F489205
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1057 | 399 | 1057 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10421597|Ga0163161_104215972 |
| Length | 137 |
| Sequence | MARTDANPPMPDFATDYELQEVDPSFLTASVKPKQFLHIDQAECILCEGCVDICPWKCIHMLSTGAIDEAVNADQPGDDPKDHVVFVVDEDVYTRCALCVDRCPTGVIILGKVTNDWADGDPNVRTNRHGYAYGVRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 91 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 170 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 184 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 205 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 206 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 211 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 212 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 213 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 214 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 215 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 222 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 223 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 224 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 227 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 228 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 229 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 230 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 231 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 232 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 233 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 238 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 239 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 240 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 241 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 242 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 356 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 378 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 380 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 383 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 384 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 385 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 399 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.26 |
| Metatranscriptomes | 2.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.88 |
| Nodule | 0 |
| Rhizoplane | 5.3 |
| Rhizosphere | 88.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10010920 | 3300003911 | Bacteria | 1734 |
| 2 | Ga0065715_11066122 | 3300005293 | Bacteria | 528 |
| 3 | Ga0070676_10232303 | 3300005328 | Bacteria | 1223 |
| 4 | Ga0070683_101208140 | 3300005329 | Bacteria | 727 |
| 5 | Ga0070690_100909737 | 3300005330 | Bacteria | 689 |
| 6 | Ga0070670_100234340 | 3300005331 | Bacteria | 1598 |
| 7 | Ga0070680_101153123 | 3300005336 | Unclassified | 670 |
| 8 | Ga0070682_100588518 | 3300005337 | Bacteria | 877 |
| 9 | Ga0068868_100626281 | 3300005338 | Bacteria | 955 |
| 10 | Ga0070660_100283627 | 3300005339 | Bacteria | 1355 |
| 11 | Ga0070687_100690722 | 3300005343 | Bacteria | 712 |
| 12 | Ga0070668_100374403 | 3300005347 | Bacteria | 1211 |
| 13 | Ga0070668_100443719 | 3300005347 | Bacteria | 1114 |
| 14 | Ga0070669_101804822 | 3300005353 | Bacteria | 534 |
| 15 | Ga0070671_100000397 | 3300005355 | Bacteria | 29950 |
| 16 | Ga0070671_100610725 | 3300005355 | Bacteria | 943 |
| 17 | Ga0070674_101036350 | 3300005356 | Bacteria | 722 |
| 18 | Ga0070673_100085202 | 3300005364 | Bacteria | 2572 |
| 19 | Ga0070659_101086781 | 3300005366 | Bacteria | 705 |
| 20 | Ga0070659_101233882 | 3300005366 | Bacteria | 662 |
| 21 | Ga0070667_100133103 | 3300005367 | Bacteria | 2172 |
| 22 | Ga0070667_100578598 | 3300005367 | Bacteria | 1034 |
| 23 | Ga0070703_10012438 | 3300005406 | Bacteria | 2411 |
| 24 | Ga0070703_10271845 | 3300005406 | Bacteria | 696 |
| 25 | Ga0070709_10962166 | 3300005434 | Bacteria | 678 |
| 26 | Ga0070714_101304250 | 3300005435 | Bacteria | 709 |
| 27 | Ga0070713_100285018 | 3300005436 | Bacteria | 1516 |
| 28 | Ga0070713_100351102 | 3300005436 | Bacteria | 1368 |
| 29 | Ga0070713_101109849 | 3300005436 | Bacteria | 764 |
| 30 | Ga0070710_10130697 | 3300005437 | Bacteria | 1531 |
| 31 | Ga0070701_10409034 | 3300005438 | Bacteria | 861 |
| 32 | Ga0070705_100048023 | 3300005440 | Bacteria | 2470 |
| 33 | Ga0070694_100733337 | 3300005444 | Bacteria | 806 |
| 34 | Ga0070708_100002403 | 3300005445 | Bacteria | 14512 |
| 35 | Ga0070708_100877145 | 3300005445 | Unclassified | 843 |
| 36 | Ga0070708_101488566 | 3300005445 | Bacteria | 631 |
| 37 | Ga0070663_100444355 | 3300005455 | Bacteria | 1068 |
| 38 | Ga0070663_100795386 | 3300005455 | Bacteria | 811 |
| 39 | Ga0070678_100446881 | 3300005456 | Bacteria | 1132 |
| 40 | Ga0070678_100572092 | 3300005456 | Bacteria | 1005 |
| 41 | Ga0070678_100738462 | 3300005456 | Bacteria | 890 |
| 42 | Ga0070678_101558569 | 3300005456 | Bacteria | 620 |
| 43 | Ga0070662_101075910 | 3300005457 | Bacteria | 690 |
| 44 | Ga0070681_10011974 | 3300005458 | Bacteria | 8600 |
| 45 | Ga0070681_10017995 | 3300005458 | Bacteria | 7060 |
| 46 | Ga0070681_10372019 | 3300005458 | Bacteria | 1339 |
| 47 | Ga0070681_11086252 | 3300005458 | Bacteria | 721 |
| 48 | Ga0068867_100407840 | 3300005459 | Bacteria | 1148 |
| 49 | Ga0068867_100926061 | 3300005459 | Bacteria | 786 |
| 50 | Ga0070706_100017012 | 3300005467 | Bacteria | 6716 |
| 51 | Ga0070706_100086897 | 3300005467 | Bacteria | 2898 |
| 52 | Ga0070706_100144692 | 3300005467 | Bacteria | 2220 |
| 53 | Ga0070706_100219158 | 3300005467 | Bacteria | 1776 |
| 54 | Ga0070707_100167078 | 3300005468 | Bacteria | 2144 |
| 55 | Ga0070698_100814956 | 3300005471 | Bacteria | 878 |
| 56 | Ga0070699_100079282 | 3300005518 | Bacteria | 2860 |
| 57 | Ga0070699_100947875 | 3300005518 | Bacteria | 789 |
| 58 | Ga0070684_100258533 | 3300005535 | Bacteria | 1593 |
| 59 | Ga0070697_100058072 | 3300005536 | Bacteria | 3148 |
| 60 | Ga0070697_100209557 | 3300005536 | Bacteria | 1659 |
| 61 | Ga0070672_101347882 | 3300005543 | Bacteria | 638 |
| 62 | Ga0070686_100498444 | 3300005544 | Bacteria | 945 |
| 63 | Ga0070686_100550004 | 3300005544 | Bacteria | 903 |
| 64 | Ga0070696_100280699 | 3300005546 | Bacteria | 1269 |
| 65 | Ga0070696_100439545 | 3300005546 | Bacteria | 1027 |
| 66 | Ga0070696_100473731 | 3300005546 | Bacteria | 992 |
| 67 | Ga0070693_100194188 | 3300005547 | Bacteria | 1315 |
| 68 | Ga0070693_100824062 | 3300005547 | Bacteria | 690 |
| 69 | Ga0070665_100056101 | 3300005548 | Bacteria | 3950 |
| 70 | Ga0068856_100510669 | 3300005614 | Bacteria | 1223 |
| 71 | Ga0068856_100702437 | 3300005614 | Bacteria | 1032 |
| 72 | Ga0070702_100670671 | 3300005615 | Bacteria | 787 |
| 73 | Ga0070702_100925012 | 3300005615 | Bacteria | 685 |
| 74 | Ga0068859_101769379 | 3300005617 | Bacteria | 682 |
| 75 | Ga0068864_101036364 | 3300005618 | Bacteria | 815 |
| 76 | Ga0068866_10358637 | 3300005718 | Bacteria | 929 |
| 77 | Ga0068861_101688587 | 3300005719 | Bacteria | 626 |
| 78 | Ga0068851_10626331 | 3300005834 | Bacteria | 657 |
| 79 | Ga0068870_10416892 | 3300005840 | Bacteria | 878 |
| 80 | Ga0068863_100049247 | 3300005841 | Bacteria | 3995 |
| 81 | Ga0068858_101321825 | 3300005842 | Bacteria | 710 |
| 82 | Ga0068860_100489451 | 3300005843 | Bacteria | 1227 |
| 83 | Ga0068860_100732572 | 3300005843 | Bacteria | 1000 |
| 84 | Ga0081455_10010519 | 3300005937 | Bacteria | 9378 |
| 85 | Ga0081455_10031164 | 3300005937 | Bacteria | 4830 |
| 86 | Ga0081455_10059279 | 3300005937 | Bacteria | 3233 |
| 87 | Ga0081455_10967213 | 3300005937 | Bacteria | 528 |
| 88 | Ga0081538_10000033 | 3300005981 | Bacteria | 121023 |
| 89 | Ga0081538_10010515 | 3300005981 | Bacteria | 7587 |
| 90 | Ga0081538_10056089 | 3300005981 | Bacteria | 2312 |
| 91 | Ga0081540_1056255 | 3300005983 | Bacteria | 1910 |
| 92 | Ga0081539_10088490 | 3300005985 | Bacteria | 1606 |
| 93 | Ga0081539_10091344 | 3300005985 | Bacteria | 1573 |
| 94 | Ga0070717_10733988 | 3300006028 | Bacteria | 898 |
| 95 | Ga0075365_10061270 | 3300006038 | Bacteria | 2512 |
| 96 | Ga0075365_10083302 | 3300006038 | Bacteria | 2169 |
| 97 | Ga0075365_10178842 | 3300006038 | Bacteria | 1483 |
| 98 | Ga0075365_10460727 | 3300006038 | Bacteria | 898 |
| 99 | Ga0075368_10005827 | 3300006042 | Bacteria | 4260 |
| 100 | Ga0075368_10064509 | 3300006042 | Bacteria | 1471 |
| 101 | Ga0075363_100001656 | 3300006048 | Bacteria | 8623 |
| 102 | Ga0075363_100146624 | 3300006048 | Bacteria | 1331 |
| 103 | Ga0075363_100321995 | 3300006048 | Bacteria | 900 |
| 104 | Ga0075364_10128715 | 3300006051 | Bacteria | 1698 |
| 105 | Ga0075364_10287162 | 3300006051 | Bacteria | 1119 |
| 106 | Ga0075364_10374037 | 3300006051 | Bacteria | 972 |
| 107 | Ga0075364_10467578 | 3300006051 | Bacteria | 862 |
| 108 | Ga0075432_10343577 | 3300006058 | Bacteria | 631 |
| 109 | Ga0070716_100511822 | 3300006173 | Bacteria | 888 |
| 110 | Ga0070716_100713316 | 3300006173 | Bacteria | 767 |
| 111 | Ga0070716_100946180 | 3300006173 | Bacteria | 678 |
| 112 | Ga0070716_100988566 | 3300006173 | Bacteria | 665 |
| 113 | Ga0075362_10059418 | 3300006177 | Bacteria | 1726 |
| 114 | Ga0075362_10064178 | 3300006177 | Bacteria | 1666 |
| 115 | Ga0075362_10138128 | 3300006177 | Bacteria | 1163 |
| 116 | Ga0075362_10140823 | 3300006177 | Bacteria | 1152 |
| 117 | Ga0075369_10188606 | 3300006186 | Bacteria | 950 |
| 118 | Ga0075427_10050259 | 3300006194 | Bacteria | 717 |
| 119 | Ga0097621_100202557 | 3300006237 | Bacteria | 1724 |
| 120 | Ga0075428_100319779 | 3300006844 | Bacteria | 1668 |
| 121 | Ga0075428_100983146 | 3300006844 | Bacteria | 894 |
| 122 | Ga0075430_100285432 | 3300006846 | Bacteria | 1366 |
| 123 | Ga0075431_100005694 | 3300006847 | Bacteria | 12313 |
| 124 | Ga0075431_100186693 | 3300006847 | Bacteria | 2126 |
| 125 | Ga0075431_100221244 | 3300006847 | Bacteria | 1931 |
| 126 | Ga0075433_10823643 | 3300006852 | Bacteria | 811 |
| 127 | Ga0075433_11011688 | 3300006852 | Bacteria | 724 |
| 128 | Ga0075433_11254868 | 3300006852 | Bacteria | 643 |
| 129 | Ga0075434_100208023 | 3300006871 | Bacteria | 1977 |
| 130 | Ga0075434_100512893 | 3300006871 | Bacteria | 1220 |
| 131 | Ga0075429_100000064 | 3300006880 | Bacteria | 52724 |
| 132 | Ga0075429_100132174 | 3300006880 | Bacteria | 2184 |
| 133 | Ga0075429_100294671 | 3300006880 | Bacteria | 1420 |
| 134 | Ga0075429_100508597 | 3300006880 | Bacteria | 1055 |
| 135 | Ga0068865_101539842 | 3300006881 | Bacteria | 597 |
| 136 | Ga0097620_100492833 | 3300006931 | Bacteria | 1321 |
| 137 | Ga0097620_101769393 | 3300006931 | Bacteria | 682 |
| 138 | Ga0075435_101706767 | 3300007076 | Bacteria | 553 |
| 139 | Ga0099795_10090457 | 3300007788 | Bacteria | 1186 |
| 140 | Ga0105240_11312613 | 3300009093 | Bacteria | 763 |
| 141 | Ga0111539_10000426 | 3300009094 | Bacteria | 52948 |
| 142 | Ga0111539_10782521 | 3300009094 | Bacteria | 1110 |
| 143 | Ga0105245_10005614 | 3300009098 | Bacteria | 11021 |
| 144 | Ga0105245_10856129 | 3300009098 | Bacteria | 949 |
| 145 | Ga0105245_10872225 | 3300009098 | Bacteria | 941 |
| 146 | Ga0105245_10996494 | 3300009098 | Bacteria | 882 |
| 147 | Ga0105245_11396855 | 3300009098 | Bacteria | 750 |
| 148 | Ga0105247_10983182 | 3300009101 | Bacteria | 658 |
| 149 | Ga0114129_10096511 | 3300009147 | Bacteria | 4092 |
| 150 | Ga0114129_10290496 | 3300009147 | Bacteria | 2182 |
| 151 | Ga0114129_10307886 | 3300009147 | Bacteria | 2110 |
| 152 | Ga0114129_10952600 | 3300009147 | Bacteria | 1084 |
| 153 | Ga0114129_12018827 | 3300009147 | Bacteria | 697 |
| 154 | Ga0105243_11158237 | 3300009148 | Bacteria | 784 |
| 155 | Ga0105243_11298584 | 3300009148 | Bacteria | 745 |
| 156 | Ga0105242_10141940 | 3300009176 | Bacteria | 2085 |
| 157 | Ga0105242_10335343 | 3300009176 | Bacteria | 1392 |
| 158 | Ga0105242_10452210 | 3300009176 | Bacteria | 1211 |
| 159 | Ga0105242_11310039 | 3300009176 | Bacteria | 748 |
| 160 | Ga0105242_11485317 | 3300009176 | Bacteria | 708 |
| 161 | Ga0105248_10853642 | 3300009177 | Bacteria | 1028 |
| 162 | Ga0105248_11644308 | 3300009177 | Bacteria | 728 |
| 163 | Ga0105238_11016882 | 3300009551 | Bacteria | 850 |
| 164 | Ga0105238_11194181 | 3300009551 | Bacteria | 785 |
| 165 | Ga0105238_11341284 | 3300009551 | Bacteria | 742 |
| 166 | Ga0105238_11365354 | 3300009551 | Bacteria | 735 |
| 167 | Ga0105238_12587005 | 3300009551 | Bacteria | 544 |
| 168 | Ga0105249_10269630 | 3300009553 | Bacteria | 1695 |
| 169 | Ga0105249_10559792 | 3300009553 | Bacteria | 1195 |
| 170 | Ga0105249_10917164 | 3300009553 | Bacteria | 943 |
| 171 | Ga0105030_112130 | 3300009987 | Bacteria | 749 |
| 172 | Ga0105030_120303 | 3300009987 | Bacteria | 601 |
| 173 | Ga0105028_101416 | 3300009993 | Bacteria | 2535 |
| 174 | Ga0105028_102783 | 3300009993 | Bacteria | 1841 |
| 175 | Ga0099796_10550402 | 3300010159 | Bacteria | 519 |
| 176 | Ga0105239_10162302 | 3300010375 | Bacteria | 2497 |
| 177 | Ga0105246_10238616 | 3300011119 | Bacteria | 1436 |
| 178 | Ga0105246_10858821 | 3300011119 | Bacteria | 810 |
| 179 | Ga0105246_10937704 | 3300011119 | Bacteria | 779 |
| 180 | Ga0105246_10992831 | 3300011119 | Bacteria | 759 |
| 181 | Ga0105246_11119678 | 3300011119 | Bacteria | 720 |
| 182 | Ga0157315_1006333 | 3300012508 | Bacteria | 922 |
| 183 | Ga0157371_10523371 | 3300013102 | Bacteria | 877 |
| 184 | Ga0157369_10192305 | 3300013105 | Bacteria | 2144 |
| 185 | Ga0157369_10507310 | 3300013105 | Bacteria | 1248 |
| 186 | Ga0157378_12082987 | 3300013297 | Bacteria | 618 |
| 187 | Ga0163162_10520701 | 3300013306 | Bacteria | 1319 |
| 188 | Ga0163162_10572152 | 3300013306 | Bacteria | 1257 |
| 189 | Ga0163162_10643004 | 3300013306 | Bacteria | 1185 |
| 190 | Ga0157372_11200469 | 3300013307 | Bacteria | 877 |
| 191 | Ga0157375_11578069 | 3300013308 | Bacteria | 776 |
| 192 | Ga0163163_11152365 | 3300014325 | Bacteria | 838 |
| 193 | Ga0163163_11559741 | 3300014325 | Bacteria | 721 |
| 194 | Ga0157380_10541713 | 3300014326 | Bacteria | 1140 |
| 195 | Ga0157380_10891018 | 3300014326 | Bacteria | 915 |
| 196 | Ga0157380_11362156 | 3300014326 | Bacteria | 759 |
| 197 | Ga0157380_11539729 | 3300014326 | Bacteria | 719 |
| 198 | Ga0157380_11546930 | 3300014326 | Bacteria | 717 |
| 199 | Ga0157380_12579997 | 3300014326 | Bacteria | 574 |
| 200 | Ga0182008_10742053 | 3300014497 | Bacteria | 565 |
| 201 | Ga0157379_10719827 | 3300014968 | Bacteria | 938 |
| 202 | Ga0157379_11735212 | 3300014968 | Bacteria | 612 |
| 203 | Ga0157376_10650702 | 3300014969 | Bacteria | 1054 |
| 204 | Ga0157376_11063357 | 3300014969 | Bacteria | 834 |
| 205 | Ga0157376_11753242 | 3300014969 | Bacteria | 657 |
| 206 | Ga0157376_12053117 | 3300014969 | Bacteria | 610 |
| 207 | Ga0163161_10333236 | 3300017792 | Bacteria | 1202 |
| 208 | Ga0163161_10421597 | 3300017792 | Bacteria | 1074 |
| 209 | Ga0163161_10690831 | 3300017792 | Bacteria | 849 |
| 210 | Ga0197907_11295313 | 3300020069 | Bacteria | 903 |
| 211 | Ga0206356_10392024 | 3300020070 | Bacteria | 1263 |
| 212 | Ga0206356_10711293 | 3300020070 | Bacteria | 1166 |
| 213 | Ga0206356_11711064 | 3300020070 | Bacteria | 1300 |
| 214 | Ga0206349_1233624 | 3300020075 | Bacteria | 1015 |
| 215 | Ga0206349_1393095 | 3300020075 | Bacteria | 1315 |
| 216 | Ga0206352_10456902 | 3300020078 | Bacteria | 675 |
| 217 | Ga0206352_11285469 | 3300020078 | Bacteria | 713 |
| 218 | Ga0206350_11397962 | 3300020080 | Bacteria | 1877 |
| 219 | Ga0206354_10531322 | 3300020081 | Bacteria | 511 |
| 220 | Ga0206354_11239045 | 3300020081 | Bacteria | 1231 |
| 221 | Ga0213876_10293538 | 3300021384 | Bacteria | 864 |
| 222 | Ga0224712_10029818 | 3300022467 | Bacteria | 1963 |
| 223 | Ga0207653_10088085 | 3300025885 | Bacteria | 1084 |
| 224 | Ga0207642_10573688 | 3300025899 | Bacteria | 699 |
| 225 | Ga0207688_10196196 | 3300025901 | Bacteria | 1209 |
| 226 | Ga0207645_10312000 | 3300025907 | Bacteria | 1048 |
| 227 | Ga0207645_10530096 | 3300025907 | Bacteria | 798 |
| 228 | Ga0207643_10631655 | 3300025908 | Bacteria | 690 |
| 229 | Ga0207684_10026536 | 3300025910 | Bacteria | 4939 |
| 230 | Ga0207684_10026643 | 3300025910 | Bacteria | 4928 |
| 231 | Ga0207684_10182567 | 3300025910 | Bacteria | 1809 |
| 232 | Ga0207684_10727025 | 3300025910 | Bacteria | 842 |
| 233 | Ga0207654_10450814 | 3300025911 | Bacteria | 902 |
| 234 | Ga0207654_10527263 | 3300025911 | Bacteria | 837 |
| 235 | Ga0207707_10003489 | 3300025912 | Bacteria | 13914 |
| 236 | Ga0207707_10026410 | 3300025912 | Bacteria | 5075 |
| 237 | Ga0207707_10076663 | 3300025912 | Bacteria | 2918 |
| 238 | Ga0207707_10212961 | 3300025912 | Bacteria | 1683 |
| 239 | Ga0207662_10534384 | 3300025918 | Bacteria | 811 |
| 240 | Ga0207657_10220837 | 3300025919 | Bacteria | 1518 |
| 241 | Ga0207646_10675813 | 3300025922 | Bacteria | 924 |
| 242 | Ga0207646_11369174 | 3300025922 | Bacteria | 616 |
| 243 | Ga0207694_10776513 | 3300025924 | Bacteria | 809 |
| 244 | Ga0207650_10416118 | 3300025925 | Bacteria | 1114 |
| 245 | Ga0207687_10001161 | 3300025927 | Bacteria | 17971 |
| 246 | Ga0207700_10253632 | 3300025928 | Bacteria | 1504 |
| 247 | Ga0207700_10819284 | 3300025928 | Bacteria | 833 |
| 248 | Ga0207664_10911755 | 3300025929 | Bacteria | 789 |
| 249 | Ga0207664_10958078 | 3300025929 | Bacteria | 767 |
| 250 | Ga0207664_11206537 | 3300025929 | Bacteria | 675 |
| 251 | Ga0207644_10002764 | 3300025931 | Bacteria | 11300 |
| 252 | Ga0207644_10625504 | 3300025931 | Bacteria | 895 |
| 253 | Ga0207686_10608619 | 3300025934 | Bacteria | 861 |
| 254 | Ga0207686_10922113 | 3300025934 | Bacteria | 706 |
| 255 | Ga0207686_11286582 | 3300025934 | Bacteria | 600 |
| 256 | Ga0207669_11322070 | 3300025937 | Bacteria | 613 |
| 257 | Ga0207665_10078645 | 3300025939 | Bacteria | 2266 |
| 258 | Ga0207665_10480049 | 3300025939 | Bacteria | 958 |
| 259 | Ga0207711_11006564 | 3300025941 | Bacteria | 773 |
| 260 | Ga0207689_10646740 | 3300025942 | Bacteria | 891 |
| 261 | Ga0207689_10950670 | 3300025942 | Bacteria | 725 |
| 262 | Ga0207667_10610955 | 3300025949 | Bacteria | 1099 |
| 263 | Ga0207651_10101839 | 3300025960 | Bacteria | 2133 |
| 264 | Ga0207712_10672225 | 3300025961 | Bacteria | 902 |
| 265 | Ga0207712_11558730 | 3300025961 | Bacteria | 592 |
| 266 | Ga0207712_12137861 | 3300025961 | Bacteria | 501 |
| 267 | Ga0207658_10619726 | 3300025986 | Bacteria | 973 |
| 268 | Ga0207658_12018461 | 3300025986 | Bacteria | 525 |
| 269 | Ga0207677_11871196 | 3300026023 | Bacteria | 557 |
| 270 | Ga0207639_12188891 | 3300026041 | Bacteria | 514 |
| 271 | Ga0207678_10117462 | 3300026067 | Bacteria | 2270 |
| 272 | Ga0207678_10279158 | 3300026067 | Bacteria | 1433 |
| 273 | Ga0207702_11974517 | 3300026078 | Bacteria | 574 |
| 274 | Ga0207641_10149980 | 3300026088 | Bacteria | 2111 |
| 275 | Ga0207641_10492193 | 3300026088 | Bacteria | 1190 |
| 276 | Ga0207641_10498067 | 3300026088 | Bacteria | 1183 |
| 277 | Ga0207648_10515627 | 3300026089 | Bacteria | 1095 |
| 278 | Ga0207676_10124872 | 3300026095 | Bacteria | 2178 |
| 279 | Ga0207676_10441689 | 3300026095 | Bacteria | 1225 |
| 280 | Ga0207675_100100627 | 3300026118 | Bacteria | 2723 |
| 281 | Ga0207675_100403950 | 3300026118 | Bacteria | 1347 |
| 282 | Ga0207675_100585287 | 3300026118 | Bacteria | 1118 |
| 283 | Ga0207675_101104445 | 3300026118 | Bacteria | 813 |
| 284 | Ga0207683_10647202 | 3300026121 | Bacteria | 979 |
| 285 | Ga0207683_10684896 | 3300026121 | Bacteria | 950 |
| 286 | Ga0209813_10015006 | 3300027866 | Bacteria | 2093 |
| 287 | Ga0209974_10395855 | 3300027876 | Unclassified | 542 |
| 288 | Ga0207428_10008172 | 3300027907 | Bacteria | 9469 |
| 289 | Ga0207428_10234082 | 3300027907 | Bacteria | 1374 |
| 290 | Ga0207428_10300348 | 3300027907 | Bacteria | 1188 |
| 291 | Ga0268265_10932380 | 3300028380 | Bacteria | 854 |
| 292 | Ga0268264_10582892 | 3300028381 | Bacteria | 1100 |
| 293 | Ga0268264_11054016 | 3300028381 | Bacteria | 821 |
| 294 | Ga0265337_1106810 | 3300028556 | Bacteria | 761 |
| 295 | Ga0265322_10115326 | 3300028654 | Bacteria | 765 |
| 296 | Ga0265338_10000404 | 3300028800 | Bacteria | 77425 |
| 297 | Ga0265338_10193405 | 3300028800 | Bacteria | 1540 |
| 298 | Ga0265338_10607596 | 3300028800 | Bacteria | 761 |
| 299 | Ga0265330_10192244 | 3300031235 | Bacteria | 864 |
| 300 | Ga0265328_10271932 | 3300031239 | Bacteria | 651 |
| 301 | Ga0265320_10520267 | 3300031240 | Bacteria | 526 |
| 302 | Ga0265325_10002389 | 3300031241 | Bacteria | 12687 |
| 303 | Ga0265339_10036862 | 3300031249 | Bacteria | 2734 |
| 304 | Ga0265339_10579177 | 3300031249 | Bacteria | 515 |
| 305 | Ga0265331_10052636 | 3300031250 | Bacteria | 1944 |
| 306 | Ga0265327_10034891 | 3300031251 | Bacteria | 2786 |
| 307 | Ga0265327_10059187 | 3300031251 | Bacteria | 1963 |
| 308 | Ga0265327_10267202 | 3300031251 | Bacteria | 758 |
| 309 | Ga0265316_10596465 | 3300031344 | Bacteria | 783 |
| 310 | Ga0307408_100180627 | 3300031548 | Bacteria | 1692 |
| 311 | Ga0265313_10000776 | 3300031595 | Bacteria | 32397 |
| 312 | Ga0316575_10243186 | 3300031665 | Bacteria | 754 |
| 313 | Ga0316579_10017298 | 3300031691 | Bacteria | 3160 |
| 314 | Ga0265314_10092562 | 3300031711 | Bacteria | 1965 |
| 315 | Ga0265314_10406592 | 3300031711 | Bacteria | 735 |
| 316 | Ga0265342_10156185 | 3300031712 | Bacteria | 1264 |
| 317 | Ga0316576_10012357 | 3300031727 | Bacteria | 5636 |
| 318 | Ga0316576_10027706 | 3300031727 | Bacteria | 3985 |
| 319 | Ga0316576_10054211 | 3300031727 | Bacteria | 2924 |
| 320 | Ga0316576_10165266 | 3300031727 | Bacteria | 1670 |
| 321 | Ga0316576_10235728 | 3300031727 | Bacteria | 1375 |
| 322 | Ga0316578_10012581 | 3300031728 | Bacteria | 4465 |
| 323 | Ga0307405_11668919 | 3300031731 | Bacteria | 564 |
| 324 | Ga0316577_10010865 | 3300031733 | Bacteria | 4923 |
| 325 | Ga0316577_10128256 | 3300031733 | Bacteria | 1427 |
| 326 | Ga0316577_10174856 | 3300031733 | Bacteria | 1212 |
| 327 | Ga0307410_10503308 | 3300031852 | Bacteria | 997 |
| 328 | Ga0307406_10258551 | 3300031901 | Bacteria | 1316 |
| 329 | Ga0307406_10582699 | 3300031901 | Bacteria | 920 |
| 330 | Ga0307407_10127235 | 3300031903 | Bacteria | 1624 |
| 331 | Ga0307407_10964967 | 3300031903 | Bacteria | 657 |
| 332 | Ga0307416_100069594 | 3300032002 | Bacteria | 2913 |
| 333 | Ga0307416_101067272 | 3300032002 | Bacteria | 912 |
| 334 | Ga0307414_10040824 | 3300032004 | Bacteria | 3137 |
| 335 | Ga0307415_100306253 | 3300032126 | Bacteria | 1318 |
| 336 | Ga0307415_100579662 | 3300032126 | Bacteria | 995 |
| 337 | Ga0307415_100793002 | 3300032126 | Bacteria | 864 |
| 338 | Ga0307415_100805671 | 3300032126 | Bacteria | 858 |
| 339 | Ga0307415_100945856 | 3300032126 | Bacteria | 797 |
| 340 | Ga0307415_101043610 | 3300032126 | Bacteria | 762 |
| 341 | Ga0316585_10086067 | 3300032137 | Bacteria | 1026 |
| 342 | Ga0316580_10021572 | 3300032139 | Bacteria | 1985 |
| 343 | Ga0373926_0333235 | 3300035083 | Bacteria | 595 |
| 344 | Ga0373926_0355644 | 3300035083 | Bacteria | 575 |
| 345 | Ga0373928_0280948 | 3300035084 | Bacteria | 505 |
| 346 | Ga0373929_0074432 | 3300035085 | Bacteria | 818 |
| 347 | Ga0373944_0372451 | 3300035089 | Bacteria | 546 |
| 348 | Ga0373939_0076157 | 3300035114 | Bacteria | 1104 |
| 349 | Ga0373945_0384129 | 3300035116 | Bacteria | 613 |
| 350 | Ga0373943_0272790 | 3300035170 | Bacteria | 954 |
| 351 | Ga0373946_0114699 | 3300035171 | Bacteria | 1223 |
| 352 | Ga0373942_0256721 | 3300035207 | Bacteria | 596 |
| 353 | Ga0316574_0016888 | 3300035398 | Bacteria | 4260 |
| 354 | Ga0316574_0030977 | 3300035398 | Bacteria | 3243 |
| 355 | Ga0316574_0115231 | 3300035398 | Bacteria | 1723 |
| 356 | Ga0316574_0166622 | 3300035398 | Bacteria | 1419 |
| 357 | Ga0316574_0307818 | 3300035398 | Bacteria | 1007 |
| 358 | Ga0373931_0013527 | 3300035691 | Bacteria | 3975 |
| 359 | Ga0373935_0098909 | 3300035692 | Bacteria | 1920 |
| 360 | Ga0373935_0109742 | 3300035692 | Bacteria | 1830 |
| 361 | Ga0373935_0176449 | 3300035692 | Bacteria | 1465 |
| 362 | Ga0373933_0231936 | 3300035724 | Bacteria | 1186 |
| 363 | Ga0373933_0774017 | 3300035724 | Bacteria | 632 |
| 364 | Ga0373947_0062015 | 3300035725 | Bacteria | 2274 |
| 365 | Ga0373947_0167346 | 3300035725 | Bacteria | 1425 |
| 366 | Ga0373937_0421046 | 3300036401 | Bacteria | 1268 |
| 367 | Ga0373937_0567628 | 3300036401 | Bacteria | 1078 |
| 368 | Ga0373937_1389207 | 3300036401 | Bacteria | 650 |
| 369 | Ga0316582_0085568 | 3300036647 | Bacteria | 2066 |
| 370 | Ga0316582_0456259 | 3300036647 | Bacteria | 881 |
| 371 | Ga0316584_0016841 | 3300036712 | Bacteria | 5245 |
| 372 | Ga0316584_0038830 | 3300036712 | Bacteria | 3543 |
| 373 | Ga0316584_0119260 | 3300036712 | Bacteria | 1972 |
| 374 | Ga0316584_0241678 | 3300036712 | Bacteria | 1321 |
| 375 | Ga0373925_0167156 | 3300037068 | Bacteria | 1735 |
| 376 | Ga0373925_1106298 | 3300037068 | Bacteria | 652 |
| 377 | Ga0395900_0992021 | 3300037418 | Bacteria | 760 |
| 378 | Ga0395900_1836060 | 3300037418 | Bacteria | 517 |
| 379 | Ga0400485_07726 | 3300038735 | Bacteria | 4146 |
| 380 | Ga0400485_07921 | 3300038735 | Bacteria | 6699 |
| 381 | Ga0400486_02192 | 3300038742 | Bacteria | 1656 |
| 382 | Ga0400483_006374 | 3300039062 | Bacteria | 8573 |
| 383 | Ga0400483_102644 | 3300039062 | Bacteria | 1539 |
| 384 | Ga0400483_119634 | 3300039062 | Bacteria | 8580 |
| 385 | Ga0400483_135474 | 3300039062 | Bacteria | 19039 |
| 386 | Ga0400483_271686 | 3300039062 | Bacteria | 10762 |
| 387 | Ga0400483_286448 | 3300039062 | Bacteria | 1035 |
| 388 | Ga0436365_0047787 | 3300039437 | Bacteria | 609 |
| 389 | Ga0436365_0055491 | 3300039437 | Bacteria | 1233 |
| 390 | Ga0436365_0454746 | 3300039437 | Bacteria | 672 |
| 391 | Ga0436365_0921705 | 3300039437 | Bacteria | 837 |
| 392 | Ga0436365_0956643 | 3300039437 | Bacteria | 1163 |
| 393 | Ga0436365_1069374 | 3300039437 | Bacteria | 1706 |
| 394 | Ga0436360_0714011 | 3300039438 | Bacteria | 1003 |
| 395 | Ga0436363_0953663 | 3300039450 | Bacteria | 697 |
| 396 | Ga0436363_1269616 | 3300039450 | Bacteria | 857 |
| 397 | Ga0436363_1371372 | 3300039450 | Bacteria | 688 |
| 398 | Ga0436362_0257499 | 3300039453 | Bacteria | 987 |
| 399 | Ga0436362_0777461 | 3300039453 | Bacteria | 779 |
| 400 | Ga0436362_0822080 | 3300039453 | Bacteria | 619 |
| 401 | Ga0436362_1097698 | 3300039453 | Bacteria | 757 |
| 402 | Ga0436362_1235245 | 3300039453 | Bacteria | 569 |
| 403 | Ga0436362_1259949 | 3300039453 | Bacteria | 6913 |
| 404 | Ga0439438_126189 | 3300041405 | Bacteria | 615 |
| 405 | Ga0439439_0035272 | 3300041406 | Bacteria | 1285 |
| 406 | Ga0439447_084172 | 3300041407 | Bacteria | 733 |
| 407 | Ga0439453_0036030 | 3300041408 | Bacteria | 955 |
| 408 | Ga0451797_0697581 | 3300041453 | Bacteria | 547 |
| 409 | Ga0451798_0038043 | 3300041458 | Bacteria | 510 |
| 410 | Ga0451800_1088893 | 3300041459 | Bacteria | 565 |
| 411 | Ga0451800_1225528 | 3300041459 | Bacteria | 693 |
| 412 | Ga0451802_0197124 | 3300041460 | Bacteria | 780 |
| 413 | Ga0451804_1080182 | 3300041463 | Bacteria | 608 |
| 414 | Ga0451807_2190932 | 3300041486 | Bacteria | 721 |
| 415 | Ga0451835_0911484 | 3300041492 | Bacteria | 619 |
| 416 | Ga0451835_1221373 | 3300041492 | Bacteria | 501 |
| 417 | Ga0451839_1338875 | 3300041496 | Bacteria | 659 |
| 418 | Ga0451849_0525999 | 3300041505 | Bacteria | 570 |
| 419 | Ga0451851_0358739 | 3300041507 | Bacteria | 683 |
| 420 | Ga0451853_0327854 | 3300041512 | Bacteria | 501 |
| 421 | Ga0451853_3757407 | 3300041512 | Bacteria | 711 |
| 422 | Ga0439443_028594 | 3300042003 | Bacteria | 910 |
| 423 | Ga0439448_0003737 | 3300042005 | Bacteria | 4242 |
| 424 | Ga0439432_176514 | 3300042006 | Bacteria | 623 |
| 425 | Ga0439450_000313 | 3300042008 | Bacteria | 6035 |
| 426 | Ga0439463_004804 | 3300042016 | Bacteria | 3375 |
| 427 | Ga0450920_010777 | 3300042122 | Bacteria | 1698 |
| 428 | Ga0450888_073165 | 3300042126 | Bacteria | 518 |
| 429 | Ga0450906_047207 | 3300042145 | Bacteria | 760 |
| 430 | Ga0439458_0168438 | 3300042157 | Bacteria | 592 |
| 431 | Ga0450908_093698 | 3300042184 | Bacteria | 546 |
| 432 | Ga0439434_0126408 | 3300042435 | Bacteria | 837 |
| 433 | Ga0439435_0305059 | 3300042436 | Unclassified | 546 |
| 434 | Ga0439444_0022164 | 3300042437 | Bacteria | 1130 |
| 435 | Ga0439464_0001455 | 3300042439 | Bacteria | 5582 |
| 436 | Ga0439460_0170586 | 3300042461 | Bacteria | 732 |
| 437 | Ga0450918_012076 | 3300042531 | Bacteria | 1505 |
| 438 | Ga0450901_010290 | 3300042533 | Bacteria | 968 |
| 439 | Ga0466966_0308943 | 3300044684 | Bacteria | 950 |
| 440 | Ga0466966_0362990 | 3300044684 | Bacteria | 870 |
| 441 | Ga0466961_0150203 | 3300044693 | Bacteria | 1455 |
| 442 | Ga0466963_0271608 | 3300044694 | Bacteria | 1191 |
| 443 | Ga0466958_0220396 | 3300045836 | Bacteria | 1210 |
| 444 | Ga0495592_0121987 | 3300046454 | Bacteria | 1832 |
| 445 | Ga0495603_0483769 | 3300046455 | Bacteria | 709 |
| 446 | Ga0495603_0748761 | 3300046455 | Bacteria | 558 |
| 447 | Ga0495641_0209791 | 3300046461 | Bacteria | 873 |
| 448 | Ga0495641_0310819 | 3300046461 | Bacteria | 711 |
| 449 | Ga0495651_0484363 | 3300046462 | Bacteria | 794 |
| 450 | Ga0495653_0459294 | 3300046463 | Bacteria | 800 |
| 451 | Ga0495653_0538478 | 3300046463 | Bacteria | 724 |
| 452 | Ga0495653_0939132 | 3300046463 | Bacteria | 514 |
| 453 | Ga0495582_0232496 | 3300046473 | Bacteria | 1056 |
| 454 | Ga0495605_0179163 | 3300046474 | Bacteria | 933 |
| 455 | Ga0495639_0187872 | 3300046475 | Bacteria | 1008 |
| 456 | Ga0495639_0256549 | 3300046475 | Bacteria | 865 |
| 457 | Ga0495639_0434685 | 3300046475 | Bacteria | 666 |
| 458 | Ga0495662_0310985 | 3300046476 | Bacteria | 775 |
| 459 | Ga0495664_0055799 | 3300046477 | Bacteria | 2350 |
| 460 | Ga0495594_0220000 | 3300046499 | Bacteria | 1083 |
| 461 | Ga0495596_0215373 | 3300046500 | Bacteria | 746 |
| 462 | Ga0495583_0205470 | 3300046506 | Bacteria | 799 |
| 463 | Ga0495608_0133541 | 3300046511 | Bacteria | 1587 |
| 464 | Ga0495608_0269690 | 3300046511 | Bacteria | 1058 |
| 465 | Ga0495608_0326738 | 3300046511 | Bacteria | 947 |
| 466 | Ga0495608_0338831 | 3300046511 | Bacteria | 927 |
| 467 | Ga0495618_0229067 | 3300046514 | Bacteria | 1170 |
| 468 | Ga0495618_0450888 | 3300046514 | Bacteria | 781 |
| 469 | Ga0495618_0685726 | 3300046514 | Bacteria | 603 |
| 470 | Ga0495618_0769535 | 3300046514 | Bacteria | 562 |
| 471 | Ga0495628_0008870 | 3300046516 | Bacteria | 8603 |
| 472 | Ga0495628_0288221 | 3300046516 | Bacteria | 1218 |
| 473 | Ga0495628_0606226 | 3300046516 | Bacteria | 782 |
| 474 | Ga0495630_0035254 | 3300046517 | Bacteria | 3739 |
| 475 | Ga0495630_0047489 | 3300046517 | Bacteria | 3211 |
| 476 | Ga0495630_0183085 | 3300046517 | Bacteria | 1597 |
| 477 | Ga0495630_0267231 | 3300046517 | Bacteria | 1307 |
| 478 | Ga0495630_1017009 | 3300046517 | Bacteria | 630 |
| 479 | Ga0495644_0068240 | 3300046523 | Bacteria | 1336 |
| 480 | Ga0495663_0042989 | 3300046525 | Bacteria | 1379 |
| 481 | Ga0495666_0026231 | 3300046526 | Bacteria | 2875 |
| 482 | Ga0495652_0364853 | 3300046529 | Bacteria | 1031 |
| 483 | Ga0495652_0389860 | 3300046529 | Bacteria | 989 |
| 484 | Ga0495640_0009407 | 3300046533 | Bacteria | 7610 |
| 485 | Ga0495640_0200041 | 3300046533 | Bacteria | 1267 |
| 486 | Ga0495640_0478650 | 3300046533 | Bacteria | 759 |
| 487 | Ga0495586_0079237 | 3300046535 | Bacteria | 1803 |
| 488 | Ga0495586_0103943 | 3300046535 | Bacteria | 1578 |
| 489 | Ga0495645_0504983 | 3300046543 | Bacteria | 755 |
| 490 | Ga0495622_0206976 | 3300046557 | Bacteria | 873 |
| 491 | Ga0495667_0167708 | 3300046559 | Bacteria | 1411 |
| 492 | Ga0495667_0251753 | 3300046559 | Bacteria | 1124 |
| 493 | Ga0495667_0426049 | 3300046559 | Bacteria | 835 |
| 494 | Ga0495668_0584640 | 3300046616 | Bacteria | 617 |
| 495 | Ga0495668_0710132 | 3300046616 | Bacteria | 556 |
| 496 | Ga0495634_0349714 | 3300046642 | Bacteria | 885 |
| 497 | Ga0495634_0486677 | 3300046642 | Bacteria | 724 |
| 498 | Ga0495634_0690592 | 3300046642 | Bacteria | 587 |
| 499 | Ga0495625_0755924 | 3300046660 | Bacteria | 569 |
| 500 | Ga0495635_0123357 | 3300046663 | Bacteria | 1767 |
| 501 | Ga0495635_0158384 | 3300046663 | Bacteria | 1541 |
| 502 | Ga0495599_0319576 | 3300046678 | Bacteria | 935 |
| 503 | Ga0495623_0503952 | 3300046679 | Bacteria | 639 |
| 504 | Ga0495646_0151615 | 3300046680 | Bacteria | 1289 |
| 505 | Ga0495647_0213001 | 3300046681 | Bacteria | 850 |
| 506 | Ga0495647_0226600 | 3300046681 | Bacteria | 826 |
| 507 | Ga0495647_0502102 | 3300046681 | Bacteria | 565 |
| 508 | Ga0495658_0065406 | 3300046683 | Bacteria | 2097 |
| 509 | Ga0495658_0070594 | 3300046683 | Bacteria | 2027 |
| 510 | Ga0495658_0315551 | 3300046683 | Bacteria | 990 |
| 511 | Ga0495658_0500872 | 3300046683 | Bacteria | 777 |
| 512 | Ga0495658_0803079 | 3300046683 | Bacteria | 602 |
| 513 | Ga0495613_0140617 | 3300046689 | Bacteria | 1725 |
| 514 | Ga0495613_0218459 | 3300046689 | Bacteria | 1339 |
| 515 | Ga0495613_0341201 | 3300046689 | Bacteria | 1030 |
| 516 | Ga0495624_0341277 | 3300046690 | Bacteria | 901 |
| 517 | Ga0495624_0356345 | 3300046690 | Bacteria | 880 |
| 518 | Ga0495624_0655241 | 3300046690 | Bacteria | 624 |
| 519 | Ga0495671_0175655 | 3300046692 | Bacteria | 1041 |
| 520 | Ga0495671_0216872 | 3300046692 | Bacteria | 927 |
| 521 | Ga0495589_0084697 | 3300046794 | Bacteria | 1541 |
| 522 | Ga0495589_0305226 | 3300046794 | Bacteria | 737 |
| 523 | Ga0495581_0526248 | 3300047315 | Bacteria | 687 |
| 524 | Ga0495581_0627086 | 3300047315 | Bacteria | 622 |
| 525 | Ga0495604_0228747 | 3300047317 | Bacteria | 1277 |
| 526 | Ga0495604_0798526 | 3300047317 | Bacteria | 594 |
| 527 | Ga0495636_0268267 | 3300047318 | Bacteria | 793 |
| 528 | Ga0495636_0479457 | 3300047318 | Bacteria | 600 |
| 529 | Ga0495636_0602818 | 3300047318 | Bacteria | 537 |
| 530 | Ga0495674_0177649 | 3300047319 | Bacteria | 1774 |
| 531 | Ga0495674_0179513 | 3300047319 | Unclassified | 1764 |
| 532 | Ga0495674_0627550 | 3300047319 | Bacteria | 849 |
| 533 | Ga0495672_0000884 | 3300047320 | Bacteria | 31539 |
| 534 | Ga0495672_0093189 | 3300047320 | Bacteria | 1650 |
| 535 | Ga0495676_0030448 | 3300047321 | Bacteria | 4580 |
| 536 | Ga0495676_0055288 | 3300047321 | Bacteria | 3148 |
| 537 | Ga0495676_0059179 | 3300047321 | Bacteria | 3011 |
| 538 | Ga0495676_0611527 | 3300047321 | Bacteria | 709 |
| 539 | Ga0495680_0085474 | 3300047322 | Bacteria | 2375 |
| 540 | Ga0495683_0452195 | 3300047323 | Bacteria | 527 |
| 541 | Ga0495675_0295112 | 3300047444 | Bacteria | 964 |
| 542 | Ga0495677_0214575 | 3300047445 | Bacteria | 749 |
| 543 | Ga0495679_145206 | 3300047446 | Bacteria | 639 |
| 544 | Ga0495685_207671 | 3300047447 | Bacteria | 627 |
| 545 | Ga0495684_0166281 | 3300047471 | Bacteria | 1643 |
| 546 | Ga0495684_0168031 | 3300047471 | Bacteria | 1633 |
| 547 | Ga0495684_0654022 | 3300047471 | Bacteria | 702 |
| 548 | Ga0495686_0228577 | 3300047472 | Bacteria | 1055 |
| 549 | Ga0495593_0493308 | 3300047673 | Bacteria | 614 |
| 550 | Ga0495593_0680819 | 3300047673 | Bacteria | 516 |
| 551 | Ga0495602_0340328 | 3300048088 | Bacteria | 1085 |
| 552 | Ga0495602_0501203 | 3300048088 | Bacteria | 849 |
| 553 | Ga0495602_0566538 | 3300048088 | Bacteria | 785 |
| 554 | Ga0495602_0677115 | 3300048088 | Bacteria | 702 |
| 555 | Ga0495614_0178375 | 3300048089 | Bacteria | 955 |
| 556 | Ga0495614_0309896 | 3300048089 | Bacteria | 731 |
| 557 | Ga0495615_0091603 | 3300048090 | Bacteria | 848 |
| 558 | Ga0495626_0192685 | 3300048091 | Bacteria | 840 |
| 559 | Ga0496100_1067533 | 3300048903 | Bacteria | 636 |
| 560 | Ga0496101_0057951 | 3300048904 | Bacteria | 2803 |
| 561 | Ga0496101_0760405 | 3300048904 | Bacteria | 764 |
| 562 | Ga0496101_0834134 | 3300048904 | Bacteria | 727 |
| 563 | Ga0496101_1336702 | 3300048904 | Bacteria | 560 |
| 564 | Ga0496102_0022327 | 3300048905 | Bacteria | 5607 |
| 565 | Ga0496102_0063259 | 3300048905 | Bacteria | 3388 |
| 566 | Ga0496103_0149470 | 3300048906 | Bacteria | 1496 |
| 567 | Ga0496104_0002399 | 3300048907 | Bacteria | 16146 |
| 568 | Ga0496104_0035101 | 3300048907 | Bacteria | 4681 |
| 569 | Ga0496104_0263493 | 3300048907 | Bacteria | 1636 |
| 570 | Ga0496104_1260529 | 3300048907 | Bacteria | 642 |
| 571 | Ga0496105_0203836 | 3300048908 | Bacteria | 1614 |
| 572 | Ga0496105_0819588 | 3300048908 | Bacteria | 706 |
| 573 | Ga0496106_0136190 | 3300048909 | Bacteria | 1929 |
| 574 | Ga0496106_0507014 | 3300048909 | Bacteria | 969 |
| 575 | Ga0496107_0025907 | 3300048910 | Bacteria | 4156 |
| 576 | Ga0496108_0089960 | 3300048911 | Bacteria | 2609 |
| 577 | Ga0496108_0624172 | 3300048911 | Bacteria | 938 |
| 578 | Ga0496108_0737966 | 3300048911 | Bacteria | 852 |
| 579 | Ga0496108_0864987 | 3300048911 | Bacteria | 777 |
| 580 | Ga0496108_1604955 | 3300048911 | Bacteria | 538 |
| 581 | Ga0496109_0024454 | 3300048912 | Bacteria | 5370 |
| 582 | Ga0496109_0067024 | 3300048912 | Bacteria | 3288 |
| 583 | Ga0496109_0336309 | 3300048912 | Bacteria | 1426 |
| 584 | Ga0496109_0469254 | 3300048912 | Bacteria | 1189 |
| 585 | Ga0496109_0626399 | 3300048912 | Bacteria | 1012 |
| 586 | Ga0496109_1423156 | 3300048912 | Bacteria | 629 |
| 587 | Ga0496110_0130293 | 3300048913 | Bacteria | 2271 |
| 588 | Ga0496110_0578736 | 3300048913 | Bacteria | 1019 |
| 589 | Ga0496110_0689981 | 3300048913 | Bacteria | 922 |
| 590 | Ga0496110_1238087 | 3300048913 | Bacteria | 655 |
| 591 | Ga0496111_0086327 | 3300048914 | Bacteria | 2296 |
| 592 | Ga0496111_0301316 | 3300048914 | Bacteria | 1188 |
| 593 | Ga0496112_0059723 | 3300048915 | Bacteria | 3757 |
| 594 | Ga0496112_0323264 | 3300048915 | Bacteria | 1487 |
| 595 | Ga0496112_0601856 | 3300048915 | Bacteria | 1031 |
| 596 | Ga0496112_0840751 | 3300048915 | Bacteria | 842 |
| 597 | Ga0496112_0855883 | 3300048915 | Bacteria | 832 |
| 598 | Ga0496113_0184622 | 3300048916 | Bacteria | 1654 |
| 599 | Ga0496113_0320168 | 3300048916 | Bacteria | 1243 |
| 600 | Ga0496113_0330638 | 3300048916 | Bacteria | 1222 |
| 601 | Ga0496113_0431891 | 3300048916 | Bacteria | 1058 |
| 602 | Ga0496113_0749628 | 3300048916 | Bacteria | 777 |
| 603 | Ga0496114_0970744 | 3300048917 | Bacteria | 732 |
| 604 | Ga0496114_1022791 | 3300048917 | Bacteria | 710 |
| 605 | Ga0496114_1655216 | 3300048917 | Bacteria | 528 |
| 606 | Ga0496115_0012220 | 3300048918 | Bacteria | 6455 |
| 607 | Ga0496115_0538106 | 3300048918 | Bacteria | 935 |
| 608 | Ga0501307_081704 | 3300049162 | Bacteria | 529 |
| 609 | Ga0501031_0001203 | 3300049568 | Bacteria | 15788 |
| 610 | Ga0501031_0008975 | 3300049568 | Bacteria | 6504 |
| 611 | Ga0501031_0012023 | 3300049568 | Bacteria | 5645 |
| 612 | Ga0501031_0057837 | 3300049568 | Bacteria | 2526 |
| 613 | Ga0501031_0159369 | 3300049568 | Bacteria | 1475 |
| 614 | Ga0501031_0170134 | 3300049568 | Bacteria | 1424 |
| 615 | Ga0501031_0406661 | 3300049568 | Bacteria | 880 |
| 616 | Ga0501031_0854621 | 3300049568 | Bacteria | 583 |
| 617 | Ga0501032_0001203 | 3300049569 | Bacteria | 20695 |
| 618 | Ga0501032_0029797 | 3300049569 | Bacteria | 3743 |
| 619 | Ga0501032_0094265 | 3300049569 | Bacteria | 1985 |
| 620 | Ga0501032_0274713 | 3300049569 | Bacteria | 1091 |
| 621 | Ga0501032_0686972 | 3300049569 | Bacteria | 649 |
| 622 | Ga0501033_0003012 | 3300049570 | Bacteria | 14061 |
| 623 | Ga0501033_0003829 | 3300049570 | Bacteria | 12242 |
| 624 | Ga0501033_0004468 | 3300049570 | Bacteria | 11187 |
| 625 | Ga0501033_0018735 | 3300049570 | Bacteria | 5232 |
| 626 | Ga0501033_0111858 | 3300049570 | Bacteria | 1987 |
| 627 | Ga0501033_0218832 | 3300049570 | Bacteria | 1356 |
| 628 | Ga0501034_0002750 | 3300049571 | Bacteria | 20681 |
| 629 | Ga0501034_0224578 | 3300049571 | Bacteria | 1829 |
| 630 | Ga0501034_0290609 | 3300049571 | Bacteria | 1573 |
| 631 | Ga0501034_0302154 | 3300049571 | Bacteria | 1537 |
| 632 | Ga0501034_0316360 | 3300049571 | Bacteria | 1494 |
| 633 | Ga0501034_0343081 | 3300049571 | Bacteria | 1423 |
| 634 | Ga0501036_0003005 | 3300049572 | Bacteria | 13418 |
| 635 | Ga0501036_0011148 | 3300049572 | Bacteria | 7437 |
| 636 | Ga0501036_0013366 | 3300049572 | Bacteria | 6820 |
| 637 | Ga0501036_0017186 | 3300049572 | Bacteria | 6047 |
| 638 | Ga0501036_0022688 | 3300049572 | Bacteria | 5282 |
| 639 | Ga0501036_0026040 | 3300049572 | Bacteria | 4936 |
| 640 | Ga0501036_0026119 | 3300049572 | Bacteria | 4929 |
| 641 | Ga0501036_0239222 | 3300049572 | Bacteria | 1523 |
| 642 | Ga0501036_0366897 | 3300049572 | Bacteria | 1202 |
| 643 | Ga0501036_0440942 | 3300049572 | Bacteria | 1085 |
| 644 | Ga0501036_0561392 | 3300049572 | Bacteria | 948 |
| 645 | Ga0501037_0014066 | 3300049573 | Bacteria | 5895 |
| 646 | Ga0501037_0014202 | 3300049573 | Bacteria | 5864 |
| 647 | Ga0501037_0098580 | 3300049573 | Bacteria | 2111 |
| 648 | Ga0501037_0120931 | 3300049573 | Bacteria | 1883 |
| 649 | Ga0501037_0536842 | 3300049573 | Bacteria | 790 |
| 650 | Ga0501037_1106280 | 3300049573 | Bacteria | 513 |
| 651 | Ga0501038_0011836 | 3300049574 | Bacteria | 7963 |
| 652 | Ga0501038_0025889 | 3300049574 | Bacteria | 5226 |
| 653 | Ga0501038_0043269 | 3300049574 | Bacteria | 3916 |
| 654 | Ga0501038_0070861 | 3300049574 | Bacteria | 2958 |
| 655 | Ga0501038_0160072 | 3300049574 | Bacteria | 1830 |
| 656 | Ga0501038_0328419 | 3300049574 | Bacteria | 1195 |
| 657 | Ga0501038_0603558 | 3300049574 | Bacteria | 830 |
| 658 | Ga0501039_0006601 | 3300049575 | Bacteria | 8812 |
| 659 | Ga0501039_0007919 | 3300049575 | Bacteria | 8097 |
| 660 | Ga0501039_0010232 | 3300049575 | Bacteria | 7147 |
| 661 | Ga0501039_0010828 | 3300049575 | Bacteria | 6950 |
| 662 | Ga0501039_0011747 | 3300049575 | Bacteria | 6669 |
| 663 | Ga0501039_0082281 | 3300049575 | Bacteria | 2507 |
| 664 | Ga0501039_0122257 | 3300049575 | Bacteria | 2041 |
| 665 | Ga0501039_0171381 | 3300049575 | Bacteria | 1706 |
| 666 | Ga0501039_0184410 | 3300049575 | Bacteria | 1641 |
| 667 | Ga0501039_0214615 | 3300049575 | Bacteria | 1513 |
| 668 | Ga0501039_0245352 | 3300049575 | Bacteria | 1408 |
| 669 | Ga0501039_0367929 | 3300049575 | Bacteria | 1129 |
| 670 | Ga0501039_0784040 | 3300049575 | Bacteria | 744 |
| 671 | Ga0501040_0000785 | 3300049576 | Bacteria | 19752 |
| 672 | Ga0501040_0007501 | 3300049576 | Bacteria | 7056 |
| 673 | Ga0501040_0024646 | 3300049576 | Bacteria | 4039 |
| 674 | Ga0501040_0025298 | 3300049576 | Bacteria | 3991 |
| 675 | Ga0501040_0029703 | 3300049576 | Bacteria | 3690 |
| 676 | Ga0501040_0052223 | 3300049576 | Bacteria | 2797 |
| 677 | Ga0501040_0059568 | 3300049576 | Bacteria | 2623 |
| 678 | Ga0501040_0072846 | 3300049576 | Bacteria | 2373 |
| 679 | Ga0501040_0265090 | 3300049576 | Bacteria | 1226 |
| 680 | Ga0501040_0274613 | 3300049576 | Bacteria | 1204 |
| 681 | Ga0501040_0348809 | 3300049576 | Bacteria | 1060 |
| 682 | Ga0501040_0430537 | 3300049576 | Bacteria | 949 |
| 683 | Ga0501040_0518383 | 3300049576 | Unclassified | 859 |
| 684 | Ga0501041_0000759 | 3300049577 | Bacteria | 17243 |
| 685 | Ga0501041_0000812 | 3300049577 | Bacteria | 16745 |
| 686 | Ga0501041_0005964 | 3300049577 | Bacteria | 7127 |
| 687 | Ga0501041_0006962 | 3300049577 | Bacteria | 6633 |
| 688 | Ga0501041_0026988 | 3300049577 | Bacteria | 3459 |
| 689 | Ga0501041_0035281 | 3300049577 | Bacteria | 3030 |
| 690 | Ga0501041_0090992 | 3300049577 | Bacteria | 1884 |
| 691 | Ga0501041_0115017 | 3300049577 | Bacteria | 1670 |
| 692 | Ga0501041_0244085 | 3300049577 | Bacteria | 1129 |
| 693 | Ga0501041_0405228 | 3300049577 | Bacteria | 864 |
| 694 | Ga0501041_0503439 | 3300049577 | Bacteria | 771 |
| 695 | Ga0501042_0000504 | 3300049578 | Bacteria | 20325 |
| 696 | Ga0501042_0001643 | 3300049578 | Bacteria | 13318 |
| 697 | Ga0501042_0006408 | 3300049578 | Bacteria | 7633 |
| 698 | Ga0501042_0044901 | 3300049578 | Bacteria | 3148 |
| 699 | Ga0501042_0068497 | 3300049578 | Bacteria | 2538 |
| 700 | Ga0501042_0094621 | 3300049578 | Bacteria | 2146 |
| 701 | Ga0501042_0272575 | 3300049578 | Bacteria | 1222 |
| 702 | Ga0501042_0291670 | 3300049578 | Bacteria | 1178 |
| 703 | Ga0501042_0327871 | 3300049578 | Bacteria | 1106 |
| 704 | Ga0501042_0370007 | 3300049578 | Bacteria | 1037 |
| 705 | Ga0501042_0514263 | 3300049578 | Bacteria | 869 |
| 706 | Ga0501042_0603488 | 3300049578 | Bacteria | 798 |
| 707 | Ga0501042_1006182 | 3300049578 | Bacteria | 607 |
| 708 | Ga0501042_1103803 | 3300049578 | Bacteria | 578 |
| 709 | Ga0501042_1193239 | 3300049578 | Bacteria | 555 |
| 710 | Ga0501042_1319602 | 3300049578 | Bacteria | 526 |
| 711 | Ga0501043_0007699 | 3300049579 | Bacteria | 8530 |
| 712 | Ga0501043_0016411 | 3300049579 | Bacteria | 5806 |
| 713 | Ga0501043_0271505 | 3300049579 | Bacteria | 1302 |
| 714 | Ga0501043_0315188 | 3300049579 | Bacteria | 1193 |
| 715 | Ga0501043_1132799 | 3300049579 | Bacteria | 552 |
| 716 | Ga0501043_1188617 | 3300049579 | Bacteria | 536 |
| 717 | Ga0501046_0004094 | 3300049580 | Bacteria | 13285 |
| 718 | Ga0501046_0005560 | 3300049580 | Bacteria | 11260 |
| 719 | Ga0501046_0023951 | 3300049580 | Bacteria | 5013 |
| 720 | Ga0501046_0025957 | 3300049580 | Bacteria | 4788 |
| 721 | Ga0501046_0029128 | 3300049580 | Bacteria | 4492 |
| 722 | Ga0501046_0040868 | 3300049580 | Bacteria | 3703 |
| 723 | Ga0501046_0047264 | 3300049580 | Bacteria | 3412 |
| 724 | Ga0501046_0895073 | 3300049580 | Bacteria | 619 |
| 725 | Ga0501047_0012694 | 3300049581 | Bacteria | 7979 |
| 726 | Ga0501047_0179649 | 3300049581 | Bacteria | 1983 |
| 727 | Ga0501048_0008087 | 3300049582 | Bacteria | 7961 |
| 728 | Ga0501048_0017750 | 3300049582 | Bacteria | 5236 |
| 729 | Ga0501048_0019700 | 3300049582 | Bacteria | 4947 |
| 730 | Ga0501048_0022677 | 3300049582 | Bacteria | 4589 |
| 731 | Ga0501048_0034719 | 3300049582 | Bacteria | 3636 |
| 732 | Ga0501048_0041802 | 3300049582 | Bacteria | 3283 |
| 733 | Ga0501048_0142628 | 3300049582 | Bacteria | 1694 |
| 734 | Ga0501048_0151861 | 3300049582 | Bacteria | 1638 |
| 735 | Ga0501048_0354493 | 3300049582 | Bacteria | 1046 |
| 736 | Ga0501048_0385645 | 3300049582 | Bacteria | 1001 |
| 737 | Ga0501048_0592175 | 3300049582 | Bacteria | 796 |
| 738 | Ga0501068_0011607 | 3300049584 | Bacteria | 4976 |
| 739 | Ga0501068_0014374 | 3300049584 | Bacteria | 4524 |
| 740 | Ga0501068_0020679 | 3300049584 | Bacteria | 3838 |
| 741 | Ga0501068_0153425 | 3300049584 | Bacteria | 1448 |
| 742 | Ga0501068_0188878 | 3300049584 | Bacteria | 1304 |
| 743 | Ga0501068_0281611 | 3300049584 | Unclassified | 1063 |
| 744 | Ga0501068_0320511 | 3300049584 | Bacteria | 994 |
| 745 | Ga0501068_0394015 | 3300049584 | Bacteria | 892 |
| 746 | Ga0501068_0394163 | 3300049584 | Bacteria | 892 |
| 747 | Ga0501068_0496223 | 3300049584 | Bacteria | 792 |
| 748 | Ga0501069_0005350 | 3300049585 | Bacteria | 6677 |
| 749 | Ga0501069_0057589 | 3300049585 | Bacteria | 2167 |
| 750 | Ga0501069_0083881 | 3300049585 | Bacteria | 1797 |
| 751 | Ga0501069_0191753 | 3300049585 | Bacteria | 1183 |
| 752 | Ga0501069_0405670 | 3300049585 | Bacteria | 807 |
| 753 | Ga0501069_0902066 | 3300049585 | Bacteria | 538 |
| 754 | Ga0501070_0002318 | 3300049586 | Bacteria | 16701 |
| 755 | Ga0501070_0002602 | 3300049586 | Bacteria | 15769 |
| 756 | Ga0501070_0003086 | 3300049586 | Bacteria | 14505 |
| 757 | Ga0501070_0052792 | 3300049586 | Bacteria | 3374 |
| 758 | Ga0501070_0054265 | 3300049586 | Bacteria | 3324 |
| 759 | Ga0501070_0280994 | 3300049586 | Bacteria | 1358 |
| 760 | Ga0501070_0561343 | 3300049586 | Bacteria | 913 |
| 761 | Ga0501070_0683202 | 3300049586 | Bacteria | 813 |
| 762 | Ga0501070_1003681 | 3300049586 | Unclassified | 647 |
| 763 | Ga0501071_0000545 | 3300049587 | Bacteria | 19380 |
| 764 | Ga0501071_0000787 | 3300049587 | Bacteria | 16887 |
| 765 | Ga0501071_0001054 | 3300049587 | Bacteria | 15259 |
| 766 | Ga0501071_0009639 | 3300049587 | Bacteria | 6445 |
| 767 | Ga0501071_0014181 | 3300049587 | Bacteria | 5448 |
| 768 | Ga0501071_0015392 | 3300049587 | Bacteria | 5251 |
| 769 | Ga0501071_0016589 | 3300049587 | Bacteria | 5067 |
| 770 | Ga0501071_0021976 | 3300049587 | Bacteria | 4446 |
| 771 | Ga0501071_0022614 | 3300049587 | Bacteria | 4384 |
| 772 | Ga0501071_0038298 | 3300049587 | Bacteria | 3426 |
| 773 | Ga0501071_0084865 | 3300049587 | Bacteria | 2322 |
| 774 | Ga0501071_0251806 | 3300049587 | Bacteria | 1333 |
| 775 | Ga0501071_0616628 | 3300049587 | Unclassified | 834 |
| 776 | Ga0501071_0620315 | 3300049587 | Unclassified | 832 |
| 777 | Ga0501071_0711013 | 3300049587 | Unclassified | 774 |
| 778 | Ga0501071_1028915 | 3300049587 | Bacteria | 636 |
| 779 | Ga0501071_1225224 | 3300049587 | Bacteria | 580 |
| 780 | Ga0501072_0000534 | 3300049588 | Bacteria | 27305 |
| 781 | Ga0501072_0000940 | 3300049588 | Bacteria | 21452 |
| 782 | Ga0501072_0003389 | 3300049588 | Bacteria | 11992 |
| 783 | Ga0501072_0003761 | 3300049588 | Bacteria | 11457 |
| 784 | Ga0501072_0004312 | 3300049588 | Bacteria | 10800 |
| 785 | Ga0501072_0045577 | 3300049588 | Bacteria | 3448 |
| 786 | Ga0501072_0047186 | 3300049588 | Bacteria | 3392 |
| 787 | Ga0501072_0154071 | 3300049588 | Bacteria | 1832 |
| 788 | Ga0501072_0294452 | 3300049588 | Bacteria | 1290 |
| 789 | Ga0501072_0454268 | 3300049588 | Bacteria | 1014 |
| 790 | Ga0501072_0595413 | 3300049588 | Bacteria | 872 |
| 791 | Ga0501072_1024453 | 3300049588 | Unclassified | 643 |
| 792 | Ga0501072_1098263 | 3300049588 | Bacteria | 619 |
| 793 | Ga0501072_1453231 | 3300049588 | Bacteria | 530 |
| 794 | Ga0501073_0003892 | 3300049589 | Bacteria | 11212 |
| 795 | Ga0501073_0008573 | 3300049589 | Bacteria | 7582 |
| 796 | Ga0501073_0082006 | 3300049589 | Bacteria | 2243 |
| 797 | Ga0501073_0576918 | 3300049589 | Bacteria | 777 |
| 798 | Ga0501074_0000933 | 3300049590 | Bacteria | 18810 |
| 799 | Ga0501074_0048376 | 3300049590 | Bacteria | 3072 |
| 800 | Ga0501074_0094709 | 3300049590 | Bacteria | 2138 |
| 801 | Ga0501074_0111622 | 3300049590 | Bacteria | 1956 |
| 802 | Ga0501074_0130833 | 3300049590 | Bacteria | 1795 |
| 803 | Ga0501074_0134948 | 3300049590 | Bacteria | 1765 |
| 804 | Ga0501074_0552390 | 3300049590 | Unclassified | 815 |
| 805 | Ga0501074_0899457 | 3300049590 | Bacteria | 623 |
| 806 | Ga0501075_0000765 | 3300049591 | Bacteria | 20070 |
| 807 | Ga0501075_0002356 | 3300049591 | Bacteria | 12543 |
| 808 | Ga0501075_0004561 | 3300049591 | Bacteria | 9390 |
| 809 | Ga0501075_0006710 | 3300049591 | Bacteria | 7941 |
| 810 | Ga0501075_0016972 | 3300049591 | Bacteria | 5252 |
| 811 | Ga0501075_0025233 | 3300049591 | Bacteria | 4367 |
| 812 | Ga0501075_0066505 | 3300049591 | Bacteria | 2720 |
| 813 | Ga0501075_0108832 | 3300049591 | Bacteria | 2107 |
| 814 | Ga0501075_0192315 | 3300049591 | Bacteria | 1556 |
| 815 | Ga0501075_0306942 | 3300049591 | Bacteria | 1209 |
| 816 | Ga0501075_0607970 | 3300049591 | Bacteria | 834 |
| 817 | Ga0501075_0660795 | 3300049591 | Bacteria | 797 |
| 818 | Ga0501075_0881628 | 3300049591 | Bacteria | 680 |
| 819 | Ga0501076_0001754 | 3300049592 | Bacteria | 14659 |
| 820 | Ga0501076_0002077 | 3300049592 | Bacteria | 13724 |
| 821 | Ga0501076_0002252 | 3300049592 | Bacteria | 13204 |
| 822 | Ga0501076_0003130 | 3300049592 | Bacteria | 11530 |
| 823 | Ga0501076_0008401 | 3300049592 | Bacteria | 7565 |
| 824 | Ga0501076_0010913 | 3300049592 | Bacteria | 6758 |
| 825 | Ga0501076_0020135 | 3300049592 | Bacteria | 5105 |
| 826 | Ga0501076_0044611 | 3300049592 | Bacteria | 3496 |
| 827 | Ga0501076_0048861 | 3300049592 | Bacteria | 3343 |
| 828 | Ga0501076_0166806 | 3300049592 | Bacteria | 1795 |
| 829 | Ga0501076_0264849 | 3300049592 | Bacteria | 1407 |
| 830 | Ga0501076_0454080 | 3300049592 | Bacteria | 1055 |
| 831 | Ga0501076_0486181 | 3300049592 | Bacteria | 1017 |
| 832 | Ga0501076_0680452 | 3300049592 | Bacteria | 849 |
| 833 | Ga0501076_0715444 | 3300049592 | Bacteria | 826 |
| 834 | Ga0501076_0902471 | 3300049592 | Bacteria | 728 |
| 835 | Ga0501077_0001976 | 3300049593 | Bacteria | 12390 |
| 836 | Ga0501077_0002417 | 3300049593 | Bacteria | 11209 |
| 837 | Ga0501077_0004688 | 3300049593 | Bacteria | 8310 |
| 838 | Ga0501077_0007289 | 3300049593 | Bacteria | 6824 |
| 839 | Ga0501077_0014703 | 3300049593 | Bacteria | 4918 |
| 840 | Ga0501077_0068525 | 3300049593 | Bacteria | 2249 |
| 841 | Ga0501077_0135043 | 3300049593 | Bacteria | 1565 |
| 842 | Ga0501077_0149323 | 3300049593 | Bacteria | 1483 |
| 843 | Ga0501077_0251052 | 3300049593 | Bacteria | 1125 |
| 844 | Ga0501077_0364784 | 3300049593 | Bacteria | 922 |
| 845 | Ga0501077_0826738 | 3300049593 | Bacteria | 596 |
| 846 | Ga0501225_0113375 | 3300049705 | Bacteria | 801 |
| 847 | Ga0501079_0002313 | 3300049741 | Bacteria | 13801 |
| 848 | Ga0501079_0003485 | 3300049741 | Bacteria | 11570 |
| 849 | Ga0501079_0018502 | 3300049741 | Bacteria | 5323 |
| 850 | Ga0501079_0024344 | 3300049741 | Bacteria | 4644 |
| 851 | Ga0501079_0024745 | 3300049741 | Bacteria | 4607 |
| 852 | Ga0501079_0027572 | 3300049741 | Bacteria | 4356 |
| 853 | Ga0501079_0042445 | 3300049741 | Bacteria | 3512 |
| 854 | Ga0501079_0179751 | 3300049741 | Unclassified | 1651 |
| 855 | Ga0501079_0236580 | 3300049741 | Bacteria | 1427 |
| 856 | Ga0501079_0307457 | 3300049741 | Bacteria | 1240 |
| 857 | Ga0501079_0576108 | 3300049741 | Bacteria | 885 |
| 858 | Ga0501079_0742448 | 3300049741 | Bacteria | 773 |
| 859 | Ga0501079_0944173 | 3300049741 | Bacteria | 679 |
| 860 | Ga0501079_1075010 | 3300049741 | Bacteria | 634 |
| 861 | Ga0501079_1280245 | 3300049741 | Bacteria | 577 |
| 862 | Ga0501080_0001292 | 3300049742 | Bacteria | 20823 |
| 863 | Ga0501080_0004589 | 3300049742 | Bacteria | 12311 |
| 864 | Ga0501080_0009468 | 3300049742 | Bacteria | 8884 |
| 865 | Ga0501080_0015557 | 3300049742 | Bacteria | 7015 |
| 866 | Ga0501080_0188504 | 3300049742 | Bacteria | 1896 |
| 867 | Ga0501080_0213418 | 3300049742 | Bacteria | 1768 |
| 868 | Ga0501080_0262952 | 3300049742 | Bacteria | 1572 |
| 869 | Ga0501080_0408345 | 3300049742 | Bacteria | 1221 |
| 870 | Ga0501080_1262825 | 3300049742 | Bacteria | 633 |
| 871 | Ga0501080_1832621 | 3300049742 | Bacteria | 509 |
| 872 | Ga0501081_0000178 | 3300049743 | Bacteria | 30143 |
| 873 | Ga0501081_0003569 | 3300049743 | Bacteria | 9945 |
| 874 | Ga0501081_0006630 | 3300049743 | Bacteria | 7526 |
| 875 | Ga0501081_0010894 | 3300049743 | Bacteria | 5943 |
| 876 | Ga0501081_0011534 | 3300049743 | Bacteria | 5782 |
| 877 | Ga0501081_0027421 | 3300049743 | Bacteria | 3842 |
| 878 | Ga0501081_0050391 | 3300049743 | Bacteria | 2868 |
| 879 | Ga0501081_0054743 | 3300049743 | Bacteria | 2756 |
| 880 | Ga0501081_0068693 | 3300049743 | Bacteria | 2467 |
| 881 | Ga0501081_0484907 | 3300049743 | Unclassified | 920 |
| 882 | Ga0501081_0490885 | 3300049743 | Bacteria | 915 |
| 883 | Ga0501081_0704976 | 3300049743 | Unclassified | 758 |
| 884 | Ga0501081_1200789 | 3300049743 | Bacteria | 575 |
| 885 | Ga0501083_0062822 | 3300049744 | Bacteria | 2477 |
| 886 | Ga0501083_0110053 | 3300049744 | Bacteria | 1811 |
| 887 | Ga0501083_0173779 | 3300049744 | Bacteria | 1408 |
| 888 | Ga0501083_0308597 | 3300049744 | Bacteria | 1029 |
| 889 | Ga0501083_0605318 | 3300049744 | Bacteria | 713 |
| 890 | Ga0501083_0997187 | 3300049744 | Bacteria | 545 |
| 891 | Ga0501035_0007096 | 3300049822 | Bacteria | 10477 |
| 892 | Ga0501035_0106576 | 3300049822 | Bacteria | 2457 |
| 893 | Ga0501035_0388526 | 3300049822 | Bacteria | 1163 |
| 894 | Ga0501035_0428607 | 3300049822 | Bacteria | 1097 |
| 895 | Ga0501035_0431286 | 3300049822 | Bacteria | 1093 |
| 896 | Ga0501035_0677495 | 3300049822 | Bacteria | 834 |
| 897 | Ga0501035_0783113 | 3300049822 | Bacteria | 763 |
| 898 | Ga0501044_0016386 | 3300049823 | Bacteria | 7958 |
| 899 | Ga0501044_0040147 | 3300049823 | Bacteria | 4879 |
| 900 | Ga0501044_0364336 | 3300049823 | Bacteria | 1363 |
| 901 | Ga0501044_0553098 | 3300049823 | Bacteria | 1048 |
| 902 | Ga0501044_0588216 | 3300049823 | Bacteria | 1007 |
| 903 | Ga0501045_0001690 | 3300049824 | Bacteria | 14859 |
| 904 | Ga0501045_0003702 | 3300049824 | Bacteria | 10515 |
| 905 | Ga0501045_0004890 | 3300049824 | Bacteria | 9278 |
| 906 | Ga0501045_0006370 | 3300049824 | Bacteria | 8169 |
| 907 | Ga0501045_0007530 | 3300049824 | Bacteria | 7566 |
| 908 | Ga0501045_0008943 | 3300049824 | Bacteria | 6995 |
| 909 | Ga0501045_0022706 | 3300049824 | Bacteria | 4493 |
| 910 | Ga0501045_0037680 | 3300049824 | Bacteria | 3516 |
| 911 | Ga0501045_0058139 | 3300049824 | Bacteria | 2831 |
| 912 | Ga0501045_0094213 | 3300049824 | Bacteria | 2215 |
| 913 | Ga0501045_0263714 | 3300049824 | Bacteria | 1282 |
| 914 | Ga0501045_0496898 | 3300049824 | Unclassified | 906 |
| 915 | Ga0501045_0504035 | 3300049824 | Bacteria | 899 |
| 916 | Ga0501045_0654527 | 3300049824 | Bacteria | 776 |
| 917 | Ga0501045_0826465 | 3300049824 | Bacteria | 682 |
| 918 | Ga0501204_035123 | 3300049850 | Bacteria | 712 |
| 919 | nmdc:mga03683_121393_c1 | 3300050489 | Bacteria | 1162 |
| 920 | nmdc:mga03683_55340_c1 | 3300050489 | Bacteria | 1666 |
| 921 | nmdc:mga03n38_193044_c1 | 3300050490 | Bacteria | 1050 |
| 922 | nmdc:mga03n38_33169_c1 | 3300050490 | Bacteria | 2194 |
| 923 | nmdc:mga03n38_36953_c1 | 3300050490 | Bacteria | 2103 |
| 924 | nmdc:mga00v17_109390_c1 | 3300050491 | Bacteria | 1752 |
| 925 | nmdc:mga00v17_484830_c1 | 3300050491 | Bacteria | 802 |
| 926 | nmdc:mga00v17_604429_c1 | 3300050491 | Bacteria | 707 |
| 927 | nmdc:mga0yw44_1049155_c1 | 3300050492 | Bacteria | 551 |
| 928 | nmdc:mga0yw44_119578_c1 | 3300050492 | Bacteria | 1696 |
| 929 | nmdc:mga0yw44_165030_c1 | 3300050492 | Bacteria | 1452 |
| 930 | nmdc:mga0yw44_365528_c1 | 3300050492 | Bacteria | 973 |
| 931 | nmdc:mga0yw44_48412_c1 | 3300050492 | Bacteria | 2563 |
| 932 | nmdc:mga06z11_129152_c1 | 3300050494 | Bacteria | 1417 |
| 933 | nmdc:mga04h51_25951_c1 | 3300050495 | Bacteria | 1808 |
| 934 | nmdc:mga07m45_598146_c1 | 3300050496 | Bacteria | 637 |
| 935 | nmdc:mga05p37_1254526_c1 | 3300050507 | Bacteria | 760 |
| 936 | nmdc:mga05p37_305953_c1 | 3300050507 | Bacteria | 1886 |
| 937 | nmdc:mga05p37_31750_c1 | 3300050507 | Bacteria | 6455 |
| 938 | nmdc:mga05p37_619657_c1 | 3300050507 | Bacteria | 1218 |
| 939 | nmdc:mga05p37_68259_c1 | 3300050507 | Bacteria | 4372 |
| 940 | nmdc:mga09592_1434329_c1 | 3300050508 | Bacteria | 564 |
| 941 | nmdc:mga09592_187433_c1 | 3300050508 | Bacteria | 1790 |
| 942 | nmdc:mga09592_297379_c1 | 3300050508 | Bacteria | 1400 |
| 943 | nmdc:mga09592_356043_c1 | 3300050508 | Bacteria | 1267 |
| 944 | nmdc:mga09592_492952_c1 | 3300050508 | Bacteria | 1055 |
| 945 | nmdc:mga0qj67_128852_c1 | 3300050509 | Bacteria | 2048 |
| 946 | nmdc:mga0qj67_252862_c1 | 3300050509 | Bacteria | 1430 |
| 947 | nmdc:mga0qj67_315888_c1 | 3300050509 | Bacteria | 1265 |
| 948 | nmdc:mga0qj67_374042_c1 | 3300050509 | Bacteria | 1151 |
| 949 | nmdc:mga0qj67_648315_c1 | 3300050509 | Bacteria | 843 |
| 950 | nmdc:mga0qj67_844300_c1 | 3300050509 | Bacteria | 724 |
| 951 | nmdc:mga0qj67_917407_c1 | 3300050509 | Bacteria | 690 |
| 952 | nmdc:mga06r32_219428_c1 | 3300050510 | Bacteria | 1890 |
| 953 | nmdc:mga06r32_272114_c1 | 3300050510 | Bacteria | 1681 |
| 954 | nmdc:mga06r32_33363_c1 | 3300050510 | Bacteria | 4849 |
| 955 | nmdc:mga06r32_52497_c1 | 3300050510 | Bacteria | 3905 |
| 956 | nmdc:mga06r32_89875_c1 | 3300050510 | Bacteria | 3000 |
| 957 | nmdc:mga08y16_389974_c1 | 3300050511 | Bacteria | 1427 |
| 958 | nmdc:mga08y16_581575_c1 | 3300050511 | Bacteria | 1130 |
| 959 | nmdc:mga08y16_74620_c1 | 3300050511 | Bacteria | 3535 |
| 960 | nmdc:mga0n895_222292_c1 | 3300050512 | Bacteria | 1917 |
| 961 | nmdc:mga0rr50_346351_c1 | 3300050513 | Bacteria | 1249 |
| 962 | nmdc:mga0rr50_892356_c1 | 3300050513 | Bacteria | 758 |
| 963 | nmdc:mga0rr50_948481_c1 | 3300050513 | Bacteria | 733 |
| 964 | nmdc:mga08x19_12713_c1 | 3300050514 | Bacteria | 5077 |
| 965 | nmdc:mga08x19_683542_c1 | 3300050514 | Bacteria | 728 |
| 966 | nmdc:mga08x19_800794_c1 | 3300050514 | Bacteria | 669 |
| 967 | nmdc:mga0a205_704560_c1 | 3300050515 | Bacteria | 859 |
| 968 | Ga0495601_0208155 | 3300053077 | Bacteria | 1278 |
| 969 | Ga0495601_0615291 | 3300053077 | Bacteria | 696 |
| 970 | Ga0495612_0134373 | 3300053078 | Bacteria | 1070 |
| 971 | Ga0495612_0246829 | 3300053078 | Bacteria | 794 |
| 972 | Ga0495612_0374825 | 3300053078 | Bacteria | 644 |
| 973 | Ga0500635_0110502 | 3300053080 | Bacteria | 1020 |
| 974 | Ga0500635_0427445 | 3300053080 | Bacteria | 525 |
| 975 | Ga0495595_0039362 | 3300053084 | Bacteria | 2156 |
| 976 | Ga0495595_0157766 | 3300053084 | Bacteria | 1118 |
| 977 | Ga0495595_0177581 | 3300053084 | Bacteria | 1055 |
| 978 | Ga0495595_0202593 | 3300053084 | Bacteria | 988 |
| 979 | Ga0495619_0007373 | 3300053085 | Bacteria | 6967 |
| 980 | Ga0495619_0022185 | 3300053085 | Bacteria | 4060 |
| 981 | Ga0495619_0085163 | 3300053085 | Bacteria | 2134 |
| 982 | Ga0495619_0148138 | 3300053085 | Bacteria | 1619 |
| 983 | Ga0495619_0472678 | 3300053085 | Bacteria | 863 |
| 984 | Ga0495619_0548370 | 3300053085 | Bacteria | 793 |
| 985 | Ga0495619_0957582 | 3300053085 | Bacteria | 574 |
| 986 | Ga0495619_1024400 | 3300053085 | Bacteria | 551 |
| 987 | Ga0500646_0115826 | 3300053090 | Bacteria | 857 |
| 988 | Ga0500566_0000443 | 3300053094 | Bacteria | 23094 |
| 989 | Ga0500655_045931 | 3300053133 | Bacteria | 863 |
| 990 | Ga0500616_0002763 | 3300053153 | Bacteria | 14173 |
| 991 | Ga0501084_0000009 | 3300054114 | Bacteria | 194961 |
| 992 | Ga0501084_0003222 | 3300054114 | Bacteria | 13216 |
| 993 | Ga0501084_0007626 | 3300054114 | Bacteria | 8922 |
| 994 | Ga0501084_0012792 | 3300054114 | Bacteria | 6952 |
| 995 | Ga0501084_0017700 | 3300054114 | Bacteria | 5928 |
| 996 | Ga0501084_0019565 | 3300054114 | Bacteria | 5641 |
| 997 | Ga0501084_0034137 | 3300054114 | Bacteria | 4253 |
| 998 | Ga0501084_0034773 | 3300054114 | Bacteria | 4213 |
| 999 | Ga0501084_0055533 | 3300054114 | Bacteria | 3313 |
| 1000 | Ga0501084_0184707 | 3300054114 | Bacteria | 1760 |
| 1001 | Ga0501084_0215464 | 3300054114 | Bacteria | 1620 |
| 1002 | Ga0501084_0299055 | 3300054114 | Bacteria | 1359 |
| 1003 | Ga0501084_1281420 | 3300054114 | Bacteria | 614 |
| 1004 | Ga0501084_1287531 | 3300054114 | Unclassified | 613 |
| 1005 | Ga0590071_111381 | 3300059421 | Bacteria | 695 |
| 1006 | Ga0590075_016083 | 3300059424 | Bacteria | 1839 |
| 1007 | Ga0590077_046504 | 3300059426 | Bacteria | 971 |
| 1008 | Ga0587084_063996 | 3300059477 | Unclassified | 680 |
| 1009 | Ga0587084_072720 | 3300059477 | Bacteria | 652 |
| 1010 | Ga0587066_032358 | 3300059490 | Bacteria | 940 |
| 1011 | Ga0587073_0124465 | 3300059492 | Bacteria | 700 |
| 1012 | Ga0587125_070311 | 3300059607 | Bacteria | 527 |
| 1013 | Ga0587113_027502 | 3300059625 | Bacteria | 630 |
| 1014 | Ga0587117_094234 | 3300059627 | Bacteria | 563 |
| 1015 | Ga0587128_091992 | 3300059630 | Bacteria | 623 |
| 1016 | Ga0587128_139972 | 3300059630 | Unclassified | 543 |
| 1017 | Ga0587128_141435 | 3300059630 | Bacteria | 541 |
| 1018 | Ga0587075_049985 | 3300059644 | Bacteria | 727 |
| 1019 | Ga0587079_115479 | 3300059647 | Bacteria | 658 |
| 1020 | Ga0587079_144066 | 3300059647 | Unclassified | 610 |
| 1021 | Ga0587100_034130 | 3300059648 | Bacteria | 551 |
| 1022 | Ga0587107_080079 | 3300059652 | Bacteria | 612 |
| 1023 | Ga0587071_059809 | 3300060344 | Bacteria | 807 |
| 1024 | Ga0501082_0001635 | 3300060353 | Bacteria | 19758 |
| 1025 | Ga0501082_0005603 | 3300060353 | Bacteria | 10898 |
| 1026 | Ga0501082_0008693 | 3300060353 | Bacteria | 8758 |
| 1027 | Ga0501082_0010236 | 3300060353 | Bacteria | 8074 |
| 1028 | Ga0501082_0018771 | 3300060353 | Bacteria | 5958 |
| 1029 | Ga0501082_0021667 | 3300060353 | Bacteria | 5540 |
| 1030 | Ga0501082_0081583 | 3300060353 | Bacteria | 2790 |
| 1031 | Ga0501082_0179068 | 3300060353 | Bacteria | 1843 |
| 1032 | Ga0501082_0276496 | 3300060353 | Bacteria | 1462 |
| 1033 | Ga0501082_0441048 | 3300060353 | Bacteria | 1137 |
| 1034 | Ga0501082_0451447 | 3300060353 | Bacteria | 1123 |
| 1035 | Ga0501082_0663618 | 3300060353 | Bacteria | 913 |
| 1036 | Ga0501082_0706473 | 3300060353 | Bacteria | 882 |
| 1037 | Ga0501082_1164115 | 3300060353 | Bacteria | 674 |
| 1038 | Ga0466962_0105642 | 3300061719 | Bacteria | 1354 |
| 1039 | Ga0530510_0000984 | 3300061734 | Bacteria | 18861 |
| 1040 | Ga0530510_0001714 | 3300061734 | Bacteria | 14898 |
| 1041 | Ga0530510_0001976 | 3300061734 | Bacteria | 14048 |
| 1042 | Ga0530510_0003814 | 3300061734 | Bacteria | 10389 |
| 1043 | Ga0530510_0003983 | 3300061734 | Bacteria | 10192 |
| 1044 | Ga0530510_0005385 | 3300061734 | Bacteria | 8856 |
| 1045 | Ga0530510_0009528 | 3300061734 | Bacteria | 6810 |
| 1046 | Ga0530510_0011077 | 3300061734 | Bacteria | 6326 |
| 1047 | Ga0530510_0020233 | 3300061734 | Bacteria | 4732 |
| 1048 | Ga0530510_0031036 | 3300061734 | Bacteria | 3841 |
| 1049 | Ga0530510_0031408 | 3300061734 | Bacteria | 3819 |
| 1050 | Ga0530510_0200878 | 3300061734 | Bacteria | 1480 |
| 1051 | Ga0530510_0268463 | 3300061734 | Bacteria | 1273 |
| 1052 | Ga0530510_0314895 | 3300061734 | Bacteria | 1172 |
| 1053 | Ga0530510_0339940 | 3300061734 | Bacteria | 1127 |
| 1054 | Ga0530510_0644595 | 3300061734 | Bacteria | 806 |
| 1055 | Ga0530510_0786449 | 3300061734 | Bacteria | 726 |
| 1056 | Ga0530510_0800685 | 3300061734 | Unclassified | 719 |
| 1057 | Ga0530510_1518702 | 3300061734 | Bacteria | 514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061734 | Ga0530510_0314895 | Ga0530510_0314895_768_1160 | 88 |
| 2 | 3300039062 | Ga0400483_006374 | Ga0400483_006374_4907_5266 | 92 |
| 3 | 3300049591 | Ga0501075_0660795 | Ga0501075_0660795_105_554 | 93 |
| 4 | 3300035207 | Ga0373942_0256721 | Ga0373942_0256721_88_501 | 94 |
| 5 | 3300049850 | Ga0501204_035123 | Ga0501204_035123_134_520 | 95 |
| 6 | 3300005547 | Ga0070693_100824062 | Ga0070693_1008240621 | 96 |
| 7 | 3300005615 | Ga0070702_100925012 | Ga0070702_1009250121 | 96 |
| 8 | 3300009993 | Ga0105028_102783 | Ga0105028_1027832 | 96 |
| 9 | 3300050490 | nmdc:mga03n38_193044_c1 | nmdc:mga03n38_193044_c1_124_513 | 96 |
| 10 | 3300050495 | nmdc:mga04h51_25951_c1 | nmdc:mga04h51_25951_c1_432_821 | 96 |
| 11 | 3300009993 | Ga0105028_101416 | Ga0105028_1014163 | 97 |
| 12 | 3300011119 | Ga0105246_10992831 | Ga0105246_109928311 | 97 |
| 13 | 3300006048 | Ga0075363_100321995 | Ga0075363_1003219952 | 98 |
| 14 | 3300009147 | Ga0114129_10290496 | Ga0114129_102904962 | 98 |
| 15 | 3300014326 | Ga0157380_11539729 | Ga0157380_115397291 | 98 |
| 16 | 3300049586 | Ga0501070_0002318 | Ga0501070_0002318_4710_5126 | 98 |
| 17 | 3300049589 | Ga0501073_0003892 | Ga0501073_0003892_6114_6530 | 98 |
| 18 | 3300049705 | Ga0501225_0113375 | Ga0501225_0113375_137_523 | 98 |
| 19 | 3300049741 | Ga0501079_0018502 | Ga0501079_0018502_4622_5038 | 98 |
| 20 | 3300049742 | Ga0501080_0015557 | Ga0501080_0015557_6242_6658 | 98 |
| 21 | 3300049744 | Ga0501083_0062822 | Ga0501083_0062822_2026_2442 | 98 |
| 22 | 3300054114 | Ga0501084_0007626 | Ga0501084_0007626_362_778 | 98 |
| 23 | 3300005355 | Ga0070671_100610725 | Ga0070671_1006107252 | 99 |
| 24 | 3300049577 | Ga0501041_0244085 | Ga0501041_0244085_331_780 | 99 |
| 25 | 3300049587 | Ga0501071_0620315 | Ga0501071_0620315_144_593 | 99 |
| 26 | 3300049741 | Ga0501079_0179751 | Ga0501079_0179751_1040_1489 | 99 |
| 27 | 3300049568 | Ga0501031_0012023 | Ga0501031_0012023_1592_2041 | 100 |
| 28 | 3300049572 | Ga0501036_0011148 | Ga0501036_0011148_5847_6296 | 100 |
| 29 | 3300049573 | Ga0501037_0120931 | Ga0501037_0120931_1118_1567 | 100 |
| 30 | 3300049574 | Ga0501038_0011836 | Ga0501038_0011836_7359_7808 | 100 |
| 31 | 3300049575 | Ga0501039_0007919 | Ga0501039_0007919_81_530 | 100 |
| 32 | 3300049576 | Ga0501040_0029703 | Ga0501040_0029703_1373_1822 | 100 |
| 33 | 3300049578 | Ga0501042_0006408 | Ga0501042_0006408_7051_7500 | 100 |
| 34 | 3300049580 | Ga0501046_0029128 | Ga0501046_0029128_756_1205 | 100 |
| 35 | 3300049582 | Ga0501048_0034719 | Ga0501048_0034719_1589_2038 | 100 |
| 36 | 3300049587 | Ga0501071_0021976 | Ga0501071_0021976_3151_3600 | 100 |
| 37 | 3300049588 | Ga0501072_0003761 | Ga0501072_0003761_7197_7646 | 100 |
| 38 | 3300049590 | Ga0501074_0048376 | Ga0501074_0048376_2518_2967 | 100 |
| 39 | 3300049591 | Ga0501075_0000765 | Ga0501075_0000765_17353_17802 | 100 |
| 40 | 3300049592 | Ga0501076_0020135 | Ga0501076_0020135_1142_1591 | 100 |
| 41 | 3300049593 | Ga0501077_0007289 | Ga0501077_0007289_4293_4742 | 100 |
| 42 | 3300049741 | Ga0501079_0002313 | Ga0501079_0002313_12635_13084 | 100 |
| 43 | 3300049742 | Ga0501080_1262825 | Ga0501080_1262825_104_553 | 100 |
| 44 | 3300049743 | Ga0501081_0003569 | Ga0501081_0003569_9080_9529 | 100 |
| 45 | 3300049822 | Ga0501035_0431286 | Ga0501035_0431286_69_518 | 100 |
| 46 | 3300049824 | Ga0501045_0008943 | Ga0501045_0008943_2587_3036 | 100 |
| 47 | 3300053080 | Ga0500635_0110502 | Ga0500635_0110502_481_870 | 100 |
| 48 | 3300053090 | Ga0500646_0115826 | Ga0500646_0115826_209_598 | 100 |
| 49 | 3300054114 | Ga0501084_0003222 | Ga0501084_0003222_9896_10345 | 100 |
| 50 | 3300060353 | Ga0501082_0005603 | Ga0501082_0005603_1589_2038 | 100 |
| 51 | 3300061734 | Ga0530510_0031036 | Ga0530510_0031036_338_787 | 100 |
| 52 | 3300009177 | Ga0105248_10853642 | Ga0105248_108536421 | 101 |
| 53 | 3300014969 | Ga0157376_11753242 | Ga0157376_117532421 | 101 |
| 54 | 3300046461 | Ga0495641_0310819 | Ga0495641_0310819_136_525 | 102 |
| 55 | 3300048908 | Ga0496105_0819588 | Ga0496105_0819588_299_688 | 102 |
| 56 | 3300049823 | Ga0501044_0553098 | Ga0501044_0553098_644_1033 | 102 |
| 57 | 3300050489 | nmdc:mga03683_55340_c1 | nmdc:mga03683_55340_c1_793_1182 | 102 |
| 58 | 3300050492 | nmdc:mga0yw44_1049155_c1 | nmdc:mga0yw44_1049155_c1_17_406 | 102 |
| 59 | 3300005467 | Ga0070706_100144692 | Ga0070706_1001446924 | 103 |
| 60 | 3300005536 | Ga0070697_100209557 | Ga0070697_1002095572 | 103 |
| 61 | 3300005543 | Ga0070672_101347882 | Ga0070672_1013478821 | 103 |
| 62 | 3300005834 | Ga0068851_10626331 | Ga0068851_106263311 | 103 |
| 63 | 3300006038 | Ga0075365_10178842 | Ga0075365_101788422 | 103 |
| 64 | 3300006042 | Ga0075368_10064509 | Ga0075368_100645094 | 103 |
| 65 | 3300009176 | Ga0105242_11310039 | Ga0105242_113100392 | 103 |
| 66 | 3300013308 | Ga0157375_11578069 | Ga0157375_115780692 | 103 |
| 67 | 3300025910 | Ga0207684_10727025 | Ga0207684_107270252 | 103 |
| 68 | 3300005329 | Ga0070683_101208140 | Ga0070683_1012081402 | 104 |
| 69 | 3300005339 | Ga0070660_100283627 | Ga0070660_1002836273 | 104 |
| 70 | 3300005367 | Ga0070667_100578598 | Ga0070667_1005785981 | 104 |
| 71 | 3300005436 | Ga0070713_101109849 | Ga0070713_1011098491 | 104 |
| 72 | 3300005457 | Ga0070662_101075910 | Ga0070662_1010759102 | 104 |
| 73 | 3300005548 | Ga0070665_100056101 | Ga0070665_1000561012 | 104 |
| 74 | 3300005617 | Ga0068859_101769379 | Ga0068859_1017693792 | 104 |
| 75 | 3300005937 | Ga0081455_10059279 | Ga0081455_100592793 | 104 |
| 76 | 3300006931 | Ga0097620_101769393 | Ga0097620_1017693932 | 104 |
| 77 | 3300009176 | Ga0105242_11485317 | Ga0105242_114853172 | 104 |
| 78 | 3300013105 | Ga0157369_10507310 | Ga0157369_105073101 | 104 |
| 79 | 3300013297 | Ga0157378_12082987 | Ga0157378_120829872 | 104 |
| 80 | 3300014326 | Ga0157380_11546930 | Ga0157380_115469302 | 104 |
| 81 | 3300014969 | Ga0157376_12053117 | Ga0157376_120531171 | 104 |
| 82 | 3300020078 | Ga0206352_11285469 | Ga0206352_112854692 | 104 |
| 83 | 3300025908 | Ga0207643_10631655 | Ga0207643_106316552 | 104 |
| 84 | 3300025919 | Ga0207657_10220837 | Ga0207657_102208371 | 104 |
| 85 | 3300025929 | Ga0207664_10958078 | Ga0207664_109580781 | 104 |
| 86 | 3300025939 | Ga0207665_10078645 | Ga0207665_100786453 | 104 |
| 87 | 3300028381 | Ga0268264_11054016 | Ga0268264_110540162 | 104 |
| 88 | 3300032126 | Ga0307415_100793002 | Ga0307415_1007930022 | 104 |
| 89 | 3300035084 | Ga0373928_0280948 | Ga0373928_0280948_55_468 | 104 |
| 90 | 3300037418 | Ga0395900_1836060 | Ga0395900_1836060_73_486 | 104 |
| 91 | 3300039450 | Ga0436363_1269616 | Ga0436363_1269616_147_560 | 104 |
| 92 | 3300046616 | Ga0495668_0584640 | Ga0495668_0584640_21_434 | 104 |
| 93 | 3300048904 | Ga0496101_0834134 | Ga0496101_0834134_253_666 | 104 |
| 94 | 3300048912 | Ga0496109_0626399 | Ga0496109_0626399_558_971 | 104 |
| 95 | 3300048912 | Ga0496109_1423156 | Ga0496109_1423156_25_438 | 104 |
| 96 | 3300048914 | Ga0496111_0086327 | Ga0496111_0086327_1802_2215 | 104 |
| 97 | 3300048915 | Ga0496112_0059723 | Ga0496112_0059723_3176_3589 | 104 |
| 98 | 3300048916 | Ga0496113_0749628 | Ga0496113_0749628_24_437 | 104 |
| 99 | 3300049572 | Ga0501036_0026040 | Ga0501036_0026040_290_739 | 104 |
| 100 | 3300049573 | Ga0501037_0536842 | Ga0501037_0536842_235_684 | 104 |
| 101 | 3300049575 | Ga0501039_0245352 | Ga0501039_0245352_839_1288 | 104 |
| 102 | 3300049576 | Ga0501040_0059568 | Ga0501040_0059568_1223_1672 | 104 |
| 103 | 3300049576 | Ga0501040_0274613 | Ga0501040_0274613_507_956 | 104 |
| 104 | 3300049577 | Ga0501041_0090992 | Ga0501041_0090992_1274_1723 | 104 |
| 105 | 3300049578 | Ga0501042_0291670 | Ga0501042_0291670_131_580 | 104 |
| 106 | 3300049579 | Ga0501043_1132799 | Ga0501043_1132799_127_540 | 104 |
| 107 | 3300049584 | Ga0501068_0394163 | Ga0501068_0394163_339_788 | 104 |
| 108 | 3300049586 | Ga0501070_0054265 | Ga0501070_0054265_942_1355 | 104 |
| 109 | 3300049586 | Ga0501070_0683202 | Ga0501070_0683202_151_600 | 104 |
| 110 | 3300049587 | Ga0501071_0014181 | Ga0501071_0014181_305_754 | 104 |
| 111 | 3300049588 | Ga0501072_1098263 | Ga0501072_1098263_95_544 | 104 |
| 112 | 3300049591 | Ga0501075_0607970 | Ga0501075_0607970_356_805 | 104 |
| 113 | 3300049592 | Ga0501076_0010913 | Ga0501076_0010913_4216_4665 | 104 |
| 114 | 3300049593 | Ga0501077_0068525 | Ga0501077_0068525_171_620 | 104 |
| 115 | 3300049593 | Ga0501077_0135043 | Ga0501077_0135043_370_819 | 104 |
| 116 | 3300049741 | Ga0501079_0944173 | Ga0501079_0944173_32_481 | 104 |
| 117 | 3300049742 | Ga0501080_0408345 | Ga0501080_0408345_162_611 | 104 |
| 118 | 3300049743 | Ga0501081_0050391 | Ga0501081_0050391_1803_2252 | 104 |
| 119 | 3300049824 | Ga0501045_0004890 | Ga0501045_0004890_4174_4623 | 104 |
| 120 | 3300060353 | Ga0501082_0021667 | Ga0501082_0021667_4643_5092 | 104 |
| 121 | 3300061734 | Ga0530510_0003814 | Ga0530510_0003814_3383_3832 | 104 |
| 122 | 3300005842 | Ga0068858_101321825 | Ga0068858_1013218252 | 105 |
| 123 | 3300006042 | Ga0075368_10005827 | Ga0075368_100058273 | 105 |
| 124 | 3300006048 | Ga0075363_100146624 | Ga0075363_1001466242 | 105 |
| 125 | 3300006173 | Ga0070716_100511822 | Ga0070716_1005118221 | 105 |
| 126 | 3300006173 | Ga0070716_100988566 | Ga0070716_1009885662 | 105 |
| 127 | 3300006852 | Ga0075433_10823643 | Ga0075433_108236432 | 105 |
| 128 | 3300007076 | Ga0075435_101706767 | Ga0075435_1017067672 | 105 |
| 129 | 3300009098 | Ga0105245_10996494 | Ga0105245_109964942 | 105 |
| 130 | 3300009148 | Ga0105243_11158237 | Ga0105243_111582371 | 105 |
| 131 | 3300009176 | Ga0105242_10141940 | Ga0105242_101419403 | 105 |
| 132 | 3300009553 | Ga0105249_10559792 | Ga0105249_105597922 | 105 |
| 133 | 3300009987 | Ga0105030_112130 | Ga0105030_1121302 | 105 |
| 134 | 3300011119 | Ga0105246_10238616 | Ga0105246_102386162 | 105 |
| 135 | 3300014325 | Ga0163163_11152365 | Ga0163163_111523652 | 105 |
| 136 | 3300021384 | Ga0213876_10293538 | Ga0213876_102935382 | 105 |
| 137 | 3300025961 | Ga0207712_10672225 | Ga0207712_106722251 | 105 |
| 138 | 3300026041 | Ga0207639_12188891 | Ga0207639_121888911 | 105 |
| 139 | 3300026067 | Ga0207678_10117462 | Ga0207678_101174622 | 105 |
| 140 | 3300027866 | Ga0209813_10015006 | Ga0209813_100150063 | 105 |
| 141 | 3300028800 | Ga0265338_10000404 | Ga0265338_1000040451 | 105 |
| 142 | 3300031235 | Ga0265330_10192244 | Ga0265330_101922442 | 105 |
| 143 | 3300031239 | Ga0265328_10271932 | Ga0265328_102719322 | 105 |
| 144 | 3300031241 | Ga0265325_10002389 | Ga0265325_1000238910 | 105 |
| 145 | 3300031249 | Ga0265339_10036862 | Ga0265339_100368623 | 105 |
| 146 | 3300031250 | Ga0265331_10052636 | Ga0265331_100526361 | 105 |
| 147 | 3300031344 | Ga0265316_10596465 | Ga0265316_105964652 | 105 |
| 148 | 3300031595 | Ga0265313_10000776 | Ga0265313_1000077616 | 105 |
| 149 | 3300031711 | Ga0265314_10092562 | Ga0265314_100925622 | 105 |
| 150 | 3300031711 | Ga0265314_10406592 | Ga0265314_104065922 | 105 |
| 151 | 3300031712 | Ga0265342_10156185 | Ga0265342_101561851 | 105 |
| 152 | 3300039437 | Ga0436365_0047787 | Ga0436365_0047787_78_491 | 105 |
| 153 | 3300039437 | Ga0436365_0921705 | Ga0436365_0921705_116_529 | 105 |
| 154 | 3300039437 | Ga0436365_1069374 | Ga0436365_1069374_213_626 | 105 |
| 155 | 3300041459 | Ga0451800_1088893 | Ga0451800_1088893_83_499 | 105 |
| 156 | 3300046514 | Ga0495618_0450888 | Ga0495618_0450888_111_524 | 105 |
| 157 | 3300047315 | Ga0495581_0627086 | Ga0495581_0627086_163_576 | 105 |
| 158 | 3300047321 | Ga0495676_0030448 | Ga0495676_0030448_1907_2320 | 105 |
| 159 | 3300048911 | Ga0496108_1604955 | Ga0496108_1604955_33_446 | 105 |
| 160 | 3300048912 | Ga0496109_0336309 | Ga0496109_0336309_176_589 | 105 |
| 161 | 3300048913 | Ga0496110_0130293 | Ga0496110_0130293_1746_2159 | 105 |
| 162 | 3300048915 | Ga0496112_0855883 | Ga0496112_0855883_105_518 | 105 |
| 163 | 3300048916 | Ga0496113_0320168 | Ga0496113_0320168_542_955 | 105 |
| 164 | 3300048918 | Ga0496115_0538106 | Ga0496115_0538106_127_540 | 105 |
| 165 | 3300049569 | Ga0501032_0686972 | Ga0501032_0686972_150_563 | 105 |
| 166 | 3300050507 | nmdc:mga05p37_1254526_c1 | nmdc:mga05p37_1254526_c1_301_714 | 105 |
| 167 | 3300050511 | nmdc:mga08y16_581575_c1 | nmdc:mga08y16_581575_c1_659_1072 | 105 |
| 168 | 3300050513 | nmdc:mga0rr50_948481_c1 | nmdc:mga0rr50_948481_c1_241_654 | 105 |
| 169 | 3300054114 | Ga0501084_0299055 | Ga0501084_0299055_356_820 | 105 |
| 170 | 3300005331 | Ga0070670_100234340 | Ga0070670_1002343402 | 106 |
| 171 | 3300005347 | Ga0070668_100374403 | Ga0070668_1003744031 | 106 |
| 172 | 3300005367 | Ga0070667_100133103 | Ga0070667_1001331033 | 106 |
| 173 | 3300005547 | Ga0070693_100194188 | Ga0070693_1001941882 | 106 |
| 174 | 3300005719 | Ga0068861_101688587 | Ga0068861_1016885871 | 106 |
| 175 | 3300005840 | Ga0068870_10416892 | Ga0068870_104168922 | 106 |
| 176 | 3300005841 | Ga0068863_100049247 | Ga0068863_1000492474 | 106 |
| 177 | 3300005843 | Ga0068860_100489451 | Ga0068860_1004894512 | 106 |
| 178 | 3300006051 | Ga0075364_10128715 | Ga0075364_101287153 | 106 |
| 179 | 3300006058 | Ga0075432_10343577 | Ga0075432_103435771 | 106 |
| 180 | 3300006177 | Ga0075362_10059418 | Ga0075362_100594182 | 106 |
| 181 | 3300006852 | Ga0075433_11254868 | Ga0075433_112548682 | 106 |
| 182 | 3300006871 | Ga0075434_100208023 | Ga0075434_1002080232 | 106 |
| 183 | 3300013306 | Ga0163162_10572152 | Ga0163162_105721522 | 106 |
| 184 | 3300025907 | Ga0207645_10530096 | Ga0207645_105300962 | 106 |
| 185 | 3300025925 | Ga0207650_10416118 | Ga0207650_104161182 | 106 |
| 186 | 3300025986 | Ga0207658_10619726 | Ga0207658_106197261 | 106 |
| 187 | 3300026088 | Ga0207641_10149980 | Ga0207641_101499802 | 106 |
| 188 | 3300026095 | Ga0207676_10124872 | Ga0207676_101248723 | 106 |
| 189 | 3300026118 | Ga0207675_100100627 | Ga0207675_1001006274 | 106 |
| 190 | 3300027876 | Ga0209974_10395855 | Ga0209974_103958551 | 106 |
| 191 | 3300028380 | Ga0268265_10932380 | Ga0268265_109323802 | 106 |
| 192 | 3300028381 | Ga0268264_10582892 | Ga0268264_105828922 | 106 |
| 193 | 3300028556 | Ga0265337_1106810 | Ga0265337_11068102 | 106 |
| 194 | 3300031665 | Ga0316575_10243186 | Ga0316575_102431861 | 106 |
| 195 | 3300031727 | Ga0316576_10165266 | Ga0316576_101652662 | 106 |
| 196 | 3300031731 | Ga0307405_11668919 | Ga0307405_116689191 | 106 |
| 197 | 3300031852 | Ga0307410_10503308 | Ga0307410_105033082 | 106 |
| 198 | 3300032002 | Ga0307416_101067272 | Ga0307416_1010672722 | 106 |
| 199 | 3300036401 | Ga0373937_0567628 | Ga0373937_0567628_438_854 | 106 |
| 200 | 3300039450 | Ga0436363_1371372 | Ga0436363_1371372_125_541 | 106 |
| 201 | 3300041486 | Ga0451807_2190932 | Ga0451807_2190932_249_662 | 106 |
| 202 | 3300042436 | Ga0439435_0305059 | Ga0439435_0305059_51_500 | 106 |
| 203 | 3300046500 | Ga0495596_0215373 | Ga0495596_0215373_142_555 | 106 |
| 204 | 3300046525 | Ga0495663_0042989 | Ga0495663_0042989_331_744 | 106 |
| 205 | 3300047673 | Ga0495593_0493308 | Ga0495593_0493308_125_541 | 106 |
| 206 | 3300049568 | Ga0501031_0001203 | Ga0501031_0001203_7712_8161 | 106 |
| 207 | 3300049568 | Ga0501031_0159369 | Ga0501031_0159369_734_1183 | 106 |
| 208 | 3300049569 | Ga0501032_0094265 | Ga0501032_0094265_263_712 | 106 |
| 209 | 3300049570 | Ga0501033_0111858 | Ga0501033_0111858_1036_1485 | 106 |
| 210 | 3300049572 | Ga0501036_0003005 | Ga0501036_0003005_7814_8263 | 106 |
| 211 | 3300049572 | Ga0501036_0561392 | Ga0501036_0561392_282_695 | 106 |
| 212 | 3300049573 | Ga0501037_0014066 | Ga0501037_0014066_263_712 | 106 |
| 213 | 3300049574 | Ga0501038_0070861 | Ga0501038_0070861_1238_1687 | 106 |
| 214 | 3300049574 | Ga0501038_0603558 | Ga0501038_0603558_110_523 | 106 |
| 215 | 3300049575 | Ga0501039_0010232 | Ga0501039_0010232_1353_1802 | 106 |
| 216 | 3300049575 | Ga0501039_0122257 | Ga0501039_0122257_198_644 | 106 |
| 217 | 3300049576 | Ga0501040_0007501 | Ga0501040_0007501_5129_5578 | 106 |
| 218 | 3300049576 | Ga0501040_0072846 | Ga0501040_0072846_393_842 | 106 |
| 219 | 3300049577 | Ga0501041_0000759 | Ga0501041_0000759_6026_6475 | 106 |
| 220 | 3300049578 | Ga0501042_0044901 | Ga0501042_0044901_378_827 | 106 |
| 221 | 3300049578 | Ga0501042_0094621 | Ga0501042_0094621_531_980 | 106 |
| 222 | 3300049578 | Ga0501042_0370007 | Ga0501042_0370007_390_839 | 106 |
| 223 | 3300049579 | Ga0501043_0007699 | Ga0501043_0007699_3233_3682 | 106 |
| 224 | 3300049580 | Ga0501046_0005560 | Ga0501046_0005560_3086_3535 | 106 |
| 225 | 3300049582 | Ga0501048_0017750 | Ga0501048_0017750_3626_4075 | 106 |
| 226 | 3300049582 | Ga0501048_0142628 | Ga0501048_0142628_670_1116 | 106 |
| 227 | 3300049584 | Ga0501068_0188878 | Ga0501068_0188878_378_827 | 106 |
| 228 | 3300049584 | Ga0501068_0281611 | Ga0501068_0281611_460_909 | 106 |
| 229 | 3300049584 | Ga0501068_0496223 | Ga0501068_0496223_218_664 | 106 |
| 230 | 3300049585 | Ga0501069_0057589 | Ga0501069_0057589_1413_1862 | 106 |
| 231 | 3300049585 | Ga0501069_0902066 | Ga0501069_0902066_105_518 | 106 |
| 232 | 3300049586 | Ga0501070_0280994 | Ga0501070_0280994_768_1217 | 106 |
| 233 | 3300049587 | Ga0501071_0000545 | Ga0501071_0000545_18428_18877 | 106 |
| 234 | 3300049587 | Ga0501071_0084865 | Ga0501071_0084865_822_1271 | 106 |
| 235 | 3300049588 | Ga0501072_0000940 | Ga0501072_0000940_16020_16469 | 106 |
| 236 | 3300049588 | Ga0501072_0047186 | Ga0501072_0047186_1810_2256 | 106 |
| 237 | 3300049588 | Ga0501072_0154071 | Ga0501072_0154071_73_522 | 106 |
| 238 | 3300049589 | Ga0501073_0082006 | Ga0501073_0082006_270_719 | 106 |
| 239 | 3300049590 | Ga0501074_0111622 | Ga0501074_0111622_1356_1805 | 106 |
| 240 | 3300049590 | Ga0501074_0899457 | Ga0501074_0899457_89_535 | 106 |
| 241 | 3300049591 | Ga0501075_0016972 | Ga0501075_0016972_4479_4928 | 106 |
| 242 | 3300049591 | Ga0501075_0066505 | Ga0501075_0066505_268_717 | 106 |
| 243 | 3300049592 | Ga0501076_0003130 | Ga0501076_0003130_7832_8281 | 106 |
| 244 | 3300049592 | Ga0501076_0166806 | Ga0501076_0166806_1193_1642 | 106 |
| 245 | 3300049592 | Ga0501076_0264849 | Ga0501076_0264849_103_552 | 106 |
| 246 | 3300049592 | Ga0501076_0715444 | Ga0501076_0715444_147_593 | 106 |
| 247 | 3300049593 | Ga0501077_0014703 | Ga0501077_0014703_1340_1789 | 106 |
| 248 | 3300049593 | Ga0501077_0149323 | Ga0501077_0149323_490_939 | 106 |
| 249 | 3300049741 | Ga0501079_0027572 | Ga0501079_0027572_479_928 | 106 |
| 250 | 3300049742 | Ga0501080_0004589 | Ga0501080_0004589_9634_10083 | 106 |
| 251 | 3300049742 | Ga0501080_0262952 | Ga0501080_0262952_514_963 | 106 |
| 252 | 3300049743 | Ga0501081_0027421 | Ga0501081_0027421_1321_1770 | 106 |
| 253 | 3300049744 | Ga0501083_0110053 | Ga0501083_0110053_1087_1536 | 106 |
| 254 | 3300049822 | Ga0501035_0007096 | Ga0501035_0007096_3110_3559 | 106 |
| 255 | 3300049822 | Ga0501035_0677495 | Ga0501035_0677495_34_480 | 106 |
| 256 | 3300049823 | Ga0501044_0588216 | Ga0501044_0588216_253_702 | 106 |
| 257 | 3300049824 | Ga0501045_0007530 | Ga0501045_0007530_5480_5929 | 106 |
| 258 | 3300049824 | Ga0501045_0058139 | Ga0501045_0058139_2348_2797 | 106 |
| 259 | 3300049824 | Ga0501045_0094213 | Ga0501045_0094213_378_824 | 106 |
| 260 | 3300050489 | nmdc:mga03683_121393_c1 | nmdc:mga03683_121393_c1_377_790 | 106 |
| 261 | 3300050491 | nmdc:mga00v17_109390_c1 | nmdc:mga00v17_109390_c1_1043_1456 | 106 |
| 262 | 3300050492 | nmdc:mga0yw44_165030_c1 | nmdc:mga0yw44_165030_c1_620_1033 | 106 |
| 263 | 3300050512 | nmdc:mga0n895_222292_c1 | nmdc:mga0n895_222292_c1_634_1047 | 106 |
| 264 | 3300050513 | nmdc:mga0rr50_892356_c1 | nmdc:mga0rr50_892356_c1_240_653 | 106 |
| 265 | 3300050514 | nmdc:mga08x19_800794_c1 | nmdc:mga08x19_800794_c1_16_429 | 106 |
| 266 | 3300054114 | Ga0501084_0017700 | Ga0501084_0017700_5129_5578 | 106 |
| 267 | 3300054114 | Ga0501084_0184707 | Ga0501084_0184707_977_1426 | 106 |
| 268 | 3300059477 | Ga0587084_063996 | Ga0587084_063996_160_573 | 106 |
| 269 | 3300059630 | Ga0587128_091992 | Ga0587128_091992_174_587 | 106 |
| 270 | 3300060353 | Ga0501082_0018771 | Ga0501082_0018771_5159_5608 | 106 |
| 271 | 3300060353 | Ga0501082_0179068 | Ga0501082_0179068_915_1364 | 106 |
| 272 | 3300060353 | Ga0501082_0276496 | Ga0501082_0276496_435_881 | 106 |
| 273 | 3300061734 | Ga0530510_0005385 | Ga0530510_0005385_2808_3257 | 106 |
| 274 | 3300061734 | Ga0530510_0011077 | Ga0530510_0011077_1108_1557 | 106 |
| 275 | 3300061734 | Ga0530510_0200878 | Ga0530510_0200878_381_827 | 106 |
| 276 | 3300005355 | Ga0070671_100000397 | Ga0070671_10000039730 | 107 |
| 277 | 3300005356 | Ga0070674_101036350 | Ga0070674_1010363502 | 107 |
| 278 | 3300006051 | Ga0075364_10287162 | Ga0075364_102871622 | 107 |
| 279 | 3300006173 | Ga0070716_100713316 | Ga0070716_1007133162 | 107 |
| 280 | 3300009148 | Ga0105243_11298584 | Ga0105243_112985841 | 107 |
| 281 | 3300009177 | Ga0105248_11644308 | Ga0105248_116443082 | 107 |
| 282 | 3300014326 | Ga0157380_11362156 | Ga0157380_113621562 | 107 |
| 283 | 3300014326 | Ga0157380_12579997 | Ga0157380_125799972 | 107 |
| 284 | 3300014968 | Ga0157379_11735212 | Ga0157379_117352122 | 107 |
| 285 | 3300017792 | Ga0163161_10690831 | Ga0163161_106908312 | 107 |
| 286 | 3300025901 | Ga0207688_10196196 | Ga0207688_101961962 | 107 |
| 287 | 3300025929 | Ga0207664_10911755 | Ga0207664_109117552 | 107 |
| 288 | 3300025931 | Ga0207644_10002764 | Ga0207644_100027646 | 107 |
| 289 | 3300025931 | Ga0207644_10625504 | Ga0207644_106255042 | 107 |
| 290 | 3300025942 | Ga0207689_10950670 | Ga0207689_109506702 | 107 |
| 291 | 3300025961 | Ga0207712_11558730 | Ga0207712_115587301 | 107 |
| 292 | 3300026023 | Ga0207677_11871196 | Ga0207677_118711962 | 107 |
| 293 | 3300031901 | Ga0307406_10258551 | Ga0307406_102585512 | 107 |
| 294 | 3300031903 | Ga0307407_10127235 | Ga0307407_101272352 | 107 |
| 295 | 3300032002 | Ga0307416_100069594 | Ga0307416_1000695942 | 107 |
| 296 | 3300032004 | Ga0307414_10040824 | Ga0307414_100408244 | 107 |
| 297 | 3300032126 | Ga0307415_100805671 | Ga0307415_1008056712 | 107 |
| 298 | 3300032126 | Ga0307415_101043610 | Ga0307415_1010436102 | 107 |
| 299 | 3300036647 | Ga0316582_0085568 | Ga0316582_0085568_57_503 | 107 |
| 300 | 3300036712 | Ga0316584_0241678 | Ga0316584_0241678_510_959 | 107 |
| 301 | 3300038735 | Ga0400485_07921 | Ga0400485_07921_1080_1523 | 107 |
| 302 | 3300038742 | Ga0400486_02192 | Ga0400486_02192_1000_1443 | 107 |
| 303 | 3300039450 | Ga0436363_0953663 | Ga0436363_0953663_172_585 | 107 |
| 304 | 3300041463 | Ga0451804_1080182 | Ga0451804_1080182_76_492 | 107 |
| 305 | 3300042122 | Ga0450920_010777 | Ga0450920_010777_509_958 | 107 |
| 306 | 3300042157 | Ga0439458_0168438 | Ga0439458_0168438_39_455 | 107 |
| 307 | 3300042435 | Ga0439434_0126408 | Ga0439434_0126408_11_460 | 107 |
| 308 | 3300042531 | Ga0450918_012076 | Ga0450918_012076_204_653 | 107 |
| 309 | 3300046511 | Ga0495608_0338831 | Ga0495608_0338831_399_812 | 107 |
| 310 | 3300046794 | Ga0495589_0084697 | Ga0495589_0084697_851_1264 | 107 |
| 311 | 3300047323 | Ga0495683_0452195 | Ga0495683_0452195_31_444 | 107 |
| 312 | 3300048089 | Ga0495614_0309896 | Ga0495614_0309896_23_436 | 107 |
| 313 | 3300049568 | Ga0501031_0008975 | Ga0501031_0008975_565_1014 | 107 |
| 314 | 3300049568 | Ga0501031_0057837 | Ga0501031_0057837_1786_2235 | 107 |
| 315 | 3300049568 | Ga0501031_0170134 | Ga0501031_0170134_226_675 | 107 |
| 316 | 3300049568 | Ga0501031_0406661 | Ga0501031_0406661_317_766 | 107 |
| 317 | 3300049568 | Ga0501031_0854621 | Ga0501031_0854621_72_521 | 107 |
| 318 | 3300049570 | Ga0501033_0004468 | Ga0501033_0004468_2183_2632 | 107 |
| 319 | 3300049570 | Ga0501033_0218832 | Ga0501033_0218832_843_1292 | 107 |
| 320 | 3300049571 | Ga0501034_0290609 | Ga0501034_0290609_46_495 | 107 |
| 321 | 3300049572 | Ga0501036_0013366 | Ga0501036_0013366_4176_4625 | 107 |
| 322 | 3300049572 | Ga0501036_0017186 | Ga0501036_0017186_628_1077 | 107 |
| 323 | 3300049572 | Ga0501036_0022688 | Ga0501036_0022688_314_763 | 107 |
| 324 | 3300049572 | Ga0501036_0239222 | Ga0501036_0239222_784_1233 | 107 |
| 325 | 3300049573 | Ga0501037_0014202 | Ga0501037_0014202_2137_2586 | 107 |
| 326 | 3300049573 | Ga0501037_1106280 | Ga0501037_1106280_45_494 | 107 |
| 327 | 3300049574 | Ga0501038_0025889 | Ga0501038_0025889_3259_3708 | 107 |
| 328 | 3300049575 | Ga0501039_0011747 | Ga0501039_0011747_1833_2282 | 107 |
| 329 | 3300049575 | Ga0501039_0171381 | Ga0501039_0171381_909_1358 | 107 |
| 330 | 3300049575 | Ga0501039_0184410 | Ga0501039_0184410_767_1216 | 107 |
| 331 | 3300049575 | Ga0501039_0214615 | Ga0501039_0214615_935_1384 | 107 |
| 332 | 3300049576 | Ga0501040_0024646 | Ga0501040_0024646_1216_1665 | 107 |
| 333 | 3300049576 | Ga0501040_0025298 | Ga0501040_0025298_19_468 | 107 |
| 334 | 3300049576 | Ga0501040_0052223 | Ga0501040_0052223_780_1229 | 107 |
| 335 | 3300049576 | Ga0501040_0265090 | Ga0501040_0265090_539_988 | 107 |
| 336 | 3300049576 | Ga0501040_0348809 | Ga0501040_0348809_417_866 | 107 |
| 337 | 3300049576 | Ga0501040_0430537 | Ga0501040_0430537_451_900 | 107 |
| 338 | 3300049576 | Ga0501040_0518383 | Ga0501040_0518383_255_704 | 107 |
| 339 | 3300049577 | Ga0501041_0000812 | Ga0501041_0000812_6254_6703 | 107 |
| 340 | 3300049577 | Ga0501041_0006962 | Ga0501041_0006962_5611_6060 | 107 |
| 341 | 3300049577 | Ga0501041_0026988 | Ga0501041_0026988_624_1073 | 107 |
| 342 | 3300049577 | Ga0501041_0035281 | Ga0501041_0035281_2175_2624 | 107 |
| 343 | 3300049577 | Ga0501041_0405228 | Ga0501041_0405228_231_680 | 107 |
| 344 | 3300049577 | Ga0501041_0503439 | Ga0501041_0503439_263_712 | 107 |
| 345 | 3300049578 | Ga0501042_0000504 | Ga0501042_0000504_2186_2635 | 107 |
| 346 | 3300049578 | Ga0501042_0001643 | Ga0501042_0001643_4431_4880 | 107 |
| 347 | 3300049578 | Ga0501042_0068497 | Ga0501042_0068497_57_506 | 107 |
| 348 | 3300049578 | Ga0501042_0327871 | Ga0501042_0327871_635_1084 | 107 |
| 349 | 3300049578 | Ga0501042_1006182 | Ga0501042_1006182_35_484 | 107 |
| 350 | 3300049578 | Ga0501042_1319602 | Ga0501042_1319602_94_507 | 107 |
| 351 | 3300049579 | Ga0501043_0271505 | Ga0501043_0271505_91_540 | 107 |
| 352 | 3300049579 | Ga0501043_0315188 | Ga0501043_0315188_700_1149 | 107 |
| 353 | 3300049579 | Ga0501043_1188617 | Ga0501043_1188617_92_505 | 107 |
| 354 | 3300049580 | Ga0501046_0004094 | Ga0501046_0004094_8628_9077 | 107 |
| 355 | 3300049580 | Ga0501046_0023951 | Ga0501046_0023951_1060_1509 | 107 |
| 356 | 3300049582 | Ga0501048_0019700 | Ga0501048_0019700_4482_4931 | 107 |
| 357 | 3300049582 | Ga0501048_0022677 | Ga0501048_0022677_113_562 | 107 |
| 358 | 3300049582 | Ga0501048_0385645 | Ga0501048_0385645_85_534 | 107 |
| 359 | 3300049582 | Ga0501048_0592175 | Ga0501048_0592175_133_582 | 107 |
| 360 | 3300049584 | Ga0501068_0020679 | Ga0501068_0020679_3182_3631 | 107 |
| 361 | 3300049584 | Ga0501068_0153425 | Ga0501068_0153425_694_1143 | 107 |
| 362 | 3300049585 | Ga0501069_0005350 | Ga0501069_0005350_4831_5280 | 107 |
| 363 | 3300049585 | Ga0501069_0191753 | Ga0501069_0191753_591_1040 | 107 |
| 364 | 3300049586 | Ga0501070_0052792 | Ga0501070_0052792_829_1278 | 107 |
| 365 | 3300049586 | Ga0501070_1003681 | Ga0501070_1003681_52_501 | 107 |
| 366 | 3300049587 | Ga0501071_0000787 | Ga0501071_0000787_3422_3871 | 107 |
| 367 | 3300049587 | Ga0501071_0001054 | Ga0501071_0001054_3315_3764 | 107 |
| 368 | 3300049587 | Ga0501071_0009639 | Ga0501071_0009639_2947_3396 | 107 |
| 369 | 3300049587 | Ga0501071_0015392 | Ga0501071_0015392_212_661 | 107 |
| 370 | 3300049587 | Ga0501071_0022614 | Ga0501071_0022614_3449_3898 | 107 |
| 371 | 3300049587 | Ga0501071_0616628 | Ga0501071_0616628_71_520 | 107 |
| 372 | 3300049587 | Ga0501071_0711013 | Ga0501071_0711013_237_686 | 107 |
| 373 | 3300049588 | Ga0501072_0003389 | Ga0501072_0003389_8439_8888 | 107 |
| 374 | 3300049588 | Ga0501072_0004312 | Ga0501072_0004312_992_1441 | 107 |
| 375 | 3300049588 | Ga0501072_0454268 | Ga0501072_0454268_237_686 | 107 |
| 376 | 3300049588 | Ga0501072_1024453 | Ga0501072_1024453_61_510 | 107 |
| 377 | 3300049589 | Ga0501073_0008573 | Ga0501073_0008573_4220_4669 | 107 |
| 378 | 3300049590 | Ga0501074_0000933 | Ga0501074_0000933_7564_8013 | 107 |
| 379 | 3300049590 | Ga0501074_0094709 | Ga0501074_0094709_1150_1599 | 107 |
| 380 | 3300049590 | Ga0501074_0130833 | Ga0501074_0130833_182_631 | 107 |
| 381 | 3300049590 | Ga0501074_0552390 | Ga0501074_0552390_290_739 | 107 |
| 382 | 3300049591 | Ga0501075_0004561 | Ga0501075_0004561_954_1403 | 107 |
| 383 | 3300049591 | Ga0501075_0006710 | Ga0501075_0006710_4546_4995 | 107 |
| 384 | 3300049591 | Ga0501075_0025233 | Ga0501075_0025233_3248_3697 | 107 |
| 385 | 3300049591 | Ga0501075_0108832 | Ga0501075_0108832_737_1186 | 107 |
| 386 | 3300049591 | Ga0501075_0306942 | Ga0501075_0306942_360_809 | 107 |
| 387 | 3300049591 | Ga0501075_0881628 | Ga0501075_0881628_62_511 | 107 |
| 388 | 3300049592 | Ga0501076_0001754 | Ga0501076_0001754_9898_10347 | 107 |
| 389 | 3300049592 | Ga0501076_0002077 | Ga0501076_0002077_10653_11102 | 107 |
| 390 | 3300049592 | Ga0501076_0044611 | Ga0501076_0044611_1178_1627 | 107 |
| 391 | 3300049592 | Ga0501076_0048861 | Ga0501076_0048861_1261_1710 | 107 |
| 392 | 3300049592 | Ga0501076_0454080 | Ga0501076_0454080_217_666 | 107 |
| 393 | 3300049592 | Ga0501076_0486181 | Ga0501076_0486181_361_810 | 107 |
| 394 | 3300049593 | Ga0501077_0001976 | Ga0501077_0001976_6331_6780 | 107 |
| 395 | 3300049593 | Ga0501077_0002417 | Ga0501077_0002417_4047_4496 | 107 |
| 396 | 3300049593 | Ga0501077_0251052 | Ga0501077_0251052_13_462 | 107 |
| 397 | 3300049593 | Ga0501077_0364784 | Ga0501077_0364784_381_830 | 107 |
| 398 | 3300049741 | Ga0501079_0024745 | Ga0501079_0024745_3432_3881 | 107 |
| 399 | 3300049741 | Ga0501079_0042445 | Ga0501079_0042445_2953_3402 | 107 |
| 400 | 3300049741 | Ga0501079_0307457 | Ga0501079_0307457_140_589 | 107 |
| 401 | 3300049741 | Ga0501079_0576108 | Ga0501079_0576108_95_544 | 107 |
| 402 | 3300049741 | Ga0501079_1075010 | Ga0501079_1075010_14_427 | 107 |
| 403 | 3300049741 | Ga0501079_1280245 | Ga0501079_1280245_112_561 | 107 |
| 404 | 3300049742 | Ga0501080_0001292 | Ga0501080_0001292_18222_18671 | 107 |
| 405 | 3300049742 | Ga0501080_0009468 | Ga0501080_0009468_1409_1858 | 107 |
| 406 | 3300049742 | Ga0501080_0188504 | Ga0501080_0188504_903_1352 | 107 |
| 407 | 3300049743 | Ga0501081_0000178 | Ga0501081_0000178_18082_18531 | 107 |
| 408 | 3300049743 | Ga0501081_0011534 | Ga0501081_0011534_603_1052 | 107 |
| 409 | 3300049743 | Ga0501081_0054743 | Ga0501081_0054743_100_549 | 107 |
| 410 | 3300049743 | Ga0501081_0068693 | Ga0501081_0068693_125_574 | 107 |
| 411 | 3300049743 | Ga0501081_0484907 | Ga0501081_0484907_155_604 | 107 |
| 412 | 3300049743 | Ga0501081_0490885 | Ga0501081_0490885_34_483 | 107 |
| 413 | 3300049743 | Ga0501081_0704976 | Ga0501081_0704976_296_745 | 107 |
| 414 | 3300049744 | Ga0501083_0173779 | Ga0501083_0173779_479_928 | 107 |
| 415 | 3300049744 | Ga0501083_0605318 | Ga0501083_0605318_110_559 | 107 |
| 416 | 3300049822 | Ga0501035_0106576 | Ga0501035_0106576_679_1128 | 107 |
| 417 | 3300049822 | Ga0501035_0388526 | Ga0501035_0388526_163_612 | 107 |
| 418 | 3300049824 | Ga0501045_0001690 | Ga0501045_0001690_13349_13798 | 107 |
| 419 | 3300049824 | Ga0501045_0003702 | Ga0501045_0003702_4561_5010 | 107 |
| 420 | 3300049824 | Ga0501045_0037680 | Ga0501045_0037680_2780_3229 | 107 |
| 421 | 3300049824 | Ga0501045_0263714 | Ga0501045_0263714_819_1268 | 107 |
| 422 | 3300049824 | Ga0501045_0504035 | Ga0501045_0504035_387_836 | 107 |
| 423 | 3300050494 | nmdc:mga06z11_129152_c1 | nmdc:mga06z11_129152_c1_19_429 | 107 |
| 424 | 3300053078 | Ga0495612_0246829 | Ga0495612_0246829_198_611 | 107 |
| 425 | 3300054114 | Ga0501084_0034137 | Ga0501084_0034137_3075_3524 | 107 |
| 426 | 3300054114 | Ga0501084_0034773 | Ga0501084_0034773_3436_3885 | 107 |
| 427 | 3300054114 | Ga0501084_0215464 | Ga0501084_0215464_507_956 | 107 |
| 428 | 3300054114 | Ga0501084_1287531 | Ga0501084_1287531_54_503 | 107 |
| 429 | 3300060353 | Ga0501082_0001635 | Ga0501082_0001635_15702_16151 | 107 |
| 430 | 3300060353 | Ga0501082_0010236 | Ga0501082_0010236_2291_2740 | 107 |
| 431 | 3300060353 | Ga0501082_0081583 | Ga0501082_0081583_472_921 | 107 |
| 432 | 3300060353 | Ga0501082_0441048 | Ga0501082_0441048_307_756 | 107 |
| 433 | 3300060353 | Ga0501082_0451447 | Ga0501082_0451447_148_597 | 107 |
| 434 | 3300060353 | Ga0501082_0706473 | Ga0501082_0706473_412_861 | 107 |
| 435 | 3300061734 | Ga0530510_0001976 | Ga0530510_0001976_7991_8440 | 107 |
| 436 | 3300061734 | Ga0530510_0020233 | Ga0530510_0020233_438_887 | 107 |
| 437 | 3300061734 | Ga0530510_0031408 | Ga0530510_0031408_2773_3222 | 107 |
| 438 | 3300061734 | Ga0530510_0268463 | Ga0530510_0268463_779_1228 | 107 |
| 439 | 3300061734 | Ga0530510_0644595 | Ga0530510_0644595_326_775 | 107 |
| 440 | 3300061734 | Ga0530510_0786449 | Ga0530510_0786449_112_561 | 107 |
| 441 | 3300061734 | Ga0530510_0800685 | Ga0530510_0800685_216_665 | 107 |
| 442 | 3300005330 | Ga0070690_100909737 | Ga0070690_1009097372 | 108 |
| 443 | 3300005336 | Ga0070680_101153123 | Ga0070680_1011531232 | 108 |
| 444 | 3300005406 | Ga0070703_10012438 | Ga0070703_100124383 | 108 |
| 445 | 3300005440 | Ga0070705_100048023 | Ga0070705_1000480232 | 108 |
| 446 | 3300005444 | Ga0070694_100733337 | Ga0070694_1007333372 | 108 |
| 447 | 3300005445 | Ga0070708_100002403 | Ga0070708_10000240316 | 108 |
| 448 | 3300005445 | Ga0070708_100877145 | Ga0070708_1008771452 | 108 |
| 449 | 3300005456 | Ga0070678_100738462 | Ga0070678_1007384622 | 108 |
| 450 | 3300005458 | Ga0070681_10011974 | Ga0070681_100119742 | 108 |
| 451 | 3300005458 | Ga0070681_10017995 | Ga0070681_100179955 | 108 |
| 452 | 3300005467 | Ga0070706_100086897 | Ga0070706_1000868974 | 108 |
| 453 | 3300005471 | Ga0070698_100814956 | Ga0070698_1008149562 | 108 |
| 454 | 3300005546 | Ga0070696_100280699 | Ga0070696_1002806992 | 108 |
| 455 | 3300005614 | Ga0068856_100702437 | Ga0068856_1007024372 | 108 |
| 456 | 3300005718 | Ga0068866_10358637 | Ga0068866_103586372 | 108 |
| 457 | 3300006038 | Ga0075365_10061270 | Ga0075365_100612702 | 108 |
| 458 | 3300006852 | Ga0075433_11011688 | Ga0075433_110116881 | 108 |
| 459 | 3300006871 | Ga0075434_100512893 | Ga0075434_1005128932 | 108 |
| 460 | 3300009093 | Ga0105240_11312613 | Ga0105240_113126132 | 108 |
| 461 | 3300009101 | Ga0105247_10983182 | Ga0105247_109831821 | 108 |
| 462 | 3300011119 | Ga0105246_10937704 | Ga0105246_109377042 | 108 |
| 463 | 3300014326 | Ga0157380_10541713 | Ga0157380_105417132 | 108 |
| 464 | 3300014497 | Ga0182008_10742053 | Ga0182008_107420532 | 108 |
| 465 | 3300020070 | Ga0206356_10392024 | Ga0206356_103920242 | 108 |
| 466 | 3300020075 | Ga0206349_1393095 | Ga0206349_13930952 | 108 |
| 467 | 3300020080 | Ga0206350_11397962 | Ga0206350_113979622 | 108 |
| 468 | 3300022467 | Ga0224712_10029818 | Ga0224712_100298182 | 108 |
| 469 | 3300025885 | Ga0207653_10088085 | Ga0207653_100880852 | 108 |
| 470 | 3300025910 | Ga0207684_10026536 | Ga0207684_100265365 | 108 |
| 471 | 3300025912 | Ga0207707_10003489 | Ga0207707_1000348910 | 108 |
| 472 | 3300025912 | Ga0207707_10026410 | Ga0207707_100264106 | 108 |
| 473 | 3300025922 | Ga0207646_11369174 | Ga0207646_113691741 | 108 |
| 474 | 3300025949 | Ga0207667_10610955 | Ga0207667_106109552 | 108 |
| 475 | 3300026088 | Ga0207641_10492193 | Ga0207641_104921931 | 108 |
| 476 | 3300028800 | Ga0265338_10607596 | Ga0265338_106075962 | 108 |
| 477 | 3300031548 | Ga0307408_100180627 | Ga0307408_1001806273 | 108 |
| 478 | 3300031901 | Ga0307406_10582699 | Ga0307406_105826992 | 108 |
| 479 | 3300035083 | Ga0373926_0333235 | Ga0373926_0333235_41_454 | 108 |
| 480 | 3300035692 | Ga0373935_0109742 | Ga0373935_0109742_668_1081 | 108 |
| 481 | 3300035724 | Ga0373933_0231936 | Ga0373933_0231936_688_1101 | 108 |
| 482 | 3300035725 | Ga0373947_0062015 | Ga0373947_0062015_468_881 | 108 |
| 483 | 3300041405 | Ga0439438_126189 | Ga0439438_126189_64_477 | 108 |
| 484 | 3300041407 | Ga0439447_084172 | Ga0439447_084172_96_509 | 108 |
| 485 | 3300041408 | Ga0439453_0036030 | Ga0439453_0036030_474_887 | 108 |
| 486 | 3300042145 | Ga0450906_047207 | Ga0450906_047207_168_581 | 108 |
| 487 | 3300042184 | Ga0450908_093698 | Ga0450908_093698_123_536 | 108 |
| 488 | 3300044684 | Ga0466966_0308943 | Ga0466966_0308943_444_857 | 108 |
| 489 | 3300044684 | Ga0466966_0362990 | Ga0466966_0362990_379_792 | 108 |
| 490 | 3300044693 | Ga0466961_0150203 | Ga0466961_0150203_390_803 | 108 |
| 491 | 3300044694 | Ga0466963_0271608 | Ga0466963_0271608_580_993 | 108 |
| 492 | 3300045836 | Ga0466958_0220396 | Ga0466958_0220396_35_448 | 108 |
| 493 | 3300046455 | Ga0495603_0483769 | Ga0495603_0483769_193_606 | 108 |
| 494 | 3300046475 | Ga0495639_0187872 | Ga0495639_0187872_574_987 | 108 |
| 495 | 3300046533 | Ga0495640_0200041 | Ga0495640_0200041_393_806 | 108 |
| 496 | 3300046642 | Ga0495634_0690592 | Ga0495634_0690592_34_447 | 108 |
| 497 | 3300046663 | Ga0495635_0158384 | Ga0495635_0158384_620_1033 | 108 |
| 498 | 3300046690 | Ga0495624_0655241 | Ga0495624_0655241_187_600 | 108 |
| 499 | 3300047318 | Ga0495636_0268267 | Ga0495636_0268267_95_508 | 108 |
| 500 | 3300047471 | Ga0495684_0166281 | Ga0495684_0166281_1135_1548 | 108 |
| 501 | 3300049580 | Ga0501046_0895073 | Ga0501046_0895073_21_428 | 108 |
| 502 | 3300049587 | Ga0501071_1225224 | Ga0501071_1225224_75_488 | 108 |
| 503 | 3300049588 | Ga0501072_0294452 | Ga0501072_0294452_285_734 | 108 |
| 504 | 3300049588 | Ga0501072_0595413 | Ga0501072_0595413_402_815 | 108 |
| 505 | 3300049588 | Ga0501072_1453231 | Ga0501072_1453231_105_518 | 108 |
| 506 | 3300050492 | nmdc:mga0yw44_365528_c1 | nmdc:mga0yw44_365528_c1_541_954 | 108 |
| 507 | 3300050492 | nmdc:mga0yw44_48412_c1 | nmdc:mga0yw44_48412_c1_797_1213 | 108 |
| 508 | 3300050514 | nmdc:mga08x19_683542_c1 | nmdc:mga08x19_683542_c1_146_559 | 108 |
| 509 | 3300050515 | nmdc:mga0a205_704560_c1 | nmdc:mga0a205_704560_c1_87_500 | 108 |
| 510 | 3300053085 | Ga0495619_0548370 | Ga0495619_0548370_19_432 | 108 |
| 511 | 3300054114 | Ga0501084_0055533 | Ga0501084_0055533_430_879 | 108 |
| 512 | 3300059490 | Ga0587066_032358 | Ga0587066_032358_154_567 | 108 |
| 513 | 3300059492 | Ga0587073_0124465 | Ga0587073_0124465_210_623 | 108 |
| 514 | 3300059627 | Ga0587117_094234 | Ga0587117_094234_66_479 | 108 |
| 515 | 3300060344 | Ga0587071_059809 | Ga0587071_059809_49_462 | 108 |
| 516 | 3300061719 | Ga0466962_0105642 | Ga0466962_0105642_691_1104 | 108 |
| 517 | 3300061734 | Ga0530510_1518702 | Ga0530510_1518702_80_493 | 108 |
| 518 | 3300005455 | Ga0070663_100795386 | Ga0070663_1007953862 | 109 |
| 519 | 3300005614 | Ga0068856_100510669 | Ga0068856_1005106692 | 109 |
| 520 | 3300005618 | Ga0068864_101036364 | Ga0068864_1010363641 | 109 |
| 521 | 3300005843 | Ga0068860_100732572 | Ga0068860_1007325722 | 109 |
| 522 | 3300005985 | Ga0081539_10088490 | Ga0081539_100884902 | 109 |
| 523 | 3300006038 | Ga0075365_10083302 | Ga0075365_100833023 | 109 |
| 524 | 3300006173 | Ga0070716_100946180 | Ga0070716_1009461802 | 109 |
| 525 | 3300006186 | Ga0075369_10188606 | Ga0075369_101886062 | 109 |
| 526 | 3300006847 | Ga0075431_100005694 | Ga0075431_1000056944 | 109 |
| 527 | 3300006880 | Ga0075429_100000064 | Ga0075429_10000006428 | 109 |
| 528 | 3300009147 | Ga0114129_10096511 | Ga0114129_100965112 | 109 |
| 529 | 3300009551 | Ga0105238_11341284 | Ga0105238_113412842 | 109 |
| 530 | 3300009551 | Ga0105238_11365354 | Ga0105238_113653542 | 109 |
| 531 | 3300010159 | Ga0099796_10550402 | Ga0099796_105504021 | 109 |
| 532 | 3300011119 | Ga0105246_10858821 | Ga0105246_108588212 | 109 |
| 533 | 3300013105 | Ga0157369_10192305 | Ga0157369_101923052 | 109 |
| 534 | 3300014969 | Ga0157376_10650702 | Ga0157376_106507022 | 109 |
| 535 | 3300020075 | Ga0206349_1233624 | Ga0206349_12336242 | 109 |
| 536 | 3300035398 | Ga0316574_0307818 | Ga0316574_0307818_426_878 | 109 |
| 537 | 3300039437 | Ga0436365_0454746 | Ga0436365_0454746_145_558 | 109 |
| 538 | 3300039453 | Ga0436362_0257499 | Ga0436362_0257499_138_551 | 109 |
| 539 | 3300039453 | Ga0436362_0777461 | Ga0436362_0777461_92_505 | 109 |
| 540 | 3300039453 | Ga0436362_1235245 | Ga0436362_1235245_130_543 | 109 |
| 541 | 3300041453 | Ga0451797_0697581 | Ga0451797_0697581_70_483 | 109 |
| 542 | 3300041512 | Ga0451853_3757407 | Ga0451853_3757407_107_523 | 109 |
| 543 | 3300046455 | Ga0495603_0748761 | Ga0495603_0748761_50_463 | 109 |
| 544 | 3300046475 | Ga0495639_0434685 | Ga0495639_0434685_107_520 | 109 |
| 545 | 3300046511 | Ga0495608_0133541 | Ga0495608_0133541_560_976 | 109 |
| 546 | 3300046516 | Ga0495628_0288221 | Ga0495628_0288221_253_669 | 109 |
| 547 | 3300046529 | Ga0495652_0389860 | Ga0495652_0389860_251_667 | 109 |
| 548 | 3300046559 | Ga0495667_0251753 | Ga0495667_0251753_220_636 | 109 |
| 549 | 3300046559 | Ga0495667_0426049 | Ga0495667_0426049_359_772 | 109 |
| 550 | 3300046642 | Ga0495634_0486677 | Ga0495634_0486677_43_459 | 109 |
| 551 | 3300046678 | Ga0495599_0319576 | Ga0495599_0319576_499_915 | 109 |
| 552 | 3300046681 | Ga0495647_0213001 | Ga0495647_0213001_176_589 | 109 |
| 553 | 3300046683 | Ga0495658_0070594 | Ga0495658_0070594_1575_1988 | 109 |
| 554 | 3300046689 | Ga0495613_0218459 | Ga0495613_0218459_845_1261 | 109 |
| 555 | 3300047321 | Ga0495676_0055288 | Ga0495676_0055288_748_1161 | 109 |
| 556 | 3300047471 | Ga0495684_0168031 | Ga0495684_0168031_995_1411 | 109 |
| 557 | 3300048088 | Ga0495602_0566538 | Ga0495602_0566538_72_488 | 109 |
| 558 | 3300048907 | Ga0496104_1260529 | Ga0496104_1260529_55_468 | 109 |
| 559 | 3300048909 | Ga0496106_0507014 | Ga0496106_0507014_115_528 | 109 |
| 560 | 3300048911 | Ga0496108_0089960 | Ga0496108_0089960_797_1210 | 109 |
| 561 | 3300048912 | Ga0496109_0024454 | Ga0496109_0024454_3272_3685 | 109 |
| 562 | 3300048916 | Ga0496113_0330638 | Ga0496113_0330638_550_963 | 109 |
| 563 | 3300049162 | Ga0501307_081704 | Ga0501307_081704_61_477 | 109 |
| 564 | 3300049570 | Ga0501033_0003012 | Ga0501033_0003012_3132_3545 | 109 |
| 565 | 3300049585 | Ga0501069_0083881 | Ga0501069_0083881_759_1172 | 109 |
| 566 | 3300049744 | Ga0501083_0997187 | Ga0501083_0997187_20_433 | 109 |
| 567 | 3300049823 | Ga0501044_0040147 | Ga0501044_0040147_1161_1574 | 109 |
| 568 | 3300049824 | Ga0501045_0496898 | Ga0501045_0496898_452_865 | 109 |
| 569 | 3300050491 | nmdc:mga00v17_484830_c1 | nmdc:mga00v17_484830_c1_140_553 | 109 |
| 570 | 3300050509 | nmdc:mga0qj67_315888_c1 | nmdc:mga0qj67_315888_c1_574_987 | 109 |
| 571 | 3300053077 | Ga0495601_0208155 | Ga0495601_0208155_436_852 | 109 |
| 572 | 3300053084 | Ga0495595_0157766 | Ga0495595_0157766_593_1009 | 109 |
| 573 | 3300053085 | Ga0495619_0085163 | Ga0495619_0085163_845_1261 | 109 |
| 574 | 3300053085 | Ga0495619_0957582 | Ga0495619_0957582_18_431 | 109 |
| 575 | 3300053094 | Ga0500566_0000443 | Ga0500566_0000443_21713_22126 | 109 |
| 576 | 3300053133 | Ga0500655_045931 | Ga0500655_045931_383_799 | 109 |
| 577 | 3300005293 | Ga0065715_11066122 | Ga0065715_110661221 | 110 |
| 578 | 3300005328 | Ga0070676_10232303 | Ga0070676_102323032 | 110 |
| 579 | 3300005337 | Ga0070682_100588518 | Ga0070682_1005885182 | 110 |
| 580 | 3300005338 | Ga0068868_100626281 | Ga0068868_1006262812 | 110 |
| 581 | 3300005343 | Ga0070687_100690722 | Ga0070687_1006907221 | 110 |
| 582 | 3300005347 | Ga0070668_100443719 | Ga0070668_1004437192 | 110 |
| 583 | 3300005353 | Ga0070669_101804822 | Ga0070669_1018048221 | 110 |
| 584 | 3300005364 | Ga0070673_100085202 | Ga0070673_1000852023 | 110 |
| 585 | 3300005366 | Ga0070659_101086781 | Ga0070659_1010867811 | 110 |
| 586 | 3300005366 | Ga0070659_101233882 | Ga0070659_1012338822 | 110 |
| 587 | 3300005406 | Ga0070703_10271845 | Ga0070703_102718451 | 110 |
| 588 | 3300005434 | Ga0070709_10962166 | Ga0070709_109621661 | 110 |
| 589 | 3300005435 | Ga0070714_101304250 | Ga0070714_1013042502 | 110 |
| 590 | 3300005436 | Ga0070713_100285018 | Ga0070713_1002850182 | 110 |
| 591 | 3300005436 | Ga0070713_100351102 | Ga0070713_1003511022 | 110 |
| 592 | 3300005437 | Ga0070710_10130697 | Ga0070710_101306973 | 110 |
| 593 | 3300005438 | Ga0070701_10409034 | Ga0070701_104090341 | 110 |
| 594 | 3300005445 | Ga0070708_101488566 | Ga0070708_1014885661 | 110 |
| 595 | 3300005455 | Ga0070663_100444355 | Ga0070663_1004443551 | 110 |
| 596 | 3300005456 | Ga0070678_100446881 | Ga0070678_1004468812 | 110 |
| 597 | 3300005456 | Ga0070678_100572092 | Ga0070678_1005720922 | 110 |
| 598 | 3300005456 | Ga0070678_101558569 | Ga0070678_1015585691 | 110 |
| 599 | 3300005458 | Ga0070681_10372019 | Ga0070681_103720193 | 110 |
| 600 | 3300005458 | Ga0070681_11086252 | Ga0070681_110862522 | 110 |
| 601 | 3300005459 | Ga0068867_100407840 | Ga0068867_1004078402 | 110 |
| 602 | 3300005459 | Ga0068867_100926061 | Ga0068867_1009260611 | 110 |
| 603 | 3300005467 | Ga0070706_100017012 | Ga0070706_1000170124 | 110 |
| 604 | 3300005467 | Ga0070706_100219158 | Ga0070706_1002191581 | 110 |
| 605 | 3300005468 | Ga0070707_100167078 | Ga0070707_1001670783 | 110 |
| 606 | 3300005518 | Ga0070699_100079282 | Ga0070699_1000792824 | 110 |
| 607 | 3300005518 | Ga0070699_100947875 | Ga0070699_1009478752 | 110 |
| 608 | 3300005535 | Ga0070684_100258533 | Ga0070684_1002585331 | 110 |
| 609 | 3300005536 | Ga0070697_100058072 | Ga0070697_1000580722 | 110 |
| 610 | 3300005544 | Ga0070686_100498444 | Ga0070686_1004984442 | 110 |
| 611 | 3300005544 | Ga0070686_100550004 | Ga0070686_1005500042 | 110 |
| 612 | 3300005546 | Ga0070696_100439545 | Ga0070696_1004395452 | 110 |
| 613 | 3300005546 | Ga0070696_100473731 | Ga0070696_1004737312 | 110 |
| 614 | 3300005615 | Ga0070702_100670671 | Ga0070702_1006706712 | 110 |
| 615 | 3300005937 | Ga0081455_10031164 | Ga0081455_100311645 | 110 |
| 616 | 3300005981 | Ga0081538_10056089 | Ga0081538_100560893 | 110 |
| 617 | 3300005983 | Ga0081540_1056255 | Ga0081540_10562552 | 110 |
| 618 | 3300005985 | Ga0081539_10091344 | Ga0081539_100913443 | 110 |
| 619 | 3300006028 | Ga0070717_10733988 | Ga0070717_107339882 | 110 |
| 620 | 3300006038 | Ga0075365_10460727 | Ga0075365_104607272 | 110 |
| 621 | 3300006048 | Ga0075363_100001656 | Ga0075363_1000016563 | 110 |
| 622 | 3300006051 | Ga0075364_10467578 | Ga0075364_104675782 | 110 |
| 623 | 3300006194 | Ga0075427_10050259 | Ga0075427_100502592 | 110 |
| 624 | 3300006237 | Ga0097621_100202557 | Ga0097621_1002025572 | 110 |
| 625 | 3300006844 | Ga0075428_100319779 | Ga0075428_1003197792 | 110 |
| 626 | 3300006844 | Ga0075428_100983146 | Ga0075428_1009831462 | 110 |
| 627 | 3300006847 | Ga0075431_100221244 | Ga0075431_1002212443 | 110 |
| 628 | 3300006880 | Ga0075429_100132174 | Ga0075429_1001321742 | 110 |
| 629 | 3300006880 | Ga0075429_100294671 | Ga0075429_1002946712 | 110 |
| 630 | 3300006881 | Ga0068865_101539842 | Ga0068865_1015398422 | 110 |
| 631 | 3300006931 | Ga0097620_100492833 | Ga0097620_1004928332 | 110 |
| 632 | 3300007788 | Ga0099795_10090457 | Ga0099795_100904572 | 110 |
| 633 | 3300009094 | Ga0111539_10782521 | Ga0111539_107825212 | 110 |
| 634 | 3300009098 | Ga0105245_10005614 | Ga0105245_100056148 | 110 |
| 635 | 3300009098 | Ga0105245_10856129 | Ga0105245_108561292 | 110 |
| 636 | 3300009098 | Ga0105245_10872225 | Ga0105245_108722251 | 110 |
| 637 | 3300009098 | Ga0105245_11396855 | Ga0105245_113968551 | 110 |
| 638 | 3300009147 | Ga0114129_10307886 | Ga0114129_103078863 | 110 |
| 639 | 3300009147 | Ga0114129_10952600 | Ga0114129_109526002 | 110 |
| 640 | 3300009147 | Ga0114129_12018827 | Ga0114129_120188272 | 110 |
| 641 | 3300009176 | Ga0105242_10335343 | Ga0105242_103353432 | 110 |
| 642 | 3300009176 | Ga0105242_10452210 | Ga0105242_104522102 | 110 |
| 643 | 3300009551 | Ga0105238_11016882 | Ga0105238_110168821 | 110 |
| 644 | 3300009551 | Ga0105238_11194181 | Ga0105238_111941811 | 110 |
| 645 | 3300009553 | Ga0105249_10269630 | Ga0105249_102696303 | 110 |
| 646 | 3300009553 | Ga0105249_10917164 | Ga0105249_109171642 | 110 |
| 647 | 3300009987 | Ga0105030_120303 | Ga0105030_1203032 | 110 |
| 648 | 3300010375 | Ga0105239_10162302 | Ga0105239_101623022 | 110 |
| 649 | 3300011119 | Ga0105246_11119678 | Ga0105246_111196782 | 110 |
| 650 | 3300012508 | Ga0157315_1006333 | Ga0157315_10063332 | 110 |
| 651 | 3300013102 | Ga0157371_10523371 | Ga0157371_105233712 | 110 |
| 652 | 3300013306 | Ga0163162_10520701 | Ga0163162_105207013 | 110 |
| 653 | 3300013307 | Ga0157372_11200469 | Ga0157372_112004691 | 110 |
| 654 | 3300014325 | Ga0163163_11559741 | Ga0163163_115597412 | 110 |
| 655 | 3300014326 | Ga0157380_10891018 | Ga0157380_108910181 | 110 |
| 656 | 3300014968 | Ga0157379_10719827 | Ga0157379_107198272 | 110 |
| 657 | 3300014969 | Ga0157376_11063357 | Ga0157376_110633572 | 110 |
| 658 | 3300017792 | Ga0163161_10421597 | Ga0163161_104215972 | 110 |
| 659 | 3300020069 | Ga0197907_11295313 | Ga0197907_112953132 | 110 |
| 660 | 3300020070 | Ga0206356_10711293 | Ga0206356_107112932 | 110 |
| 661 | 3300020070 | Ga0206356_11711064 | Ga0206356_117110642 | 110 |
| 662 | 3300020078 | Ga0206352_10456902 | Ga0206352_104569022 | 110 |
| 663 | 3300020081 | Ga0206354_10531322 | Ga0206354_105313221 | 110 |
| 664 | 3300020081 | Ga0206354_11239045 | Ga0206354_112390452 | 110 |
| 665 | 3300025899 | Ga0207642_10573688 | Ga0207642_105736882 | 110 |
| 666 | 3300025907 | Ga0207645_10312000 | Ga0207645_103120002 | 110 |
| 667 | 3300025910 | Ga0207684_10026643 | Ga0207684_100266434 | 110 |
| 668 | 3300025910 | Ga0207684_10182567 | Ga0207684_101825672 | 110 |
| 669 | 3300025911 | Ga0207654_10450814 | Ga0207654_104508141 | 110 |
| 670 | 3300025911 | Ga0207654_10527263 | Ga0207654_105272631 | 110 |
| 671 | 3300025912 | Ga0207707_10076663 | Ga0207707_100766634 | 110 |
| 672 | 3300025912 | Ga0207707_10212961 | Ga0207707_102129611 | 110 |
| 673 | 3300025918 | Ga0207662_10534384 | Ga0207662_105343842 | 110 |
| 674 | 3300025922 | Ga0207646_10675813 | Ga0207646_106758132 | 110 |
| 675 | 3300025924 | Ga0207694_10776513 | Ga0207694_107765131 | 110 |
| 676 | 3300025927 | Ga0207687_10001161 | Ga0207687_1000116120 | 110 |
| 677 | 3300025928 | Ga0207700_10253632 | Ga0207700_102536323 | 110 |
| 678 | 3300025928 | Ga0207700_10819284 | Ga0207700_108192842 | 110 |
| 679 | 3300025929 | Ga0207664_11206537 | Ga0207664_112065371 | 110 |
| 680 | 3300025934 | Ga0207686_10608619 | Ga0207686_106086192 | 110 |
| 681 | 3300025934 | Ga0207686_10922113 | Ga0207686_109221132 | 110 |
| 682 | 3300025934 | Ga0207686_11286582 | Ga0207686_112865821 | 110 |
| 683 | 3300025937 | Ga0207669_11322070 | Ga0207669_113220701 | 110 |
| 684 | 3300025939 | Ga0207665_10480049 | Ga0207665_104800492 | 110 |
| 685 | 3300025941 | Ga0207711_11006564 | Ga0207711_110065642 | 110 |
| 686 | 3300025942 | Ga0207689_10646740 | Ga0207689_106467402 | 110 |
| 687 | 3300025960 | Ga0207651_10101839 | Ga0207651_101018393 | 110 |
| 688 | 3300025961 | Ga0207712_12137861 | Ga0207712_121378611 | 110 |
| 689 | 3300025986 | Ga0207658_12018461 | Ga0207658_120184611 | 110 |
| 690 | 3300026067 | Ga0207678_10279158 | Ga0207678_102791581 | 110 |
| 691 | 3300026078 | Ga0207702_11974517 | Ga0207702_119745171 | 110 |
| 692 | 3300026088 | Ga0207641_10498067 | Ga0207641_104980672 | 110 |
| 693 | 3300026089 | Ga0207648_10515627 | Ga0207648_105156272 | 110 |
| 694 | 3300026095 | Ga0207676_10441689 | Ga0207676_104416891 | 110 |
| 695 | 3300026118 | Ga0207675_100403950 | Ga0207675_1004039502 | 110 |
| 696 | 3300026118 | Ga0207675_100585287 | Ga0207675_1005852872 | 110 |
| 697 | 3300026118 | Ga0207675_101104445 | Ga0207675_1011044452 | 110 |
| 698 | 3300026121 | Ga0207683_10647202 | Ga0207683_106472022 | 110 |
| 699 | 3300026121 | Ga0207683_10684896 | Ga0207683_106848962 | 110 |
| 700 | 3300027907 | Ga0207428_10300348 | Ga0207428_103003482 | 110 |
| 701 | 3300028654 | Ga0265322_10115326 | Ga0265322_101153262 | 110 |
| 702 | 3300031240 | Ga0265320_10520267 | Ga0265320_105202671 | 110 |
| 703 | 3300031251 | Ga0265327_10034891 | Ga0265327_100348913 | 110 |
| 704 | 3300031251 | Ga0265327_10059187 | Ga0265327_100591873 | 110 |
| 705 | 3300031251 | Ga0265327_10267202 | Ga0265327_102672021 | 110 |
| 706 | 3300031727 | Ga0316576_10012357 | Ga0316576_100123574 | 110 |
| 707 | 3300031727 | Ga0316576_10054211 | Ga0316576_100542114 | 110 |
| 708 | 3300031728 | Ga0316578_10012581 | Ga0316578_100125812 | 110 |
| 709 | 3300031733 | Ga0316577_10010865 | Ga0316577_100108654 | 110 |
| 710 | 3300031733 | Ga0316577_10174856 | Ga0316577_101748562 | 110 |
| 711 | 3300032126 | Ga0307415_100945856 | Ga0307415_1009458562 | 110 |
| 712 | 3300035083 | Ga0373926_0355644 | Ga0373926_0355644_104_517 | 110 |
| 713 | 3300035085 | Ga0373929_0074432 | Ga0373929_0074432_120_533 | 110 |
| 714 | 3300035089 | Ga0373944_0372451 | Ga0373944_0372451_46_459 | 110 |
| 715 | 3300035114 | Ga0373939_0076157 | Ga0373939_0076157_534_947 | 110 |
| 716 | 3300035116 | Ga0373945_0384129 | Ga0373945_0384129_153_566 | 110 |
| 717 | 3300035170 | Ga0373943_0272790 | Ga0373943_0272790_318_731 | 110 |
| 718 | 3300035171 | Ga0373946_0114699 | Ga0373946_0114699_650_1063 | 110 |
| 719 | 3300035398 | Ga0316574_0115231 | Ga0316574_0115231_1257_1709 | 110 |
| 720 | 3300035691 | Ga0373931_0013527 | Ga0373931_0013527_655_1068 | 110 |
| 721 | 3300035692 | Ga0373935_0098909 | Ga0373935_0098909_1477_1890 | 110 |
| 722 | 3300035692 | Ga0373935_0176449 | Ga0373935_0176449_715_1128 | 110 |
| 723 | 3300035724 | Ga0373933_0774017 | Ga0373933_0774017_80_493 | 110 |
| 724 | 3300035725 | Ga0373947_0167346 | Ga0373947_0167346_31_444 | 110 |
| 725 | 3300036401 | Ga0373937_0421046 | Ga0373937_0421046_427_840 | 110 |
| 726 | 3300036401 | Ga0373937_1389207 | Ga0373937_1389207_114_527 | 110 |
| 727 | 3300036647 | Ga0316582_0456259 | Ga0316582_0456259_271_687 | 110 |
| 728 | 3300036712 | Ga0316584_0016841 | Ga0316584_0016841_1676_2125 | 110 |
| 729 | 3300037068 | Ga0373925_0167156 | Ga0373925_0167156_860_1273 | 110 |
| 730 | 3300037068 | Ga0373925_1106298 | Ga0373925_1106298_183_596 | 110 |
| 731 | 3300037418 | Ga0395900_0992021 | Ga0395900_0992021_202_615 | 110 |
| 732 | 3300039062 | Ga0400483_102644 | Ga0400483_102644_542_958 | 110 |
| 733 | 3300039062 | Ga0400483_286448 | Ga0400483_286448_224_640 | 110 |
| 734 | 3300039437 | Ga0436365_0055491 | Ga0436365_0055491_614_1027 | 110 |
| 735 | 3300039438 | Ga0436360_0714011 | Ga0436360_0714011_537_950 | 110 |
| 736 | 3300039453 | Ga0436362_0822080 | Ga0436362_0822080_28_441 | 110 |
| 737 | 3300039453 | Ga0436362_1097698 | Ga0436362_1097698_313_726 | 110 |
| 738 | 3300039453 | Ga0436362_1259949 | Ga0436362_1259949_1498_1911 | 110 |
| 739 | 3300041406 | Ga0439439_0035272 | Ga0439439_0035272_220_633 | 110 |
| 740 | 3300041458 | Ga0451798_0038043 | Ga0451798_0038043_75_488 | 110 |
| 741 | 3300041459 | Ga0451800_1225528 | Ga0451800_1225528_37_450 | 110 |
| 742 | 3300041492 | Ga0451835_0911484 | Ga0451835_0911484_39_452 | 110 |
| 743 | 3300041492 | Ga0451835_1221373 | Ga0451835_1221373_45_458 | 110 |
| 744 | 3300041496 | Ga0451839_1338875 | Ga0451839_1338875_112_525 | 110 |
| 745 | 3300041507 | Ga0451851_0358739 | Ga0451851_0358739_79_492 | 110 |
| 746 | 3300041512 | Ga0451853_0327854 | Ga0451853_0327854_30_443 | 110 |
| 747 | 3300042003 | Ga0439443_028594 | Ga0439443_028594_153_569 | 110 |
| 748 | 3300042005 | Ga0439448_0003737 | Ga0439448_0003737_2806_3222 | 110 |
| 749 | 3300042006 | Ga0439432_176514 | Ga0439432_176514_48_461 | 110 |
| 750 | 3300042008 | Ga0439450_000313 | Ga0439450_000313_4425_4841 | 110 |
| 751 | 3300042016 | Ga0439463_004804 | Ga0439463_004804_1378_1794 | 110 |
| 752 | 3300042437 | Ga0439444_0022164 | Ga0439444_0022164_575_991 | 110 |
| 753 | 3300042439 | Ga0439464_0001455 | Ga0439464_0001455_2510_2926 | 110 |
| 754 | 3300042461 | Ga0439460_0170586 | Ga0439460_0170586_240_656 | 110 |
| 755 | 3300046454 | Ga0495592_0121987 | Ga0495592_0121987_1349_1762 | 110 |
| 756 | 3300046461 | Ga0495641_0209791 | Ga0495641_0209791_265_678 | 110 |
| 757 | 3300046462 | Ga0495651_0484363 | Ga0495651_0484363_149_562 | 110 |
| 758 | 3300046463 | Ga0495653_0459294 | Ga0495653_0459294_246_659 | 110 |
| 759 | 3300046463 | Ga0495653_0538478 | Ga0495653_0538478_44_457 | 110 |
| 760 | 3300046463 | Ga0495653_0939132 | Ga0495653_0939132_66_479 | 110 |
| 761 | 3300046473 | Ga0495582_0232496 | Ga0495582_0232496_307_720 | 110 |
| 762 | 3300046474 | Ga0495605_0179163 | Ga0495605_0179163_142_555 | 110 |
| 763 | 3300046475 | Ga0495639_0256549 | Ga0495639_0256549_271_684 | 110 |
| 764 | 3300046476 | Ga0495662_0310985 | Ga0495662_0310985_11_424 | 110 |
| 765 | 3300046477 | Ga0495664_0055799 | Ga0495664_0055799_1771_2184 | 110 |
| 766 | 3300046499 | Ga0495594_0220000 | Ga0495594_0220000_620_1033 | 110 |
| 767 | 3300046506 | Ga0495583_0205470 | Ga0495583_0205470_236_649 | 110 |
| 768 | 3300046511 | Ga0495608_0269690 | Ga0495608_0269690_192_605 | 110 |
| 769 | 3300046511 | Ga0495608_0326738 | Ga0495608_0326738_233_646 | 110 |
| 770 | 3300046514 | Ga0495618_0229067 | Ga0495618_0229067_154_567 | 110 |
| 771 | 3300046514 | Ga0495618_0685726 | Ga0495618_0685726_169_582 | 110 |
| 772 | 3300046514 | Ga0495618_0769535 | Ga0495618_0769535_132_545 | 110 |
| 773 | 3300046516 | Ga0495628_0008870 | Ga0495628_0008870_6159_6572 | 110 |
| 774 | 3300046516 | Ga0495628_0606226 | Ga0495628_0606226_100_513 | 110 |
| 775 | 3300046517 | Ga0495630_0035254 | Ga0495630_0035254_748_1161 | 110 |
| 776 | 3300046517 | Ga0495630_0047489 | Ga0495630_0047489_1819_2232 | 110 |
| 777 | 3300046517 | Ga0495630_0183085 | Ga0495630_0183085_105_518 | 110 |
| 778 | 3300046517 | Ga0495630_0267231 | Ga0495630_0267231_585_998 | 110 |
| 779 | 3300046517 | Ga0495630_1017009 | Ga0495630_1017009_205_618 | 110 |
| 780 | 3300046523 | Ga0495644_0068240 | Ga0495644_0068240_353_766 | 110 |
| 781 | 3300046526 | Ga0495666_0026231 | Ga0495666_0026231_1021_1434 | 110 |
| 782 | 3300046529 | Ga0495652_0364853 | Ga0495652_0364853_249_662 | 110 |
| 783 | 3300046533 | Ga0495640_0009407 | Ga0495640_0009407_5440_5853 | 110 |
| 784 | 3300046533 | Ga0495640_0478650 | Ga0495640_0478650_292_705 | 110 |
| 785 | 3300046535 | Ga0495586_0079237 | Ga0495586_0079237_329_742 | 110 |
| 786 | 3300046535 | Ga0495586_0103943 | Ga0495586_0103943_891_1304 | 110 |
| 787 | 3300046543 | Ga0495645_0504983 | Ga0495645_0504983_312_725 | 110 |
| 788 | 3300046557 | Ga0495622_0206976 | Ga0495622_0206976_321_734 | 110 |
| 789 | 3300046559 | Ga0495667_0167708 | Ga0495667_0167708_84_497 | 110 |
| 790 | 3300046616 | Ga0495668_0710132 | Ga0495668_0710132_39_452 | 110 |
| 791 | 3300046642 | Ga0495634_0349714 | Ga0495634_0349714_143_556 | 110 |
| 792 | 3300046660 | Ga0495625_0755924 | Ga0495625_0755924_80_493 | 110 |
| 793 | 3300046663 | Ga0495635_0123357 | Ga0495635_0123357_825_1238 | 110 |
| 794 | 3300046679 | Ga0495623_0503952 | Ga0495623_0503952_85_498 | 110 |
| 795 | 3300046680 | Ga0495646_0151615 | Ga0495646_0151615_92_505 | 110 |
| 796 | 3300046681 | Ga0495647_0226600 | Ga0495647_0226600_285_698 | 110 |
| 797 | 3300046681 | Ga0495647_0502102 | Ga0495647_0502102_22_435 | 110 |
| 798 | 3300046683 | Ga0495658_0065406 | Ga0495658_0065406_205_618 | 110 |
| 799 | 3300046683 | Ga0495658_0315551 | Ga0495658_0315551_319_732 | 110 |
| 800 | 3300046683 | Ga0495658_0500872 | Ga0495658_0500872_230_643 | 110 |
| 801 | 3300046683 | Ga0495658_0803079 | Ga0495658_0803079_94_507 | 110 |
| 802 | 3300046689 | Ga0495613_0140617 | Ga0495613_0140617_305_718 | 110 |
| 803 | 3300046689 | Ga0495613_0341201 | Ga0495613_0341201_76_489 | 110 |
| 804 | 3300046690 | Ga0495624_0341277 | Ga0495624_0341277_164_577 | 110 |
| 805 | 3300046690 | Ga0495624_0356345 | Ga0495624_0356345_159_572 | 110 |
| 806 | 3300046692 | Ga0495671_0175655 | Ga0495671_0175655_503_916 | 110 |
| 807 | 3300046692 | Ga0495671_0216872 | Ga0495671_0216872_134_547 | 110 |
| 808 | 3300046794 | Ga0495589_0305226 | Ga0495589_0305226_303_716 | 110 |
| 809 | 3300047315 | Ga0495581_0526248 | Ga0495581_0526248_128_541 | 110 |
| 810 | 3300047317 | Ga0495604_0228747 | Ga0495604_0228747_39_452 | 110 |
| 811 | 3300047317 | Ga0495604_0798526 | Ga0495604_0798526_164_577 | 110 |
| 812 | 3300047318 | Ga0495636_0479457 | Ga0495636_0479457_75_488 | 110 |
| 813 | 3300047318 | Ga0495636_0602818 | Ga0495636_0602818_108_521 | 110 |
| 814 | 3300047319 | Ga0495674_0177649 | Ga0495674_0177649_1017_1430 | 110 |
| 815 | 3300047319 | Ga0495674_0179513 | Ga0495674_0179513_1159_1572 | 110 |
| 816 | 3300047319 | Ga0495674_0627550 | Ga0495674_0627550_180_593 | 110 |
| 817 | 3300047320 | Ga0495672_0093189 | Ga0495672_0093189_1092_1505 | 110 |
| 818 | 3300047321 | Ga0495676_0059179 | Ga0495676_0059179_1684_2097 | 110 |
| 819 | 3300047321 | Ga0495676_0611527 | Ga0495676_0611527_143_556 | 110 |
| 820 | 3300047322 | Ga0495680_0085474 | Ga0495680_0085474_1892_2305 | 110 |
| 821 | 3300047444 | Ga0495675_0295112 | Ga0495675_0295112_298_711 | 110 |
| 822 | 3300047445 | Ga0495677_0214575 | Ga0495677_0214575_153_566 | 110 |
| 823 | 3300047446 | Ga0495679_145206 | Ga0495679_145206_71_484 | 110 |
| 824 | 3300047447 | Ga0495685_207671 | Ga0495685_207671_84_497 | 110 |
| 825 | 3300047471 | Ga0495684_0654022 | Ga0495684_0654022_261_674 | 110 |
| 826 | 3300047472 | Ga0495686_0228577 | Ga0495686_0228577_410_823 | 110 |
| 827 | 3300047673 | Ga0495593_0680819 | Ga0495593_0680819_88_501 | 110 |
| 828 | 3300048088 | Ga0495602_0340328 | Ga0495602_0340328_245_658 | 110 |
| 829 | 3300048088 | Ga0495602_0501203 | Ga0495602_0501203_401_814 | 110 |
| 830 | 3300048088 | Ga0495602_0677115 | Ga0495602_0677115_114_527 | 110 |
| 831 | 3300048089 | Ga0495614_0178375 | Ga0495614_0178375_255_668 | 110 |
| 832 | 3300048090 | Ga0495615_0091603 | Ga0495615_0091603_95_508 | 110 |
| 833 | 3300048091 | Ga0495626_0192685 | Ga0495626_0192685_350_763 | 110 |
| 834 | 3300048903 | Ga0496100_1067533 | Ga0496100_1067533_53_466 | 110 |
| 835 | 3300048904 | Ga0496101_0057951 | Ga0496101_0057951_2084_2497 | 110 |
| 836 | 3300048904 | Ga0496101_0760405 | Ga0496101_0760405_69_482 | 110 |
| 837 | 3300048904 | Ga0496101_1336702 | Ga0496101_1336702_52_465 | 110 |
| 838 | 3300048905 | Ga0496102_0022327 | Ga0496102_0022327_4662_5075 | 110 |
| 839 | 3300048905 | Ga0496102_0063259 | Ga0496102_0063259_1064_1477 | 110 |
| 840 | 3300048906 | Ga0496103_0149470 | Ga0496103_0149470_355_768 | 110 |
| 841 | 3300048907 | Ga0496104_0002399 | Ga0496104_0002399_15653_16066 | 110 |
| 842 | 3300048907 | Ga0496104_0035101 | Ga0496104_0035101_2864_3277 | 110 |
| 843 | 3300048907 | Ga0496104_0263493 | Ga0496104_0263493_66_479 | 110 |
| 844 | 3300048908 | Ga0496105_0203836 | Ga0496105_0203836_249_662 | 110 |
| 845 | 3300048909 | Ga0496106_0136190 | Ga0496106_0136190_1205_1618 | 110 |
| 846 | 3300048910 | Ga0496107_0025907 | Ga0496107_0025907_1729_2142 | 110 |
| 847 | 3300048911 | Ga0496108_0624172 | Ga0496108_0624172_285_698 | 110 |
| 848 | 3300048911 | Ga0496108_0737966 | Ga0496108_0737966_231_644 | 110 |
| 849 | 3300048911 | Ga0496108_0864987 | Ga0496108_0864987_182_595 | 110 |
| 850 | 3300048912 | Ga0496109_0067024 | Ga0496109_0067024_1161_1574 | 110 |
| 851 | 3300048912 | Ga0496109_0469254 | Ga0496109_0469254_348_761 | 110 |
| 852 | 3300048913 | Ga0496110_0578736 | Ga0496110_0578736_231_644 | 110 |
| 853 | 3300048913 | Ga0496110_0689981 | Ga0496110_0689981_188_601 | 110 |
| 854 | 3300048913 | Ga0496110_1238087 | Ga0496110_1238087_28_441 | 110 |
| 855 | 3300048914 | Ga0496111_0301316 | Ga0496111_0301316_587_1000 | 110 |
| 856 | 3300048915 | Ga0496112_0323264 | Ga0496112_0323264_987_1400 | 110 |
| 857 | 3300048915 | Ga0496112_0601856 | Ga0496112_0601856_429_842 | 110 |
| 858 | 3300048915 | Ga0496112_0840751 | Ga0496112_0840751_325_738 | 110 |
| 859 | 3300048916 | Ga0496113_0184622 | Ga0496113_0184622_205_618 | 110 |
| 860 | 3300048916 | Ga0496113_0431891 | Ga0496113_0431891_313_726 | 110 |
| 861 | 3300048917 | Ga0496114_0970744 | Ga0496114_0970744_76_489 | 110 |
| 862 | 3300048917 | Ga0496114_1022791 | Ga0496114_1022791_245_658 | 110 |
| 863 | 3300048917 | Ga0496114_1655216 | Ga0496114_1655216_56_469 | 110 |
| 864 | 3300048918 | Ga0496115_0012220 | Ga0496115_0012220_4949_5362 | 110 |
| 865 | 3300049569 | Ga0501032_0274713 | Ga0501032_0274713_293_706 | 110 |
| 866 | 3300049571 | Ga0501034_0343081 | Ga0501034_0343081_617_1033 | 110 |
| 867 | 3300049572 | Ga0501036_0366897 | Ga0501036_0366897_376_789 | 110 |
| 868 | 3300049574 | Ga0501038_0160072 | Ga0501038_0160072_301_714 | 110 |
| 869 | 3300049575 | Ga0501039_0367929 | Ga0501039_0367929_261_674 | 110 |
| 870 | 3300049578 | Ga0501042_0603488 | Ga0501042_0603488_235_648 | 110 |
| 871 | 3300049578 | Ga0501042_1103803 | Ga0501042_1103803_85_498 | 110 |
| 872 | 3300049578 | Ga0501042_1193239 | Ga0501042_1193239_122_535 | 110 |
| 873 | 3300049580 | Ga0501046_0047264 | Ga0501046_0047264_2362_2775 | 110 |
| 874 | 3300049581 | Ga0501047_0012694 | Ga0501047_0012694_1325_1738 | 110 |
| 875 | 3300049581 | Ga0501047_0179649 | Ga0501047_0179649_310_726 | 110 |
| 876 | 3300049582 | Ga0501048_0354493 | Ga0501048_0354493_19_432 | 110 |
| 877 | 3300049584 | Ga0501068_0320511 | Ga0501068_0320511_415_828 | 110 |
| 878 | 3300049586 | Ga0501070_0003086 | Ga0501070_0003086_7693_8106 | 110 |
| 879 | 3300049587 | Ga0501071_1028915 | Ga0501071_1028915_133_546 | 110 |
| 880 | 3300049589 | Ga0501073_0576918 | Ga0501073_0576918_30_443 | 110 |
| 881 | 3300049592 | Ga0501076_0680452 | Ga0501076_0680452_174_587 | 110 |
| 882 | 3300049593 | Ga0501077_0826738 | Ga0501077_0826738_34_447 | 110 |
| 883 | 3300049741 | Ga0501079_0742448 | Ga0501079_0742448_25_438 | 110 |
| 884 | 3300049742 | Ga0501080_0213418 | Ga0501080_0213418_764_1177 | 110 |
| 885 | 3300049743 | Ga0501081_1200789 | Ga0501081_1200789_64_477 | 110 |
| 886 | 3300049822 | Ga0501035_0428607 | Ga0501035_0428607_303_716 | 110 |
| 887 | 3300049822 | Ga0501035_0783113 | Ga0501035_0783113_88_501 | 110 |
| 888 | 3300049824 | Ga0501045_0826465 | Ga0501045_0826465_69_482 | 110 |
| 889 | 3300050490 | nmdc:mga03n38_33169_c1 | nmdc:mga03n38_33169_c1_379_792 | 110 |
| 890 | 3300050491 | nmdc:mga00v17_604429_c1 | nmdc:mga00v17_604429_c1_10_423 | 110 |
| 891 | 3300050492 | nmdc:mga0yw44_119578_c1 | nmdc:mga0yw44_119578_c1_616_1032 | 110 |
| 892 | 3300050496 | nmdc:mga07m45_598146_c1 | nmdc:mga07m45_598146_c1_137_550 | 110 |
| 893 | 3300050507 | nmdc:mga05p37_305953_c1 | nmdc:mga05p37_305953_c1_250_663 | 110 |
| 894 | 3300050507 | nmdc:mga05p37_31750_c1 | nmdc:mga05p37_31750_c1_1585_1998 | 110 |
| 895 | 3300050507 | nmdc:mga05p37_619657_c1 | nmdc:mga05p37_619657_c1_342_755 | 110 |
| 896 | 3300050508 | nmdc:mga09592_1434329_c1 | nmdc:mga09592_1434329_c1_23_436 | 110 |
| 897 | 3300050508 | nmdc:mga09592_187433_c1 | nmdc:mga09592_187433_c1_267_680 | 110 |
| 898 | 3300050508 | nmdc:mga09592_297379_c1 | nmdc:mga09592_297379_c1_49_462 | 110 |
| 899 | 3300050509 | nmdc:mga0qj67_252862_c1 | nmdc:mga0qj67_252862_c1_14_427 | 110 |
| 900 | 3300050509 | nmdc:mga0qj67_374042_c1 | nmdc:mga0qj67_374042_c1_691_1104 | 110 |
| 901 | 3300050509 | nmdc:mga0qj67_844300_c1 | nmdc:mga0qj67_844300_c1_150_563 | 110 |
| 902 | 3300050509 | nmdc:mga0qj67_917407_c1 | nmdc:mga0qj67_917407_c1_30_443 | 110 |
| 903 | 3300050510 | nmdc:mga06r32_33363_c1 | nmdc:mga06r32_33363_c1_3005_3418 | 110 |
| 904 | 3300050510 | nmdc:mga06r32_52497_c1 | nmdc:mga06r32_52497_c1_2971_3387 | 110 |
| 905 | 3300050511 | nmdc:mga08y16_389974_c1 | nmdc:mga08y16_389974_c1_476_889 | 110 |
| 906 | 3300050513 | nmdc:mga0rr50_346351_c1 | nmdc:mga0rr50_346351_c1_144_557 | 110 |
| 907 | 3300050514 | nmdc:mga08x19_12713_c1 | nmdc:mga08x19_12713_c1_311_724 | 110 |
| 908 | 3300053077 | Ga0495601_0615291 | Ga0495601_0615291_252_665 | 110 |
| 909 | 3300053078 | Ga0495612_0134373 | Ga0495612_0134373_322_735 | 110 |
| 910 | 3300053078 | Ga0495612_0374825 | Ga0495612_0374825_207_620 | 110 |
| 911 | 3300053080 | Ga0500635_0427445 | Ga0500635_0427445_14_427 | 110 |
| 912 | 3300053084 | Ga0495595_0039362 | Ga0495595_0039362_114_527 | 110 |
| 913 | 3300053084 | Ga0495595_0177581 | Ga0495595_0177581_264_677 | 110 |
| 914 | 3300053084 | Ga0495595_0202593 | Ga0495595_0202593_130_543 | 110 |
| 915 | 3300053085 | Ga0495619_0007373 | Ga0495619_0007373_1285_1698 | 110 |
| 916 | 3300053085 | Ga0495619_0022185 | Ga0495619_0022185_146_559 | 110 |
| 917 | 3300053085 | Ga0495619_0148138 | Ga0495619_0148138_1054_1467 | 110 |
| 918 | 3300053085 | Ga0495619_0472678 | Ga0495619_0472678_278_691 | 110 |
| 919 | 3300053085 | Ga0495619_1024400 | Ga0495619_1024400_65_478 | 110 |
| 920 | 3300053153 | Ga0500616_0002763 | Ga0500616_0002763_1166_1579 | 110 |
| 921 | 3300054114 | Ga0501084_0000009 | Ga0501084_0000009_90838_91251 | 110 |
| 922 | 3300054114 | Ga0501084_1281420 | Ga0501084_1281420_157_570 | 110 |
| 923 | 3300059421 | Ga0590071_111381 | Ga0590071_111381_26_439 | 110 |
| 924 | 3300059477 | Ga0587084_072720 | Ga0587084_072720_80_493 | 110 |
| 925 | 3300059625 | Ga0587113_027502 | Ga0587113_027502_56_469 | 110 |
| 926 | 3300059630 | Ga0587128_139972 | Ga0587128_139972_29_442 | 110 |
| 927 | 3300059630 | Ga0587128_141435 | Ga0587128_141435_71_484 | 110 |
| 928 | 3300059644 | Ga0587075_049985 | Ga0587075_049985_74_487 | 110 |
| 929 | 3300059647 | Ga0587079_144066 | Ga0587079_144066_119_532 | 110 |
| 930 | 3300059648 | Ga0587100_034130 | Ga0587100_034130_40_453 | 110 |
| 931 | 3300060353 | Ga0501082_0663618 | Ga0501082_0663618_214_627 | 110 |
| 932 | 3300061734 | Ga0530510_0003983 | Ga0530510_0003983_9157_9570 | 110 |
| 933 | 3300061734 | Ga0530510_0339940 | Ga0530510_0339940_248_661 | 110 |
| 934 | 3300003911 | JGI25405J52794_10010920 | JGI25405J52794_100109202 | 111 |
| 935 | 3300005937 | Ga0081455_10010519 | Ga0081455_100105199 | 111 |
| 936 | 3300005937 | Ga0081455_10967213 | Ga0081455_109672131 | 111 |
| 937 | 3300005981 | Ga0081538_10000033 | Ga0081538_1000003327 | 111 |
| 938 | 3300005981 | Ga0081538_10010515 | Ga0081538_100105156 | 111 |
| 939 | 3300006051 | Ga0075364_10374037 | Ga0075364_103740372 | 111 |
| 940 | 3300006177 | Ga0075362_10064178 | Ga0075362_100641782 | 111 |
| 941 | 3300006177 | Ga0075362_10138128 | Ga0075362_101381282 | 111 |
| 942 | 3300006177 | Ga0075362_10140823 | Ga0075362_101408232 | 111 |
| 943 | 3300006846 | Ga0075430_100285432 | Ga0075430_1002854322 | 111 |
| 944 | 3300006847 | Ga0075431_100186693 | Ga0075431_1001866933 | 111 |
| 945 | 3300006880 | Ga0075429_100508597 | Ga0075429_1005085972 | 111 |
| 946 | 3300009094 | Ga0111539_10000426 | Ga0111539_100004262 | 111 |
| 947 | 3300009551 | Ga0105238_12587005 | Ga0105238_125870051 | 111 |
| 948 | 3300013306 | Ga0163162_10643004 | Ga0163162_106430042 | 111 |
| 949 | 3300017792 | Ga0163161_10333236 | Ga0163161_103332361 | 111 |
| 950 | 3300027907 | Ga0207428_10008172 | Ga0207428_1000817210 | 111 |
| 951 | 3300027907 | Ga0207428_10234082 | Ga0207428_102340822 | 111 |
| 952 | 3300028800 | Ga0265338_10193405 | Ga0265338_101934052 | 111 |
| 953 | 3300031249 | Ga0265339_10579177 | Ga0265339_105791771 | 111 |
| 954 | 3300031691 | Ga0316579_10017298 | Ga0316579_100172983 | 111 |
| 955 | 3300031727 | Ga0316576_10027706 | Ga0316576_100277063 | 111 |
| 956 | 3300031727 | Ga0316576_10235728 | Ga0316576_102357282 | 111 |
| 957 | 3300031733 | Ga0316577_10128256 | Ga0316577_101282562 | 111 |
| 958 | 3300031903 | Ga0307407_10964967 | Ga0307407_109649672 | 111 |
| 959 | 3300032126 | Ga0307415_100306253 | Ga0307415_1003062532 | 111 |
| 960 | 3300032126 | Ga0307415_100579662 | Ga0307415_1005796622 | 111 |
| 961 | 3300032137 | Ga0316585_10086067 | Ga0316585_100860671 | 111 |
| 962 | 3300032139 | Ga0316580_10021572 | Ga0316580_100215722 | 111 |
| 963 | 3300035398 | Ga0316574_0016888 | Ga0316574_0016888_2020_2439 | 111 |
| 964 | 3300035398 | Ga0316574_0030977 | Ga0316574_0030977_73_489 | 111 |
| 965 | 3300035398 | Ga0316574_0166622 | Ga0316574_0166622_633_1049 | 111 |
| 966 | 3300036712 | Ga0316584_0038830 | Ga0316584_0038830_1269_1688 | 111 |
| 967 | 3300036712 | Ga0316584_0119260 | Ga0316584_0119260_1208_1627 | 111 |
| 968 | 3300038735 | Ga0400485_07726 | Ga0400485_07726_3502_3918 | 111 |
| 969 | 3300039062 | Ga0400483_119634 | Ga0400483_119634_5472_5888 | 111 |
| 970 | 3300039062 | Ga0400483_135474 | Ga0400483_135474_12716_13132 | 111 |
| 971 | 3300039062 | Ga0400483_271686 | Ga0400483_271686_1647_2063 | 111 |
| 972 | 3300039437 | Ga0436365_0956643 | Ga0436365_0956643_128_544 | 111 |
| 973 | 3300041460 | Ga0451802_0197124 | Ga0451802_0197124_201_617 | 111 |
| 974 | 3300041505 | Ga0451849_0525999 | Ga0451849_0525999_26_442 | 111 |
| 975 | 3300042126 | Ga0450888_073165 | Ga0450888_073165_83_499 | 111 |
| 976 | 3300042533 | Ga0450901_010290 | Ga0450901_010290_460_876 | 111 |
| 977 | 3300047320 | Ga0495672_0000884 | Ga0495672_0000884_19541_19957 | 111 |
| 978 | 3300049569 | Ga0501032_0001203 | Ga0501032_0001203_13330_13746 | 111 |
| 979 | 3300049569 | Ga0501032_0029797 | Ga0501032_0029797_2988_3404 | 111 |
| 980 | 3300049570 | Ga0501033_0003829 | Ga0501033_0003829_8821_9237 | 111 |
| 981 | 3300049570 | Ga0501033_0018735 | Ga0501033_0018735_1288_1704 | 111 |
| 982 | 3300049571 | Ga0501034_0002750 | Ga0501034_0002750_6574_6990 | 111 |
| 983 | 3300049571 | Ga0501034_0224578 | Ga0501034_0224578_329_745 | 111 |
| 984 | 3300049571 | Ga0501034_0302154 | Ga0501034_0302154_273_689 | 111 |
| 985 | 3300049571 | Ga0501034_0316360 | Ga0501034_0316360_425_841 | 111 |
| 986 | 3300049572 | Ga0501036_0026119 | Ga0501036_0026119_1169_1585 | 111 |
| 987 | 3300049572 | Ga0501036_0440942 | Ga0501036_0440942_28_444 | 111 |
| 988 | 3300049573 | Ga0501037_0098580 | Ga0501037_0098580_1420_1836 | 111 |
| 989 | 3300049574 | Ga0501038_0043269 | Ga0501038_0043269_3318_3734 | 111 |
| 990 | 3300049574 | Ga0501038_0328419 | Ga0501038_0328419_263_679 | 111 |
| 991 | 3300049575 | Ga0501039_0006601 | Ga0501039_0006601_6693_7109 | 111 |
| 992 | 3300049575 | Ga0501039_0010828 | Ga0501039_0010828_189_605 | 111 |
| 993 | 3300049575 | Ga0501039_0082281 | Ga0501039_0082281_1505_1921 | 111 |
| 994 | 3300049575 | Ga0501039_0784040 | Ga0501039_0784040_37_453 | 111 |
| 995 | 3300049576 | Ga0501040_0000785 | Ga0501040_0000785_7425_7841 | 111 |
| 996 | 3300049577 | Ga0501041_0005964 | Ga0501041_0005964_2900_3316 | 111 |
| 997 | 3300049577 | Ga0501041_0115017 | Ga0501041_0115017_712_1128 | 111 |
| 998 | 3300049578 | Ga0501042_0272575 | Ga0501042_0272575_216_632 | 111 |
| 999 | 3300049578 | Ga0501042_0514263 | Ga0501042_0514263_259_675 | 111 |
| 1000 | 3300049579 | Ga0501043_0016411 | Ga0501043_0016411_495_911 | 111 |
| 1001 | 3300049580 | Ga0501046_0025957 | Ga0501046_0025957_1060_1476 | 111 |
| 1002 | 3300049580 | Ga0501046_0040868 | Ga0501046_0040868_416_832 | 111 |
| 1003 | 3300049582 | Ga0501048_0008087 | Ga0501048_0008087_1561_1977 | 111 |
| 1004 | 3300049582 | Ga0501048_0041802 | Ga0501048_0041802_219_635 | 111 |
| 1005 | 3300049582 | Ga0501048_0151861 | Ga0501048_0151861_449_865 | 111 |
| 1006 | 3300049584 | Ga0501068_0011607 | Ga0501068_0011607_1019_1435 | 111 |
| 1007 | 3300049584 | Ga0501068_0014374 | Ga0501068_0014374_366_782 | 111 |
| 1008 | 3300049584 | Ga0501068_0394015 | Ga0501068_0394015_365_781 | 111 |
| 1009 | 3300049585 | Ga0501069_0405670 | Ga0501069_0405670_232_648 | 111 |
| 1010 | 3300049586 | Ga0501070_0002602 | Ga0501070_0002602_2013_2429 | 111 |
| 1011 | 3300049586 | Ga0501070_0561343 | Ga0501070_0561343_272_688 | 111 |
| 1012 | 3300049587 | Ga0501071_0016589 | Ga0501071_0016589_1380_1796 | 111 |
| 1013 | 3300049587 | Ga0501071_0038298 | Ga0501071_0038298_817_1233 | 111 |
| 1014 | 3300049587 | Ga0501071_0251806 | Ga0501071_0251806_165_581 | 111 |
| 1015 | 3300049588 | Ga0501072_0000534 | Ga0501072_0000534_6751_7167 | 111 |
| 1016 | 3300049588 | Ga0501072_0045577 | Ga0501072_0045577_354_770 | 111 |
| 1017 | 3300049590 | Ga0501074_0134948 | Ga0501074_0134948_250_666 | 111 |
| 1018 | 3300049591 | Ga0501075_0002356 | Ga0501075_0002356_7322_7738 | 111 |
| 1019 | 3300049591 | Ga0501075_0192315 | Ga0501075_0192315_165_581 | 111 |
| 1020 | 3300049592 | Ga0501076_0002252 | Ga0501076_0002252_11738_12154 | 111 |
| 1021 | 3300049592 | Ga0501076_0008401 | Ga0501076_0008401_2890_3306 | 111 |
| 1022 | 3300049592 | Ga0501076_0902471 | Ga0501076_0902471_34_450 | 111 |
| 1023 | 3300049593 | Ga0501077_0004688 | Ga0501077_0004688_7116_7532 | 111 |
| 1024 | 3300049741 | Ga0501079_0003485 | Ga0501079_0003485_8471_8887 | 111 |
| 1025 | 3300049741 | Ga0501079_0024344 | Ga0501079_0024344_3222_3638 | 111 |
| 1026 | 3300049741 | Ga0501079_0236580 | Ga0501079_0236580_181_597 | 111 |
| 1027 | 3300049742 | Ga0501080_1832621 | Ga0501080_1832621_39_455 | 111 |
| 1028 | 3300049743 | Ga0501081_0006630 | Ga0501081_0006630_5650_6066 | 111 |
| 1029 | 3300049743 | Ga0501081_0010894 | Ga0501081_0010894_4015_4431 | 111 |
| 1030 | 3300049744 | Ga0501083_0308597 | Ga0501083_0308597_571_987 | 111 |
| 1031 | 3300049823 | Ga0501044_0016386 | Ga0501044_0016386_6782_7198 | 111 |
| 1032 | 3300049823 | Ga0501044_0364336 | Ga0501044_0364336_316_732 | 111 |
| 1033 | 3300049824 | Ga0501045_0006370 | Ga0501045_0006370_6668_7084 | 111 |
| 1034 | 3300049824 | Ga0501045_0022706 | Ga0501045_0022706_1422_1838 | 111 |
| 1035 | 3300049824 | Ga0501045_0654527 | Ga0501045_0654527_210_626 | 111 |
| 1036 | 3300050490 | nmdc:mga03n38_36953_c1 | nmdc:mga03n38_36953_c1_785_1201 | 111 |
| 1037 | 3300050507 | nmdc:mga05p37_68259_c1 | nmdc:mga05p37_68259_c1_2726_3142 | 111 |
| 1038 | 3300050508 | nmdc:mga09592_356043_c1 | nmdc:mga09592_356043_c1_75_491 | 111 |
| 1039 | 3300050508 | nmdc:mga09592_492952_c1 | nmdc:mga09592_492952_c1_307_723 | 111 |
| 1040 | 3300050509 | nmdc:mga0qj67_128852_c1 | nmdc:mga0qj67_128852_c1_649_1065 | 111 |
| 1041 | 3300050509 | nmdc:mga0qj67_648315_c1 | nmdc:mga0qj67_648315_c1_229_645 | 111 |
| 1042 | 3300050510 | nmdc:mga06r32_219428_c1 | nmdc:mga06r32_219428_c1_70_486 | 111 |
| 1043 | 3300050510 | nmdc:mga06r32_272114_c1 | nmdc:mga06r32_272114_c1_702_1118 | 111 |
| 1044 | 3300050510 | nmdc:mga06r32_89875_c1 | nmdc:mga06r32_89875_c1_1583_1999 | 111 |
| 1045 | 3300050511 | nmdc:mga08y16_74620_c1 | nmdc:mga08y16_74620_c1_935_1351 | 111 |
| 1046 | 3300054114 | Ga0501084_0012792 | Ga0501084_0012792_6033_6449 | 111 |
| 1047 | 3300054114 | Ga0501084_0019565 | Ga0501084_0019565_200_616 | 111 |
| 1048 | 3300059424 | Ga0590075_016083 | Ga0590075_016083_537_953 | 111 |
| 1049 | 3300059426 | Ga0590077_046504 | Ga0590077_046504_219_635 | 111 |
| 1050 | 3300059607 | Ga0587125_070311 | Ga0587125_070311_64_480 | 111 |
| 1051 | 3300059647 | Ga0587079_115479 | Ga0587079_115479_172_588 | 111 |
| 1052 | 3300059652 | Ga0587107_080079 | Ga0587107_080079_102_518 | 111 |
| 1053 | 3300060353 | Ga0501082_0008693 | Ga0501082_0008693_5904_6320 | 111 |
| 1054 | 3300060353 | Ga0501082_1164115 | Ga0501082_1164115_86_502 | 111 |
| 1055 | 3300061734 | Ga0530510_0000984 | Ga0530510_0000984_5895_6311 | 111 |
| 1056 | 3300061734 | Ga0530510_0001714 | Ga0530510_0001714_13047_13463 | 111 |
| 1057 | 3300061734 | Ga0530510_0009528 | Ga0530510_0009528_1558_1974 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar