria 17093
1032 Ga0495619_0001282 3300053085 Bacteria 16496
1033 Ga0495619_0019618 3300053085 Bacteria 4299
1034 Ga0495619_0024745 3300053085 Bacteria 3851
1035 Ga0495619_0137020 3300053085 Bacteria 1684
1036 Ga0495619_0300667 3300053085 Bacteria 1111
1037 Ga0500578_0130427 3300053086 Bacteria 1577
1038 Ga0500644_0001147 3300053088 Bacteria 7707
1039 Ga0500651_0354343 3300053093 Bacteria 832
1040 Ga0500641_0007205 3300053096 Bacteria 3965
1041 Ga0500650_0023134 3300053098 Bacteria 2759
1042 Ga0500595_000001 3300053119 Bacteria 1088438
1043 Ga0500652_047034 3300053131 Bacteria 1752
1044 Ga0500658_0001811 3300053134 Bacteria 8444
1045 Ga0500600_0130244 3300053149 Bacteria 1282
1046 Ga0500616_0000001 3300053153 Bacteria 1986011
1047 Ga0500616_0021977 3300053153 Bacteria 3567
1048 Ga0500611_024837 3300053727 Bacteria 1181
1049 Ga0500645_001586 3300053730 Bacteria 11303
1050 Ga0501084_0032895 3300054114 Bacteria 4339
1051 Ga0501084_0484845 3300054114 Bacteria 1045
1052 Ga0501082_0078312 3300060353 Bacteria 2851
1053 Ga0501082_0244194 3300060353 Bacteria 1563
1054 Ga0530510_0000048 3300061734 Bacteria 56268
1055 Ga0530510_0015226 3300061734 Bacteria 5430
1056 2880501956 2880495981 Bacteria 7340502
1057 8057346749 8057345674 Bacteria 4160394
1058 Ga0105238_10160971
1059 ARcpr5oldR_c000008
1060 ARSoilYngRDRAFT_c00170
1061 ARcpr5yngRDRAFT_c000152
1062 ARSoilOldRDRAFT_c000004
1063 ARCol0oldRDRAFT_c00123
1064 ARCol0yngRDRAFT_1000172
1065 JGI24739J22299_10002554
1066 JGI24737J22298_10000781
1067 JGI24737J22298_10010031
1068 JGI24738J21930_10000064
1069 JGI24035J26624_1000003
1070 JGI24034J26672_10000179
1071 JGI24742J22300_10000052
1072 JGI24751J29686_10005666
1073 JGI25153J46596_10001534
1074 Ga0065704_10002758
1075 Ga0065712_10076040
1076 Ga0065712_10098531
1077 Ga0065715_10001538
1078 Ga0065715_10169460
1079 Ga0065707_10268990
1080 Ga0070676_10000449
1081 Ga0070683_100209776
1082 Ga0070690_100000670
1083 Ga0070690_100201569
1084 Ga0070690_100265063
1085 Ga0070690_100269480
1086 Ga0070670_100002498
1087 Ga0070677_10000651
1088 Ga0068869_100049914
1089 Ga0070666_10005435
1090 Ga0070666_10055057
1091 Ga0070680_100075832
1092 Ga0070680_100117896
1093 Ga0070680_100162887
1094 Ga0070682_100011539
1095 Ga0070682_100134080
1096 Ga0068868_100005589
1097 Ga0070660_100027690
1098 Ga0070660_100033054
1099 Ga0070689_100000270
1100 Ga0070689_100003632
1101 Ga0070689_100016370
1102 Ga0070689_100026944
1103 Ga0070689_100290204
1104 Ga0070691_10000446
1105 Ga0070691_10017126
1106 Ga0070691_10053564
1107 Ga0070687_100000211
1108 Ga0070687_100056512
1109 Ga0070661_100000642
1110 Ga0070692_10061367
1111 Ga0070668_100559006
1112 Ga0070668_100677934
1113 Ga0070669_100010124
1114 Ga0070675_100073059
1115 Ga0070671_100002503
1116 Ga0070674_100004794
1117 Ga0070674_100014229
1118 Ga0070674_100142533
1119 Ga0070673_100001089
1120 Ga0070673_100021948
1121 Ga0070673_100051488
1122 Ga0070688_100000288
1123 Ga0070688_100003398
1124 Ga0070688_100107833
1125 Ga0070688_100124677
1126 Ga0070667_100022673
1127 Ga0070667_100076926
1128 Ga0070667_100221122
1129 Ga0070709_10009286
1130 Ga0070709_10157101
1131 Ga0070714_100015452
1132 Ga0070714_100268166
1133 Ga0070713_100001029
1134 Ga0070713_100007302
1135 Ga0070713_100089481
1136 Ga0070713_100200846
1137 Ga0070710_10048048
1138 Ga0070710_10049988
1139 Ga0070710_10113377
1140 Ga0070710_10114412
1141 Ga0070710_10403158
1142 Ga0070701_10000069
1143 Ga0070711_100064384
1144 Ga0070711_100216889
1145 Ga0070711_100375279
1146 Ga0070705_100002117
1147 Ga0070705_100014222
1148 Ga0070700_100074336
1149 Ga0070700_100103892
1150 Ga0070700_100112520
1151 Ga0070708_100173847
1152 Ga0070663_100008152
1153 Ga0070663_100040563
1154 Ga0070663_100116801
1155 Ga0070678_100023591
1156 Ga0070678_100113115
1157 Ga0070662_100057158
1158 Ga0070662_100189192
1159 Ga0070681_10006773
1160 Ga0070681_10030347
1161 Ga0070681_10144979
1162 Ga0068867_100003827
1163 Ga0068867_100048713
1164 Ga0070685_10001066
1165 Ga0070685_10010683
1166 Ga0070685_10419467
1167 Ga0070707_100181158
1168 Ga0070699_100333566
1169 Ga0070679_100251411
1170 Ga0070679_100577671
1171 Ga0070684_100003138
1172 Ga0070684_100309145
1173 Ga0068853_100001831
1174 Ga0070672_100000546
1175 Ga0070672_100068334
1176 Ga0070672_100126920
1177 Ga0070686_100001242
1178 Ga0070686_100060198
1179 Ga0070686_100109624
1180 Ga0070686_100164060
1181 Ga0070686_100206925
1182 Ga0070695_100004462
1183 Ga0070695_100259951
1184 Ga0070696_100190102
1185 Ga0070696_100261075
1186 Ga0070696_100322220
1187 Ga0070696_100422743
1188 Ga0070693_100012264
1189 Ga0070693_100015493
1190 Ga0070693_100087024
1191 Ga0070665_100114728
1192 Ga0070665_100245355
1193 Ga0070704_100074296
1194 Ga0068855_100149814
1195 Ga0068855_100222171
1196 Ga0070664_100122138
1197 Ga0068854_100063460
1198 Ga0068856_100059506
1199 Ga0070702_100017944
1200 Ga0070702_100037599
1201 Ga0070702_100065842
1202 Ga0068852_100013641
1203 Ga0068859_100001888
1204 Ga0068859_100087315
1205 Ga0068859_100279963
1206 Ga0068864_100000756
1207 Ga0068864_100044294
1208 Ga0068866_10002380
1209 Ga0068861_100008028
1210 Ga0068861_100055029
1211 Ga0068861_100318327
1212 Ga0068851_10025383
1213 Ga0068870_10000946
1214 Ga0068863_100002620
1215 Ga0068863_100458830
1216 Ga0068858_100003321
1217 Ga0068858_100137583
1218 Ga0068860_100056400
1219 Ga0068860_100227594
1220 Ga0068860_100393079
1221 Ga0068860_100689551
1222 Ga0068860_100699128
1223 Ga0068862_100106693
1224 Ga0081455_10000002
1225 Ga0081455_10023181
1226 Ga0081455_10071658
1227 Ga0081540_1015680
1228 Ga0070717_10001350
1229 Ga0070717_10261478
1230 Ga0075365_10328233
1231 Ga0075365_10430488
1232 Ga0075363_100298706
1233 Ga0075364_10234810
1234 Ga0075432_10023329
1235 Ga0070715_10066390
1236 Ga0070716_100114858
1237 Ga0070716_100186558
1238 Ga0070712_100093831
1239 Ga0070712_100376557
1240 Ga0070712_100377362
1241 Ga0075367_10034696
1242 Ga0075367_10036510
1243 Ga0075367_10079230
1244 Ga0075367_10079889
1245 Ga0075367_10147459
1246 Ga0075427_10000124
1247 Ga0075366_10006199
1248 Ga0075366_10044597
1249 Ga0097621_100001960
1250 Ga0097621_100056292
1251 Ga0068871_100000443
1252 Ga0068871_100003970
1253 Ga0068871_100032465
1254 Ga0075428_100001993
1255 Ga0075428_100108391
1256 Ga0075430_100001036
1257 Ga0075430_100001212
1258 Ga0075430_100001234
1259 Ga0075430_100001401
1260 Ga0075430_100002889
1261 Ga0075430_100020954
1262 Ga0075430_100060941
1263 Ga0075431_100004308
1264 Ga0075431_100522540
1265 Ga0075433_10000231
1266 Ga0075433_10083977
1267 Ga0075434_100000271
1268 Ga0075434_100015400
1269 Ga0075434_100137581
1270 Ga0075434_100164590
1271 Ga0075434_100169058
1272 Ga0075434_100409772
1273 Ga0075429_100003189
1274 Ga0075429_100044202
1275 Ga0075429_100426131
1276 Ga0068865_100065756
1277 Ga0068865_100206072
1278 Ga0075436_100318703
1279 Ga0075436_100397801
1280 Ga0097620_100001888
1281 Ga0097620_100087318
1282 Ga0097620_100279946
1283 Ga0075435_100003631
1284 Ga0075435_100152449
1285 Ga0075435_100239259
1286 Ga0075435_100361959
1287 Ga0105251_10075569
1288 Ga0105244_10160577
1289 Ga0105240_10121417
1290 Ga0105240_10465691
1291 Ga0111539_10001391
1292 Ga0111539_10002666
1293 Ga0111539_10011778
1294 Ga0111539_10041685
1295 Ga0111539_10068770
1296 Ga0105245_10028914
1297 Ga0105245_10031665
1298 Ga0105245_10196650
1299 Ga0105245_10340992
1300 Ga0105245_10420733
1301 Ga0105247_10002444
1302 Ga0105247_10006559
1303 Ga0105247_10026832
1304 Ga0114129_10006834
1305 Ga0114129_10031007
1306 Ga0105243_10018909
1307 Ga0105243_10097166
1308 Ga0105243_10223036
1309 Ga0105243_10358009
1310 Ga0105243_10593591
1311 Ga0105241_10008877
1312 Ga0105241_10024212
1313 Ga0105241_10057628
1314 Ga0105241_10506351
1315 Ga0105242_10029260
1316 Ga0105242_10067974
1317 Ga0105242_10092583
1318 Ga0105242_10142189
1319 Ga0105248_10003359
1320 Ga0105248_10046907
1321 Ga0105248_10053410
1322 Ga0105248_10085000
1323 Ga0105248_10092497
1324 Ga0105248_10866089
1325 Ga0105237_10118774
1326 Ga0105237_10207466
1327 Ga0105238_10093664
1328 Ga0105238_10311092
1329 Ga0105249_10058734
1330 Ga0105249_10306742
1331 Ga0105239_10068260
1332 Ga0105239_10643689
1333 Ga0105246_10011703
1334 Ga0105246_10061553
1335 Ga0105246_10155259
1336 Ga0157342_1000261
1337 Ga0157370_10015185
1338 Ga0157370_10203222
1339 Ga0157369_10246042
1340 Ga0157374_10036560
1341 Ga0157374_10055041
1342 Ga0157378_10044464
1343 Ga0157378_10667043
1344 Ga0163162_10134460
1345 Ga0163162_10205606
1346 Ga0163162_10320401
1347 Ga0157372_10019847
1348 Ga0157372_10157813
1349 Ga0157372_10569154
1350 Ga0157375_10051725
1351 Ga0157375_10061780
1352 Ga0157375_10074094
1353 Ga0157375_10121010
1354 Ga0157375_10437848
1355 Ga0163163_10038545
1356 Ga0163163_10053639
1357 Ga0157380_10075434
1358 Ga0157380_10134839
1359 Ga0157380_10237040
1360 Ga0157380_10283496
1361 Ga0157380_10842916
1362 Ga0182008_10025921
1363 Ga0157379_10000836
1364 Ga0157379_10039347
1365 Ga0157379_10048344
1366 Ga0157379_10506292
1367 Ga0157379_10546068
1368 Ga0157376_10025740
1369 Ga0157376_10096060
1370 Ga0157376_10190334
1371 Ga0206353_10283231
1372 Ga0213876_10024089
1373 Ga0224572_1008822
1374 Ga0207666_1000023
1375 Ga0207666_1000703
1376 Ga0207673_1000096
1377 Ga0209758_1000469
1378 Ga0209758_1013194
1379 Ga0207697_10000627
1380 Ga0207697_10076958
1381 Ga0207656_10055069
1382 Ga0207653_10002616
1383 Ga0207682_10000011
1384 Ga0207692_10138403
1385 Ga0207642_10200275
1386 Ga0207710_10022883
1387 Ga0207688_10000212
1388 Ga0207688_10226994
1389 Ga0207680_10002872
1390 Ga0207680_10009784
1391 Ga0207680_10011476
1392 Ga0207647_10011482
1393 Ga0207647_10265665
1394 Ga0207685_10002484
1395 Ga0207685_10011029
1396 Ga0207699_10046026
1397 Ga0207699_10048513
1398 Ga0207645_10002046
1399 Ga0207645_10016084
1400 Ga0207645_10051736
1401 Ga0207643_10003537
1402 Ga0207654_10231793
1403 Ga0207707_10156030
1404 Ga0207707_10243690
1405 Ga0207707_10510379
1406 Ga0207671_10145020
1407 Ga0207693_10001510
1408 Ga0207693_10007846
1409 Ga0207693_10149863
1410 Ga0207663_10011095
1411 Ga0207663_10026370
1412 Ga0207663_10029293
1413 Ga0207663_10060805
1414 Ga0207663_10147729
1415 Ga0207660_10001331
1416 Ga0207660_10041878
1417 Ga0207660_10090345
1418 Ga0207660_10394341
1419 Ga0207662_10000370
1420 Ga0207662_10040020
1421 Ga0207662_10048451
1422 Ga0207662_10081911
1423 Ga0207662_10245452
1424 Ga0207657_10003563
1425 Ga0207657_10020389
1426 Ga0207657_10023586
1427 Ga0207694_10373956
1428 Ga0207650_10052664
1429 Ga0207650_10147926
1430 Ga0207659_10000028
1431 Ga0207659_10069445
1432 Ga0207659_10100975
1433 Ga0207687_10004134
1434 Ga0207687_10042557
1435 Ga0207687_10061649
1436 Ga0207687_10346536
1437 Ga0207700_10000590
1438 Ga0207700_10132628
1439 Ga0207700_10254216
1440 Ga0207664_10423808
1441 Ga0207644_10006109
1442 Ga0207690_10000758
1443 Ga0207706_10004191
1444 Ga0207706_10064878
1445 Ga0207706_10096182
1446 Ga0207706_10357878
1447 Ga0207686_10004502
1448 Ga0207686_10082329
1449 Ga0207686_10174003
1450 Ga0207709_10124871
1451 Ga0207709_10165663
1452 Ga0207670_10000358
1453 Ga0207670_10052418
1454 Ga0207670_10226278
1455 Ga0207670_10421094
1456 Ga0207670_10511804
1457 Ga0207669_10012840
1458 Ga0207669_10016340
1459 Ga0207669_10070612
1460 Ga0207704_10001593
1461 Ga0207704_10037420
1462 Ga0207665_10004996
1463 Ga0207665_10076827
1464 Ga0207665_10445308
1465 Ga0207691_10003120
1466 Ga0207691_10285112
1467 Ga0207691_10571794
1468 Ga0207711_10003815
1469 Ga0207711_10011321
1470 Ga0207711_10029896
1471 Ga0207711_10209736
1472 Ga0207711_10481379
1473 Ga0207689_10002572
1474 Ga0207689_10022090
1475 Ga0207661_10025019
1476 Ga0207661_10139415
1477 Ga0207679_10000026
1478 Ga0207679_10032446
1479 Ga0207667_10120678
1480 Ga0207651_10000487
1481 Ga0207712_10001407
1482 Ga0207668_10000474
1483 Ga0207668_10033807
1484 Ga0207668_10472303
1485 Ga0207668_10648162
1486 Ga0207640_10010302
1487 Ga0207640_10108903
1488 Ga0207658_10011216
1489 Ga0207658_10144371
1490 Ga0207658_10178968
1491 Ga0207658_10192792
1492 Ga0207677_10001084
1493 Ga0207677_10012758
1494 Ga0207703_10073479
1495 Ga0207703_10181091
1496 Ga0207703_10183525
1497 Ga0207639_10106561
1498 Ga0207639_10213131
1499 Ga0207678_10009141
1500 Ga0207678_10028553
1501 Ga0207678_10070433
1502 Ga0207678_10086479
1503 Ga0207678_10160242
1504 Ga0207708_10001391
1505 Ga0207708_10002206
1506 Ga0207708_10049977
1507 Ga0207708_10238382
1508 Ga0207702_10009283
1509 Ga0207702_10506606
1510 Ga0207641_10007214
1511 Ga0207641_10277390
1512 Ga0207648_10002405
1513 Ga0207648_10033311
1514 Ga0207676_10001364
1515 Ga0207676_10042727
1516 Ga0207676_10091959
1517 Ga0207674_10004931
1518 Ga0207675_100004770
1519 Ga0207675_100301568
1520 Ga0207675_100424161
1521 Ga0207683_10000034
1522 Ga0207683_10009986
1523 Ga0207683_10087706
1524 Ga0207683_10139729
1525 Ga0207698_10371970
1526 Ga0209967_1002937
1527 Ga0209981_1000449
1528 Ga0210000_1000242
1529 Ga0209995_1013080
1530 Ga0209983_1009445
1531 Ga0209983_1018033
1532 Ga0209971_1011217
1533 Ga0209966_1002165
1534 Ga0209966_1003074
1535 Ga0209966_1005605
1536 Ga0209966_1013971
1537 Ga0209974_10066311
1538 Ga0209974_10102865
1539 Ga0207428_10000082
1540 Ga0207428_10000851
1541 Ga0207428_10001235
1542 Ga0207428_10306142
1543 Ga0265357_1000593
1544 Ga0268266_10039685
1545 Ga0268266_10847344
1546 Ga0268265_10001023
1547 Ga0268265_10064443
1548 Ga0268264_10001465
1549 Ga0268264_10073361
1550 Ga0265337_1000345
1551 Ga0265338_10024461
1552 Ga0265325_10000043
1553 Ga0265325_10002436
1554 Ga0265325_10005946
1555 Ga0265325_10007742
1556 Ga0265325_10136468
1557 Ga0265325_10136722
1558 Ga0265339_10000085
1559 Ga0265339_10017208
1560 Ga0265331_10015805
1561 Ga0265313_10000505
1562 Ga0265313_10003283
1563 Ga0265313_10008462
1564 Ga0265313_10044426
1565 Ga0265314_10001067
1566 Ga0265314_10022307
1567 Ga0307406_10146104
1568 Ga0307416_100071702
1569 Ga0307411_10305276
1570 Ga0307415_100860322
1571 Ga0373948_0002778
1572 Ga0373948_0042211
1573 Ga0373948_0060197
1574 Ga0373950_0000279
1575 Ga0373950_0008864
1576 Ga0373958_0000746
1577 Ga0373959_0000072
1578 Ga0373938_0000378
1579 Ga0373926_0002906
1580 Ga0373926_0015860
1581 Ga0373926_0086622
1582 Ga0373928_0003260
1583 Ga0373928_0007693
1584 Ga0373928_0044178
1585 Ga0373929_0000199
1586 Ga0373940_0065915
1587 Ga0373944_0007051
1588 Ga0373949_0000406
1589 Ga0373949_0041392
1590 Ga0373951_0000404
1591 Ga0373951_0027676
1592 Ga0373952_0000261
1593 Ga0373952_0007588
1594 Ga0373952_0026843
1595 Ga0373952_0075326
1596 Ga0373923_0002366
1597 Ga0373923_0006572
1598 Ga0373923_0054899
1599 Ga0373923_0089582
1600 Ga0373932_0001164
1601 Ga0373932_0130568
1602 Ga0373936_0004145
1603 Ga0373936_0034730
1604 Ga0373936_0040150
1605 Ga0373939_0035442
1606 Ga0373939_0086951
1607 Ga0373941_0010011
1608 Ga0373941_0027580
1609 Ga0373945_0000668
1610 Ga0373945_0028747
1611 Ga0373953_0001620
1612 Ga0373953_0005144
1613 Ga0373954_0001884
1614 Ga0373954_0009096
1615 Ga0373954_0085116
1616 Ga0373954_0138474
1617 Ga0373956_0010440
1618 Ga0373956_0050889
1619 Ga0373956_0055781
1620 Ga0373957_0026192
1621 Ga0373960_0042814
1622 Ga0373960_0074755
1623 Ga0373960_0075204
1624 Ga0373943_0004499
1625 Ga0373943_0013973
1626 Ga0373943_0018512
1627 Ga0373943_0060346
1628 Ga0373946_0111196
1629 Ga0373946_0133050
1630 Ga0373946_0136105
1631 Ga0373955_0003830
1632 Ga0373955_0012329
1633 Ga0373955_0054861
1634 Ga0373942_0011809
1635 Ga0373942_0022526
1636 Ga0373961_0004521
1637 Ga0373961_0019638
1638 Ga0373962_0069552
1639 Ga0373924_0005992
1640 Ga0373924_0026106
1641 Ga0373931_0004664
1642 Ga0373931_0006426
1643 Ga0373931_0006940
1644 Ga0373931_0007446
1645 Ga0373931_0134094
1646 Ga0373935_0010928
1647 Ga0373935_0033150
1648 Ga0373935_0059195
1649 Ga0373935_0059945
1650 Ga0373935_0184413
1651 Ga0373935_0196912
1652 Ga0373927_0006334
1653 Ga0373927_0014865
1654 Ga0373927_0174768
1655 Ga0373927_0282185
1656 Ga0373927_0304394
1657 Ga0373933_0002425
1658 Ga0373933_0013860
1659 Ga0373933_0020733
1660 Ga0373933_0044752
1661 Ga0373933_0047216
1662 Ga0373947_0004414
1663 Ga0373947_0132550
1664 Ga0373937_0003517
1665 Ga0373937_0005472
1666 Ga0373937_0006936
1667 Ga0373937_0007990
1668 Ga0373937_0340674
1669 Ga0373937_0683867
1670 Ga0373925_0003383
1671 Ga0373925_0007098
1672 Ga0373925_0032046
1673 Ga0373925_0042882
1674 Ga0373925_0044048
1675 Ga0373925_0095121
1676 Ga0242420_006937
1677 Ga0436365_0590730
1678 Ga0436365_0630398
1679 Ga0436365_1800837
1680 Ga0436363_0033271
1681 Ga0439453_0003678
1682 Ga0439461_0032404
1683 Ga0439441_003340
1684 Ga0439450_050911
1685 Ga0439451_033953
1686 Ga0450923_005649
1687 Ga0439446_0054272
1688 Ga0439435_0000162
1689 Ga0439435_0001286
1690 Ga0439444_0001368
1691 Ga0439444_0005809
1692 Ga0439464_0031411
1693 Ga0439460_0003474
1694 Ga0453684_0181456
1695 Ga0451576_0079606
1696 Ga0495592_0004212
1697 Ga0495592_0007097
1698 Ga0495592_0008484
1699 Ga0495592_0061291
1700 Ga0495592_0293514
1701 Ga0495603_0115615
1702 Ga0495629_0000062
1703 Ga0495629_0013668
1704 Ga0495629_0156299
1705 Ga0495629_0367284
1706 Ga0495641_0005773
1707 Ga0495641_0058068
1708 Ga0495651_0000198
1709 Ga0495651_0000786
1710 Ga0495651_0001525
1711 Ga0495651_0044602
1712 Ga0495651_0115195
1713 Ga0495653_0000637
1714 Ga0495653_0004143
1715 Ga0495653_0013367
1716 Ga0495580_0025191
1717 Ga0495580_0099274
1718 Ga0495582_0006436
1719 Ga0495605_0067416
1720 Ga0495639_0011168
1721 Ga0495639_0109778
1722 Ga0495662_0018392
1723 Ga0495662_0023349
1724 Ga0495662_0124313
1725 Ga0495664_0003341
1726 Ga0495664_0026814
1727 Ga0495664_0101867
1728 Ga0495664_0173006
1729 Ga0495585_0010974
1730 Ga0495594_0001170
1731 Ga0495594_0016090
1732 Ga0495607_0085826
1733 Ga0495608_0000129
1734 Ga0495608_0001490
1735 Ga0495608_0006737
1736 Ga0495608_0126167
1737 Ga0495608_0366716
1738 Ga0495618_0001889
1739 Ga0495618_0003324
1740 Ga0495618_0019734
1741 Ga0495618_0108429
1742 Ga0495618_0168749
1743 Ga0495618_0190180
1744 Ga0495618_0216421
1745 Ga0495628_0002820
1746 Ga0495628_0003583
1747 Ga0495628_0042233
1748 Ga0495628_0049548
1749 Ga0495630_0016604
1750 Ga0495630_0079439
1751 Ga0495630_0121617
1752 Ga0495630_0425377
1753 Ga0495644_0003944
1754 Ga0495652_0002132
1755 Ga0495652_0005898
1756 Ga0495652_0006193
1757 Ga0495652_0022579
1758 Ga0495652_0102520
1759 Ga0495652_0135173
1760 Ga0495665_0000858
1761 Ga0495665_0125460
1762 Ga0495640_0008539
1763 Ga0495640_0020078
1764 Ga0495640_0036202
1765 Ga0495640_0170276
1766 Ga0495586_0023273
1767 Ga0495586_0024166
1768 Ga0495587_0001240
1769 Ga0495587_0002939
1770 Ga0495587_0007485
1771 Ga0495609_0126862
1772 Ga0495645_0004147
1773 Ga0495645_0005941
1774 Ga0495645_0200276
1775 Ga0495622_0003230
1776 Ga0495622_0049083
1777 Ga0495633_0004354
1778 Ga0495667_0005015
1779 Ga0495667_0008282
1780 Ga0495667_0027384
1781 Ga0495667_0089540
1782 Ga0495667_0108197
1783 Ga0495667_0138784
1784 Ga0495656_0001803
1785 Ga0495634_0055095
1786 Ga0495634_0056584
1787 Ga0495634_0074562
1788 Ga0495634_0077844
1789 Ga0495634_0103057
1790 Ga0495611_0040555
1791 Ga0495635_0001121
1792 Ga0495635_0001404
1793 Ga0495635_0001797
1794 Ga0495635_0021629
1795 Ga0495635_0046504
1796 Ga0495635_0286102
1797 Ga0495659_0002049
1798 Ga0495661_0043906
1799 Ga0495588_0010862
1800 Ga0495588_0099136
1801 Ga0495657_0008038
1802 Ga0495657_0085864
1803 Ga0495657_0101438
1804 Ga0495657_0167156
1805 Ga0495657_0185835
1806 Ga0495599_0000871
1807 Ga0495599_0031212
1808 Ga0495599_0034449
1809 Ga0495623_0000055
1810 Ga0495623_0001077
1811 Ga0495623_0008134
1812 Ga0495623_0257076
1813 Ga0495646_0002042
1814 Ga0495646_0003544
1815 Ga0495646_0029495
1816 Ga0495646_0170459
1817 Ga0495647_0006994
1818 Ga0495647_0016227
1819 Ga0495647_0099726
1820 Ga0495658_0004161
1821 Ga0495669_0047021
1822 Ga0495613_0003377
1823 Ga0495613_0004171
1824 Ga0495613_0414481
1825 Ga0495624_0026573
1826 Ga0495624_0081712
1827 Ga0495624_0087763
1828 Ga0495624_0196918
1829 Ga0495670_0004753
1830 Ga0495600_0000293
1831 Ga0495600_0017754
1832 Ga0495600_0018500
1833 Ga0495600_0049234
1834 Ga0495600_0055719
1835 Ga0495581_0011015
1836 Ga0495581_0064889
1837 Ga0495604_0001806
1838 Ga0495604_0002503
1839 Ga0495604_0005734
1840 Ga0495604_0007487
1841 Ga0495604_0071368
1842 Ga0495604_0100000
1843 Ga0495674_0009382
1844 Ga0495674_0048385
1845 Ga0495674_0068175
1846 Ga0495674_0076095
1847 Ga0495674_0145656
1848 Ga0495676_0029654
1849 Ga0495680_0001199
1850 Ga0495680_0001339
1851 Ga0495680_0007362
1852 Ga0495680_0021607
1853 Ga0495680_0033484
1854 Ga0495680_0042824
1855 Ga0495680_0268767
1856 Ga0495675_0000602
1857 Ga0495675_0032070
1858 Ga0495675_0135322
1859 Ga0495675_0203066
1860 Ga0495685_086188
1861 Ga0495684_0000443
1862 Ga0495684_0006864
1863 Ga0495684_0039619
1864 Ga0495684_0079887
1865 Ga0495684_0122125
1866 Ga0495593_0017797
1867 Ga0495593_0250126
1868 Ga0495602_0003288
1869 Ga0495602_0008217
1870 Ga0495602_0065000
1871 Ga0495602_0183986
1872 Ga0495614_0025301
1873 Ga0496100_0002411
1874 Ga0496100_0004426
1875 Ga0496100_0015342
1876 Ga0496100_0224882
1877 Ga0496101_0010365
1878 Ga0496101_0017690
1879 Ga0496101_0046872
1880 Ga0496101_0049120
1881 Ga0496101_0111520
1882 Ga0496102_0021320
1883 Ga0496102_0024394
1884 Ga0496102_0027063
1885 Ga0496102_0043560
1886 Ga0496102_0045830
1887 Ga0496102_0071633
1888 Ga0496102_0108614
1889 Ga0496102_0203502
1890 Ga0496103_0008536
1891 Ga0496103_0065314
1892 Ga0496103_0067906
1893 Ga0496103_0203349
1894 Ga0496104_0000903
1895 Ga0496104_0020437
1896 Ga0496104_0022869
1897 Ga0496104_0059161
1898 Ga0496104_0122802
1899 Ga0496105_0000890
1900 Ga0496105_0022479
1901 Ga0496105_0042530
1902 Ga0496105_0060056
1903 Ga0496105_0145830
1904 Ga0496105_0192712
1905 Ga0496106_0027494
1906 Ga0496106_0051581
1907 Ga0496106_0074929
1908 Ga0496106_0547506
1909 Ga0496107_0001196
1910 Ga0496107_0009752
1911 Ga0496107_0072308
1912 Ga0496107_0223030
1913 Ga0496108_0051311
1914 Ga0496108_0071528
1915 Ga0496108_0105101
1916 Ga0496108_0119067
1917 Ga0496108_0147458
1918 Ga0496108_0499438
1919 Ga0496109_0000984
1920 Ga0496109_0013882
1921 Ga0496109_0018945
1922 Ga0496109_0048301
1923 Ga0496109_0068963
1924 Ga0496109_0071605
1925 Ga0496109_0079040
1926 Ga0496109_0375703
1927 Ga0496109_0563768
1928 Ga0496110_0013940
1929 Ga0496110_0031256
1930 Ga0496110_0063767
1931 Ga0496110_0138233
1932 Ga0496110_0255431
1933 Ga0496110_0320822
1934 Ga0496111_0049428
1935 Ga0496111_0077053
1936 Ga0496111_0088248
1937 Ga0496111_0140275
1938 Ga0496112_0002341
1939 Ga0496112_0015511
1940 Ga0496112_0156680
1941 Ga0496112_0166088
1942 Ga0496112_0304161
1943 Ga0496112_0431395
1944 Ga0496112_0728028
1945 Ga0496113_0004428
1946 Ga0496113_0081346
1947 Ga0496113_0086052
1948 Ga0496113_0095004
1949 Ga0496113_0241129
1950 Ga0496114_0015669
1951 Ga0496114_0116347
1952 Ga0496114_0247428
1953 Ga0496114_0684591
1954 Ga0496115_0005902
1955 Ga0496115_0009672
1956 Ga0496115_0033229
1957 Ga0496115_0037850
1958 Ga0496115_0041233
1959 Ga0496115_0085733
1960 Ga0496115_0436142
1961 Ga0496115_0511372
1962 Ga0496119_0173936
1963 Ga0496126_0072636
1964 Ga0501034_0020588
1965 Ga0501034_0105023
1966 Ga0501036_0004228
1967 Ga0501036_0068203
1968 Ga0501037_0226075
1969 Ga0501038_0010884
1970 Ga0501038_0158781
1971 Ga0501038_0470370
1972 Ga0501039_0034206
1973 Ga0501039_0211949
1974 Ga0501040_0007536
1975 Ga0501040_0007601
1976 Ga0501040_0063569
1977 Ga0501041_0006949
1978 Ga0501041_0010945
1979 Ga0501042_0000898
1980 Ga0501042_0019407
1981 Ga0501047_0029848
1982 Ga0501048_0019501
1983 Ga0501048_0381971
1984 Ga0501069_0157482
1985 Ga0501071_0041928
1986 Ga0501071_0165230
1987 Ga0501071_0201599
1988 Ga0501072_0002223
1989 Ga0501072_0105091
1990 Ga0501072_0162028
1991 Ga0501072_0489483
1992 Ga0501073_0022874
1993 Ga0501075_0011470
1994 Ga0501076_0000393
1995 Ga0501076_0217920
1996 Ga0501076_0225082
1997 Ga0501076_0311599
1998 Ga0501077_0014343
1999 Ga0501077_0292027
2000 Ga0501077_0368490
2001 Ga0501079_0054329
2002 Ga0501080_0359586
2003 Ga0501080_0664530
2004 Ga0501081_0003515
2005 Ga0501081_0477126
2006 Ga0501044_0062793
2007 Ga0501044_0075858
2008 Ga0501044_0198364
2009 Ga0501045_0002603
2010 Ga0501045_0032523
2011 Ga0501045_0321343
2012 nmdc:mga03n38_201943_c1
2013 nmdc:mga0yw44_299177_c1
2014 nmdc:mga0yw44_320042_c1
2015 nmdc:mga0k408_17841_c1
2016 nmdc:mga0k408_4845_c1
2017 nmdc:mga06z11_214369_c1
2018 nmdc:mga06z11_308646_c1
2019 nmdc:mga06z11_364234_c1
2020 nmdc:mga06z11_42307_c1
2021 nmdc:mga06z11_7235_c1
2022 nmdc:mga04h51_28784_c1
2023 nmdc:mga05p37_179232_c1
2024 nmdc:mga05p37_19_c2
2025 nmdc:mga05p37_52088_c1
2026 nmdc:mga09592_1401_c1
2027 nmdc:mga0qj67_108468_c1
2028 nmdc:mga0qj67_12481_c1
2029 nmdc:mga0qj67_142906_c1
2030 nmdc:mga0qj67_18_c1
2031 nmdc:mga0qj67_21064_c1
2032 nmdc:mga0qj67_3298_c1
2033 nmdc:mga0qj67_351_c1
2034 nmdc:mga0qj67_35278_c1
2035 nmdc:mga0qj67_7844_c1
2036 nmdc:mga0qj67_79145_c1
2037 nmdc:mga06r32_141649_c1
2038 nmdc:mga06r32_641_c1
2039 nmdc:mga08y16_131978_c1
2040 nmdc:mga08y16_354_c1
2041 nmdc:mga08y16_41752_c1
2042 nmdc:mga08y16_8687_c1
2043 nmdc:mga0n895_116821_c1
2044 nmdc:mga0n895_14310_c1
2045 nmdc:mga0n895_158848_c1
2046 nmdc:mga0n895_436379_c1
2047 nmdc:mga0n895_55437_c1
2048 nmdc:mga0n895_666_c1
2049 nmdc:mga0n895_6909_c1
2050 nmdc:mga0n895_88954_c1
2051 nmdc:mga0rr50_105337_c1
2052 nmdc:mga0rr50_1874_c1
2053 nmdc:mga0rr50_274898_c1
2054 nmdc:mga08x19_128206_c1
2055 nmdc:mga08x19_211410_c1
2056 nmdc:mga0a205_121144_c1
2057 nmdc:mga0a205_130043_c1
2058 nmdc:mga0a205_1663_c1
2059 nmdc:mga0a205_25880_c1
2060 nmdc:mga0sz30_69818_c1
2061 Ga0495601_0000434
2062 Ga0495601_0001541
2063 Ga0495601_0006068
2064 Ga0495601_0009504
2065 Ga0495601_0010246
2066 Ga0495601_0050519
2067 Ga0495601_0052766
2068 Ga0495601_0065453
2069 Ga0495601_0180190
2070 Ga0495601_0473493
2071 Ga0495612_0000635
2072 Ga0495612_0000752
2073 Ga0495612_0001002
2074 Ga0495612_0028173
2075 Ga0495612_0050351
2076 Ga0495655_0094607
2077 Ga0495595_0000382
2078 Ga0495595_0001690
2079 Ga0495595_0002041
2080 Ga0495595_0002412
2081 Ga0495595_0006648
2082 Ga0495595_0014696
2083 Ga0495595_0057570
2084 Ga0495595_0083068
2085 Ga0495595_0210001
2086 Ga0495619_0000052
2087 Ga0495619_0000078
2088 Ga0495619_0001197
2089 Ga0495619_0001282
2090 Ga0495619_0019618
2091 Ga0495619_0024745
2092 Ga0495619_0137020
2093 Ga0495619_0300667
2094 Ga0500578_0130427
2095 Ga0500644_0001147
2096 Ga0500651_0354343
2097 Ga0500641_0007205
2098 Ga0500650_0023134
2099 Ga0500595_000001
2100 Ga0500652_047034
2101 Ga0500658_0001811
2102 Ga0500600_0130244
2103 Ga0500616_0000001
2104 Ga0500616_0021977
2105 Ga0500611_024837
2106 Ga0500645_001586
2107 Ga0501084_0032895
2108 Ga0501084_0484845
2109 Ga0501082_0078312
2110 Ga0501082_0244194
2111 Ga0530510_0000048
2112 Ga0530510_0015226
2113 2880501956
2114 8057346749

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

225

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

279

0.9

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

37

150

0.88

PF08659

KR

KR domain

36

216

0.77

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

37

176

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew8-assembly1.cif.gz_C crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9898 6 255
2ewm-assembly1.cif.gz_A-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.989 6 255
2ew8-assembly1.cif.gz_D crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9883 6 255
2ewm-assembly1.cif.gz_B-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9852 6 255
2ew8-assembly1.cif.gz_C crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9726 6 255
ID Description Score Start End Superfamily
2ewmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9852 6 255 3.40.50.720
2ewmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9694 6 255 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 12 253 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.949 6 255 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9477 6 253 3.40.50.720
ID Description Score Start End GO Terms
AF-B9JM47-F1-model_v4 Short chain dehydrogenase protein 0.9856 3 255 GO:0016491
AF-B9JMN7-F1-model_v4 Acetoacetyl-CoA reductase protein 0.9792 6 255 GO:0016491
AF-A0A6B3A7A6-F1-model_v4 SDR family oxidoreductase 0.9789 11 255
AF-B9JM47-F1-model_v4 Short chain dehydrogenase protein 0.9778 3 255 GO:0016491
AF-A0A661ESZ7-F1-model_v4 Dehydrogenase 0.977 1 255 GO:0006633
GO:0016616
GO:0048038

Map