F489202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1057 | 420 | 2114 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10160971|Ga0105238_101609712 |
| Length | 282 |
| Sequence | VGGCPPDRDHLDSRSARPGDDKVWGNFMAKGHKDKVAVITGAAGGIGQAFARRLAEDGVHVAIADLSDGAATVKMVQAAGREAIAVKCDVSSEDSVAALAKEVNAKFSHVDIVVNCAGIFPQKDFSEMTFADWRKVLSINLDGTFLVTAAFVPGMRARKWGRVVNMASSTLGSVVTGFAHYVASKGGIVGFTRALATDLAGDGITVNAIAPGLTRSPGTVVRAPRPTFKTMDEEFEAVAQMQAIKRVEVPDDLVGAISFLTSDDASFITGQTLNVDGGRVRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 272 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 273 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 274 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 275 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 276 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 277 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 278 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 279 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 280 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 407 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 409 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 411 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 413 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 415 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 419 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 420 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.69 |
| Nodule | 0 |
| Rhizoplane | 8.42 |
| Rhizosphere | 87.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105238_10160971 | 3300009551 | Bacteria | 2220 |
| 2 | ARcpr5oldR_c000008 | 3300000041 | Bacteria | 40651 |
| 3 | ARSoilYngRDRAFT_c00170 | 3300000042 | Bacteria | 11114 |
| 4 | ARcpr5yngRDRAFT_c000152 | 3300000043 | Bacteria | 11173 |
| 5 | ARSoilOldRDRAFT_c000004 | 3300000044 | Bacteria | 62556 |
| 6 | ARCol0oldRDRAFT_c00123 | 3300000045 | Bacteria | 6884 |
| 7 | ARCol0yngRDRAFT_1000172 | 3300000652 | Bacteria | 11045 |
| 8 | JGI24739J22299_10002554 | 3300001989 | Bacteria | 7020 |
| 9 | JGI24737J22298_10000781 | 3300001990 | Bacteria | 11263 |
| 10 | JGI24737J22298_10010031 | 3300001990 | Bacteria | 3136 |
| 11 | JGI24738J21930_10000064 | 3300002075 | Bacteria | 22266 |
| 12 | JGI24035J26624_1000003 | 3300002126 | Bacteria | 16650 |
| 13 | JGI24034J26672_10000179 | 3300002239 | Bacteria | 8708 |
| 14 | JGI24742J22300_10000052 | 3300002244 | Bacteria | 17010 |
| 15 | JGI24751J29686_10005666 | 3300002459 | Bacteria | 2544 |
| 16 | JGI25153J46596_10001534 | 3300003215 | Bacteria | 13705 |
| 17 | Ga0065704_10002758 | 3300005289 | Bacteria | 4914 |
| 18 | Ga0065712_10076040 | 3300005290 | Bacteria | 3744 |
| 19 | Ga0065712_10098531 | 3300005290 | Bacteria | 2116 |
| 20 | Ga0065715_10001538 | 3300005293 | Bacteria | 10123 |
| 21 | Ga0065715_10169460 | 3300005293 | Bacteria | 1559 |
| 22 | Ga0065707_10268990 | 3300005295 | Bacteria | 1076 |
| 23 | Ga0070676_10000449 | 3300005328 | Bacteria | 19642 |
| 24 | Ga0070683_100209776 | 3300005329 | Bacteria | 1850 |
| 25 | Ga0070690_100000670 | 3300005330 | Bacteria | 17462 |
| 26 | Ga0070690_100201569 | 3300005330 | Bacteria | 1385 |
| 27 | Ga0070690_100265063 | 3300005330 | Bacteria | 1220 |
| 28 | Ga0070690_100269480 | 3300005330 | Bacteria | 1211 |
| 29 | Ga0070670_100002498 | 3300005331 | Bacteria | 15168 |
| 30 | Ga0070677_10000651 | 3300005333 | Bacteria | 11608 |
| 31 | Ga0068869_100049914 | 3300005334 | Bacteria | 3031 |
| 32 | Ga0070666_10005435 | 3300005335 | Bacteria | 7812 |
| 33 | Ga0070666_10055057 | 3300005335 | Bacteria | 2684 |
| 34 | Ga0070680_100075832 | 3300005336 | Bacteria | 2768 |
| 35 | Ga0070680_100117896 | 3300005336 | Bacteria | 2214 |
| 36 | Ga0070680_100162887 | 3300005336 | Bacteria | 1874 |
| 37 | Ga0070682_100011539 | 3300005337 | Bacteria | 5052 |
| 38 | Ga0070682_100134080 | 3300005337 | Bacteria | 1680 |
| 39 | Ga0068868_100005589 | 3300005338 | Bacteria | 8840 |
| 40 | Ga0070660_100027690 | 3300005339 | Bacteria | 4232 |
| 41 | Ga0070660_100033054 | 3300005339 | Bacteria | 3896 |
| 42 | Ga0070689_100000270 | 3300005340 | Bacteria | 30009 |
| 43 | Ga0070689_100003632 | 3300005340 | Bacteria | 10290 |
| 44 | Ga0070689_100016370 | 3300005340 | Bacteria | 5426 |
| 45 | Ga0070689_100026944 | 3300005340 | Bacteria | 4331 |
| 46 | Ga0070689_100290204 | 3300005340 | Bacteria | 1359 |
| 47 | Ga0070691_10000446 | 3300005341 | Bacteria | 15275 |
| 48 | Ga0070691_10017126 | 3300005341 | Bacteria | 3335 |
| 49 | Ga0070691_10053564 | 3300005341 | Bacteria | 1930 |
| 50 | Ga0070687_100000211 | 3300005343 | Bacteria | 20314 |
| 51 | Ga0070687_100056512 | 3300005343 | Bacteria | 2053 |
| 52 | Ga0070661_100000642 | 3300005344 | Bacteria | 25881 |
| 53 | Ga0070692_10061367 | 3300005345 | Bacteria | 1981 |
| 54 | Ga0070668_100559006 | 3300005347 | Unclassified | 997 |
| 55 | Ga0070668_100677934 | 3300005347 | Bacteria | 907 |
| 56 | Ga0070669_100010124 | 3300005353 | Bacteria | 6707 |
| 57 | Ga0070675_100073059 | 3300005354 | Bacteria | 2847 |
| 58 | Ga0070671_100002503 | 3300005355 | Bacteria | 14229 |
| 59 | Ga0070674_100004794 | 3300005356 | Bacteria | 7748 |
| 60 | Ga0070674_100014229 | 3300005356 | Bacteria | 4942 |
| 61 | Ga0070674_100142533 | 3300005356 | Bacteria | 1800 |
| 62 | Ga0070673_100001089 | 3300005364 | Bacteria | 15535 |
| 63 | Ga0070673_100021948 | 3300005364 | Bacteria | 4639 |
| 64 | Ga0070673_100051488 | 3300005364 | Bacteria | 3225 |
| 65 | Ga0070688_100000288 | 3300005365 | Bacteria | 25809 |
| 66 | Ga0070688_100003398 | 3300005365 | Bacteria | 8176 |
| 67 | Ga0070688_100107833 | 3300005365 | Bacteria | 1847 |
| 68 | Ga0070688_100124677 | 3300005365 | Bacteria | 1730 |
| 69 | Ga0070667_100022673 | 3300005367 | Bacteria | 5206 |
| 70 | Ga0070667_100076926 | 3300005367 | Bacteria | 2849 |
| 71 | Ga0070667_100221122 | 3300005367 | Bacteria | 1686 |
| 72 | Ga0070709_10009286 | 3300005434 | Bacteria | 5419 |
| 73 | Ga0070709_10157101 | 3300005434 | Bacteria | 1577 |
| 74 | Ga0070714_100015452 | 3300005435 | Bacteria | 6143 |
| 75 | Ga0070714_100268166 | 3300005435 | Bacteria | 1582 |
| 76 | Ga0070713_100001029 | 3300005436 | Bacteria | 17824 |
| 77 | Ga0070713_100007302 | 3300005436 | Bacteria | 7738 |
| 78 | Ga0070713_100089481 | 3300005436 | Bacteria | 2644 |
| 79 | Ga0070713_100200846 | 3300005436 | Bacteria | 1800 |
| 80 | Ga0070710_10048048 | 3300005437 | Bacteria | 2382 |
| 81 | Ga0070710_10049988 | 3300005437 | Bacteria | 2341 |
| 82 | Ga0070710_10113377 | 3300005437 | Bacteria | 1631 |
| 83 | Ga0070710_10114412 | 3300005437 | Bacteria | 1625 |
| 84 | Ga0070710_10403158 | 3300005437 | Bacteria | 917 |
| 85 | Ga0070701_10000069 | 3300005438 | Bacteria | 27989 |
| 86 | Ga0070711_100064384 | 3300005439 | Bacteria | 2562 |
| 87 | Ga0070711_100216889 | 3300005439 | Bacteria | 1485 |
| 88 | Ga0070711_100375279 | 3300005439 | Bacteria | 1148 |
| 89 | Ga0070705_100002117 | 3300005440 | Bacteria | 10108 |
| 90 | Ga0070705_100014222 | 3300005440 | Bacteria | 4090 |
| 91 | Ga0070700_100074336 | 3300005441 | Bacteria | 2177 |
| 92 | Ga0070700_100103892 | 3300005441 | Bacteria | 1877 |
| 93 | Ga0070700_100112520 | 3300005441 | Bacteria | 1812 |
| 94 | Ga0070708_100173847 | 3300005445 | Bacteria | 2012 |
| 95 | Ga0070663_100008152 | 3300005455 | Bacteria | 6426 |
| 96 | Ga0070663_100040563 | 3300005455 | Bacteria | 3260 |
| 97 | Ga0070663_100116801 | 3300005455 | Bacteria | 2011 |
| 98 | Ga0070678_100023591 | 3300005456 | Bacteria | 4102 |
| 99 | Ga0070678_100113115 | 3300005456 | Bacteria | 2127 |
| 100 | Ga0070662_100057158 | 3300005457 | Bacteria | 2834 |
| 101 | Ga0070662_100189192 | 3300005457 | Bacteria | 1627 |
| 102 | Ga0070681_10006773 | 3300005458 | Bacteria | 11154 |
| 103 | Ga0070681_10030347 | 3300005458 | Bacteria | 5424 |
| 104 | Ga0070681_10144979 | 3300005458 | Bacteria | 2304 |
| 105 | Ga0068867_100003827 | 3300005459 | Bacteria | 10576 |
| 106 | Ga0068867_100048713 | 3300005459 | Bacteria | 3118 |
| 107 | Ga0070685_10001066 | 3300005466 | Bacteria | 14712 |
| 108 | Ga0070685_10010683 | 3300005466 | Bacteria | 4778 |
| 109 | Ga0070685_10419467 | 3300005466 | Bacteria | 931 |
| 110 | Ga0070707_100181158 | 3300005468 | Bacteria | 2054 |
| 111 | Ga0070699_100333566 | 3300005518 | Unclassified | 1364 |
| 112 | Ga0070679_100251411 | 3300005530 | Bacteria | 1724 |
| 113 | Ga0070679_100577671 | 3300005530 | Bacteria | 1067 |
| 114 | Ga0070684_100003138 | 3300005535 | Bacteria | 12335 |
| 115 | Ga0070684_100309145 | 3300005535 | Bacteria | 1451 |
| 116 | Ga0068853_100001831 | 3300005539 | Bacteria | 15636 |
| 117 | Ga0070672_100000546 | 3300005543 | Bacteria | 22105 |
| 118 | Ga0070672_100068334 | 3300005543 | Bacteria | 2818 |
| 119 | Ga0070672_100126920 | 3300005543 | Bacteria | 2093 |
| 120 | Ga0070686_100001242 | 3300005544 | Bacteria | 14478 |
| 121 | Ga0070686_100060198 | 3300005544 | Bacteria | 2449 |
| 122 | Ga0070686_100109624 | 3300005544 | Bacteria | 1878 |
| 123 | Ga0070686_100164060 | 3300005544 | Bacteria | 1567 |
| 124 | Ga0070686_100206925 | 3300005544 | Bacteria | 1410 |
| 125 | Ga0070695_100004462 | 3300005545 | Bacteria | 8222 |
| 126 | Ga0070695_100259951 | 3300005545 | Bacteria | 1267 |
| 127 | Ga0070696_100190102 | 3300005546 | Bacteria | 1528 |
| 128 | Ga0070696_100261075 | 3300005546 | Bacteria | 1313 |
| 129 | Ga0070696_100322220 | 3300005546 | Bacteria | 1190 |
| 130 | Ga0070696_100422743 | 3300005546 | Bacteria | 1047 |
| 131 | Ga0070693_100012264 | 3300005547 | Bacteria | 4335 |
| 132 | Ga0070693_100015493 | 3300005547 | Bacteria | 3927 |
| 133 | Ga0070693_100087024 | 3300005547 | Bacteria | 1876 |
| 134 | Ga0070665_100114728 | 3300005548 | Bacteria | 2696 |
| 135 | Ga0070665_100245355 | 3300005548 | Bacteria | 1791 |
| 136 | Ga0070704_100074296 | 3300005549 | Bacteria | 2479 |
| 137 | Ga0068855_100149814 | 3300005563 | Bacteria | 2653 |
| 138 | Ga0068855_100222171 | 3300005563 | Bacteria | 2117 |
| 139 | Ga0070664_100122138 | 3300005564 | Bacteria | 2281 |
| 140 | Ga0068854_100063460 | 3300005578 | Bacteria | 2682 |
| 141 | Ga0068856_100059506 | 3300005614 | Bacteria | 3773 |
| 142 | Ga0070702_100017944 | 3300005615 | Bacteria | 3660 |
| 143 | Ga0070702_100037599 | 3300005615 | Bacteria | 2689 |
| 144 | Ga0070702_100065842 | 3300005615 | Bacteria | 2123 |
| 145 | Ga0068852_100013641 | 3300005616 | Bacteria | 6223 |
| 146 | Ga0068859_100001888 | 3300005617 | Bacteria | 21352 |
| 147 | Ga0068859_100087315 | 3300005617 | Bacteria | 3167 |
| 148 | Ga0068859_100279963 | 3300005617 | Bacteria | 1761 |
| 149 | Ga0068864_100000756 | 3300005618 | Bacteria | 27190 |
| 150 | Ga0068864_100044294 | 3300005618 | Bacteria | 3813 |
| 151 | Ga0068866_10002380 | 3300005718 | Bacteria | 7798 |
| 152 | Ga0068861_100008028 | 3300005719 | Bacteria | 7261 |
| 153 | Ga0068861_100055029 | 3300005719 | Bacteria | 3033 |
| 154 | Ga0068861_100318327 | 3300005719 | Bacteria | 1354 |
| 155 | Ga0068851_10025383 | 3300005834 | Bacteria | 2907 |
| 156 | Ga0068870_10000946 | 3300005840 | Bacteria | 11387 |
| 157 | Ga0068863_100002620 | 3300005841 | Bacteria | 17829 |
| 158 | Ga0068863_100458830 | 3300005841 | Bacteria | 1251 |
| 159 | Ga0068858_100003321 | 3300005842 | Bacteria | 16019 |
| 160 | Ga0068858_100137583 | 3300005842 | Bacteria | 2292 |
| 161 | Ga0068860_100056400 | 3300005843 | Bacteria | 3735 |
| 162 | Ga0068860_100227594 | 3300005843 | Bacteria | 1812 |
| 163 | Ga0068860_100393079 | 3300005843 | Bacteria | 1370 |
| 164 | Ga0068860_100689551 | 3300005843 | Bacteria | 1031 |
| 165 | Ga0068860_100699128 | 3300005843 | Bacteria | 1023 |
| 166 | Ga0068862_100106693 | 3300005844 | Bacteria | 2456 |
| 167 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 168 | Ga0081455_10023181 | 3300005937 | Bacteria | 5782 |
| 169 | Ga0081455_10071658 | 3300005937 | Bacteria | 2872 |
| 170 | Ga0081540_1015680 | 3300005983 | Bacteria | 4783 |
| 171 | Ga0070717_10001350 | 3300006028 | Bacteria | 16869 |
| 172 | Ga0070717_10261478 | 3300006028 | Bacteria | 1531 |
| 173 | Ga0075365_10328233 | 3300006038 | Bacteria | 1078 |
| 174 | Ga0075365_10430488 | 3300006038 | Bacteria | 932 |
| 175 | Ga0075363_100298706 | 3300006048 | Bacteria | 934 |
| 176 | Ga0075364_10234810 | 3300006051 | Bacteria | 1245 |
| 177 | Ga0075432_10023329 | 3300006058 | Bacteria | 2119 |
| 178 | Ga0070715_10066390 | 3300006163 | Bacteria | 1599 |
| 179 | Ga0070716_100114858 | 3300006173 | Bacteria | 1675 |
| 180 | Ga0070716_100186558 | 3300006173 | Bacteria | 1366 |
| 181 | Ga0070712_100093831 | 3300006175 | Bacteria | 2204 |
| 182 | Ga0070712_100376557 | 3300006175 | Bacteria | 1168 |
| 183 | Ga0070712_100377362 | 3300006175 | Bacteria | 1166 |
| 184 | Ga0075367_10034696 | 3300006178 | Bacteria | 2916 |
| 185 | Ga0075367_10036510 | 3300006178 | Bacteria | 2850 |
| 186 | Ga0075367_10079230 | 3300006178 | Bacteria | 1985 |
| 187 | Ga0075367_10079889 | 3300006178 | Bacteria | 1977 |
| 188 | Ga0075367_10147459 | 3300006178 | Bacteria | 1459 |
| 189 | Ga0075427_10000124 | 3300006194 | Bacteria | 6888 |
| 190 | Ga0075366_10006199 | 3300006195 | Bacteria | 6527 |
| 191 | Ga0075366_10044597 | 3300006195 | Bacteria | 2628 |
| 192 | Ga0097621_100001960 | 3300006237 | Bacteria | 14039 |
| 193 | Ga0097621_100056292 | 3300006237 | Bacteria | 3212 |
| 194 | Ga0068871_100000443 | 3300006358 | Bacteria | 28545 |
| 195 | Ga0068871_100003970 | 3300006358 | Bacteria | 10218 |
| 196 | Ga0068871_100032465 | 3300006358 | Bacteria | 4125 |
| 197 | Ga0075428_100001993 | 3300006844 | Bacteria | 22014 |
| 198 | Ga0075428_100108391 | 3300006844 | Bacteria | 3027 |
| 199 | Ga0075430_100001036 | 3300006846 | Bacteria | 21971 |
| 200 | Ga0075430_100001212 | 3300006846 | Bacteria | 20739 |
| 201 | Ga0075430_100001234 | 3300006846 | Bacteria | 20572 |
| 202 | Ga0075430_100001401 | 3300006846 | Bacteria | 19600 |
| 203 | Ga0075430_100002889 | 3300006846 | Bacteria | 14385 |
| 204 | Ga0075430_100020954 | 3300006846 | Bacteria | 5557 |
| 205 | Ga0075430_100060941 | 3300006846 | Bacteria | 3171 |
| 206 | Ga0075431_100004308 | 3300006847 | Bacteria | 13946 |
| 207 | Ga0075431_100522540 | 3300006847 | Bacteria | 1176 |
| 208 | Ga0075433_10000231 | 3300006852 | Bacteria | 31958 |
| 209 | Ga0075433_10083977 | 3300006852 | Bacteria | 2811 |
| 210 | Ga0075434_100000271 | 3300006871 | Bacteria | 36857 |
| 211 | Ga0075434_100015400 | 3300006871 | Bacteria | 7329 |
| 212 | Ga0075434_100137581 | 3300006871 | Bacteria | 2462 |
| 213 | Ga0075434_100164590 | 3300006871 | Bacteria | 2238 |
| 214 | Ga0075434_100169058 | 3300006871 | Bacteria | 2206 |
| 215 | Ga0075434_100409772 | 3300006871 | Bacteria | 1377 |
| 216 | Ga0075429_100003189 | 3300006880 | Bacteria | 13946 |
| 217 | Ga0075429_100044202 | 3300006880 | Bacteria | 3875 |
| 218 | Ga0075429_100426131 | 3300006880 | Bacteria | 1162 |
| 219 | Ga0068865_100065756 | 3300006881 | Bacteria | 2556 |
| 220 | Ga0068865_100206072 | 3300006881 | Bacteria | 1530 |
| 221 | Ga0075436_100318703 | 3300006914 | Bacteria | 1117 |
| 222 | Ga0075436_100397801 | 3300006914 | Bacteria | 998 |
| 223 | Ga0097620_100001888 | 3300006931 | Bacteria | 21352 |
| 224 | Ga0097620_100087318 | 3300006931 | Bacteria | 3167 |
| 225 | Ga0097620_100279946 | 3300006931 | Bacteria | 1761 |
| 226 | Ga0075435_100003631 | 3300007076 | Bacteria | 10504 |
| 227 | Ga0075435_100152449 | 3300007076 | Bacteria | 1944 |
| 228 | Ga0075435_100239259 | 3300007076 | Bacteria | 1544 |
| 229 | Ga0075435_100361959 | 3300007076 | Bacteria | 1244 |
| 230 | Ga0105251_10075569 | 3300009011 | Bacteria | 1564 |
| 231 | Ga0105244_10160577 | 3300009036 | Bacteria | 1073 |
| 232 | Ga0105240_10121417 | 3300009093 | Bacteria | 3146 |
| 233 | Ga0105240_10465691 | 3300009093 | Bacteria | 1411 |
| 234 | Ga0111539_10001391 | 3300009094 | Bacteria | 32180 |
| 235 | Ga0111539_10002666 | 3300009094 | Bacteria | 23636 |
| 236 | Ga0111539_10011778 | 3300009094 | Bacteria | 10964 |
| 237 | Ga0111539_10041685 | 3300009094 | Bacteria | 5517 |
| 238 | Ga0111539_10068770 | 3300009094 | Bacteria | 4181 |
| 239 | Ga0105245_10028914 | 3300009098 | Bacteria | 4893 |
| 240 | Ga0105245_10031665 | 3300009098 | Bacteria | 4681 |
| 241 | Ga0105245_10196650 | 3300009098 | Bacteria | 1934 |
| 242 | Ga0105245_10340992 | 3300009098 | Bacteria | 1482 |
| 243 | Ga0105245_10420733 | 3300009098 | Bacteria | 1339 |
| 244 | Ga0105247_10002444 | 3300009101 | Bacteria | 12635 |
| 245 | Ga0105247_10006559 | 3300009101 | Bacteria | 7196 |
| 246 | Ga0105247_10026832 | 3300009101 | Bacteria | 3481 |
| 247 | Ga0114129_10006834 | 3300009147 | Bacteria | 16211 |
| 248 | Ga0114129_10031007 | 3300009147 | Bacteria | 7562 |
| 249 | Ga0105243_10018909 | 3300009148 | Bacteria | 5224 |
| 250 | Ga0105243_10097166 | 3300009148 | Bacteria | 2438 |
| 251 | Ga0105243_10223036 | 3300009148 | Bacteria | 1667 |
| 252 | Ga0105243_10358009 | 3300009148 | Bacteria | 1342 |
| 253 | Ga0105243_10593591 | 3300009148 | Bacteria | 1065 |
| 254 | Ga0105241_10008877 | 3300009174 | Bacteria | 7394 |
| 255 | Ga0105241_10024212 | 3300009174 | Bacteria | 4508 |
| 256 | Ga0105241_10057628 | 3300009174 | Bacteria | 2981 |
| 257 | Ga0105241_10506351 | 3300009174 | Bacteria | 1077 |
| 258 | Ga0105242_10029260 | 3300009176 | Bacteria | 4392 |
| 259 | Ga0105242_10067974 | 3300009176 | Plasmid | 2947 |
| 260 | Ga0105242_10092583 | 3300009176 | Bacteria | 2547 |
| 261 | Ga0105242_10142189 | 3300009176 | Bacteria | 2083 |
| 262 | Ga0105248_10003359 | 3300009177 | Bacteria | 17784 |
| 263 | Ga0105248_10046907 | 3300009177 | Bacteria | 4845 |
| 264 | Ga0105248_10053410 | 3300009177 | Bacteria | 4534 |
| 265 | Ga0105248_10085000 | 3300009177 | Bacteria | 3560 |
| 266 | Ga0105248_10092497 | 3300009177 | Bacteria | 3406 |
| 267 | Ga0105248_10866089 | 3300009177 | Bacteria | 1020 |
| 268 | Ga0105237_10118774 | 3300009545 | Bacteria | 2638 |
| 269 | Ga0105237_10207466 | 3300009545 | Bacteria | 1960 |
| 270 | Ga0105238_10093664 | 3300009551 | Bacteria | 2992 |
| 271 | Ga0105238_10311092 | 3300009551 | Bacteria | 1560 |
| 272 | Ga0105249_10058734 | 3300009553 | Bacteria | 3526 |
| 273 | Ga0105249_10306742 | 3300009553 | Unclassified | 1594 |
| 274 | Ga0105239_10068260 | 3300010375 | Bacteria | 3907 |
| 275 | Ga0105239_10643689 | 3300010375 | Bacteria | 1210 |
| 276 | Ga0105246_10011703 | 3300011119 | Bacteria | 5452 |
| 277 | Ga0105246_10061553 | 3300011119 | Bacteria | 2612 |
| 278 | Ga0105246_10155259 | 3300011119 | Bacteria | 1737 |
| 279 | Ga0157342_1000261 | 3300012507 | Bacteria | 2932 |
| 280 | Ga0157370_10015185 | 3300013104 | Bacteria | 7843 |
| 281 | Ga0157370_10203222 | 3300013104 | Bacteria | 1838 |
| 282 | Ga0157369_10246042 | 3300013105 | Bacteria | 1867 |
| 283 | Ga0157374_10036560 | 3300013296 | Bacteria | 4499 |
| 284 | Ga0157374_10055041 | 3300013296 | Bacteria | 3712 |
| 285 | Ga0157378_10044464 | 3300013297 | Bacteria | 3944 |
| 286 | Ga0157378_10667043 | 3300013297 | Bacteria | 1057 |
| 287 | Ga0163162_10134460 | 3300013306 | Bacteria | 2583 |
| 288 | Ga0163162_10205606 | 3300013306 | Bacteria | 2098 |
| 289 | Ga0163162_10320401 | 3300013306 | Bacteria | 1683 |
| 290 | Ga0157372_10019847 | 3300013307 | Bacteria | 7242 |
| 291 | Ga0157372_10157813 | 3300013307 | Bacteria | 2621 |
| 292 | Ga0157372_10569154 | 3300013307 | Bacteria | 1321 |
| 293 | Ga0157375_10051725 | 3300013308 | Bacteria | 4036 |
| 294 | Ga0157375_10061780 | 3300013308 | Bacteria | 3721 |
| 295 | Ga0157375_10074094 | 3300013308 | Bacteria | 3424 |
| 296 | Ga0157375_10121010 | 3300013308 | Bacteria | 2727 |
| 297 | Ga0157375_10437848 | 3300013308 | Bacteria | 1473 |
| 298 | Ga0163163_10038545 | 3300014325 | Bacteria | 4659 |
| 299 | Ga0163163_10053639 | 3300014325 | Bacteria | 3980 |
| 300 | Ga0157380_10075434 | 3300014326 | Bacteria | 2740 |
| 301 | Ga0157380_10134839 | 3300014326 | Bacteria | 2112 |
| 302 | Ga0157380_10237040 | 3300014326 | Bacteria | 1642 |
| 303 | Ga0157380_10283496 | 3300014326 | Bacteria | 1517 |
| 304 | Ga0157380_10842916 | 3300014326 | Bacteria | 938 |
| 305 | Ga0182008_10025921 | 3300014497 | Bacteria | 2974 |
| 306 | Ga0157379_10000836 | 3300014968 | Bacteria | 24921 |
| 307 | Ga0157379_10039347 | 3300014968 | Bacteria | 4218 |
| 308 | Ga0157379_10048344 | 3300014968 | Bacteria | 3796 |
| 309 | Ga0157379_10506292 | 3300014968 | Bacteria | 1120 |
| 310 | Ga0157379_10546068 | 3300014968 | Bacteria | 1078 |
| 311 | Ga0157376_10025740 | 3300014969 | Bacteria | 4637 |
| 312 | Ga0157376_10096060 | 3300014969 | Bacteria | 2578 |
| 313 | Ga0157376_10190334 | 3300014969 | Bacteria | 1881 |
| 314 | Ga0206353_10283231 | 3300020082 | Bacteria | 1382 |
| 315 | Ga0213876_10024089 | 3300021384 | Bacteria | 3214 |
| 316 | Ga0224572_1008822 | 3300024225 | Bacteria | 1871 |
| 317 | Ga0207666_1000023 | 3300025271 | Bacteria | 37093 |
| 318 | Ga0207666_1000703 | 3300025271 | Bacteria | 4014 |
| 319 | Ga0207673_1000096 | 3300025290 | Bacteria | 7770 |
| 320 | Ga0209758_1000469 | 3300025297 | Bacteria | 66568 |
| 321 | Ga0209758_1013194 | 3300025297 | Bacteria | 4537 |
| 322 | Ga0207697_10000627 | 3300025315 | Bacteria | 20084 |
| 323 | Ga0207697_10076958 | 3300025315 | Bacteria | 1403 |
| 324 | Ga0207656_10055069 | 3300025321 | Bacteria | 1730 |
| 325 | Ga0207653_10002616 | 3300025885 | Bacteria | 5715 |
| 326 | Ga0207682_10000011 | 3300025893 | Bacteria | 85533 |
| 327 | Ga0207692_10138403 | 3300025898 | Bacteria | 1382 |
| 328 | Ga0207642_10200275 | 3300025899 | Bacteria | 1102 |
| 329 | Ga0207710_10022883 | 3300025900 | Bacteria | 2682 |
| 330 | Ga0207688_10000212 | 3300025901 | Bacteria | 25999 |
| 331 | Ga0207688_10226994 | 3300025901 | Bacteria | 1126 |
| 332 | Ga0207680_10002872 | 3300025903 | Bacteria | 8068 |
| 333 | Ga0207680_10009784 | 3300025903 | Bacteria | 4771 |
| 334 | Ga0207680_10011476 | 3300025903 | Bacteria | 4479 |
| 335 | Ga0207647_10011482 | 3300025904 | Bacteria | 6210 |
| 336 | Ga0207647_10265665 | 3300025904 | Bacteria | 982 |
| 337 | Ga0207685_10002484 | 3300025905 | Bacteria | 4242 |
| 338 | Ga0207685_10011029 | 3300025905 | Bacteria | 2699 |
| 339 | Ga0207699_10046026 | 3300025906 | Bacteria | 2549 |
| 340 | Ga0207699_10048513 | 3300025906 | Bacteria | 2495 |
| 341 | Ga0207645_10002046 | 3300025907 | Bacteria | 16168 |
| 342 | Ga0207645_10016084 | 3300025907 | Bacteria | 4954 |
| 343 | Ga0207645_10051736 | 3300025907 | Bacteria | 2624 |
| 344 | Ga0207643_10003537 | 3300025908 | Bacteria | 8409 |
| 345 | Ga0207654_10231793 | 3300025911 | Bacteria | 1230 |
| 346 | Ga0207707_10156030 | 3300025912 | Bacteria | 1996 |
| 347 | Ga0207707_10243690 | 3300025912 | Bacteria | 1562 |
| 348 | Ga0207707_10510379 | 3300025912 | Unclassified | 1025 |
| 349 | Ga0207671_10145020 | 3300025914 | Bacteria | 1831 |
| 350 | Ga0207693_10001510 | 3300025915 | Bacteria | 20547 |
| 351 | Ga0207693_10007846 | 3300025915 | Bacteria | 8763 |
| 352 | Ga0207693_10149863 | 3300025915 | Bacteria | 1834 |
| 353 | Ga0207663_10011095 | 3300025916 | Bacteria | 4825 |
| 354 | Ga0207663_10026370 | 3300025916 | Bacteria | 3372 |
| 355 | Ga0207663_10029293 | 3300025916 | Bacteria | 3232 |
| 356 | Ga0207663_10060805 | 3300025916 | Unclassified | 2395 |
| 357 | Ga0207663_10147729 | 3300025916 | Bacteria | 1645 |
| 358 | Ga0207660_10001331 | 3300025917 | Bacteria | 16522 |
| 359 | Ga0207660_10041878 | 3300025917 | Bacteria | 3212 |
| 360 | Ga0207660_10090345 | 3300025917 | Bacteria | 2269 |
| 361 | Ga0207660_10394341 | 3300025917 | Bacteria | 1114 |
| 362 | Ga0207662_10000370 | 3300025918 | Bacteria | 20235 |
| 363 | Ga0207662_10040020 | 3300025918 | Bacteria | 2753 |
| 364 | Ga0207662_10048451 | 3300025918 | Bacteria | 2517 |
| 365 | Ga0207662_10081911 | 3300025918 | Bacteria | 1971 |
| 366 | Ga0207662_10245452 | 3300025918 | Bacteria | 1173 |
| 367 | Ga0207657_10003563 | 3300025919 | Bacteria | 16610 |
| 368 | Ga0207657_10020389 | 3300025919 | Bacteria | 6265 |
| 369 | Ga0207657_10023586 | 3300025919 | Bacteria | 5725 |
| 370 | Ga0207694_10373956 | 3300025924 | Unclassified | 1182 |
| 371 | Ga0207650_10052664 | 3300025925 | Bacteria | 3015 |
| 372 | Ga0207650_10147926 | 3300025925 | Bacteria | 1851 |
| 373 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 374 | Ga0207659_10069445 | 3300025926 | Bacteria | 2566 |
| 375 | Ga0207659_10100975 | 3300025926 | Bacteria | 2175 |
| 376 | Ga0207687_10004134 | 3300025927 | Bacteria | 9720 |
| 377 | Ga0207687_10042557 | 3300025927 | Bacteria | 3126 |
| 378 | Ga0207687_10061649 | 3300025927 | Bacteria | 2649 |
| 379 | Ga0207687_10346536 | 3300025927 | Bacteria | 1209 |
| 380 | Ga0207700_10000590 | 3300025928 | Bacteria | 21178 |
| 381 | Ga0207700_10132628 | 3300025928 | Bacteria | 2036 |
| 382 | Ga0207700_10254216 | 3300025928 | Bacteria | 1502 |
| 383 | Ga0207664_10423808 | 3300025929 | Bacteria | 1186 |
| 384 | Ga0207644_10006109 | 3300025931 | Bacteria | 7852 |
| 385 | Ga0207690_10000758 | 3300025932 | Bacteria | 20840 |
| 386 | Ga0207706_10004191 | 3300025933 | Bacteria | 13575 |
| 387 | Ga0207706_10064878 | 3300025933 | Bacteria | 3215 |
| 388 | Ga0207706_10096182 | 3300025933 | Unclassified | 2604 |
| 389 | Ga0207706_10357878 | 3300025933 | Bacteria | 1268 |
| 390 | Ga0207686_10004502 | 3300025934 | Bacteria | 7466 |
| 391 | Ga0207686_10082329 | 3300025934 | Bacteria | 2104 |
| 392 | Ga0207686_10174003 | 3300025934 | Bacteria | 1521 |
| 393 | Ga0207709_10124871 | 3300025935 | Bacteria | 1744 |
| 394 | Ga0207709_10165663 | 3300025935 | Bacteria | 1546 |
| 395 | Ga0207670_10000358 | 3300025936 | Bacteria | 26775 |
| 396 | Ga0207670_10052418 | 3300025936 | Bacteria | 2743 |
| 397 | Ga0207670_10226278 | 3300025936 | Bacteria | 1434 |
| 398 | Ga0207670_10421094 | 3300025936 | Bacteria | 1071 |
| 399 | Ga0207670_10511804 | 3300025936 | Bacteria | 976 |
| 400 | Ga0207669_10012840 | 3300025937 | Bacteria | 4134 |
| 401 | Ga0207669_10016340 | 3300025937 | Bacteria | 3768 |
| 402 | Ga0207669_10070612 | 3300025937 | Bacteria | 2190 |
| 403 | Ga0207704_10001593 | 3300025938 | Bacteria | 10195 |
| 404 | Ga0207704_10037420 | 3300025938 | Bacteria | 2803 |
| 405 | Ga0207665_10004996 | 3300025939 | Bacteria | 8849 |
| 406 | Ga0207665_10076827 | 3300025939 | Bacteria | 2291 |
| 407 | Ga0207665_10445308 | 3300025939 | Bacteria | 993 |
| 408 | Ga0207691_10003120 | 3300025940 | Bacteria | 16182 |
| 409 | Ga0207691_10285112 | 3300025940 | Bacteria | 1421 |
| 410 | Ga0207691_10571794 | 3300025940 | Bacteria | 958 |
| 411 | Ga0207711_10003815 | 3300025941 | Bacteria | 12963 |
| 412 | Ga0207711_10011321 | 3300025941 | Bacteria | 7410 |
| 413 | Ga0207711_10029896 | 3300025941 | Bacteria | 4595 |
| 414 | Ga0207711_10209736 | 3300025941 | Bacteria | 1779 |
| 415 | Ga0207711_10481379 | 3300025941 | Bacteria | 1156 |
| 416 | Ga0207689_10002572 | 3300025942 | Bacteria | 16806 |
| 417 | Ga0207689_10022090 | 3300025942 | Bacteria | 5351 |
| 418 | Ga0207661_10025019 | 3300025944 | Bacteria | 4533 |
| 419 | Ga0207661_10139415 | 3300025944 | Bacteria | 2086 |
| 420 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 421 | Ga0207679_10032446 | 3300025945 | Bacteria | 3666 |
| 422 | Ga0207667_10120678 | 3300025949 | Bacteria | 2701 |
| 423 | Ga0207651_10000487 | 3300025960 | Bacteria | 16704 |
| 424 | Ga0207712_10001407 | 3300025961 | Bacteria | 16410 |
| 425 | Ga0207668_10000474 | 3300025972 | Bacteria | 25172 |
| 426 | Ga0207668_10033807 | 3300025972 | Bacteria | 3390 |
| 427 | Ga0207668_10472303 | 3300025972 | Bacteria | 1074 |
| 428 | Ga0207668_10648162 | 3300025972 | Bacteria | 924 |
| 429 | Ga0207640_10010302 | 3300025981 | Bacteria | 5261 |
| 430 | Ga0207640_10108903 | 3300025981 | Bacteria | 1959 |
| 431 | Ga0207658_10011216 | 3300025986 | Bacteria | 6105 |
| 432 | Ga0207658_10144371 | 3300025986 | Bacteria | 1930 |
| 433 | Ga0207658_10178968 | 3300025986 | Bacteria | 1753 |
| 434 | Ga0207658_10192792 | 3300025986 | Bacteria | 1695 |
| 435 | Ga0207677_10001084 | 3300026023 | Bacteria | 14821 |
| 436 | Ga0207677_10012758 | 3300026023 | Bacteria | 4847 |
| 437 | Ga0207703_10073479 | 3300026035 | Bacteria | 2829 |
| 438 | Ga0207703_10181091 | 3300026035 | Bacteria | 1860 |
| 439 | Ga0207703_10183525 | 3300026035 | Bacteria | 1848 |
| 440 | Ga0207639_10106561 | 3300026041 | Bacteria | 2275 |
| 441 | Ga0207639_10213131 | 3300026041 | Bacteria | 1664 |
| 442 | Ga0207678_10009141 | 3300026067 | Bacteria | 8728 |
| 443 | Ga0207678_10028553 | 3300026067 | Bacteria | 4869 |
| 444 | Ga0207678_10070433 | 3300026067 | Bacteria | 2998 |
| 445 | Ga0207678_10086479 | 3300026067 | Bacteria | 2679 |
| 446 | Ga0207678_10160242 | 3300026067 | Bacteria | 1922 |
| 447 | Ga0207708_10001391 | 3300026075 | Bacteria | 18182 |
| 448 | Ga0207708_10002206 | 3300026075 | Bacteria | 14391 |
| 449 | Ga0207708_10049977 | 3300026075 | Bacteria | 3184 |
| 450 | Ga0207708_10238382 | 3300026075 | Bacteria | 1462 |
| 451 | Ga0207702_10009283 | 3300026078 | Bacteria | 8262 |
| 452 | Ga0207702_10506606 | 3300026078 | Bacteria | 1177 |
| 453 | Ga0207641_10007214 | 3300026088 | Bacteria | 9264 |
| 454 | Ga0207641_10277390 | 3300026088 | Bacteria | 1575 |
| 455 | Ga0207648_10002405 | 3300026089 | Bacteria | 20161 |
| 456 | Ga0207648_10033311 | 3300026089 | Bacteria | 4544 |
| 457 | Ga0207676_10001364 | 3300026095 | Bacteria | 18171 |
| 458 | Ga0207676_10042727 | 3300026095 | Bacteria | 3486 |
| 459 | Ga0207676_10091959 | 3300026095 | Bacteria | 2494 |
| 460 | Ga0207674_10004931 | 3300026116 | Bacteria | 15954 |
| 461 | Ga0207675_100004770 | 3300026118 | Bacteria | 13063 |
| 462 | Ga0207675_100301568 | 3300026118 | Bacteria | 1560 |
| 463 | Ga0207675_100424161 | 3300026118 | Bacteria | 1314 |
| 464 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 465 | Ga0207683_10009986 | 3300026121 | Bacteria | 8101 |
| 466 | Ga0207683_10087706 | 3300026121 | Bacteria | 2767 |
| 467 | Ga0207683_10139729 | 3300026121 | Bacteria | 2182 |
| 468 | Ga0207698_10371970 | 3300026142 | Bacteria | 1357 |
| 469 | Ga0209967_1002937 | 3300027364 | Bacteria | 2231 |
| 470 | Ga0209981_1000449 | 3300027378 | Bacteria | 5207 |
| 471 | Ga0210000_1000242 | 3300027462 | Bacteria | 7786 |
| 472 | Ga0209995_1013080 | 3300027471 | Bacteria | 1358 |
| 473 | Ga0209983_1009445 | 3300027665 | Bacteria | 1995 |
| 474 | Ga0209983_1018033 | 3300027665 | Bacteria | 1464 |
| 475 | Ga0209971_1011217 | 3300027682 | Bacteria | 2122 |
| 476 | Ga0209966_1002165 | 3300027695 | Bacteria | 3275 |
| 477 | Ga0209966_1003074 | 3300027695 | Bacteria | 2799 |
| 478 | Ga0209966_1005605 | 3300027695 | Bacteria | 2158 |
| 479 | Ga0209966_1013971 | 3300027695 | Bacteria | 1494 |
| 480 | Ga0209974_10066311 | 3300027876 | Bacteria | 1227 |
| 481 | Ga0209974_10102865 | 3300027876 | Bacteria | 999 |
| 482 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 483 | Ga0207428_10000851 | 3300027907 | Bacteria | 34354 |
| 484 | Ga0207428_10001235 | 3300027907 | Bacteria | 27417 |
| 485 | Ga0207428_10306142 | 3300027907 | Bacteria | 1175 |
| 486 | Ga0265357_1000593 | 3300028023 | Bacteria | 2218 |
| 487 | Ga0268266_10039685 | 3300028379 | Bacteria | 4010 |
| 488 | Ga0268266_10847344 | 3300028379 | Bacteria | 883 |
| 489 | Ga0268265_10001023 | 3300028380 | Bacteria | 25231 |
| 490 | Ga0268265_10064443 | 3300028380 | Bacteria | 2823 |
| 491 | Ga0268264_10001465 | 3300028381 | Bacteria | 22046 |
| 492 | Ga0268264_10073361 | 3300028381 | Bacteria | 2904 |
| 493 | Ga0265337_1000345 | 3300028556 | Bacteria | 24838 |
| 494 | Ga0265338_10024461 | 3300028800 | Bacteria | 6168 |
| 495 | Ga0265325_10000043 | 3300031241 | Bacteria | 89158 |
| 496 | Ga0265325_10002436 | 3300031241 | Bacteria | 12563 |
| 497 | Ga0265325_10005946 | 3300031241 | Bacteria | 7475 |
| 498 | Ga0265325_10007742 | 3300031241 | Bacteria | 6400 |
| 499 | Ga0265325_10136468 | 3300031241 | Bacteria | 1170 |
| 500 | Ga0265325_10136722 | 3300031241 | Bacteria | 1169 |
| 501 | Ga0265339_10000085 | 3300031249 | Bacteria | 79483 |
| 502 | Ga0265339_10017208 | 3300031249 | Bacteria | 4285 |
| 503 | Ga0265331_10015805 | 3300031250 | Bacteria | 3976 |
| 504 | Ga0265313_10000505 | 3300031595 | Bacteria | 40966 |
| 505 | Ga0265313_10003283 | 3300031595 | Bacteria | 13282 |
| 506 | Ga0265313_10008462 | 3300031595 | Bacteria | 6826 |
| 507 | Ga0265313_10044426 | 3300031595 | Bacteria | 2168 |
| 508 | Ga0265314_10001067 | 3300031711 | Bacteria | 31824 |
| 509 | Ga0265314_10022307 | 3300031711 | Bacteria | 4851 |
| 510 | Ga0307406_10146104 | 3300031901 | Bacteria | 1681 |
| 511 | Ga0307416_100071702 | 3300032002 | Bacteria | 2879 |
| 512 | Ga0307411_10305276 | 3300032005 | Bacteria | 1278 |
| 513 | Ga0307415_100860322 | 3300032126 | Bacteria | 833 |
| 514 | Ga0373948_0002778 | 3300034817 | Bacteria | 2626 |
| 515 | Ga0373948_0042211 | 3300034817 | Unclassified | 957 |
| 516 | Ga0373948_0060197 | 3300034817 | Bacteria | 833 |
| 517 | Ga0373950_0000279 | 3300034818 | Bacteria | 6447 |
| 518 | Ga0373950_0008864 | 3300034818 | Unclassified | 1593 |
| 519 | Ga0373958_0000746 | 3300034819 | Bacteria | 4152 |
| 520 | Ga0373959_0000072 | 3300034820 | Bacteria | 22681 |
| 521 | Ga0373938_0000378 | 3300034957 | Bacteria | 7139 |
| 522 | Ga0373926_0002906 | 3300035083 | Bacteria | 5495 |
| 523 | Ga0373926_0015860 | 3300035083 | Bacteria | 2571 |
| 524 | Ga0373926_0086622 | 3300035083 | Bacteria | 1162 |
| 525 | Ga0373928_0003260 | 3300035084 | Bacteria | 3109 |
| 526 | Ga0373928_0007693 | 3300035084 | Bacteria | 2082 |
| 527 | Ga0373928_0044178 | 3300035084 | Bacteria | 1033 |
| 528 | Ga0373929_0000199 | 3300035085 | Bacteria | 10691 |
| 529 | Ga0373940_0065915 | 3300035088 | Bacteria | 1045 |
| 530 | Ga0373944_0007051 | 3300035089 | Bacteria | 3003 |
| 531 | Ga0373949_0000406 | 3300035090 | Bacteria | 15004 |
| 532 | Ga0373949_0041392 | 3300035090 | Bacteria | 1134 |
| 533 | Ga0373951_0000404 | 3300035091 | Bacteria | 12744 |
| 534 | Ga0373951_0027676 | 3300035091 | Bacteria | 1324 |
| 535 | Ga0373952_0000261 | 3300035092 | Bacteria | 8645 |
| 536 | Ga0373952_0007588 | 3300035092 | Bacteria | 2037 |
| 537 | Ga0373952_0026843 | 3300035092 | Bacteria | 1253 |
| 538 | Ga0373952_0075326 | 3300035092 | Bacteria | 851 |
| 539 | Ga0373923_0002366 | 3300035111 | Bacteria | 5786 |
| 540 | Ga0373923_0006572 | 3300035111 | Bacteria | 4028 |
| 541 | Ga0373923_0054899 | 3300035111 | Bacteria | 1678 |
| 542 | Ga0373923_0089582 | 3300035111 | Bacteria | 1344 |
| 543 | Ga0373932_0001164 | 3300035112 | Bacteria | 7562 |
| 544 | Ga0373932_0130568 | 3300035112 | Bacteria | 846 |
| 545 | Ga0373936_0004145 | 3300035113 | Bacteria | 5465 |
| 546 | Ga0373936_0034730 | 3300035113 | Bacteria | 2005 |
| 547 | Ga0373936_0040150 | 3300035113 | Bacteria | 1874 |
| 548 | Ga0373939_0035442 | 3300035114 | Bacteria | 1470 |
| 549 | Ga0373939_0086951 | 3300035114 | Unclassified | 1049 |
| 550 | Ga0373941_0010011 | 3300035115 | Bacteria | 2407 |
| 551 | Ga0373941_0027580 | 3300035115 | Bacteria | 1659 |
| 552 | Ga0373945_0000668 | 3300035116 | Bacteria | 9919 |
| 553 | Ga0373945_0028747 | 3300035116 | Bacteria | 1949 |
| 554 | Ga0373953_0001620 | 3300035117 | Bacteria | 6588 |
| 555 | Ga0373953_0005144 | 3300035117 | Bacteria | 4227 |
| 556 | Ga0373954_0001884 | 3300035118 | Bacteria | 8661 |
| 557 | Ga0373954_0009096 | 3300035118 | Bacteria | 4368 |
| 558 | Ga0373954_0085116 | 3300035118 | Bacteria | 1514 |
| 559 | Ga0373954_0138474 | 3300035118 | Bacteria | 1187 |
| 560 | Ga0373956_0010440 | 3300035119 | Bacteria | 3807 |
| 561 | Ga0373956_0050889 | 3300035119 | Bacteria | 1861 |
| 562 | Ga0373956_0055781 | 3300035119 | Bacteria | 1782 |
| 563 | Ga0373957_0026192 | 3300035120 | Bacteria | 2107 |
| 564 | Ga0373960_0042814 | 3300035121 | Bacteria | 1316 |
| 565 | Ga0373960_0074755 | 3300035121 | Bacteria | 1055 |
| 566 | Ga0373960_0075204 | 3300035121 | Bacteria | 1052 |
| 567 | Ga0373943_0004499 | 3300035170 | Bacteria | 6307 |
| 568 | Ga0373943_0013973 | 3300035170 | Bacteria | 3630 |
| 569 | Ga0373943_0018512 | 3300035170 | Bacteria | 3201 |
| 570 | Ga0373943_0060346 | 3300035170 | Bacteria | 1893 |
| 571 | Ga0373946_0111196 | 3300035171 | Bacteria | 1240 |
| 572 | Ga0373946_0133050 | 3300035171 | Bacteria | 1146 |
| 573 | Ga0373946_0136105 | 3300035171 | Bacteria | 1134 |
| 574 | Ga0373955_0003830 | 3300035172 | Bacteria | 6630 |
| 575 | Ga0373955_0012329 | 3300035172 | Bacteria | 4108 |
| 576 | Ga0373955_0054861 | 3300035172 | Bacteria | 2181 |
| 577 | Ga0373942_0011809 | 3300035207 | Bacteria | 2076 |
| 578 | Ga0373942_0022526 | 3300035207 | Bacteria | 1599 |
| 579 | Ga0373961_0004521 | 3300035241 | Bacteria | 3361 |
| 580 | Ga0373961_0019638 | 3300035241 | Bacteria | 1777 |
| 581 | Ga0373962_0069552 | 3300035242 | Unclassified | 1049 |
| 582 | Ga0373924_0005992 | 3300035410 | Bacteria | 4335 |
| 583 | Ga0373924_0026106 | 3300035410 | Bacteria | 2314 |
| 584 | Ga0373931_0004664 | 3300035691 | Bacteria | 6272 |
| 585 | Ga0373931_0006426 | 3300035691 | Bacteria | 5491 |
| 586 | Ga0373931_0006940 | 3300035691 | Bacteria | 5328 |
| 587 | Ga0373931_0007446 | 3300035691 | Bacteria | 5157 |
| 588 | Ga0373931_0134094 | 3300035691 | Bacteria | 1428 |
| 589 | Ga0373935_0010928 | 3300035692 | Bacteria | 5449 |
| 590 | Ga0373935_0033150 | 3300035692 | Bacteria | 3213 |
| 591 | Ga0373935_0059195 | 3300035692 | Bacteria | 2448 |
| 592 | Ga0373935_0059945 | 3300035692 | Bacteria | 2434 |
| 593 | Ga0373935_0184413 | 3300035692 | Bacteria | 1434 |
| 594 | Ga0373935_0196912 | 3300035692 | Bacteria | 1390 |
| 595 | Ga0373927_0006334 | 3300035695 | Bacteria | 8063 |
| 596 | Ga0373927_0014865 | 3300035695 | Bacteria | 5148 |
| 597 | Ga0373927_0174768 | 3300035695 | Bacteria | 1408 |
| 598 | Ga0373927_0282185 | 3300035695 | Bacteria | 1092 |
| 599 | Ga0373927_0304394 | 3300035695 | Bacteria | 1049 |
| 600 | Ga0373933_0002425 | 3300035724 | Bacteria | 10522 |
| 601 | Ga0373933_0013860 | 3300035724 | Bacteria | 4472 |
| 602 | Ga0373933_0020733 | 3300035724 | Bacteria | 3726 |
| 603 | Ga0373933_0044752 | 3300035724 | Bacteria | 2623 |
| 604 | Ga0373933_0047216 | 3300035724 | Bacteria | 2560 |
| 605 | Ga0373947_0004414 | 3300035725 | Bacteria | 8250 |
| 606 | Ga0373947_0132550 | 3300035725 | Bacteria | 1592 |
| 607 | Ga0373937_0003517 | 3300036401 | Bacteria | 13178 |
| 608 | Ga0373937_0005472 | 3300036401 | Bacteria | 10876 |
| 609 | Ga0373937_0006936 | 3300036401 | Bacteria | 9782 |
| 610 | Ga0373937_0007990 | 3300036401 | Bacteria | 9172 |
| 611 | Ga0373937_0340674 | 3300036401 | Bacteria | 1420 |
| 612 | Ga0373937_0683867 | 3300036401 | Unclassified | 972 |
| 613 | Ga0373925_0003383 | 3300037068 | Bacteria | 12366 |
| 614 | Ga0373925_0007098 | 3300037068 | Bacteria | 8188 |
| 615 | Ga0373925_0032046 | 3300037068 | Bacteria | 3866 |
| 616 | Ga0373925_0042882 | 3300037068 | Bacteria | 3357 |
| 617 | Ga0373925_0044048 | 3300037068 | Bacteria | 3313 |
| 618 | Ga0373925_0095121 | 3300037068 | Bacteria | 2281 |
| 619 | Ga0242420_006937 | 3300038996 | Bacteria | 1805 |
| 620 | Ga0436365_0590730 | 3300039437 | Bacteria | 1250 |
| 621 | Ga0436365_0630398 | 3300039437 | Bacteria | 2315 |
| 622 | Ga0436365_1800837 | 3300039437 | Bacteria | 1547 |
| 623 | Ga0436363_0033271 | 3300039450 | Bacteria | 1821 |
| 624 | Ga0439453_0003678 | 3300041408 | Bacteria | 2225 |
| 625 | Ga0439461_0032404 | 3300041410 | Bacteria | 1095 |
| 626 | Ga0439441_003340 | 3300042001 | Bacteria | 2360 |
| 627 | Ga0439450_050911 | 3300042008 | Bacteria | 983 |
| 628 | Ga0439451_033953 | 3300042009 | Bacteria | 1026 |
| 629 | Ga0450923_005649 | 3300042125 | Bacteria | 2033 |
| 630 | Ga0439446_0054272 | 3300042156 | Bacteria | 1202 |
| 631 | Ga0439435_0000162 | 3300042436 | Bacteria | 9223 |
| 632 | Ga0439435_0001286 | 3300042436 | Bacteria | 4558 |
| 633 | Ga0439444_0001368 | 3300042437 | Bacteria | 3136 |
| 634 | Ga0439444_0005809 | 3300042437 | Bacteria | 1842 |
| 635 | Ga0439464_0031411 | 3300042439 | Bacteria | 1490 |
| 636 | Ga0439460_0003474 | 3300042461 | Bacteria | 3813 |
| 637 | Ga0453684_0181456 | 3300044712 | Bacteria | 2471 |
| 638 | Ga0451576_0079606 | 3300045051 | Bacteria | 3409 |
| 639 | Ga0495592_0004212 | 3300046454 | Bacteria | 10505 |
| 640 | Ga0495592_0007097 | 3300046454 | Bacteria | 8383 |
| 641 | Ga0495592_0008484 | 3300046454 | Bacteria | 7711 |
| 642 | Ga0495592_0061291 | 3300046454 | Bacteria | 2765 |
| 643 | Ga0495592_0293514 | 3300046454 | Bacteria | 1059 |
| 644 | Ga0495603_0115615 | 3300046455 | Bacteria | 1564 |
| 645 | Ga0495629_0000062 | 3300046459 | Bacteria | 97169 |
| 646 | Ga0495629_0013668 | 3300046459 | Bacteria | 5857 |
| 647 | Ga0495629_0156299 | 3300046459 | Bacteria | 1584 |
| 648 | Ga0495629_0367284 | 3300046459 | Bacteria | 980 |
| 649 | Ga0495641_0005773 | 3300046461 | Bacteria | 8219 |
| 650 | Ga0495641_0058068 | 3300046461 | Bacteria | 1752 |
| 651 | Ga0495651_0000198 | 3300046462 | Bacteria | 45766 |
| 652 | Ga0495651_0000786 | 3300046462 | Bacteria | 24616 |
| 653 | Ga0495651_0001525 | 3300046462 | Bacteria | 17903 |
| 654 | Ga0495651_0044602 | 3300046462 | Bacteria | 3436 |
| 655 | Ga0495651_0115195 | 3300046462 | Bacteria | 1982 |
| 656 | Ga0495653_0000637 | 3300046463 | Bacteria | 26722 |
| 657 | Ga0495653_0004143 | 3300046463 | Bacteria | 11728 |
| 658 | Ga0495653_0013367 | 3300046463 | Bacteria | 6690 |
| 659 | Ga0495580_0025191 | 3300046472 | Bacteria | 4348 |
| 660 | Ga0495580_0099274 | 3300046472 | Bacteria | 2025 |
| 661 | Ga0495582_0006436 | 3300046473 | Bacteria | 6524 |
| 662 | Ga0495605_0067416 | 3300046474 | Bacteria | 1698 |
| 663 | Ga0495639_0011168 | 3300046475 | Bacteria | 3868 |
| 664 | Ga0495639_0109778 | 3300046475 | Bacteria | 1308 |
| 665 | Ga0495662_0018392 | 3300046476 | Bacteria | 3382 |
| 666 | Ga0495662_0023349 | 3300046476 | Bacteria | 2986 |
| 667 | Ga0495662_0124313 | 3300046476 | Bacteria | 1267 |
| 668 | Ga0495664_0003341 | 3300046477 | Bacteria | 8722 |
| 669 | Ga0495664_0026814 | 3300046477 | Bacteria | 3357 |
| 670 | Ga0495664_0101867 | 3300046477 | Bacteria | 1730 |
| 671 | Ga0495664_0173006 | 3300046477 | Bacteria | 1310 |
| 672 | Ga0495585_0010974 | 3300046492 | Bacteria | 5381 |
| 673 | Ga0495594_0001170 | 3300046499 | Bacteria | 13725 |
| 674 | Ga0495594_0016090 | 3300046499 | Bacteria | 3935 |
| 675 | Ga0495607_0085826 | 3300046501 | Bacteria | 1718 |
| 676 | Ga0495608_0000129 | 3300046511 | Bacteria | 53862 |
| 677 | Ga0495608_0001490 | 3300046511 | Bacteria | 16661 |
| 678 | Ga0495608_0006737 | 3300046511 | Bacteria | 8146 |
| 679 | Ga0495608_0126167 | 3300046511 | Bacteria | 1639 |
| 680 | Ga0495608_0366716 | 3300046511 | Bacteria | 884 |
| 681 | Ga0495618_0001889 | 3300046514 | Bacteria | 13794 |
| 682 | Ga0495618_0003324 | 3300046514 | Bacteria | 10055 |
| 683 | Ga0495618_0019734 | 3300046514 | Bacteria | 4148 |
| 684 | Ga0495618_0108429 | 3300046514 | Bacteria | 1778 |
| 685 | Ga0495618_0168749 | 3300046514 | Bacteria | 1393 |
| 686 | Ga0495618_0190180 | 3300046514 | Bacteria | 1302 |
| 687 | Ga0495618_0216421 | 3300046514 | Bacteria | 1210 |
| 688 | Ga0495628_0002820 | 3300046516 | Bacteria | 15591 |
| 689 | Ga0495628_0003583 | 3300046516 | Bacteria | 13897 |
| 690 | Ga0495628_0042233 | 3300046516 | Bacteria | 3638 |
| 691 | Ga0495628_0049548 | 3300046516 | Bacteria | 3326 |
| 692 | Ga0495630_0016604 | 3300046517 | Bacteria | 5384 |
| 693 | Ga0495630_0079439 | 3300046517 | Bacteria | 2474 |
| 694 | Ga0495630_0121617 | 3300046517 | Bacteria | 1980 |
| 695 | Ga0495630_0425377 | 3300046517 | Bacteria | 1018 |
| 696 | Ga0495644_0003944 | 3300046523 | Bacteria | 5832 |
| 697 | Ga0495652_0002132 | 3300046529 | Bacteria | 20866 |
| 698 | Ga0495652_0005898 | 3300046529 | Bacteria | 11458 |
| 699 | Ga0495652_0006193 | 3300046529 | Bacteria | 11162 |
| 700 | Ga0495652_0022579 | 3300046529 | Bacteria | 5583 |
| 701 | Ga0495652_0102520 | 3300046529 | Bacteria | 2318 |
| 702 | Ga0495652_0135173 | 3300046529 | Bacteria | 1947 |
| 703 | Ga0495665_0000858 | 3300046531 | Bacteria | 15925 |
| 704 | Ga0495665_0125460 | 3300046531 | Bacteria | 1344 |
| 705 | Ga0495640_0008539 | 3300046533 | Bacteria | 8030 |
| 706 | Ga0495640_0020078 | 3300046533 | Bacteria | 4924 |
| 707 | Ga0495640_0036202 | 3300046533 | Bacteria | 3487 |
| 708 | Ga0495640_0170276 | 3300046533 | Bacteria | 1392 |
| 709 | Ga0495586_0023273 | 3300046535 | Bacteria | 3307 |
| 710 | Ga0495586_0024166 | 3300046535 | Bacteria | 3246 |
| 711 | Ga0495587_0001240 | 3300046536 | Bacteria | 16941 |
| 712 | Ga0495587_0002939 | 3300046536 | Bacteria | 11399 |
| 713 | Ga0495587_0007485 | 3300046536 | Bacteria | 7071 |
| 714 | Ga0495609_0126862 | 3300046538 | Bacteria | 1095 |
| 715 | Ga0495645_0004147 | 3300046543 | Bacteria | 9901 |
| 716 | Ga0495645_0005941 | 3300046543 | Bacteria | 8435 |
| 717 | Ga0495645_0200276 | 3300046543 | Bacteria | 1355 |
| 718 | Ga0495622_0003230 | 3300046557 | Bacteria | 7725 |
| 719 | Ga0495622_0049083 | 3300046557 | Bacteria | 1960 |
| 720 | Ga0495633_0004354 | 3300046558 | Bacteria | 9041 |
| 721 | Ga0495667_0005015 | 3300046559 | Bacteria | 8945 |
| 722 | Ga0495667_0008282 | 3300046559 | Bacteria | 7049 |
| 723 | Ga0495667_0027384 | 3300046559 | Bacteria | 3842 |
| 724 | Ga0495667_0089540 | 3300046559 | Bacteria | 1994 |
| 725 | Ga0495667_0108197 | 3300046559 | Bacteria | 1796 |
| 726 | Ga0495667_0138784 | 3300046559 | Bacteria | 1567 |
| 727 | Ga0495656_0001803 | 3300046615 | Bacteria | 7042 |
| 728 | Ga0495634_0055095 | 3300046642 | Bacteria | 2659 |
| 729 | Ga0495634_0056584 | 3300046642 | Bacteria | 2619 |
| 730 | Ga0495634_0074562 | 3300046642 | Bacteria | 2229 |
| 731 | Ga0495634_0077844 | 3300046642 | Bacteria | 2173 |
| 732 | Ga0495634_0103057 | 3300046642 | Bacteria | 1842 |
| 733 | Ga0495611_0040555 | 3300046648 | Bacteria | 2076 |
| 734 | Ga0495635_0001121 | 3300046663 | Bacteria | 17818 |
| 735 | Ga0495635_0001404 | 3300046663 | Bacteria | 16066 |
| 736 | Ga0495635_0001797 | 3300046663 | Bacteria | 14500 |
| 737 | Ga0495635_0021629 | 3300046663 | Bacteria | 4484 |
| 738 | Ga0495635_0046504 | 3300046663 | Bacteria | 2994 |
| 739 | Ga0495635_0286102 | 3300046663 | Bacteria | 1107 |
| 740 | Ga0495659_0002049 | 3300046664 | Bacteria | 6592 |
| 741 | Ga0495661_0043906 | 3300046665 | Bacteria | 2744 |
| 742 | Ga0495588_0010862 | 3300046674 | Bacteria | 4254 |
| 743 | Ga0495588_0099136 | 3300046674 | Bacteria | 1530 |
| 744 | Ga0495657_0008038 | 3300046675 | Bacteria | 8088 |
| 745 | Ga0495657_0085864 | 3300046675 | Bacteria | 2028 |
| 746 | Ga0495657_0101438 | 3300046675 | Bacteria | 1833 |
| 747 | Ga0495657_0167156 | 3300046675 | Bacteria | 1357 |
| 748 | Ga0495657_0185835 | 3300046675 | Bacteria | 1272 |
| 749 | Ga0495599_0000871 | 3300046678 | Bacteria | 16887 |
| 750 | Ga0495599_0031212 | 3300046678 | Bacteria | 3344 |
| 751 | Ga0495599_0034449 | 3300046678 | Bacteria | 3181 |
| 752 | Ga0495623_0000055 | 3300046679 | Bacteria | 69548 |
| 753 | Ga0495623_0001077 | 3300046679 | Bacteria | 18487 |
| 754 | Ga0495623_0008134 | 3300046679 | Bacteria | 6817 |
| 755 | Ga0495623_0257076 | 3300046679 | Bacteria | 980 |
| 756 | Ga0495646_0002042 | 3300046680 | Bacteria | 12239 |
| 757 | Ga0495646_0003544 | 3300046680 | Bacteria | 9724 |
| 758 | Ga0495646_0029495 | 3300046680 | Bacteria | 3429 |
| 759 | Ga0495646_0170459 | 3300046680 | Bacteria | 1200 |
| 760 | Ga0495647_0006994 | 3300046681 | Bacteria | 3760 |
| 761 | Ga0495647_0016227 | 3300046681 | Bacteria | 2619 |
| 762 | Ga0495647_0099726 | 3300046681 | Bacteria | 1201 |
| 763 | Ga0495658_0004161 | 3300046683 | Bacteria | 7127 |
| 764 | Ga0495669_0047021 | 3300046684 | Bacteria | 1927 |
| 765 | Ga0495613_0003377 | 3300046689 | Bacteria | 11931 |
| 766 | Ga0495613_0004171 | 3300046689 | Bacteria | 10816 |
| 767 | Ga0495613_0414481 | 3300046689 | Bacteria | 917 |
| 768 | Ga0495624_0026573 | 3300046690 | Bacteria | 3792 |
| 769 | Ga0495624_0081712 | 3300046690 | Bacteria | 2001 |
| 770 | Ga0495624_0087763 | 3300046690 | Bacteria | 1921 |
| 771 | Ga0495624_0196918 | 3300046690 | Bacteria | 1225 |
| 772 | Ga0495670_0004753 | 3300046691 | Bacteria | 6671 |
| 773 | Ga0495600_0000293 | 3300046809 | Bacteria | 26819 |
| 774 | Ga0495600_0017754 | 3300046809 | Bacteria | 4529 |
| 775 | Ga0495600_0018500 | 3300046809 | Bacteria | 4439 |
| 776 | Ga0495600_0049234 | 3300046809 | Bacteria | 2749 |
| 777 | Ga0495600_0055719 | 3300046809 | Bacteria | 2582 |
| 778 | Ga0495581_0011015 | 3300047315 | Bacteria | 5226 |
| 779 | Ga0495581_0064889 | 3300047315 | Bacteria | 2110 |
| 780 | Ga0495604_0001806 | 3300047317 | Bacteria | 17433 |
| 781 | Ga0495604_0002503 | 3300047317 | Bacteria | 14670 |
| 782 | Ga0495604_0005734 | 3300047317 | Bacteria | 9845 |
| 783 | Ga0495604_0007487 | 3300047317 | Bacteria | 8640 |
| 784 | Ga0495604_0071368 | 3300047317 | Bacteria | 2627 |
| 785 | Ga0495604_0100000 | 3300047317 | Bacteria | 2133 |
| 786 | Ga0495674_0009382 | 3300047319 | Bacteria | 9302 |
| 787 | Ga0495674_0048385 | 3300047319 | Bacteria | 3763 |
| 788 | Ga0495674_0068175 | 3300047319 | Bacteria | 3079 |
| 789 | Ga0495674_0076095 | 3300047319 | Bacteria | 2887 |
| 790 | Ga0495674_0145656 | 3300047319 | Bacteria | 1988 |
| 791 | Ga0495676_0029654 | 3300047321 | Bacteria | 4656 |
| 792 | Ga0495680_0001199 | 3300047322 | Bacteria | 28457 |
| 793 | Ga0495680_0001339 | 3300047322 | Bacteria | 26787 |
| 794 | Ga0495680_0007362 | 3300047322 | Bacteria | 10111 |
| 795 | Ga0495680_0021607 | 3300047322 | Bacteria | 5385 |
| 796 | Ga0495680_0033484 | 3300047322 | Bacteria | 4159 |
| 797 | Ga0495680_0042824 | 3300047322 | Bacteria | 3589 |
| 798 | Ga0495680_0268767 | 3300047322 | Bacteria | 1204 |
| 799 | Ga0495675_0000602 | 3300047444 | Bacteria | 23167 |
| 800 | Ga0495675_0032070 | 3300047444 | Bacteria | 3354 |
| 801 | Ga0495675_0135322 | 3300047444 | Bacteria | 1530 |
| 802 | Ga0495675_0203066 | 3300047444 | Bacteria | 1206 |
| 803 | Ga0495685_086188 | 3300047447 | Bacteria | 1043 |
| 804 | Ga0495684_0000443 | 3300047471 | Bacteria | 33877 |
| 805 | Ga0495684_0006864 | 3300047471 | Bacteria | 8844 |
| 806 | Ga0495684_0039619 | 3300047471 | Bacteria | 3612 |
| 807 | Ga0495684_0079887 | 3300047471 | Bacteria | 2483 |
| 808 | Ga0495684_0122125 | 3300047471 | Bacteria | 1961 |
| 809 | Ga0495593_0017797 | 3300047673 | Bacteria | 4002 |
| 810 | Ga0495593_0250126 | 3300047673 | Bacteria | 887 |
| 811 | Ga0495602_0003288 | 3300048088 | Bacteria | 16685 |
| 812 | Ga0495602_0008217 | 3300048088 | Bacteria | 10900 |
| 813 | Ga0495602_0065000 | 3300048088 | Bacteria | 3151 |
| 814 | Ga0495602_0183986 | 3300048088 | Bacteria | 1608 |
| 815 | Ga0495614_0025301 | 3300048089 | Bacteria | 2560 |
| 816 | Ga0496100_0002411 | 3300048903 | Bacteria | 9473 |
| 817 | Ga0496100_0004426 | 3300048903 | Bacteria | 7445 |
| 818 | Ga0496100_0015342 | 3300048903 | Bacteria | 4473 |
| 819 | Ga0496100_0224882 | 3300048903 | Bacteria | 1378 |
| 820 | Ga0496101_0010365 | 3300048904 | Bacteria | 6154 |
| 821 | Ga0496101_0017690 | 3300048904 | Bacteria | 4834 |
| 822 | Ga0496101_0046872 | 3300048904 | Unclassified | 3101 |
| 823 | Ga0496101_0049120 | 3300048904 | Bacteria | 3033 |
| 824 | Ga0496101_0111520 | 3300048904 | Bacteria | 2059 |
| 825 | Ga0496102_0021320 | 3300048905 | Bacteria | 5730 |
| 826 | Ga0496102_0024394 | 3300048905 | Bacteria | 5376 |
| 827 | Ga0496102_0027063 | 3300048905 | Bacteria | 5120 |
| 828 | Ga0496102_0043560 | 3300048905 | Bacteria | 4070 |
| 829 | Ga0496102_0045830 | 3300048905 | Bacteria | 3970 |
| 830 | Ga0496102_0071633 | 3300048905 | Unclassified | 3183 |
| 831 | Ga0496102_0108614 | 3300048905 | Bacteria | 2584 |
| 832 | Ga0496102_0203502 | 3300048905 | Bacteria | 1866 |
| 833 | Ga0496103_0008536 | 3300048906 | Bacteria | 6088 |
| 834 | Ga0496103_0065314 | 3300048906 | Bacteria | 2269 |
| 835 | Ga0496103_0067906 | 3300048906 | Bacteria | 2227 |
| 836 | Ga0496103_0203349 | 3300048906 | Bacteria | 1274 |
| 837 | Ga0496104_0000903 | 3300048907 | Bacteria | 25453 |
| 838 | Ga0496104_0020437 | 3300048907 | Bacteria | 6070 |
| 839 | Ga0496104_0022869 | 3300048907 | Bacteria | 5743 |
| 840 | Ga0496104_0059161 | 3300048907 | Bacteria | 3627 |
| 841 | Ga0496104_0122802 | 3300048907 | Bacteria | 2493 |
| 842 | Ga0496105_0000890 | 3300048908 | Bacteria | 20426 |
| 843 | Ga0496105_0022479 | 3300048908 | Bacteria | 5107 |
| 844 | Ga0496105_0042530 | 3300048908 | Bacteria | 3745 |
| 845 | Ga0496105_0060056 | 3300048908 | Bacteria | 3136 |
| 846 | Ga0496105_0145830 | 3300048908 | Bacteria | 1946 |
| 847 | Ga0496105_0192712 | 3300048908 | Bacteria | 1666 |
| 848 | Ga0496106_0027494 | 3300048909 | Bacteria | 4237 |
| 849 | Ga0496106_0051581 | 3300048909 | Bacteria | 3102 |
| 850 | Ga0496106_0074929 | 3300048909 | Bacteria | 2591 |
| 851 | Ga0496106_0547506 | 3300048909 | Bacteria | 928 |
| 852 | Ga0496107_0001196 | 3300048910 | Bacteria | 15811 |
| 853 | Ga0496107_0009752 | 3300048910 | Bacteria | 6658 |
| 854 | Ga0496107_0072308 | 3300048910 | Bacteria | 2507 |
| 855 | Ga0496107_0223030 | 3300048910 | Bacteria | 1402 |
| 856 | Ga0496108_0051311 | 3300048911 | Bacteria | 3455 |
| 857 | Ga0496108_0071528 | 3300048911 | Bacteria | 2927 |
| 858 | Ga0496108_0105101 | 3300048911 | Bacteria | 2410 |
| 859 | Ga0496108_0119067 | 3300048911 | Bacteria | 2264 |
| 860 | Ga0496108_0147458 | 3300048911 | Bacteria | 2029 |
| 861 | Ga0496108_0499438 | 3300048911 | Bacteria | 1062 |
| 862 | Ga0496109_0000984 | 3300048912 | Bacteria | 23543 |
| 863 | Ga0496109_0013882 | 3300048912 | Bacteria | 7002 |
| 864 | Ga0496109_0018945 | 3300048912 | Bacteria | 6060 |
| 865 | Ga0496109_0048301 | 3300048912 | Bacteria | 3872 |
| 866 | Ga0496109_0068963 | 3300048912 | Bacteria | 3242 |
| 867 | Ga0496109_0071605 | 3300048912 | Bacteria | 3183 |
| 868 | Ga0496109_0079040 | 3300048912 | Bacteria | 3030 |
| 869 | Ga0496109_0375703 | 3300048912 | Bacteria | 1342 |
| 870 | Ga0496109_0563768 | 3300048912 | Unclassified | 1074 |
| 871 | Ga0496110_0013940 | 3300048913 | Bacteria | 6660 |
| 872 | Ga0496110_0031256 | 3300048913 | Bacteria | 4593 |
| 873 | Ga0496110_0063767 | 3300048913 | Bacteria | 3256 |
| 874 | Ga0496110_0138233 | 3300048913 | Bacteria | 2202 |
| 875 | Ga0496110_0255431 | 3300048913 | Bacteria | 1595 |
| 876 | Ga0496110_0320822 | 3300048913 | Bacteria | 1411 |
| 877 | Ga0496111_0049428 | 3300048914 | Bacteria | 3032 |
| 878 | Ga0496111_0077053 | 3300048914 | Bacteria | 2431 |
| 879 | Ga0496111_0088248 | 3300048914 | Bacteria | 2271 |
| 880 | Ga0496111_0140275 | 3300048914 | Bacteria | 1791 |
| 881 | Ga0496112_0002341 | 3300048915 | Bacteria | 15215 |
| 882 | Ga0496112_0015511 | 3300048915 | Bacteria | 7115 |
| 883 | Ga0496112_0156680 | 3300048915 | Bacteria | 2244 |
| 884 | Ga0496112_0166088 | 3300048915 | Bacteria | 2173 |
| 885 | Ga0496112_0304161 | 3300048915 | Bacteria | 1540 |
| 886 | Ga0496112_0431395 | 3300048915 | Bacteria | 1256 |
| 887 | Ga0496112_0728028 | 3300048915 | Bacteria | 919 |
| 888 | Ga0496113_0004428 | 3300048916 | Bacteria | 8632 |
| 889 | Ga0496113_0081346 | 3300048916 | Bacteria | 2482 |
| 890 | Ga0496113_0086052 | 3300048916 | Bacteria | 2415 |
| 891 | Ga0496113_0095004 | 3300048916 | Bacteria | 2303 |
| 892 | Ga0496113_0241129 | 3300048916 | Bacteria | 1442 |
| 893 | Ga0496114_0015669 | 3300048917 | Bacteria | 6099 |
| 894 | Ga0496114_0116347 | 3300048917 | Bacteria | 2295 |
| 895 | Ga0496114_0247428 | 3300048917 | Bacteria | 1568 |
| 896 | Ga0496114_0684591 | 3300048917 | Bacteria | 900 |
| 897 | Ga0496115_0005902 | 3300048918 | Bacteria | 8926 |
| 898 | Ga0496115_0009672 | 3300048918 | Bacteria | 7174 |
| 899 | Ga0496115_0033229 | 3300048918 | Bacteria | 4071 |
| 900 | Ga0496115_0037850 | 3300048918 | Bacteria | 3824 |
| 901 | Ga0496115_0041233 | 3300048918 | Bacteria | 3672 |
| 902 | Ga0496115_0085733 | 3300048918 | Bacteria | 2569 |
| 903 | Ga0496115_0436142 | 3300048918 | Bacteria | 1060 |
| 904 | Ga0496115_0511372 | 3300048918 | Bacteria | 964 |
| 905 | Ga0496119_0173936 | 3300048922 | Bacteria | 1135 |
| 906 | Ga0496126_0072636 | 3300048929 | Bacteria | 3060 |
| 907 | Ga0501034_0020588 | 3300049571 | Bacteria | 6738 |
| 908 | Ga0501034_0105023 | 3300049571 | Bacteria | 2818 |
| 909 | Ga0501036_0004228 | 3300049572 | Bacteria | 11574 |
| 910 | Ga0501036_0068203 | 3300049572 | Bacteria | 3010 |
| 911 | Ga0501037_0226075 | 3300049573 | Bacteria | 1315 |
| 912 | Ga0501038_0010884 | 3300049574 | Bacteria | 8307 |
| 913 | Ga0501038_0158781 | 3300049574 | Bacteria | 1839 |
| 914 | Ga0501038_0470370 | 3300049574 | Bacteria | 964 |
| 915 | Ga0501039_0034206 | 3300049575 | Bacteria | 3922 |
| 916 | Ga0501039_0211949 | 3300049575 | Bacteria | 1523 |
| 917 | Ga0501040_0007536 | 3300049576 | Bacteria | 7036 |
| 918 | Ga0501040_0007601 | 3300049576 | Bacteria | 7013 |
| 919 | Ga0501040_0063569 | 3300049576 | Bacteria | 2540 |
| 920 | Ga0501041_0006949 | 3300049577 | Bacteria | 6639 |
| 921 | Ga0501041_0010945 | 3300049577 | Bacteria | 5355 |
| 922 | Ga0501042_0000898 | 3300049578 | Bacteria | 16655 |
| 923 | Ga0501042_0019407 | 3300049578 | Bacteria | 4720 |
| 924 | Ga0501047_0029848 | 3300049581 | Bacteria | 5255 |
| 925 | Ga0501048_0019501 | 3300049582 | Bacteria | 4975 |
| 926 | Ga0501048_0381971 | 3300049582 | Bacteria | 1006 |
| 927 | Ga0501069_0157482 | 3300049585 | Bacteria | 1307 |
| 928 | Ga0501071_0041928 | 3300049587 | Bacteria | 3278 |
| 929 | Ga0501071_0165230 | 3300049587 | Bacteria | 1656 |
| 930 | Ga0501071_0201599 | 3300049587 | Bacteria | 1495 |
| 931 | Ga0501072_0002223 | 3300049588 | Bacteria | 14493 |
| 932 | Ga0501072_0105091 | 3300049588 | Bacteria | 2245 |
| 933 | Ga0501072_0162028 | 3300049588 | Bacteria | 1784 |
| 934 | Ga0501072_0489483 | 3300049588 | Bacteria | 973 |
| 935 | Ga0501073_0022874 | 3300049589 | Bacteria | 4496 |
| 936 | Ga0501075_0011470 | 3300049591 | Bacteria | 6272 |
| 937 | Ga0501076_0000393 | 3300049592 | Bacteria | 27377 |
| 938 | Ga0501076_0217920 | 3300049592 | Bacteria | 1560 |
| 939 | Ga0501076_0225082 | 3300049592 | Bacteria | 1533 |
| 940 | Ga0501076_0311599 | 3300049592 | Bacteria | 1291 |
| 941 | Ga0501077_0014343 | 3300049593 | Bacteria | 4979 |
| 942 | Ga0501077_0292027 | 3300049593 | Bacteria | 1038 |
| 943 | Ga0501077_0368490 | 3300049593 | Bacteria | 917 |
| 944 | Ga0501079_0054329 | 3300049741 | Bacteria | 3089 |
| 945 | Ga0501080_0359586 | 3300049742 | Bacteria | 1314 |
| 946 | Ga0501080_0664530 | 3300049742 | Bacteria | 921 |
| 947 | Ga0501081_0003515 | 3300049743 | Bacteria | 10023 |
| 948 | Ga0501081_0477126 | 3300049743 | Bacteria | 928 |
| 949 | Ga0501044_0062793 | 3300049823 | Bacteria | 3796 |
| 950 | Ga0501044_0075858 | 3300049823 | Bacteria | 3414 |
| 951 | Ga0501044_0198364 | 3300049823 | Bacteria | 1966 |
| 952 | Ga0501045_0002603 | 3300049824 | Bacteria | 12303 |
| 953 | Ga0501045_0032523 | 3300049824 | Bacteria | 3780 |
| 954 | Ga0501045_0321343 | 3300049824 | Bacteria | 1152 |
| 955 | nmdc:mga03n38_201943_c1 | 3300050490 | Bacteria | 1029 |
| 956 | nmdc:mga0yw44_299177_c1 | 3300050492 | Bacteria | 1078 |
| 957 | nmdc:mga0yw44_320042_c1 | 3300050492 | Bacteria | 1041 |
| 958 | nmdc:mga0k408_17841_c1 | 3300050493 | Bacteria | 3956 |
| 959 | nmdc:mga0k408_4845_c1 | 3300050493 | Bacteria | 7139 |
| 960 | nmdc:mga06z11_214369_c1 | 3300050494 | Bacteria | 1123 |
| 961 | nmdc:mga06z11_308646_c1 | 3300050494 | Bacteria | 942 |
| 962 | nmdc:mga06z11_364234_c1 | 3300050494 | Bacteria | 867 |
| 963 | nmdc:mga06z11_42307_c1 | 3300050494 | Bacteria | 2284 |
| 964 | nmdc:mga06z11_7235_c1 | 3300050494 | Bacteria | 4557 |
| 965 | nmdc:mga04h51_28784_c1 | 3300050495 | Bacteria | 1735 |
| 966 | nmdc:mga05p37_179232_c1 | 3300050507 | Bacteria | 2579 |
| 967 | nmdc:mga05p37_19_c2 | 3300050507 | Bacteria | 99994 |
| 968 | nmdc:mga05p37_52088_c1 | 3300050507 | Bacteria | 5034 |
| 969 | nmdc:mga09592_1401_c1 | 3300050508 | Bacteria | 19291 |
| 970 | nmdc:mga0qj67_108468_c1 | 3300050509 | Bacteria | 2240 |
| 971 | nmdc:mga0qj67_12481_c1 | 3300050509 | Bacteria | 6400 |
| 972 | nmdc:mga0qj67_142906_c1 | 3300050509 | Bacteria | 1940 |
| 973 | nmdc:mga0qj67_18_c1 | 3300050509 | Bacteria | 120268 |
| 974 | nmdc:mga0qj67_21064_c1 | 3300050509 | Bacteria | 4998 |
| 975 | nmdc:mga0qj67_3298_c1 | 3300050509 | Bacteria | 11627 |
| 976 | nmdc:mga0qj67_351_c1 | 3300050509 | Bacteria | 31725 |
| 977 | nmdc:mga0qj67_35278_c1 | 3300050509 | Bacteria | 3909 |
| 978 | nmdc:mga0qj67_7844_c1 | 3300050509 | Bacteria | 7885 |
| 979 | nmdc:mga0qj67_79145_c1 | 3300050509 | Bacteria | 2632 |
| 980 | nmdc:mga06r32_141649_c1 | 3300050510 | Bacteria | 2381 |
| 981 | nmdc:mga06r32_641_c1 | 3300050510 | Bacteria | 30442 |
| 982 | nmdc:mga08y16_131978_c1 | 3300050511 | Bacteria | 2597 |
| 983 | nmdc:mga08y16_354_c1 | 3300050511 | Bacteria | 41427 |
| 984 | nmdc:mga08y16_41752_c1 | 3300050511 | Bacteria | 4804 |
| 985 | nmdc:mga08y16_8687_c1 | 3300050511 | Bacteria | 10656 |
| 986 | nmdc:mga0n895_116821_c1 | 3300050512 | Bacteria | 2687 |
| 987 | nmdc:mga0n895_14310_c1 | 3300050512 | Bacteria | 7199 |
| 988 | nmdc:mga0n895_158848_c1 | 3300050512 | Bacteria | 2292 |
| 989 | nmdc:mga0n895_436379_c1 | 3300050512 | Bacteria | 1323 |
| 990 | nmdc:mga0n895_55437_c1 | 3300050512 | Bacteria | 3901 |
| 991 | nmdc:mga0n895_666_c1 | 3300050512 | Bacteria | 24033 |
| 992 | nmdc:mga0n895_6909_c1 | 3300050512 | Bacteria | 9696 |
| 993 | nmdc:mga0n895_88954_c1 | 3300050512 | Bacteria | 3089 |
| 994 | nmdc:mga0rr50_105337_c1 | 3300050513 | Bacteria | 2224 |
| 995 | nmdc:mga0rr50_1874_c1 | 3300050513 | Bacteria | 11669 |
| 996 | nmdc:mga0rr50_274898_c1 | 3300050513 | Bacteria | 1404 |
| 997 | nmdc:mga08x19_128206_c1 | 3300050514 | Bacteria | 1705 |
| 998 | nmdc:mga08x19_211410_c1 | 3300050514 | Bacteria | 1331 |
| 999 | nmdc:mga0a205_121144_c1 | 3300050515 | Bacteria | 2515 |
| 1000 | nmdc:mga0a205_130043_c1 | 3300050515 | Bacteria | 2418 |
| 1001 | nmdc:mga0a205_1663_c1 | 3300050515 | Bacteria | 19148 |
| 1002 | nmdc:mga0a205_25880_c1 | 3300050515 | Bacteria | 5589 |
| 1003 | nmdc:mga0sz30_69818_c1 | 3300050516 | Bacteria | 1511 |
| 1004 | Ga0495601_0000434 | 3300053077 | Bacteria | 21883 |
| 1005 | Ga0495601_0001541 | 3300053077 | Bacteria | 12733 |
| 1006 | Ga0495601_0006068 | 3300053077 | Bacteria | 7046 |
| 1007 | Ga0495601_0009504 | 3300053077 | Bacteria | 5756 |
| 1008 | Ga0495601_0010246 | 3300053077 | Bacteria | 5574 |
| 1009 | Ga0495601_0050519 | 3300053077 | Bacteria | 2622 |
| 1010 | Ga0495601_0052766 | 3300053077 | Bacteria | 2568 |
| 1011 | Ga0495601_0065453 | 3300053077 | Bacteria | 2313 |
| 1012 | Ga0495601_0180190 | 3300053077 | Bacteria | 1381 |
| 1013 | Ga0495601_0473493 | 3300053077 | Bacteria | 809 |
| 1014 | Ga0495612_0000635 | 3300053078 | Bacteria | 14101 |
| 1015 | Ga0495612_0000752 | 3300053078 | Bacteria | 13204 |
| 1016 | Ga0495612_0001002 | 3300053078 | Bacteria | 11612 |
| 1017 | Ga0495612_0028173 | 3300053078 | Bacteria | 2261 |
| 1018 | Ga0495612_0050351 | 3300053078 | Bacteria | 1710 |
| 1019 | Ga0495655_0094607 | 3300053083 | Bacteria | 876 |
| 1020 | Ga0495595_0000382 | 3300053084 | Bacteria | 16787 |
| 1021 | Ga0495595_0001690 | 3300053084 | Bacteria | 8647 |
| 1022 | Ga0495595_0002041 | 3300053084 | Bacteria | 7849 |
| 1023 | Ga0495595_0002412 | 3300053084 | Bacteria | 7299 |
| 1024 | Ga0495595_0006648 | 3300053084 | Bacteria | 4720 |
| 1025 | Ga0495595_0014696 | 3300053084 | Bacteria | 3325 |
| 1026 | Ga0495595_0057570 | 3300053084 | Bacteria | 1813 |
| 1027 | Ga0495595_0083068 | 3300053084 | Bacteria | 1528 |
| 1028 | Ga0495595_0210001 | 3300053084 | Bacteria | 970 |
| 1029 | Ga0495619_0000052 | 3300053085 | Bacteria | 98882 |
| 1030 | Ga0495619_0000078 | 3300053085 | Bacteria | 72749 |
| 1031 | Ga0495619_0001197 | 3300053085 | Bacteria | 17093 |
| 1032 | Ga0495619_0001282 | 3300053085 | Bacteria | 16496 |
| 1033 | Ga0495619_0019618 | 3300053085 | Bacteria | 4299 |
| 1034 | Ga0495619_0024745 | 3300053085 | Bacteria | 3851 |
| 1035 | Ga0495619_0137020 | 3300053085 | Bacteria | 1684 |
| 1036 | Ga0495619_0300667 | 3300053085 | Bacteria | 1111 |
| 1037 | Ga0500578_0130427 | 3300053086 | Bacteria | 1577 |
| 1038 | Ga0500644_0001147 | 3300053088 | Bacteria | 7707 |
| 1039 | Ga0500651_0354343 | 3300053093 | Bacteria | 832 |
| 1040 | Ga0500641_0007205 | 3300053096 | Bacteria | 3965 |
| 1041 | Ga0500650_0023134 | 3300053098 | Bacteria | 2759 |
| 1042 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1043 | Ga0500652_047034 | 3300053131 | Bacteria | 1752 |
| 1044 | Ga0500658_0001811 | 3300053134 | Bacteria | 8444 |
| 1045 | Ga0500600_0130244 | 3300053149 | Bacteria | 1282 |
| 1046 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1047 | Ga0500616_0021977 | 3300053153 | Bacteria | 3567 |
| 1048 | Ga0500611_024837 | 3300053727 | Bacteria | 1181 |
| 1049 | Ga0500645_001586 | 3300053730 | Bacteria | 11303 |
| 1050 | Ga0501084_0032895 | 3300054114 | Bacteria | 4339 |
| 1051 | Ga0501084_0484845 | 3300054114 | Bacteria | 1045 |
| 1052 | Ga0501082_0078312 | 3300060353 | Bacteria | 2851 |
| 1053 | Ga0501082_0244194 | 3300060353 | Bacteria | 1563 |
| 1054 | Ga0530510_0000048 | 3300061734 | Bacteria | 56268 |
| 1055 | Ga0530510_0015226 | 3300061734 | Bacteria | 5430 |
| 1056 | 2880501956 | 2880495981 | Bacteria | 7340502 |
| 1057 | 8057346749 | 8057345674 | Bacteria | 4160394 |
| 1058 | Ga0105238_10160971 | |||
| 1059 | ARcpr5oldR_c000008 | |||
| 1060 | ARSoilYngRDRAFT_c00170 | |||
| 1061 | ARcpr5yngRDRAFT_c000152 | |||
| 1062 | ARSoilOldRDRAFT_c000004 | |||
| 1063 | ARCol0oldRDRAFT_c00123 | |||
| 1064 | ARCol0yngRDRAFT_1000172 | |||
| 1065 | JGI24739J22299_10002554 | |||
| 1066 | JGI24737J22298_10000781 | |||
| 1067 | JGI24737J22298_10010031 | |||
| 1068 | JGI24738J21930_10000064 | |||
| 1069 | JGI24035J26624_1000003 | |||
| 1070 | JGI24034J26672_10000179 | |||
| 1071 | JGI24742J22300_10000052 | |||
| 1072 | JGI24751J29686_10005666 | |||
| 1073 | JGI25153J46596_10001534 | |||
| 1074 | Ga0065704_10002758 | |||
| 1075 | Ga0065712_10076040 | |||
| 1076 | Ga0065712_10098531 | |||
| 1077 | Ga0065715_10001538 | |||
| 1078 | Ga0065715_10169460 | |||
| 1079 | Ga0065707_10268990 | |||
| 1080 | Ga0070676_10000449 | |||
| 1081 | Ga0070683_100209776 | |||
| 1082 | Ga0070690_100000670 | |||
| 1083 | Ga0070690_100201569 | |||
| 1084 | Ga0070690_100265063 | |||
| 1085 | Ga0070690_100269480 | |||
| 1086 | Ga0070670_100002498 | |||
| 1087 | Ga0070677_10000651 | |||
| 1088 | Ga0068869_100049914 | |||
| 1089 | Ga0070666_10005435 | |||
| 1090 | Ga0070666_10055057 | |||
| 1091 | Ga0070680_100075832 | |||
| 1092 | Ga0070680_100117896 | |||
| 1093 | Ga0070680_100162887 | |||
| 1094 | Ga0070682_100011539 | |||
| 1095 | Ga0070682_100134080 | |||
| 1096 | Ga0068868_100005589 | |||
| 1097 | Ga0070660_100027690 | |||
| 1098 | Ga0070660_100033054 | |||
| 1099 | Ga0070689_100000270 | |||
| 1100 | Ga0070689_100003632 | |||
| 1101 | Ga0070689_100016370 | |||
| 1102 | Ga0070689_100026944 | |||
| 1103 | Ga0070689_100290204 | |||
| 1104 | Ga0070691_10000446 | |||
| 1105 | Ga0070691_10017126 | |||
| 1106 | Ga0070691_10053564 | |||
| 1107 | Ga0070687_100000211 | |||
| 1108 | Ga0070687_100056512 | |||
| 1109 | Ga0070661_100000642 | |||
| 1110 | Ga0070692_10061367 | |||
| 1111 | Ga0070668_100559006 | |||
| 1112 | Ga0070668_100677934 | |||
| 1113 | Ga0070669_100010124 | |||
| 1114 | Ga0070675_100073059 | |||
| 1115 | Ga0070671_100002503 | |||
| 1116 | Ga0070674_100004794 | |||
| 1117 | Ga0070674_100014229 | |||
| 1118 | Ga0070674_100142533 | |||
| 1119 | Ga0070673_100001089 | |||
| 1120 | Ga0070673_100021948 | |||
| 1121 | Ga0070673_100051488 | |||
| 1122 | Ga0070688_100000288 | |||
| 1123 | Ga0070688_100003398 | |||
| 1124 | Ga0070688_100107833 | |||
| 1125 | Ga0070688_100124677 | |||
| 1126 | Ga0070667_100022673 | |||
| 1127 | Ga0070667_100076926 | |||
| 1128 | Ga0070667_100221122 | |||
| 1129 | Ga0070709_10009286 | |||
| 1130 | Ga0070709_10157101 | |||
| 1131 | Ga0070714_100015452 | |||
| 1132 | Ga0070714_100268166 | |||
| 1133 | Ga0070713_100001029 | |||
| 1134 | Ga0070713_100007302 | |||
| 1135 | Ga0070713_100089481 | |||
| 1136 | Ga0070713_100200846 | |||
| 1137 | Ga0070710_10048048 | |||
| 1138 | Ga0070710_10049988 | |||
| 1139 | Ga0070710_10113377 | |||
| 1140 | Ga0070710_10114412 | |||
| 1141 | Ga0070710_10403158 | |||
| 1142 | Ga0070701_10000069 | |||
| 1143 | Ga0070711_100064384 | |||
| 1144 | Ga0070711_100216889 | |||
| 1145 | Ga0070711_100375279 | |||
| 1146 | Ga0070705_100002117 | |||
| 1147 | Ga0070705_100014222 | |||
| 1148 | Ga0070700_100074336 | |||
| 1149 | Ga0070700_100103892 | |||
| 1150 | Ga0070700_100112520 | |||
| 1151 | Ga0070708_100173847 | |||
| 1152 | Ga0070663_100008152 | |||
| 1153 | Ga0070663_100040563 | |||
| 1154 | Ga0070663_100116801 | |||
| 1155 | Ga0070678_100023591 | |||
| 1156 | Ga0070678_100113115 | |||
| 1157 | Ga0070662_100057158 | |||
| 1158 | Ga0070662_100189192 | |||
| 1159 | Ga0070681_10006773 | |||
| 1160 | Ga0070681_10030347 | |||
| 1161 | Ga0070681_10144979 | |||
| 1162 | Ga0068867_100003827 | |||
| 1163 | Ga0068867_100048713 | |||
| 1164 | Ga0070685_10001066 | |||
| 1165 | Ga0070685_10010683 | |||
| 1166 | Ga0070685_10419467 | |||
| 1167 | Ga0070707_100181158 | |||
| 1168 | Ga0070699_100333566 | |||
| 1169 | Ga0070679_100251411 | |||
| 1170 | Ga0070679_100577671 | |||
| 1171 | Ga0070684_100003138 | |||
| 1172 | Ga0070684_100309145 | |||
| 1173 | Ga0068853_100001831 | |||
| 1174 | Ga0070672_100000546 | |||
| 1175 | Ga0070672_100068334 | |||
| 1176 | Ga0070672_100126920 | |||
| 1177 | Ga0070686_100001242 | |||
| 1178 | Ga0070686_100060198 | |||
| 1179 | Ga0070686_100109624 | |||
| 1180 | Ga0070686_100164060 | |||
| 1181 | Ga0070686_100206925 | |||
| 1182 | Ga0070695_100004462 | |||
| 1183 | Ga0070695_100259951 | |||
| 1184 | Ga0070696_100190102 | |||
| 1185 | Ga0070696_100261075 | |||
| 1186 | Ga0070696_100322220 | |||
| 1187 | Ga0070696_100422743 | |||
| 1188 | Ga0070693_100012264 | |||
| 1189 | Ga0070693_100015493 | |||
| 1190 | Ga0070693_100087024 | |||
| 1191 | Ga0070665_100114728 | |||
| 1192 | Ga0070665_100245355 | |||
| 1193 | Ga0070704_100074296 | |||
| 1194 | Ga0068855_100149814 | |||
| 1195 | Ga0068855_100222171 | |||
| 1196 | Ga0070664_100122138 | |||
| 1197 | Ga0068854_100063460 | |||
| 1198 | Ga0068856_100059506 | |||
| 1199 | Ga0070702_100017944 | |||
| 1200 | Ga0070702_100037599 | |||
| 1201 | Ga0070702_100065842 | |||
| 1202 | Ga0068852_100013641 | |||
| 1203 | Ga0068859_100001888 | |||
| 1204 | Ga0068859_100087315 | |||
| 1205 | Ga0068859_100279963 | |||
| 1206 | Ga0068864_100000756 | |||
| 1207 | Ga0068864_100044294 | |||
| 1208 | Ga0068866_10002380 | |||
| 1209 | Ga0068861_100008028 | |||
| 1210 | Ga0068861_100055029 | |||
| 1211 | Ga0068861_100318327 | |||
| 1212 | Ga0068851_10025383 | |||
| 1213 | Ga0068870_10000946 | |||
| 1214 | Ga0068863_100002620 | |||
| 1215 | Ga0068863_100458830 | |||
| 1216 | Ga0068858_100003321 | |||
| 1217 | Ga0068858_100137583 | |||
| 1218 | Ga0068860_100056400 | |||
| 1219 | Ga0068860_100227594 | |||
| 1220 | Ga0068860_100393079 | |||
| 1221 | Ga0068860_100689551 | |||
| 1222 | Ga0068860_100699128 | |||
| 1223 | Ga0068862_100106693 | |||
| 1224 | Ga0081455_10000002 | |||
| 1225 | Ga0081455_10023181 | |||
| 1226 | Ga0081455_10071658 | |||
| 1227 | Ga0081540_1015680 | |||
| 1228 | Ga0070717_10001350 | |||
| 1229 | Ga0070717_10261478 | |||
| 1230 | Ga0075365_10328233 | |||
| 1231 | Ga0075365_10430488 | |||
| 1232 | Ga0075363_100298706 | |||
| 1233 | Ga0075364_10234810 | |||
| 1234 | Ga0075432_10023329 | |||
| 1235 | Ga0070715_10066390 | |||
| 1236 | Ga0070716_100114858 | |||
| 1237 | Ga0070716_100186558 | |||
| 1238 | Ga0070712_100093831 | |||
| 1239 | Ga0070712_100376557 | |||
| 1240 | Ga0070712_100377362 | |||
| 1241 | Ga0075367_10034696 | |||
| 1242 | Ga0075367_10036510 | |||
| 1243 | Ga0075367_10079230 | |||
| 1244 | Ga0075367_10079889 | |||
| 1245 | Ga0075367_10147459 | |||
| 1246 | Ga0075427_10000124 | |||
| 1247 | Ga0075366_10006199 | |||
| 1248 | Ga0075366_10044597 | |||
| 1249 | Ga0097621_100001960 | |||
| 1250 | Ga0097621_100056292 | |||
| 1251 | Ga0068871_100000443 | |||
| 1252 | Ga0068871_100003970 | |||
| 1253 | Ga0068871_100032465 | |||
| 1254 | Ga0075428_100001993 | |||
| 1255 | Ga0075428_100108391 | |||
| 1256 | Ga0075430_100001036 | |||
| 1257 | Ga0075430_100001212 | |||
| 1258 | Ga0075430_100001234 | |||
| 1259 | Ga0075430_100001401 | |||
| 1260 | Ga0075430_100002889 | |||
| 1261 | Ga0075430_100020954 | |||
| 1262 | Ga0075430_100060941 | |||
| 1263 | Ga0075431_100004308 | |||
| 1264 | Ga0075431_100522540 | |||
| 1265 | Ga0075433_10000231 | |||
| 1266 | Ga0075433_10083977 | |||
| 1267 | Ga0075434_100000271 | |||
| 1268 | Ga0075434_100015400 | |||
| 1269 | Ga0075434_100137581 | |||
| 1270 | Ga0075434_100164590 | |||
| 1271 | Ga0075434_100169058 | |||
| 1272 | Ga0075434_100409772 | |||
| 1273 | Ga0075429_100003189 | |||
| 1274 | Ga0075429_100044202 | |||
| 1275 | Ga0075429_100426131 | |||
| 1276 | Ga0068865_100065756 | |||
| 1277 | Ga0068865_100206072 | |||
| 1278 | Ga0075436_100318703 | |||
| 1279 | Ga0075436_100397801 | |||
| 1280 | Ga0097620_100001888 | |||
| 1281 | Ga0097620_100087318 | |||
| 1282 | Ga0097620_100279946 | |||
| 1283 | Ga0075435_100003631 | |||
| 1284 | Ga0075435_100152449 | |||
| 1285 | Ga0075435_100239259 | |||
| 1286 | Ga0075435_100361959 | |||
| 1287 | Ga0105251_10075569 | |||
| 1288 | Ga0105244_10160577 | |||
| 1289 | Ga0105240_10121417 | |||
| 1290 | Ga0105240_10465691 | |||
| 1291 | Ga0111539_10001391 | |||
| 1292 | Ga0111539_10002666 | |||
| 1293 | Ga0111539_10011778 | |||
| 1294 | Ga0111539_10041685 | |||
| 1295 | Ga0111539_10068770 | |||
| 1296 | Ga0105245_10028914 | |||
| 1297 | Ga0105245_10031665 | |||
| 1298 | Ga0105245_10196650 | |||
| 1299 | Ga0105245_10340992 | |||
| 1300 | Ga0105245_10420733 | |||
| 1301 | Ga0105247_10002444 | |||
| 1302 | Ga0105247_10006559 | |||
| 1303 | Ga0105247_10026832 | |||
| 1304 | Ga0114129_10006834 | |||
| 1305 | Ga0114129_10031007 | |||
| 1306 | Ga0105243_10018909 | |||
| 1307 | Ga0105243_10097166 | |||
| 1308 | Ga0105243_10223036 | |||
| 1309 | Ga0105243_10358009 | |||
| 1310 | Ga0105243_10593591 | |||
| 1311 | Ga0105241_10008877 | |||
| 1312 | Ga0105241_10024212 | |||
| 1313 | Ga0105241_10057628 | |||
| 1314 | Ga0105241_10506351 | |||
| 1315 | Ga0105242_10029260 | |||
| 1316 | Ga0105242_10067974 | |||
| 1317 | Ga0105242_10092583 | |||
| 1318 | Ga0105242_10142189 | |||
| 1319 | Ga0105248_10003359 | |||
| 1320 | Ga0105248_10046907 | |||
| 1321 | Ga0105248_10053410 | |||
| 1322 | Ga0105248_10085000 | |||
| 1323 | Ga0105248_10092497 | |||
| 1324 | Ga0105248_10866089 | |||
| 1325 | Ga0105237_10118774 | |||
| 1326 | Ga0105237_10207466 | |||
| 1327 | Ga0105238_10093664 | |||
| 1328 | Ga0105238_10311092 | |||
| 1329 | Ga0105249_10058734 | |||
| 1330 | Ga0105249_10306742 | |||
| 1331 | Ga0105239_10068260 | |||
| 1332 | Ga0105239_10643689 | |||
| 1333 | Ga0105246_10011703 | |||
| 1334 | Ga0105246_10061553 | |||
| 1335 | Ga0105246_10155259 | |||
| 1336 | Ga0157342_1000261 | |||
| 1337 | Ga0157370_10015185 | |||
| 1338 | Ga0157370_10203222 | |||
| 1339 | Ga0157369_10246042 | |||
| 1340 | Ga0157374_10036560 | |||
| 1341 | Ga0157374_10055041 | |||
| 1342 | Ga0157378_10044464 | |||
| 1343 | Ga0157378_10667043 | |||
| 1344 | Ga0163162_10134460 | |||
| 1345 | Ga0163162_10205606 | |||
| 1346 | Ga0163162_10320401 | |||
| 1347 | Ga0157372_10019847 | |||
| 1348 | Ga0157372_10157813 | |||
| 1349 | Ga0157372_10569154 | |||
| 1350 | Ga0157375_10051725 | |||
| 1351 | Ga0157375_10061780 | |||
| 1352 | Ga0157375_10074094 | |||
| 1353 | Ga0157375_10121010 | |||
| 1354 | Ga0157375_10437848 | |||
| 1355 | Ga0163163_10038545 | |||
| 1356 | Ga0163163_10053639 | |||
| 1357 | Ga0157380_10075434 | |||
| 1358 | Ga0157380_10134839 | |||
| 1359 | Ga0157380_10237040 | |||
| 1360 | Ga0157380_10283496 | |||
| 1361 | Ga0157380_10842916 | |||
| 1362 | Ga0182008_10025921 | |||
| 1363 | Ga0157379_10000836 | |||
| 1364 | Ga0157379_10039347 | |||
| 1365 | Ga0157379_10048344 | |||
| 1366 | Ga0157379_10506292 | |||
| 1367 | Ga0157379_10546068 | |||
| 1368 | Ga0157376_10025740 | |||
| 1369 | Ga0157376_10096060 | |||
| 1370 | Ga0157376_10190334 | |||
| 1371 | Ga0206353_10283231 | |||
| 1372 | Ga0213876_10024089 | |||
| 1373 | Ga0224572_1008822 | |||
| 1374 | Ga0207666_1000023 | |||
| 1375 | Ga0207666_1000703 | |||
| 1376 | Ga0207673_1000096 | |||
| 1377 | Ga0209758_1000469 | |||
| 1378 | Ga0209758_1013194 | |||
| 1379 | Ga0207697_10000627 | |||
| 1380 | Ga0207697_10076958 | |||
| 1381 | Ga0207656_10055069 | |||
| 1382 | Ga0207653_10002616 | |||
| 1383 | Ga0207682_10000011 | |||
| 1384 | Ga0207692_10138403 | |||
| 1385 | Ga0207642_10200275 | |||
| 1386 | Ga0207710_10022883 | |||
| 1387 | Ga0207688_10000212 | |||
| 1388 | Ga0207688_10226994 | |||
| 1389 | Ga0207680_10002872 | |||
| 1390 | Ga0207680_10009784 | |||
| 1391 | Ga0207680_10011476 | |||
| 1392 | Ga0207647_10011482 | |||
| 1393 | Ga0207647_10265665 | |||
| 1394 | Ga0207685_10002484 | |||
| 1395 | Ga0207685_10011029 | |||
| 1396 | Ga0207699_10046026 | |||
| 1397 | Ga0207699_10048513 | |||
| 1398 | Ga0207645_10002046 | |||
| 1399 | Ga0207645_10016084 | |||
| 1400 | Ga0207645_10051736 | |||
| 1401 | Ga0207643_10003537 | |||
| 1402 | Ga0207654_10231793 | |||
| 1403 | Ga0207707_10156030 | |||
| 1404 | Ga0207707_10243690 | |||
| 1405 | Ga0207707_10510379 | |||
| 1406 | Ga0207671_10145020 | |||
| 1407 | Ga0207693_10001510 | |||
| 1408 | Ga0207693_10007846 | |||
| 1409 | Ga0207693_10149863 | |||
| 1410 | Ga0207663_10011095 | |||
| 1411 | Ga0207663_10026370 | |||
| 1412 | Ga0207663_10029293 | |||
| 1413 | Ga0207663_10060805 | |||
| 1414 | Ga0207663_10147729 | |||
| 1415 | Ga0207660_10001331 | |||
| 1416 | Ga0207660_10041878 | |||
| 1417 | Ga0207660_10090345 | |||
| 1418 | Ga0207660_10394341 | |||
| 1419 | Ga0207662_10000370 | |||
| 1420 | Ga0207662_10040020 | |||
| 1421 | Ga0207662_10048451 | |||
| 1422 | Ga0207662_10081911 | |||
| 1423 | Ga0207662_10245452 | |||
| 1424 | Ga0207657_10003563 | |||
| 1425 | Ga0207657_10020389 | |||
| 1426 | Ga0207657_10023586 | |||
| 1427 | Ga0207694_10373956 | |||
| 1428 | Ga0207650_10052664 | |||
| 1429 | Ga0207650_10147926 | |||
| 1430 | Ga0207659_10000028 | |||
| 1431 | Ga0207659_10069445 | |||
| 1432 | Ga0207659_10100975 | |||
| 1433 | Ga0207687_10004134 | |||
| 1434 | Ga0207687_10042557 | |||
| 1435 | Ga0207687_10061649 | |||
| 1436 | Ga0207687_10346536 | |||
| 1437 | Ga0207700_10000590 | |||
| 1438 | Ga0207700_10132628 | |||
| 1439 | Ga0207700_10254216 | |||
| 1440 | Ga0207664_10423808 | |||
| 1441 | Ga0207644_10006109 | |||
| 1442 | Ga0207690_10000758 | |||
| 1443 | Ga0207706_10004191 | |||
| 1444 | Ga0207706_10064878 | |||
| 1445 | Ga0207706_10096182 | |||
| 1446 | Ga0207706_10357878 | |||
| 1447 | Ga0207686_10004502 | |||
| 1448 | Ga0207686_10082329 | |||
| 1449 | Ga0207686_10174003 | |||
| 1450 | Ga0207709_10124871 | |||
| 1451 | Ga0207709_10165663 | |||
| 1452 | Ga0207670_10000358 | |||
| 1453 | Ga0207670_10052418 | |||
| 1454 | Ga0207670_10226278 | |||
| 1455 | Ga0207670_10421094 | |||
| 1456 | Ga0207670_10511804 | |||
| 1457 | Ga0207669_10012840 | |||
| 1458 | Ga0207669_10016340 | |||
| 1459 | Ga0207669_10070612 | |||
| 1460 | Ga0207704_10001593 | |||
| 1461 | Ga0207704_10037420 | |||
| 1462 | Ga0207665_10004996 | |||
| 1463 | Ga0207665_10076827 | |||
| 1464 | Ga0207665_10445308 | |||
| 1465 | Ga0207691_10003120 | |||
| 1466 | Ga0207691_10285112 | |||
| 1467 | Ga0207691_10571794 | |||
| 1468 | Ga0207711_10003815 | |||
| 1469 | Ga0207711_10011321 | |||
| 1470 | Ga0207711_10029896 | |||
| 1471 | Ga0207711_10209736 | |||
| 1472 | Ga0207711_10481379 | |||
| 1473 | Ga0207689_10002572 | |||
| 1474 | Ga0207689_10022090 | |||
| 1475 | Ga0207661_10025019 | |||
| 1476 | Ga0207661_10139415 | |||
| 1477 | Ga0207679_10000026 | |||
| 1478 | Ga0207679_10032446 | |||
| 1479 | Ga0207667_10120678 | |||
| 1480 | Ga0207651_10000487 | |||
| 1481 | Ga0207712_10001407 | |||
| 1482 | Ga0207668_10000474 | |||
| 1483 | Ga0207668_10033807 | |||
| 1484 | Ga0207668_10472303 | |||
| 1485 | Ga0207668_10648162 | |||
| 1486 | Ga0207640_10010302 | |||
| 1487 | Ga0207640_10108903 | |||
| 1488 | Ga0207658_10011216 | |||
| 1489 | Ga0207658_10144371 | |||
| 1490 | Ga0207658_10178968 | |||
| 1491 | Ga0207658_10192792 | |||
| 1492 | Ga0207677_10001084 | |||
| 1493 | Ga0207677_10012758 | |||
| 1494 | Ga0207703_10073479 | |||
| 1495 | Ga0207703_10181091 | |||
| 1496 | Ga0207703_10183525 | |||
| 1497 | Ga0207639_10106561 | |||
| 1498 | Ga0207639_10213131 | |||
| 1499 | Ga0207678_10009141 | |||
| 1500 | Ga0207678_10028553 | |||
| 1501 | Ga0207678_10070433 | |||
| 1502 | Ga0207678_10086479 | |||
| 1503 | Ga0207678_10160242 | |||
| 1504 | Ga0207708_10001391 | |||
| 1505 | Ga0207708_10002206 | |||
| 1506 | Ga0207708_10049977 | |||
| 1507 | Ga0207708_10238382 | |||
| 1508 | Ga0207702_10009283 | |||
| 1509 | Ga0207702_10506606 | |||
| 1510 | Ga0207641_10007214 | |||
| 1511 | Ga0207641_10277390 | |||
| 1512 | Ga0207648_10002405 | |||
| 1513 | Ga0207648_10033311 | |||
| 1514 | Ga0207676_10001364 | |||
| 1515 | Ga0207676_10042727 | |||
| 1516 | Ga0207676_10091959 | |||
| 1517 | Ga0207674_10004931 | |||
| 1518 | Ga0207675_100004770 | |||
| 1519 | Ga0207675_100301568 | |||
| 1520 | Ga0207675_100424161 | |||
| 1521 | Ga0207683_10000034 | |||
| 1522 | Ga0207683_10009986 | |||
| 1523 | Ga0207683_10087706 | |||
| 1524 | Ga0207683_10139729 | |||
| 1525 | Ga0207698_10371970 | |||
| 1526 | Ga0209967_1002937 | |||
| 1527 | Ga0209981_1000449 | |||
| 1528 | Ga0210000_1000242 | |||
| 1529 | Ga0209995_1013080 | |||
| 1530 | Ga0209983_1009445 | |||
| 1531 | Ga0209983_1018033 | |||
| 1532 | Ga0209971_1011217 | |||
| 1533 | Ga0209966_1002165 | |||
| 1534 | Ga0209966_1003074 | |||
| 1535 | Ga0209966_1005605 | |||
| 1536 | Ga0209966_1013971 | |||
| 1537 | Ga0209974_10066311 | |||
| 1538 | Ga0209974_10102865 | |||
| 1539 | Ga0207428_10000082 | |||
| 1540 | Ga0207428_10000851 | |||
| 1541 | Ga0207428_10001235 | |||
| 1542 | Ga0207428_10306142 | |||
| 1543 | Ga0265357_1000593 | |||
| 1544 | Ga0268266_10039685 | |||
| 1545 | Ga0268266_10847344 | |||
| 1546 | Ga0268265_10001023 | |||
| 1547 | Ga0268265_10064443 | |||
| 1548 | Ga0268264_10001465 | |||
| 1549 | Ga0268264_10073361 | |||
| 1550 | Ga0265337_1000345 | |||
| 1551 | Ga0265338_10024461 | |||
| 1552 | Ga0265325_10000043 | |||
| 1553 | Ga0265325_10002436 | |||
| 1554 | Ga0265325_10005946 | |||
| 1555 | Ga0265325_10007742 | |||
| 1556 | Ga0265325_10136468 | |||
| 1557 | Ga0265325_10136722 | |||
| 1558 | Ga0265339_10000085 | |||
| 1559 | Ga0265339_10017208 | |||
| 1560 | Ga0265331_10015805 | |||
| 1561 | Ga0265313_10000505 | |||
| 1562 | Ga0265313_10003283 | |||
| 1563 | Ga0265313_10008462 | |||
| 1564 | Ga0265313_10044426 | |||
| 1565 | Ga0265314_10001067 | |||
| 1566 | Ga0265314_10022307 | |||
| 1567 | Ga0307406_10146104 | |||
| 1568 | Ga0307416_100071702 | |||
| 1569 | Ga0307411_10305276 | |||
| 1570 | Ga0307415_100860322 | |||
| 1571 | Ga0373948_0002778 | |||
| 1572 | Ga0373948_0042211 | |||
| 1573 | Ga0373948_0060197 | |||
| 1574 | Ga0373950_0000279 | |||
| 1575 | Ga0373950_0008864 | |||
| 1576 | Ga0373958_0000746 | |||
| 1577 | Ga0373959_0000072 | |||
| 1578 | Ga0373938_0000378 | |||
| 1579 | Ga0373926_0002906 | |||
| 1580 | Ga0373926_0015860 | |||
| 1581 | Ga0373926_0086622 | |||
| 1582 | Ga0373928_0003260 | |||
| 1583 | Ga0373928_0007693 | |||
| 1584 | Ga0373928_0044178 | |||
| 1585 | Ga0373929_0000199 | |||
| 1586 | Ga0373940_0065915 | |||
| 1587 | Ga0373944_0007051 | |||
| 1588 | Ga0373949_0000406 | |||
| 1589 | Ga0373949_0041392 | |||
| 1590 | Ga0373951_0000404 | |||
| 1591 | Ga0373951_0027676 | |||
| 1592 | Ga0373952_0000261 | |||
| 1593 | Ga0373952_0007588 | |||
| 1594 | Ga0373952_0026843 | |||
| 1595 | Ga0373952_0075326 | |||
| 1596 | Ga0373923_0002366 | |||
| 1597 | Ga0373923_0006572 | |||
| 1598 | Ga0373923_0054899 | |||
| 1599 | Ga0373923_0089582 | |||
| 1600 | Ga0373932_0001164 | |||
| 1601 | Ga0373932_0130568 | |||
| 1602 | Ga0373936_0004145 | |||
| 1603 | Ga0373936_0034730 | |||
| 1604 | Ga0373936_0040150 | |||
| 1605 | Ga0373939_0035442 | |||
| 1606 | Ga0373939_0086951 | |||
| 1607 | Ga0373941_0010011 | |||
| 1608 | Ga0373941_0027580 | |||
| 1609 | Ga0373945_0000668 | |||
| 1610 | Ga0373945_0028747 | |||
| 1611 | Ga0373953_0001620 | |||
| 1612 | Ga0373953_0005144 | |||
| 1613 | Ga0373954_0001884 | |||
| 1614 | Ga0373954_0009096 | |||
| 1615 | Ga0373954_0085116 | |||
| 1616 | Ga0373954_0138474 | |||
| 1617 | Ga0373956_0010440 | |||
| 1618 | Ga0373956_0050889 | |||
| 1619 | Ga0373956_0055781 | |||
| 1620 | Ga0373957_0026192 | |||
| 1621 | Ga0373960_0042814 | |||
| 1622 | Ga0373960_0074755 | |||
| 1623 | Ga0373960_0075204 | |||
| 1624 | Ga0373943_0004499 | |||
| 1625 | Ga0373943_0013973 | |||
| 1626 | Ga0373943_0018512 | |||
| 1627 | Ga0373943_0060346 | |||
| 1628 | Ga0373946_0111196 | |||
| 1629 | Ga0373946_0133050 | |||
| 1630 | Ga0373946_0136105 | |||
| 1631 | Ga0373955_0003830 | |||
| 1632 | Ga0373955_0012329 | |||
| 1633 | Ga0373955_0054861 | |||
| 1634 | Ga0373942_0011809 | |||
| 1635 | Ga0373942_0022526 | |||
| 1636 | Ga0373961_0004521 | |||
| 1637 | Ga0373961_0019638 | |||
| 1638 | Ga0373962_0069552 | |||
| 1639 | Ga0373924_0005992 | |||
| 1640 | Ga0373924_0026106 | |||
| 1641 | Ga0373931_0004664 | |||
| 1642 | Ga0373931_0006426 | |||
| 1643 | Ga0373931_0006940 | |||
| 1644 | Ga0373931_0007446 | |||
| 1645 | Ga0373931_0134094 | |||
| 1646 | Ga0373935_0010928 | |||
| 1647 | Ga0373935_0033150 | |||
| 1648 | Ga0373935_0059195 | |||
| 1649 | Ga0373935_0059945 | |||
| 1650 | Ga0373935_0184413 | |||
| 1651 | Ga0373935_0196912 | |||
| 1652 | Ga0373927_0006334 | |||
| 1653 | Ga0373927_0014865 | |||
| 1654 | Ga0373927_0174768 | |||
| 1655 | Ga0373927_0282185 | |||
| 1656 | Ga0373927_0304394 | |||
| 1657 | Ga0373933_0002425 | |||
| 1658 | Ga0373933_0013860 | |||
| 1659 | Ga0373933_0020733 | |||
| 1660 | Ga0373933_0044752 | |||
| 1661 | Ga0373933_0047216 | |||
| 1662 | Ga0373947_0004414 | |||
| 1663 | Ga0373947_0132550 | |||
| 1664 | Ga0373937_0003517 | |||
| 1665 | Ga0373937_0005472 | |||
| 1666 | Ga0373937_0006936 | |||
| 1667 | Ga0373937_0007990 | |||
| 1668 | Ga0373937_0340674 | |||
| 1669 | Ga0373937_0683867 | |||
| 1670 | Ga0373925_0003383 | |||
| 1671 | Ga0373925_0007098 | |||
| 1672 | Ga0373925_0032046 | |||
| 1673 | Ga0373925_0042882 | |||
| 1674 | Ga0373925_0044048 | |||
| 1675 | Ga0373925_0095121 | |||
| 1676 | Ga0242420_006937 | |||
| 1677 | Ga0436365_0590730 | |||
| 1678 | Ga0436365_0630398 | |||
| 1679 | Ga0436365_1800837 | |||
| 1680 | Ga0436363_0033271 | |||
| 1681 | Ga0439453_0003678 | |||
| 1682 | Ga0439461_0032404 | |||
| 1683 | Ga0439441_003340 | |||
| 1684 | Ga0439450_050911 | |||
| 1685 | Ga0439451_033953 | |||
| 1686 | Ga0450923_005649 | |||
| 1687 | Ga0439446_0054272 | |||
| 1688 | Ga0439435_0000162 | |||
| 1689 | Ga0439435_0001286 | |||
| 1690 | Ga0439444_0001368 | |||
| 1691 | Ga0439444_0005809 | |||
| 1692 | Ga0439464_0031411 | |||
| 1693 | Ga0439460_0003474 | |||
| 1694 | Ga0453684_0181456 | |||
| 1695 | Ga0451576_0079606 | |||
| 1696 | Ga0495592_0004212 | |||
| 1697 | Ga0495592_0007097 | |||
| 1698 | Ga0495592_0008484 | |||
| 1699 | Ga0495592_0061291 | |||
| 1700 | Ga0495592_0293514 | |||
| 1701 | Ga0495603_0115615 | |||
| 1702 | Ga0495629_0000062 | |||
| 1703 | Ga0495629_0013668 | |||
| 1704 | Ga0495629_0156299 | |||
| 1705 | Ga0495629_0367284 | |||
| 1706 | Ga0495641_0005773 | |||
| 1707 | Ga0495641_0058068 | |||
| 1708 | Ga0495651_0000198 | |||
| 1709 | Ga0495651_0000786 | |||
| 1710 | Ga0495651_0001525 | |||
| 1711 | Ga0495651_0044602 | |||
| 1712 | Ga0495651_0115195 | |||
| 1713 | Ga0495653_0000637 | |||
| 1714 | Ga0495653_0004143 | |||
| 1715 | Ga0495653_0013367 | |||
| 1716 | Ga0495580_0025191 | |||
| 1717 | Ga0495580_0099274 | |||
| 1718 | Ga0495582_0006436 | |||
| 1719 | Ga0495605_0067416 | |||
| 1720 | Ga0495639_0011168 | |||
| 1721 | Ga0495639_0109778 | |||
| 1722 | Ga0495662_0018392 | |||
| 1723 | Ga0495662_0023349 | |||
| 1724 | Ga0495662_0124313 | |||
| 1725 | Ga0495664_0003341 | |||
| 1726 | Ga0495664_0026814 | |||
| 1727 | Ga0495664_0101867 | |||
| 1728 | Ga0495664_0173006 | |||
| 1729 | Ga0495585_0010974 | |||
| 1730 | Ga0495594_0001170 | |||
| 1731 | Ga0495594_0016090 | |||
| 1732 | Ga0495607_0085826 | |||
| 1733 | Ga0495608_0000129 | |||
| 1734 | Ga0495608_0001490 | |||
| 1735 | Ga0495608_0006737 | |||
| 1736 | Ga0495608_0126167 | |||
| 1737 | Ga0495608_0366716 | |||
| 1738 | Ga0495618_0001889 | |||
| 1739 | Ga0495618_0003324 | |||
| 1740 | Ga0495618_0019734 | |||
| 1741 | Ga0495618_0108429 | |||
| 1742 | Ga0495618_0168749 | |||
| 1743 | Ga0495618_0190180 | |||
| 1744 | Ga0495618_0216421 | |||
| 1745 | Ga0495628_0002820 | |||
| 1746 | Ga0495628_0003583 | |||
| 1747 | Ga0495628_0042233 | |||
| 1748 | Ga0495628_0049548 | |||
| 1749 | Ga0495630_0016604 | |||
| 1750 | Ga0495630_0079439 | |||
| 1751 | Ga0495630_0121617 | |||
| 1752 | Ga0495630_0425377 | |||
| 1753 | Ga0495644_0003944 | |||
| 1754 | Ga0495652_0002132 | |||
| 1755 | Ga0495652_0005898 | |||
| 1756 | Ga0495652_0006193 | |||
| 1757 | Ga0495652_0022579 | |||
| 1758 | Ga0495652_0102520 | |||
| 1759 | Ga0495652_0135173 | |||
| 1760 | Ga0495665_0000858 | |||
| 1761 | Ga0495665_0125460 | |||
| 1762 | Ga0495640_0008539 | |||
| 1763 | Ga0495640_0020078 | |||
| 1764 | Ga0495640_0036202 | |||
| 1765 | Ga0495640_0170276 | |||
| 1766 | Ga0495586_0023273 | |||
| 1767 | Ga0495586_0024166 | |||
| 1768 | Ga0495587_0001240 | |||
| 1769 | Ga0495587_0002939 | |||
| 1770 | Ga0495587_0007485 | |||
| 1771 | Ga0495609_0126862 | |||
| 1772 | Ga0495645_0004147 | |||
| 1773 | Ga0495645_0005941 | |||
| 1774 | Ga0495645_0200276 | |||
| 1775 | Ga0495622_0003230 | |||
| 1776 | Ga0495622_0049083 | |||
| 1777 | Ga0495633_0004354 | |||
| 1778 | Ga0495667_0005015 | |||
| 1779 | Ga0495667_0008282 | |||
| 1780 | Ga0495667_0027384 | |||
| 1781 | Ga0495667_0089540 | |||
| 1782 | Ga0495667_0108197 | |||
| 1783 | Ga0495667_0138784 | |||
| 1784 | Ga0495656_0001803 | |||
| 1785 | Ga0495634_0055095 | |||
| 1786 | Ga0495634_0056584 | |||
| 1787 | Ga0495634_0074562 | |||
| 1788 | Ga0495634_0077844 | |||
| 1789 | Ga0495634_0103057 | |||
| 1790 | Ga0495611_0040555 | |||
| 1791 | Ga0495635_0001121 | |||
| 1792 | Ga0495635_0001404 | |||
| 1793 | Ga0495635_0001797 | |||
| 1794 | Ga0495635_0021629 | |||
| 1795 | Ga0495635_0046504 | |||
| 1796 | Ga0495635_0286102 | |||
| 1797 | Ga0495659_0002049 | |||
| 1798 | Ga0495661_0043906 | |||
| 1799 | Ga0495588_0010862 | |||
| 1800 | Ga0495588_0099136 | |||
| 1801 | Ga0495657_0008038 | |||
| 1802 | Ga0495657_0085864 | |||
| 1803 | Ga0495657_0101438 | |||
| 1804 | Ga0495657_0167156 | |||
| 1805 | Ga0495657_0185835 | |||
| 1806 | Ga0495599_0000871 | |||
| 1807 | Ga0495599_0031212 | |||
| 1808 | Ga0495599_0034449 | |||
| 1809 | Ga0495623_0000055 | |||
| 1810 | Ga0495623_0001077 | |||
| 1811 | Ga0495623_0008134 | |||
| 1812 | Ga0495623_0257076 | |||
| 1813 | Ga0495646_0002042 | |||
| 1814 | Ga0495646_0003544 | |||
| 1815 | Ga0495646_0029495 | |||
| 1816 | Ga0495646_0170459 | |||
| 1817 | Ga0495647_0006994 | |||
| 1818 | Ga0495647_0016227 | |||
| 1819 | Ga0495647_0099726 | |||
| 1820 | Ga0495658_0004161 | |||
| 1821 | Ga0495669_0047021 | |||
| 1822 | Ga0495613_0003377 | |||
| 1823 | Ga0495613_0004171 | |||
| 1824 | Ga0495613_0414481 | |||
| 1825 | Ga0495624_0026573 | |||
| 1826 | Ga0495624_0081712 | |||
| 1827 | Ga0495624_0087763 | |||
| 1828 | Ga0495624_0196918 | |||
| 1829 | Ga0495670_0004753 | |||
| 1830 | Ga0495600_0000293 | |||
| 1831 | Ga0495600_0017754 | |||
| 1832 | Ga0495600_0018500 | |||
| 1833 | Ga0495600_0049234 | |||
| 1834 | Ga0495600_0055719 | |||
| 1835 | Ga0495581_0011015 | |||
| 1836 | Ga0495581_0064889 | |||
| 1837 | Ga0495604_0001806 | |||
| 1838 | Ga0495604_0002503 | |||
| 1839 | Ga0495604_0005734 | |||
| 1840 | Ga0495604_0007487 | |||
| 1841 | Ga0495604_0071368 | |||
| 1842 | Ga0495604_0100000 | |||
| 1843 | Ga0495674_0009382 | |||
| 1844 | Ga0495674_0048385 | |||
| 1845 | Ga0495674_0068175 | |||
| 1846 | Ga0495674_0076095 | |||
| 1847 | Ga0495674_0145656 | |||
| 1848 | Ga0495676_0029654 | |||
| 1849 | Ga0495680_0001199 | |||
| 1850 | Ga0495680_0001339 | |||
| 1851 | Ga0495680_0007362 | |||
| 1852 | Ga0495680_0021607 | |||
| 1853 | Ga0495680_0033484 | |||
| 1854 | Ga0495680_0042824 | |||
| 1855 | Ga0495680_0268767 | |||
| 1856 | Ga0495675_0000602 | |||
| 1857 | Ga0495675_0032070 | |||
| 1858 | Ga0495675_0135322 | |||
| 1859 | Ga0495675_0203066 | |||
| 1860 | Ga0495685_086188 | |||
| 1861 | Ga0495684_0000443 | |||
| 1862 | Ga0495684_0006864 | |||
| 1863 | Ga0495684_0039619 | |||
| 1864 | Ga0495684_0079887 | |||
| 1865 | Ga0495684_0122125 | |||
| 1866 | Ga0495593_0017797 | |||
| 1867 | Ga0495593_0250126 | |||
| 1868 | Ga0495602_0003288 | |||
| 1869 | Ga0495602_0008217 | |||
| 1870 | Ga0495602_0065000 | |||
| 1871 | Ga0495602_0183986 | |||
| 1872 | Ga0495614_0025301 | |||
| 1873 | Ga0496100_0002411 | |||
| 1874 | Ga0496100_0004426 | |||
| 1875 | Ga0496100_0015342 | |||
| 1876 | Ga0496100_0224882 | |||
| 1877 | Ga0496101_0010365 | |||
| 1878 | Ga0496101_0017690 | |||
| 1879 | Ga0496101_0046872 | |||
| 1880 | Ga0496101_0049120 | |||
| 1881 | Ga0496101_0111520 | |||
| 1882 | Ga0496102_0021320 | |||
| 1883 | Ga0496102_0024394 | |||
| 1884 | Ga0496102_0027063 | |||
| 1885 | Ga0496102_0043560 | |||
| 1886 | Ga0496102_0045830 | |||
| 1887 | Ga0496102_0071633 | |||
| 1888 | Ga0496102_0108614 | |||
| 1889 | Ga0496102_0203502 | |||
| 1890 | Ga0496103_0008536 | |||
| 1891 | Ga0496103_0065314 | |||
| 1892 | Ga0496103_0067906 | |||
| 1893 | Ga0496103_0203349 | |||
| 1894 | Ga0496104_0000903 | |||
| 1895 | Ga0496104_0020437 | |||
| 1896 | Ga0496104_0022869 | |||
| 1897 | Ga0496104_0059161 | |||
| 1898 | Ga0496104_0122802 | |||
| 1899 | Ga0496105_0000890 | |||
| 1900 | Ga0496105_0022479 | |||
| 1901 | Ga0496105_0042530 | |||
| 1902 | Ga0496105_0060056 | |||
| 1903 | Ga0496105_0145830 | |||
| 1904 | Ga0496105_0192712 | |||
| 1905 | Ga0496106_0027494 | |||
| 1906 | Ga0496106_0051581 | |||
| 1907 | Ga0496106_0074929 | |||
| 1908 | Ga0496106_0547506 | |||
| 1909 | Ga0496107_0001196 | |||
| 1910 | Ga0496107_0009752 | |||
| 1911 | Ga0496107_0072308 | |||
| 1912 | Ga0496107_0223030 | |||
| 1913 | Ga0496108_0051311 | |||
| 1914 | Ga0496108_0071528 | |||
| 1915 | Ga0496108_0105101 | |||
| 1916 | Ga0496108_0119067 | |||
| 1917 | Ga0496108_0147458 | |||
| 1918 | Ga0496108_0499438 | |||
| 1919 | Ga0496109_0000984 | |||
| 1920 | Ga0496109_0013882 | |||
| 1921 | Ga0496109_0018945 | |||
| 1922 | Ga0496109_0048301 | |||
| 1923 | Ga0496109_0068963 | |||
| 1924 | Ga0496109_0071605 | |||
| 1925 | Ga0496109_0079040 | |||
| 1926 | Ga0496109_0375703 | |||
| 1927 | Ga0496109_0563768 | |||
| 1928 | Ga0496110_0013940 | |||
| 1929 | Ga0496110_0031256 | |||
| 1930 | Ga0496110_0063767 | |||
| 1931 | Ga0496110_0138233 | |||
| 1932 | Ga0496110_0255431 | |||
| 1933 | Ga0496110_0320822 | |||
| 1934 | Ga0496111_0049428 | |||
| 1935 | Ga0496111_0077053 | |||
| 1936 | Ga0496111_0088248 | |||
| 1937 | Ga0496111_0140275 | |||
| 1938 | Ga0496112_0002341 | |||
| 1939 | Ga0496112_0015511 | |||
| 1940 | Ga0496112_0156680 | |||
| 1941 | Ga0496112_0166088 | |||
| 1942 | Ga0496112_0304161 | |||
| 1943 | Ga0496112_0431395 | |||
| 1944 | Ga0496112_0728028 | |||
| 1945 | Ga0496113_0004428 | |||
| 1946 | Ga0496113_0081346 | |||
| 1947 | Ga0496113_0086052 | |||
| 1948 | Ga0496113_0095004 | |||
| 1949 | Ga0496113_0241129 | |||
| 1950 | Ga0496114_0015669 | |||
| 1951 | Ga0496114_0116347 | |||
| 1952 | Ga0496114_0247428 | |||
| 1953 | Ga0496114_0684591 | |||
| 1954 | Ga0496115_0005902 | |||
| 1955 | Ga0496115_0009672 | |||
| 1956 | Ga0496115_0033229 | |||
| 1957 | Ga0496115_0037850 | |||
| 1958 | Ga0496115_0041233 | |||
| 1959 | Ga0496115_0085733 | |||
| 1960 | Ga0496115_0436142 | |||
| 1961 | Ga0496115_0511372 | |||
| 1962 | Ga0496119_0173936 | |||
| 1963 | Ga0496126_0072636 | |||
| 1964 | Ga0501034_0020588 | |||
| 1965 | Ga0501034_0105023 | |||
| 1966 | Ga0501036_0004228 | |||
| 1967 | Ga0501036_0068203 | |||
| 1968 | Ga0501037_0226075 | |||
| 1969 | Ga0501038_0010884 | |||
| 1970 | Ga0501038_0158781 | |||
| 1971 | Ga0501038_0470370 | |||
| 1972 | Ga0501039_0034206 | |||
| 1973 | Ga0501039_0211949 | |||
| 1974 | Ga0501040_0007536 | |||
| 1975 | Ga0501040_0007601 | |||
| 1976 | Ga0501040_0063569 | |||
| 1977 | Ga0501041_0006949 | |||
| 1978 | Ga0501041_0010945 | |||
| 1979 | Ga0501042_0000898 | |||
| 1980 | Ga0501042_0019407 | |||
| 1981 | Ga0501047_0029848 | |||
| 1982 | Ga0501048_0019501 | |||
| 1983 | Ga0501048_0381971 | |||
| 1984 | Ga0501069_0157482 | |||
| 1985 | Ga0501071_0041928 | |||
| 1986 | Ga0501071_0165230 | |||
| 1987 | Ga0501071_0201599 | |||
| 1988 | Ga0501072_0002223 | |||
| 1989 | Ga0501072_0105091 | |||
| 1990 | Ga0501072_0162028 | |||
| 1991 | Ga0501072_0489483 | |||
| 1992 | Ga0501073_0022874 | |||
| 1993 | Ga0501075_0011470 | |||
| 1994 | Ga0501076_0000393 | |||
| 1995 | Ga0501076_0217920 | |||
| 1996 | Ga0501076_0225082 | |||
| 1997 | Ga0501076_0311599 | |||
| 1998 | Ga0501077_0014343 | |||
| 1999 | Ga0501077_0292027 | |||
| 2000 | Ga0501077_0368490 | |||
| 2001 | Ga0501079_0054329 | |||
| 2002 | Ga0501080_0359586 | |||
| 2003 | Ga0501080_0664530 | |||
| 2004 | Ga0501081_0003515 | |||
| 2005 | Ga0501081_0477126 | |||
| 2006 | Ga0501044_0062793 | |||
| 2007 | Ga0501044_0075858 | |||
| 2008 | Ga0501044_0198364 | |||
| 2009 | Ga0501045_0002603 | |||
| 2010 | Ga0501045_0032523 | |||
| 2011 | Ga0501045_0321343 | |||
| 2012 | nmdc:mga03n38_201943_c1 | |||
| 2013 | nmdc:mga0yw44_299177_c1 | |||
| 2014 | nmdc:mga0yw44_320042_c1 | |||
| 2015 | nmdc:mga0k408_17841_c1 | |||
| 2016 | nmdc:mga0k408_4845_c1 | |||
| 2017 | nmdc:mga06z11_214369_c1 | |||
| 2018 | nmdc:mga06z11_308646_c1 | |||
| 2019 | nmdc:mga06z11_364234_c1 | |||
| 2020 | nmdc:mga06z11_42307_c1 | |||
| 2021 | nmdc:mga06z11_7235_c1 | |||
| 2022 | nmdc:mga04h51_28784_c1 | |||
| 2023 | nmdc:mga05p37_179232_c1 | |||
| 2024 | nmdc:mga05p37_19_c2 | |||
| 2025 | nmdc:mga05p37_52088_c1 | |||
| 2026 | nmdc:mga09592_1401_c1 | |||
| 2027 | nmdc:mga0qj67_108468_c1 | |||
| 2028 | nmdc:mga0qj67_12481_c1 | |||
| 2029 | nmdc:mga0qj67_142906_c1 | |||
| 2030 | nmdc:mga0qj67_18_c1 | |||
| 2031 | nmdc:mga0qj67_21064_c1 | |||
| 2032 | nmdc:mga0qj67_3298_c1 | |||
| 2033 | nmdc:mga0qj67_351_c1 | |||
| 2034 | nmdc:mga0qj67_35278_c1 | |||
| 2035 | nmdc:mga0qj67_7844_c1 | |||
| 2036 | nmdc:mga0qj67_79145_c1 | |||
| 2037 | nmdc:mga06r32_141649_c1 | |||
| 2038 | nmdc:mga06r32_641_c1 | |||
| 2039 | nmdc:mga08y16_131978_c1 | |||
| 2040 | nmdc:mga08y16_354_c1 | |||
| 2041 | nmdc:mga08y16_41752_c1 | |||
| 2042 | nmdc:mga08y16_8687_c1 | |||
| 2043 | nmdc:mga0n895_116821_c1 | |||
| 2044 | nmdc:mga0n895_14310_c1 | |||
| 2045 | nmdc:mga0n895_158848_c1 | |||
| 2046 | nmdc:mga0n895_436379_c1 | |||
| 2047 | nmdc:mga0n895_55437_c1 | |||
| 2048 | nmdc:mga0n895_666_c1 | |||
| 2049 | nmdc:mga0n895_6909_c1 | |||
| 2050 | nmdc:mga0n895_88954_c1 | |||
| 2051 | nmdc:mga0rr50_105337_c1 | |||
| 2052 | nmdc:mga0rr50_1874_c1 | |||
| 2053 | nmdc:mga0rr50_274898_c1 | |||
| 2054 | nmdc:mga08x19_128206_c1 | |||
| 2055 | nmdc:mga08x19_211410_c1 | |||
| 2056 | nmdc:mga0a205_121144_c1 | |||
| 2057 | nmdc:mga0a205_130043_c1 | |||
| 2058 | nmdc:mga0a205_1663_c1 | |||
| 2059 | nmdc:mga0a205_25880_c1 | |||
| 2060 | nmdc:mga0sz30_69818_c1 | |||
| 2061 | Ga0495601_0000434 | |||
| 2062 | Ga0495601_0001541 | |||
| 2063 | Ga0495601_0006068 | |||
| 2064 | Ga0495601_0009504 | |||
| 2065 | Ga0495601_0010246 | |||
| 2066 | Ga0495601_0050519 | |||
| 2067 | Ga0495601_0052766 | |||
| 2068 | Ga0495601_0065453 | |||
| 2069 | Ga0495601_0180190 | |||
| 2070 | Ga0495601_0473493 | |||
| 2071 | Ga0495612_0000635 | |||
| 2072 | Ga0495612_0000752 | |||
| 2073 | Ga0495612_0001002 | |||
| 2074 | Ga0495612_0028173 | |||
| 2075 | Ga0495612_0050351 | |||
| 2076 | Ga0495655_0094607 | |||
| 2077 | Ga0495595_0000382 | |||
| 2078 | Ga0495595_0001690 | |||
| 2079 | Ga0495595_0002041 | |||
| 2080 | Ga0495595_0002412 | |||
| 2081 | Ga0495595_0006648 | |||
| 2082 | Ga0495595_0014696 | |||
| 2083 | Ga0495595_0057570 | |||
| 2084 | Ga0495595_0083068 | |||
| 2085 | Ga0495595_0210001 | |||
| 2086 | Ga0495619_0000052 | |||
| 2087 | Ga0495619_0000078 | |||
| 2088 | Ga0495619_0001197 | |||
| 2089 | Ga0495619_0001282 | |||
| 2090 | Ga0495619_0019618 | |||
| 2091 | Ga0495619_0024745 | |||
| 2092 | Ga0495619_0137020 | |||
| 2093 | Ga0495619_0300667 | |||
| 2094 | Ga0500578_0130427 | |||
| 2095 | Ga0500644_0001147 | |||
| 2096 | Ga0500651_0354343 | |||
| 2097 | Ga0500641_0007205 | |||
| 2098 | Ga0500650_0023134 | |||
| 2099 | Ga0500595_000001 | |||
| 2100 | Ga0500652_047034 | |||
| 2101 | Ga0500658_0001811 | |||
| 2102 | Ga0500600_0130244 | |||
| 2103 | Ga0500616_0000001 | |||
| 2104 | Ga0500616_0021977 | |||
| 2105 | Ga0500611_024837 | |||
| 2106 | Ga0500645_001586 | |||
| 2107 | Ga0501084_0032895 | |||
| 2108 | Ga0501084_0484845 | |||
| 2109 | Ga0501082_0078312 | |||
| 2110 | Ga0501082_0244194 | |||
| 2111 | Ga0530510_0000048 | |||
| 2112 | Ga0530510_0015226 | |||
| 2113 | 2880501956 | |||
| 2114 | 8057346749 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ew8-assembly1.cif.gz_C | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9898 | 6 | 255 |
| 2ewm-assembly1.cif.gz_A-2 | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.989 | 6 | 255 |
| 2ew8-assembly1.cif.gz_D | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9883 | 6 | 255 |
| 2ewm-assembly1.cif.gz_B-2 | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9852 | 6 | 255 |
| 2ew8-assembly1.cif.gz_C | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9726 | 6 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ewmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9852 | 6 | 255 | 3.40.50.720 |
| 2ewmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9694 | 6 | 255 | 3.40.50.720 |
| 2ztuB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9499 | 12 | 253 | 3.40.50.720 |
| 4weoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.949 | 6 | 255 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9477 | 6 | 253 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B9JM47-F1-model_v4 | Short chain dehydrogenase protein | 0.9856 | 3 | 255 |
GO:0016491
|
| AF-B9JMN7-F1-model_v4 | Acetoacetyl-CoA reductase protein | 0.9792 | 6 | 255 |
GO:0016491
|
| AF-A0A6B3A7A6-F1-model_v4 | SDR family oxidoreductase | 0.9789 | 11 | 255 |
|
| AF-B9JM47-F1-model_v4 | Short chain dehydrogenase protein | 0.9778 | 3 | 255 |
GO:0016491
|
| AF-A0A661ESZ7-F1-model_v4 | Dehydrogenase | 0.977 | 1 | 255 |
GO:0006633
GO:0016616 GO:0048038 |