F489205

General Info

Members Datasets Scaffolds Average Seq Length
1057 399 1057 117

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10421597|Ga0163161_104215972
Length 137
Sequence MARTDANPPMPDFATDYELQEVDPSFLTASVKPKQFLHIDQAECILCEGCVDICPWKCIHMLSTGAIDEAVNADQPGDDPKDHVVFVVDEDVYTRCALCVDRCPTGVIILGKVTNDWADGDPNVRTNRHGYAYGVRF

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
91 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
184 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
205 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
206 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
212 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
213 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
214 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
222 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
223 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
224 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
230 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
233 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
241 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
242 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
379 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
380 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
384 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
385 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
399 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 2.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 0
Rhizoplane 5.3
Rhizosphere 88.36
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10010920 3300003911 Bacteria 1734
2 Ga0065715_11066122 3300005293 Bacteria 528
3 Ga0070676_10232303 3300005328 Bacteria 1223
4 Ga0070683_101208140 3300005329 Bacteria 727
5 Ga0070690_100909737 3300005330 Bacteria 689
6 Ga0070670_100234340 3300005331 Bacteria 1598
7 Ga0070680_101153123 3300005336 Unclassified 670
8 Ga0070682_100588518 3300005337 Bacteria 877
9 Ga0068868_100626281 3300005338 Bacteria 955
10 Ga0070660_100283627 3300005339 Bacteria 1355
11 Ga0070687_100690722 3300005343 Bacteria 712
12 Ga0070668_100374403 3300005347 Bacteria 1211
13 Ga0070668_100443719 3300005347 Bacteria 1114
14 Ga0070669_101804822 3300005353 Bacteria 534
15 Ga0070671_100000397 3300005355 Bacteria 29950
16 Ga0070671_100610725 3300005355 Bacteria 943
17 Ga0070674_101036350 3300005356 Bacteria 722
18 Ga0070673_100085202 3300005364 Bacteria 2572
19 Ga0070659_101086781 3300005366 Bacteria 705
20 Ga0070659_101233882 3300005366 Bacteria 662
21 Ga0070667_100133103 3300005367 Bacteria 2172
22 Ga0070667_100578598 3300005367 Bacteria 1034
23 Ga0070703_10012438 3300005406 Bacteria 2411
24 Ga0070703_10271845 3300005406 Bacteria 696
25 Ga0070709_10962166 3300005434 Bacteria 678
26 Ga0070714_101304250 3300005435 Bacteria 709
27 Ga0070713_100285018 3300005436 Bacteria 1516
28 Ga0070713_100351102 3300005436 Bacteria 1368
29 Ga0070713_101109849 3300005436 Bacteria 764
30 Ga0070710_10130697 3300005437 Bacteria 1531
31 Ga0070701_10409034 3300005438 Bacteria 861
32 Ga0070705_100048023 3300005440 Bacteria 2470
33 Ga0070694_100733337 3300005444 Bacteria 806
34 Ga0070708_100002403 3300005445 Bacteria 14512
35 Ga0070708_100877145 3300005445 Unclassified 843
36 Ga0070708_101488566 3300005445 Bacteria 631
37 Ga0070663_100444355 3300005455 Bacteria 1068
38 Ga0070663_100795386 3300005455 Bacteria 811
39 Ga0070678_100446881 3300005456 Bacteria 1132
40 Ga0070678_100572092 3300005456 Bacteria 1005
41 Ga0070678_100738462 3300005456 Bacteria 890
42 Ga0070678_101558569 3300005456 Bacteria 620
43 Ga0070662_101075910 3300005457 Bacteria 690
44 Ga0070681_10011974 3300005458 Bacteria 8600
45 Ga0070681_10017995 3300005458 Bacteria 7060
46 Ga0070681_10372019 3300005458 Bacteria 1339
47 Ga0070681_11086252 3300005458 Bacteria 721
48 Ga0068867_100407840 3300005459 Bacteria 1148
49 Ga0068867_100926061 3300005459 Bacteria 786
50 Ga0070706_100017012 3300005467 Bacteria 6716
51 Ga0070706_100086897 3300005467 Bacteria 2898
52 Ga0070706_100144692 3300005467 Bacteria 2220
53 Ga0070706_100219158 3300005467 Bacteria 1776
54 Ga0070707_100167078 3300005468 Bacteria 2144
55 Ga0070698_100814956 3300005471 Bacteria 878
56 Ga0070699_100079282 3300005518 Bacteria 2860
57 Ga0070699_100947875 3300005518 Bacteria 789
58 Ga0070684_100258533 3300005535 Bacteria 1593
59 Ga0070697_100058072 3300005536 Bacteria 3148
60 Ga0070697_100209557 3300005536 Bacteria 1659
61 Ga0070672_101347882 3300005543 Bacteria 638
62 Ga0070686_100498444 3300005544 Bacteria 945
63 Ga0070686_100550004 3300005544 Bacteria 903
64 Ga0070696_100280699 3300005546 Bacteria 1269
65 Ga0070696_100439545 3300005546 Bacteria 1027
66 Ga0070696_100473731 3300005546 Bacteria 992
67 Ga0070693_100194188 3300005547 Bacteria 1315
68 Ga0070693_100824062 3300005547 Bacteria 690
69 Ga0070665_100056101 3300005548 Bacteria 3950
70 Ga0068856_100510669 3300005614 Bacteria 1223
71 Ga0068856_100702437 3300005614 Bacteria 1032
72 Ga0070702_100670671 3300005615 Bacteria 787
73 Ga0070702_100925012 3300005615 Bacteria 685
74 Ga0068859_101769379 3300005617 Bacteria 682
75 Ga0068864_101036364 3300005618 Bacteria 815
76 Ga0068866_10358637 3300005718 Bacteria 929
77 Ga0068861_101688587 3300005719 Bacteria 626
78 Ga0068851_10626331 3300005834 Bacteria 657
79 Ga0068870_10416892 3300005840 Bacteria 878
80 Ga0068863_100049247 3300005841 Bacteria 3995
81 Ga0068858_101321825 3300005842 Bacteria 710
82 Ga0068860_100489451 3300005843 Bacteria 1227
83 Ga0068860_100732572 3300005843 Bacteria 1000
84 Ga0081455_10010519 3300005937 Bacteria 9378
85 Ga0081455_10031164 3300005937 Bacteria 4830
86 Ga0081455_10059279 3300005937 Bacteria 3233
87 Ga0081455_10967213 3300005937 Bacteria 528
88 Ga0081538_10000033 3300005981 Bacteria 121023
89 Ga0081538_10010515 3300005981 Bacteria 7587
90 Ga0081538_10056089 3300005981 Bacteria 2312
91 Ga0081540_1056255 3300005983 Bacteria 1910
92 Ga0081539_10088490 3300005985 Bacteria 1606
93 Ga0081539_10091344 3300005985 Bacteria 1573
94 Ga0070717_10733988 3300006028 Bacteria 898
95 Ga0075365_10061270 3300006038 Bacteria 2512
96 Ga0075365_10083302 3300006038 Bacteria 2169
97 Ga0075365_10178842 3300006038 Bacteria 1483
98 Ga0075365_10460727 3300006038 Bacteria 898
99 Ga0075368_10005827 3300006042 Bacteria 4260
100 Ga0075368_10064509 3300006042 Bacteria 1471
101 Ga0075363_100001656 3300006048 Bacteria 8623
102 Ga0075363_100146624 3300006048 Bacteria 1331
103 Ga0075363_100321995 3300006048 Bacteria 900
104 Ga0075364_10128715 3300006051 Bacteria 1698
105 Ga0075364_10287162 3300006051 Bacteria 1119
106 Ga0075364_10374037 3300006051 Bacteria 972
107 Ga0075364_10467578 3300006051 Bacteria 862
108 Ga0075432_10343577 3300006058 Bacteria 631
109 Ga0070716_100511822 3300006173 Bacteria 888
110 Ga0070716_100713316 3300006173 Bacteria 767
111 Ga0070716_100946180 3300006173 Bacteria 678
112 Ga0070716_100988566 3300006173 Bacteria 665
113 Ga0075362_10059418 3300006177 Bacteria 1726
114 Ga0075362_10064178 3300006177 Bacteria 1666
115 Ga0075362_10138128 3300006177 Bacteria 1163
116 Ga0075362_10140823 3300006177 Bacteria 1152
117 Ga0075369_10188606 3300006186 Bacteria 950
118 Ga0075427_10050259 3300006194 Bacteria 717
119 Ga0097621_100202557 3300006237 Bacteria 1724
120 Ga0075428_100319779 3300006844 Bacteria 1668
121 Ga0075428_100983146 3300006844 Bacteria 894
122 Ga0075430_100285432 3300006846 Bacteria 1366
123 Ga0075431_100005694 3300006847 Bacteria 12313
124 Ga0075431_100186693 3300006847 Bacteria 2126
125 Ga0075431_100221244 3300006847 Bacteria 1931
126 Ga0075433_10823643 3300006852 Bacteria 811
127 Ga0075433_11011688 3300006852 Bacteria 724
128 Ga0075433_11254868 3300006852 Bacteria 643
129 Ga0075434_100208023 3300006871 Bacteria 1977
130 Ga0075434_100512893 3300006871 Bacteria 1220
131 Ga0075429_100000064 3300006880 Bacteria 52724
132 Ga0075429_100132174 3300006880 Bacteria 2184
133 Ga0075429_100294671 3300006880 Bacteria 1420
134 Ga0075429_100508597 3300006880 Bacteria 1055
135 Ga0068865_101539842 3300006881 Bacteria 597
136 Ga0097620_100492833 3300006931 Bacteria 1321
137 Ga0097620_101769393 3300006931 Bacteria 682
138 Ga0075435_101706767 3300007076 Bacteria 553
139 Ga0099795_10090457 3300007788 Bacteria 1186
140 Ga0105240_11312613 3300009093 Bacteria 763
141 Ga0111539_10000426 3300009094 Bacteria 52948
142 Ga0111539_10782521 3300009094 Bacteria 1110
143 Ga0105245_10005614 3300009098 Bacteria 11021
144 Ga0105245_10856129 3300009098 Bacteria 949
145 Ga0105245_10872225 3300009098 Bacteria 941
146 Ga0105245_10996494 3300009098 Bacteria 882
147 Ga0105245_11396855 3300009098 Bacteria 750
148 Ga0105247_10983182 3300009101 Bacteria 658
149 Ga0114129_10096511 3300009147 Bacteria 4092
150 Ga0114129_10290496 3300009147 Bacteria 2182
151 Ga0114129_10307886 3300009147 Bacteria 2110
152 Ga0114129_10952600 3300009147 Bacteria 1084
153 Ga0114129_12018827 3300009147 Bacteria 697
154 Ga0105243_11158237 3300009148 Bacteria 784
155 Ga0105243_11298584 3300009148 Bacteria 745
156 Ga0105242_10141940 3300009176 Bacteria 2085
157 Ga0105242_10335343 3300009176 Bacteria 1392
158 Ga0105242_10452210 3300009176 Bacteria 1211
159 Ga0105242_11310039 3300009176 Bacteria 748
160 Ga0105242_11485317 3300009176 Bacteria 708
161 Ga0105248_10853642 3300009177 Bacteria 1028
162 Ga0105248_11644308 3300009177 Bacteria 728
163 Ga0105238_11016882 3300009551 Bacteria 850
164 Ga0105238_11194181 3300009551 Bacteria 785
165 Ga0105238_11341284 3300009551 Bacteria 742
166 Ga0105238_11365354 3300009551 Bacteria 735
167 Ga0105238_12587005 3300009551 Bacteria 544
168 Ga0105249_10269630 3300009553 Bacteria 1695
169 Ga0105249_10559792 3300009553 Bacteria 1195
170 Ga0105249_10917164 3300009553 Bacteria 943
171 Ga0105030_112130 3300009987 Bacteria 749
172 Ga0105030_120303 3300009987 Bacteria 601
173 Ga0105028_101416 3300009993 Bacteria 2535
174 Ga0105028_102783 3300009993 Bacteria 1841
175 Ga0099796_10550402 3300010159 Bacteria 519
176 Ga0105239_10162302 3300010375 Bacteria 2497
177 Ga0105246_10238616 3300011119 Bacteria 1436
178 Ga0105246_10858821 3300011119 Bacteria 810
179 Ga0105246_10937704 3300011119 Bacteria 779
180 Ga0105246_10992831 3300011119 Bacteria 759
181 Ga0105246_11119678 3300011119 Bacteria 720
182 Ga0157315_1006333 3300012508 Bacteria 922
183 Ga0157371_10523371 3300013102 Bacteria 877
184 Ga0157369_10192305 3300013105 Bacteria 2144
185 Ga0157369_10507310 3300013105 Bacteria 1248
186 Ga0157378_12082987 3300013297 Bacteria 618
187 Ga0163162_10520701 3300013306 Bacteria 1319
188 Ga0163162_10572152 3300013306 Bacteria 1257
189 Ga0163162_10643004 3300013306 Bacteria 1185
190 Ga0157372_11200469 3300013307 Bacteria 877
191 Ga0157375_11578069 3300013308 Bacteria 776
192 Ga0163163_11152365 3300014325 Bacteria 838
193 Ga0163163_11559741 3300014325 Bacteria 721
194 Ga0157380_10541713 3300014326 Bacteria 1140
195 Ga0157380_10891018 3300014326 Bacteria 915
196 Ga0157380_11362156 3300014326 Bacteria 759
197 Ga0157380_11539729 3300014326 Bacteria 719
198 Ga0157380_11546930 3300014326 Bacteria 717
199 Ga0157380_12579997 3300014326 Bacteria 574
200 Ga0182008_10742053 3300014497 Bacteria 565
201 Ga0157379_10719827 3300014968 Bacteria 938
202 Ga0157379_11735212 3300014968 Bacteria 612
203 Ga0157376_10650702 3300014969 Bacteria 1054
204 Ga0157376_11063357 3300014969 Bacteria 834
205 Ga0157376_11753242 3300014969 Bacteria 657
206 Ga0157376_12053117 3300014969 Bacteria 610
207 Ga0163161_10333236 3300017792 Bacteria 1202
208 Ga0163161_10421597 3300017792 Bacteria 1074
209 Ga0163161_10690831 3300017792 Bacteria 849
210 Ga0197907_11295313 3300020069 Bacteria 903
211 Ga0206356_10392024 3300020070 Bacteria 1263
212 Ga0206356_10711293 3300020070 Bacteria 1166
213 Ga0206356_11711064 3300020070 Bacteria 1300
214 Ga0206349_1233624 3300020075 Bacteria 1015
215 Ga0206349_1393095 3300020075 Bacteria 1315
216 Ga0206352_10456902 3300020078 Bacteria 675
217 Ga0206352_11285469 3300020078 Bacteria 713
218 Ga0206350_11397962 3300020080 Bacteria 1877
219 Ga0206354_10531322 3300020081 Bacteria 511
220 Ga0206354_11239045 3300020081 Bacteria 1231
221 Ga0213876_10293538 3300021384 Bacteria 864
222 Ga0224712_10029818 3300022467 Bacteria 1963
223 Ga0207653_10088085 3300025885 Bacteria 1084
224 Ga0207642_10573688 3300025899 Bacteria 699
225 Ga0207688_10196196 3300025901 Bacteria 1209
226 Ga0207645_10312000 3300025907 Bacteria 1048
227 Ga0207645_10530096 3300025907 Bacteria 798
228 Ga0207643_10631655 3300025908 Bacteria 690
229 Ga0207684_10026536 3300025910 Bacteria 4939
230 Ga0207684_10026643 3300025910 Bacteria 4928
231 Ga0207684_10182567 3300025910 Bacteria 1809
232 Ga0207684_10727025 3300025910 Bacteria 842
233 Ga0207654_10450814 3300025911 Bacteria 902
234 Ga0207654_10527263 3300025911 Bacteria 837
235 Ga0207707_10003489 3300025912 Bacteria 13914
236 Ga0207707_10026410 3300025912 Bacteria 5075
237 Ga0207707_10076663 3300025912 Bacteria 2918
238 Ga0207707_10212961 3300025912 Bacteria 1683
239 Ga0207662_10534384 3300025918 Bacteria 811
240 Ga0207657_10220837 3300025919 Bacteria 1518
241 Ga0207646_10675813 3300025922 Bacteria 924
242 Ga0207646_11369174 3300025922 Bacteria 616
243 Ga0207694_10776513 3300025924 Bacteria 809
244 Ga0207650_10416118 3300025925 Bacteria 1114
245 Ga0207687_10001161 3300025927 Bacteria 17971
246 Ga0207700_10253632 3300025928 Bacteria 1504
247 Ga0207700_10819284 3300025928 Bacteria 833
248 Ga0207664_10911755 3300025929 Bacteria 789
249 Ga0207664_10958078 3300025929 Bacteria 767
250 Ga0207664_11206537 3300025929 Bacteria 675
251 Ga0207644_10002764 3300025931 Bacteria 11300
252 Ga0207644_10625504 3300025931 Bacteria 895
253 Ga0207686_10608619 3300025934 Bacteria 861
254 Ga0207686_10922113 3300025934 Bacteria 706
255 Ga0207686_11286582 3300025934 Bacteria 600
256 Ga0207669_11322070 3300025937 Bacteria 613
257 Ga0207665_10078645 3300025939 Bacteria 2266
258 Ga0207665_10480049 3300025939 Bacteria 958
259 Ga0207711_11006564 3300025941 Bacteria 773
260 Ga0207689_10646740 3300025942 Bacteria 891
261 Ga0207689_10950670 3300025942 Bacteria 725
262 Ga0207667_10610955 3300025949 Bacteria 1099
263 Ga0207651_10101839 3300025960 Bacteria 2133
264 Ga0207712_10672225 3300025961 Bacteria 902
265 Ga0207712_11558730 3300025961 Bacteria 592
266 Ga0207712_12137861 3300025961 Bacteria 501
267 Ga0207658_10619726 3300025986 Bacteria 973
268 Ga0207658_12018461 3300025986 Bacteria 525
269 Ga0207677_11871196 3300026023 Bacteria 557
270 Ga0207639_12188891 3300026041 Bacteria 514
271 Ga0207678_10117462 3300026067 Bacteria 2270
272 Ga0207678_10279158 3300026067 Bacteria 1433
273 Ga0207702_11974517 3300026078 Bacteria 574
274 Ga0207641_10149980 3300026088 Bacteria 2111
275 Ga0207641_10492193 3300026088 Bacteria 1190
276 Ga0207641_10498067 3300026088 Bacteria 1183
277 Ga0207648_10515627 3300026089 Bacteria 1095
278 Ga0207676_10124872 3300026095 Bacteria 2178
279 Ga0207676_10441689 3300026095 Bacteria 1225
280 Ga0207675_100100627 3300026118 Bacteria 2723
281 Ga0207675_100403950 3300026118 Bacteria 1347
282 Ga0207675_100585287 3300026118 Bacteria 1118
283 Ga0207675_101104445 3300026118 Bacteria 813
284 Ga0207683_10647202 3300026121 Bacteria 979
285 Ga0207683_10684896 3300026121 Bacteria 950
286 Ga0209813_10015006 3300027866 Bacteria 2093
287 Ga0209974_10395855 3300027876 Unclassified 542
288 Ga0207428_10008172 3300027907 Bacteria 9469
289 Ga0207428_10234082 3300027907 Bacteria 1374
290 Ga0207428_10300348 3300027907 Bacteria 1188
291 Ga0268265_10932380 3300028380 Bacteria 854
292 Ga0268264_10582892 3300028381 Bacteria 1100
293 Ga0268264_11054016 3300028381 Bacteria 821
294 Ga0265337_1106810 3300028556 Bacteria 761
295 Ga0265322_10115326 3300028654 Bacteria 765
296 Ga0265338_10000404 3300028800 Bacteria 77425
297 Ga0265338_10193405 3300028800 Bacteria 1540
298 Ga0265338_10607596 3300028800 Bacteria 761
299 Ga0265330_10192244 3300031235 Bacteria 864
300 Ga0265328_10271932 3300031239 Bacteria 651
301 Ga0265320_10520267 3300031240 Bacteria 526
302 Ga0265325_10002389 3300031241 Bacteria 12687
303 Ga0265339_10036862 3300031249 Bacteria 2734
304 Ga0265339_10579177 3300031249 Bacteria 515
305 Ga0265331_10052636 3300031250 Bacteria 1944
306 Ga0265327_10034891 3300031251 Bacteria 2786
307 Ga0265327_10059187 3300031251 Bacteria 1963
308 Ga0265327_10267202 3300031251 Bacteria 758
309 Ga0265316_10596465 3300031344 Bacteria 783
310 Ga0307408_100180627 3300031548 Bacteria 1692
311 Ga0265313_10000776 3300031595 Bacteria 32397
312 Ga0316575_10243186 3300031665 Bacteria 754
313 Ga0316579_10017298 3300031691 Bacteria 3160
314 Ga0265314_10092562 3300031711 Bacteria 1965
315 Ga0265314_10406592 3300031711 Bacteria 735
316 Ga0265342_10156185 3300031712 Bacteria 1264
317 Ga0316576_10012357 3300031727 Bacteria 5636
318 Ga0316576_10027706 3300031727 Bacteria 3985
319 Ga0316576_10054211 3300031727 Bacteria 2924
320 Ga0316576_10165266 3300031727 Bacteria 1670
321 Ga0316576_10235728 3300031727 Bacteria 1375
322 Ga0316578_10012581 3300031728 Bacteria 4465
323 Ga0307405_11668919 3300031731 Bacteria 564
324 Ga0316577_10010865 3300031733 Bacteria 4923
325 Ga0316577_10128256 3300031733 Bacteria 1427
326 Ga0316577_10174856 3300031733 Bacteria 1212
327 Ga0307410_10503308 3300031852 Bacteria 997
328 Ga0307406_10258551 3300031901 Bacteria 1316
329 Ga0307406_10582699 3300031901 Bacteria 920
330 Ga0307407_10127235 3300031903 Bacteria 1624
331 Ga0307407_10964967 3300031903 Bacteria 657
332 Ga0307416_100069594 3300032002 Bacteria 2913
333 Ga0307416_101067272 3300032002 Bacteria 912
334 Ga0307414_10040824 3300032004 Bacteria 3137
335 Ga0307415_100306253 3300032126 Bacteria 1318
336 Ga0307415_100579662 3300032126 Bacteria 995
337 Ga0307415_100793002 3300032126 Bacteria 864
338 Ga0307415_100805671 3300032126 Bacteria 858
339 Ga0307415_100945856 3300032126 Bacteria 797
340 Ga0307415_101043610 3300032126 Bacteria 762
341 Ga0316585_10086067 3300032137 Bacteria 1026
342 Ga0316580_10021572 3300032139 Bacteria 1985
343 Ga0373926_0333235 3300035083 Bacteria 595
344 Ga0373926_0355644 3300035083 Bacteria 575
345 Ga0373928_0280948 3300035084 Bacteria 505
346 Ga0373929_0074432 3300035085 Bacteria 818
347 Ga0373944_0372451 3300035089 Bacteria 546
348 Ga0373939_0076157 3300035114 Bacteria 1104
349 Ga0373945_0384129 3300035116 Bacteria 613
350 Ga0373943_0272790 3300035170 Bacteria 954
351 Ga0373946_0114699 3300035171 Bacteria 1223
352 Ga0373942_0256721 3300035207 Bacteria 596
353 Ga0316574_0016888 3300035398 Bacteria 4260
354 Ga0316574_0030977 3300035398 Bacteria 3243
355 Ga0316574_0115231 3300035398 Bacteria 1723
356 Ga0316574_0166622 3300035398 Bacteria 1419
357 Ga0316574_0307818 3300035398 Bacteria 1007
358 Ga0373931_0013527 3300035691 Bacteria 3975
359 Ga0373935_0098909 3300035692 Bacteria 1920
360 Ga0373935_0109742 3300035692 Bacteria 1830
361 Ga0373935_0176449 3300035692 Bacteria 1465
362 Ga0373933_0231936 3300035724 Bacteria 1186
363 Ga0373933_0774017 3300035724 Bacteria 632
364 Ga0373947_0062015 3300035725 Bacteria 2274
365 Ga0373947_0167346 3300035725 Bacteria 1425
366 Ga0373937_0421046 3300036401 Bacteria 1268
367 Ga0373937_0567628 3300036401 Bacteria 1078
368 Ga0373937_1389207 3300036401 Bacteria 650
369 Ga0316582_0085568 3300036647 Bacteria 2066
370 Ga0316582_0456259 3300036647 Bacteria 881
371 Ga0316584_0016841 3300036712 Bacteria 5245
372 Ga0316584_0038830 3300036712 Bacteria 3543
373 Ga0316584_0119260 3300036712 Bacteria 1972
374 Ga0316584_0241678 3300036712 Bacteria 1321
375 Ga0373925_0167156 3300037068 Bacteria 1735
376 Ga0373925_1106298 3300037068 Bacteria 652
377 Ga0395900_0992021 3300037418 Bacteria 760
378 Ga0395900_1836060 3300037418 Bacteria 517
379 Ga0400485_07726 3300038735 Bacteria 4146
380 Ga0400485_07921 3300038735 Bacteria 6699
381 Ga0400486_02192 3300038742 Bacteria 1656
382 Ga0400483_006374 3300039062 Bacteria 8573
383 Ga0400483_102644 3300039062 Bacteria 1539
384 Ga0400483_119634 3300039062 Bacteria 8580
385 Ga0400483_135474 3300039062 Bacteria 19039
386 Ga0400483_271686 3300039062 Bacteria 10762
387 Ga0400483_286448 3300039062 Bacteria 1035
388 Ga0436365_0047787 3300039437 Bacteria 609
389 Ga0436365_0055491 3300039437 Bacteria 1233
390 Ga0436365_0454746 3300039437 Bacteria 672
391 Ga0436365_0921705 3300039437 Bacteria 837
392 Ga0436365_0956643 3300039437 Bacteria 1163
393 Ga0436365_1069374 3300039437 Bacteria 1706
394 Ga0436360_0714011 3300039438 Bacteria 1003
395 Ga0436363_0953663 3300039450 Bacteria 697
396 Ga0436363_1269616 3300039450 Bacteria 857
397 Ga0436363_1371372 3300039450 Bacteria 688
398 Ga0436362_0257499 3300039453 Bacteria 987
399 Ga0436362_0777461 3300039453 Bacteria 779
400 Ga0436362_0822080 3300039453 Bacteria 619
401 Ga0436362_1097698 3300039453 Bacteria 757
402 Ga0436362_1235245 3300039453 Bacteria 569
403 Ga0436362_1259949 3300039453 Bacteria 6913
404 Ga0439438_126189 3300041405 Bacteria 615
405 Ga0439439_0035272 3300041406 Bacteria 1285
406 Ga0439447_084172 3300041407 Bacteria 733
407 Ga0439453_0036030 3300041408 Bacteria 955
408 Ga0451797_0697581 3300041453 Bacteria 547
409 Ga0451798_0038043 3300041458 Bacteria 510
410 Ga0451800_1088893 3300041459 Bacteria 565
411 Ga0451800_1225528 3300041459 Bacteria 693
412 Ga0451802_0197124 3300041460 Bacteria 780
413 Ga0451804_1080182 3300041463 Bacteria 608
414 Ga0451807_2190932 3300041486 Bacteria 721
415 Ga0451835_0911484 3300041492 Bacteria 619
416 Ga0451835_1221373 3300041492 Bacteria 501
417 Ga0451839_1338875 3300041496 Bacteria 659
418 Ga0451849_0525999 3300041505 Bacteria 570
419 Ga0451851_0358739 3300041507 Bacteria 683
420 Ga0451853_0327854 3300041512 Bacteria 501
421 Ga0451853_3757407 3300041512 Bacteria 711
422 Ga0439443_028594 3300042003 Bacteria 910
423 Ga0439448_0003737 3300042005 Bacteria 4242
424 Ga0439432_176514 3300042006 Bacteria 623
425 Ga0439450_000313 3300042008 Bacteria 6035
426 Ga0439463_004804 3300042016 Bacteria 3375
427 Ga0450920_010777 3300042122 Bacteria 1698
428 Ga0450888_073165 3300042126 Bacteria 518
429 Ga0450906_047207 3300042145 Bacteria 760
430 Ga0439458_0168438 3300042157 Bacteria 592
431 Ga0450908_093698 3300042184 Bacteria 546
432 Ga0439434_0126408 3300042435 Bacteria 837
433 Ga0439435_0305059 3300042436 Unclassified 546
434 Ga0439444_0022164 3300042437 Bacteria 1130
435 Ga0439464_0001455 3300042439 Bacteria 5582
436 Ga0439460_0170586 3300042461 Bacteria 732
437 Ga0450918_012076 3300042531 Bacteria 1505
438 Ga0450901_010290 3300042533 Bacteria 968
439 Ga0466966_0308943 3300044684 Bacteria 950
440 Ga0466966_0362990 3300044684 Bacteria 870
441 Ga0466961_0150203 3300044693 Bacteria 1455
442 Ga0466963_0271608 3300044694 Bacteria 1191
443 Ga0466958_0220396 3300045836 Bacteria 1210
444 Ga0495592_0121987 3300046454 Bacteria 1832
445 Ga0495603_0483769 3300046455 Bacteria 709
446 Ga0495603_0748761 3300046455 Bacteria 558
447 Ga0495641_0209791 3300046461 Bacteria 873
448 Ga0495641_0310819 3300046461 Bacteria 711
449 Ga0495651_0484363 3300046462 Bacteria 794
450 Ga0495653_0459294 3300046463 Bacteria 800
451 Ga0495653_0538478 3300046463 Bacteria 724
452 Ga0495653_0939132 3300046463 Bacteria 514
453 Ga0495582_0232496 3300046473 Bacteria 1056
454 Ga0495605_0179163 3300046474 Bacteria 933
455 Ga0495639_0187872 3300046475 Bacteria 1008
456 Ga0495639_0256549 3300046475 Bacteria 865
457 Ga0495639_0434685 3300046475 Bacteria 666
458 Ga0495662_0310985 3300046476 Bacteria 775
459 Ga0495664_0055799 3300046477 Bacteria 2350
460 Ga0495594_0220000 3300046499 Bacteria 1083
461 Ga0495596_0215373 3300046500 Bacteria 746
462 Ga0495583_0205470 3300046506 Bacteria 799
463 Ga0495608_0133541 3300046511 Bacteria 1587
464 Ga0495608_0269690 3300046511 Bacteria 1058
465 Ga0495608_0326738 3300046511 Bacteria 947
466 Ga0495608_0338831 3300046511 Bacteria 927
467 Ga0495618_0229067 3300046514 Bacteria 1170
468 Ga0495618_0450888 3300046514 Bacteria 781
469 Ga0495618_0685726 3300046514 Bacteria 603
470 Ga0495618_0769535 3300046514 Bacteria 562
471 Ga0495628_0008870 3300046516 Bacteria 8603
472 Ga0495628_0288221 3300046516 Bacteria 1218
473 Ga0495628_0606226 3300046516 Bacteria 782
474 Ga0495630_0035254 3300046517 Bacteria 3739
475 Ga0495630_0047489 3300046517 Bacteria 3211
476 Ga0495630_0183085 3300046517 Bacteria 1597
477 Ga0495630_0267231 3300046517 Bacteria 1307
478 Ga0495630_1017009 3300046517 Bacteria 630
479 Ga0495644_0068240 3300046523 Bacteria 1336
480 Ga0495663_0042989 3300046525 Bacteria 1379
481 Ga0495666_0026231 3300046526 Bacteria 2875
482 Ga0495652_0364853 3300046529 Bacteria 1031
483 Ga0495652_0389860 3300046529 Bacteria 989
484 Ga0495640_0009407 3300046533 Bacteria 7610
485 Ga0495640_0200041 3300046533 Bacteria 1267
486 Ga0495640_0478650 3300046533 Bacteria 759
487 Ga0495586_0079237 3300046535 Bacteria 1803
488 Ga0495586_0103943 3300046535 Bacteria 1578
489 Ga0495645_0504983 3300046543 Bacteria 755
490 Ga0495622_0206976 3300046557 Bacteria 873
491 Ga0495667_0167708 3300046559 Bacteria 1411
492 Ga0495667_0251753 3300046559 Bacteria 1124
493 Ga0495667_0426049 3300046559 Bacteria 835
494 Ga0495668_0584640 3300046616 Bacteria 617
495 Ga0495668_0710132 3300046616 Bacteria 556
496 Ga0495634_0349714 3300046642 Bacteria 885
497 Ga0495634_0486677 3300046642 Bacteria 724
498 Ga0495634_0690592 3300046642 Bacteria 587
499 Ga0495625_0755924 3300046660 Bacteria 569
500 Ga0495635_0123357 3300046663 Bacteria 1767
501 Ga0495635_0158384 3300046663 Bacteria 1541
502 Ga0495599_0319576 3300046678 Bacteria 935
503 Ga0495623_0503952 3300046679 Bacteria 639
504 Ga0495646_0151615 3300046680 Bacteria 1289
505 Ga0495647_0213001 3300046681 Bacteria 850
506 Ga0495647_0226600 3300046681 Bacteria 826
507 Ga0495647_0502102 3300046681 Bacteria 565
508 Ga0495658_0065406 3300046683 Bacteria 2097
509 Ga0495658_0070594 3300046683 Bacteria 2027
510 Ga0495658_0315551 3300046683 Bacteria 990
511 Ga0495658_0500872 3300046683 Bacteria 777
512 Ga0495658_0803079 3300046683 Bacteria 602
513 Ga0495613_0140617 3300046689 Bacteria 1725
514 Ga0495613_0218459 3300046689 Bacteria 1339
515 Ga0495613_0341201 3300046689 Bacteria 1030
516 Ga0495624_0341277 3300046690 Bacteria 901
517 Ga0495624_0356345 3300046690 Bacteria 880
518 Ga0495624_0655241 3300046690 Bacteria 624
519 Ga0495671_0175655 3300046692 Bacteria 1041
520 Ga0495671_0216872 3300046692 Bacteria 927
521 Ga0495589_0084697 3300046794 Bacteria 1541
522 Ga0495589_0305226 3300046794 Bacteria 737
523 Ga0495581_0526248 3300047315 Bacteria 687
524 Ga0495581_0627086 3300047315 Bacteria 622
525 Ga0495604_0228747 3300047317 Bacteria 1277
526 Ga0495604_0798526 3300047317 Bacteria 594
527 Ga0495636_0268267 3300047318 Bacteria 793
528 Ga0495636_0479457 3300047318 Bacteria 600
529 Ga0495636_0602818 3300047318 Bacteria 537
530 Ga0495674_0177649 3300047319 Bacteria 1774
531 Ga0495674_0179513 3300047319 Unclassified 1764
532 Ga0495674_0627550 3300047319 Bacteria 849
533 Ga0495672_0000884 3300047320 Bacteria 31539
534 Ga0495672_0093189 3300047320 Bacteria 1650
535 Ga0495676_0030448 3300047321 Bacteria 4580
536 Ga0495676_0055288 3300047321 Bacteria 3148
537 Ga0495676_0059179 3300047321 Bacteria 3011
538 Ga0495676_0611527 3300047321 Bacteria 709
539 Ga0495680_0085474 3300047322 Bacteria 2375
540 Ga0495683_0452195 3300047323 Bacteria 527
541 Ga0495675_0295112 3300047444 Bacteria 964
542 Ga0495677_0214575 3300047445 Bacteria 749
543 Ga0495679_145206 3300047446 Bacteria 639
544 Ga0495685_207671 3300047447 Bacteria 627
545 Ga0495684_0166281 3300047471 Bacteria 1643
546 Ga0495684_0168031 3300047471 Bacteria 1633
547 Ga0495684_0654022 3300047471 Bacteria 702
548 Ga0495686_0228577 3300047472 Bacteria 1055
549 Ga0495593_0493308 3300047673 Bacteria 614
550 Ga0495593_0680819 3300047673 Bacteria 516
551 Ga0495602_0340328 3300048088 Bacteria 1085
552 Ga0495602_0501203 3300048088 Bacteria 849
553 Ga0495602_0566538 3300048088 Bacteria 785
554 Ga0495602_0677115 3300048088 Bacteria 702
555 Ga0495614_0178375 3300048089 Bacteria 955
556 Ga0495614_0309896 3300048089 Bacteria 731
557 Ga0495615_0091603 3300048090 Bacteria 848
558 Ga0495626_0192685 3300048091 Bacteria 840
559 Ga0496100_1067533 3300048903 Bacteria 636
560 Ga0496101_0057951 3300048904 Bacteria 2803
561 Ga0496101_0760405 3300048904 Bacteria 764
562 Ga0496101_0834134 3300048904 Bacteria 727
563 Ga0496101_1336702 3300048904 Bacteria 560
564 Ga0496102_0022327 3300048905 Bacteria 5607
565 Ga0496102_0063259 3300048905 Bacteria 3388
566 Ga0496103_0149470 3300048906 Bacteria 1496
567 Ga0496104_0002399 3300048907 Bacteria 16146
568 Ga0496104_0035101 3300048907 Bacteria 4681
569 Ga0496104_0263493 3300048907 Bacteria 1636
570 Ga0496104_1260529 3300048907 Bacteria 642
571 Ga0496105_0203836 3300048908 Bacteria 1614
572 Ga0496105_0819588 3300048908 Bacteria 706
573 Ga0496106_0136190 3300048909 Bacteria 1929
574 Ga0496106_0507014 3300048909 Bacteria 969
575 Ga0496107_0025907 3300048910 Bacteria 4156
576 Ga0496108_0089960 3300048911 Bacteria 2609
577 Ga0496108_0624172 3300048911 Bacteria 938
578 Ga0496108_0737966 3300048911 Bacteria 852
579 Ga0496108_0864987 3300048911 Bacteria 777
580 Ga0496108_1604955 3300048911 Bacteria 538
581 Ga0496109_0024454 3300048912 Bacteria 5370
582 Ga0496109_0067024 3300048912 Bacteria 3288
583 Ga0496109_0336309 3300048912 Bacteria 1426
584 Ga0496109_0469254 3300048912 Bacteria 1189
585 Ga0496109_0626399 3300048912 Bacteria 1012
586 Ga0496109_1423156 3300048912 Bacteria 629
587 Ga0496110_0130293 3300048913 Bacteria 2271
588 Ga0496110_0578736 3300048913 Bacteria 1019
589 Ga0496110_0689981 3300048913 Bacteria 922
590 Ga0496110_1238087 3300048913 Bacteria 655
591 Ga0496111_0086327 3300048914 Bacteria 2296
592 Ga0496111_0301316 3300048914 Bacteria 1188
593 Ga0496112_0059723 3300048915 Bacteria 3757
594 Ga0496112_0323264 3300048915 Bacteria 1487
595 Ga0496112_0601856 3300048915 Bacteria 1031
596 Ga0496112_0840751 3300048915 Bacteria 842
597 Ga0496112_0855883 3300048915 Bacteria 832
598 Ga0496113_0184622 3300048916 Bacteria 1654
599 Ga0496113_0320168 3300048916 Bacteria 1243
600 Ga0496113_0330638 3300048916 Bacteria 1222
601 Ga0496113_0431891 3300048916 Bacteria 1058
602 Ga0496113_0749628 3300048916 Bacteria 777
603 Ga0496114_0970744 3300048917 Bacteria 732
604 Ga0496114_1022791 3300048917 Bacteria 710
605 Ga0496114_1655216 3300048917 Bacteria 528
606 Ga0496115_0012220 3300048918 Bacteria 6455
607 Ga0496115_0538106 3300048918 Bacteria 935
608 Ga0501307_081704 3300049162 Bacteria 529
609 Ga0501031_0001203 3300049568 Bacteria 15788
610 Ga0501031_0008975 3300049568 Bacteria 6504
611 Ga0501031_0012023 3300049568 Bacteria 5645
612 Ga0501031_0057837 3300049568 Bacteria 2526
613 Ga0501031_0159369 3300049568 Bacteria 1475
614 Ga0501031_0170134 3300049568 Bacteria 1424
615 Ga0501031_0406661 3300049568 Bacteria 880
616 Ga0501031_0854621 3300049568 Bacteria 583
617 Ga0501032_0001203 3300049569 Bacteria 20695
618 Ga0501032_0029797 3300049569 Bacteria 3743
619 Ga0501032_0094265 3300049569 Bacteria 1985
620 Ga0501032_0274713 3300049569 Bacteria 1091
621 Ga0501032_0686972 3300049569 Bacteria 649
622 Ga0501033_0003012 3300049570 Bacteria 14061
623 Ga0501033_0003829 3300049570 Bacteria 12242
624 Ga0501033_0004468 3300049570 Bacteria 11187
625 Ga0501033_0018735 3300049570 Bacteria 5232
626 Ga0501033_0111858 3300049570 Bacteria 1987
627 Ga0501033_0218832 3300049570 Bacteria 1356
628 Ga0501034_0002750 3300049571 Bacteria 20681
629 Ga0501034_0224578 3300049571 Bacteria 1829
630 Ga0501034_0290609 3300049571 Bacteria 1573
631 Ga0501034_0302154 3300049571 Bacteria 1537
632 Ga0501034_0316360 3300049571 Bacteria 1494
633 Ga0501034_0343081 3300049571 Bacteria 1423
634 Ga0501036_0003005 3300049572 Bacteria 13418
635 Ga0501036_0011148 3300049572 Bacteria 7437
636 Ga0501036_0013366 3300049572 Bacteria 6820
637 Ga0501036_0017186 3300049572 Bacteria 6047
638 Ga0501036_0022688 3300049572 Bacteria 5282
639 Ga0501036_0026040 3300049572 Bacteria 4936
640 Ga0501036_0026119 3300049572 Bacteria 4929
641 Ga0501036_0239222 3300049572 Bacteria 1523
642 Ga0501036_0366897 3300049572 Bacteria 1202
643 Ga0501036_0440942 3300049572 Bacteria 1085
644 Ga0501036_0561392 3300049572 Bacteria 948
645 Ga0501037_0014066 3300049573 Bacteria 5895
646 Ga0501037_0014202 3300049573 Bacteria 5864
647 Ga0501037_0098580 3300049573 Bacteria 2111
648 Ga0501037_0120931 3300049573 Bacteria 1883
649 Ga0501037_0536842 3300049573 Bacteria 790
650 Ga0501037_1106280 3300049573 Bacteria 513
651 Ga0501038_0011836 3300049574 Bacteria 7963
652 Ga0501038_0025889 3300049574 Bacteria 5226
653 Ga0501038_0043269 3300049574 Bacteria 3916
654 Ga0501038_0070861 3300049574 Bacteria 2958
655 Ga0501038_0160072 3300049574 Bacteria 1830
656 Ga0501038_0328419 3300049574 Bacteria 1195
657 Ga0501038_0603558 3300049574 Bacteria 830
658 Ga0501039_0006601 3300049575 Bacteria 8812
659 Ga0501039_0007919 3300049575 Bacteria 8097
660 Ga0501039_0010232 3300049575 Bacteria 7147
661 Ga0501039_0010828 3300049575 Bacteria 6950
662 Ga0501039_0011747 3300049575 Bacteria 6669
663 Ga0501039_0082281 3300049575 Bacteria 2507
664 Ga0501039_0122257 3300049575 Bacteria 2041
665 Ga0501039_0171381 3300049575 Bacteria 1706
666 Ga0501039_0184410 3300049575 Bacteria 1641
667 Ga0501039_0214615 3300049575 Bacteria 1513
668 Ga0501039_0245352 3300049575 Bacteria 1408
669 Ga0501039_0367929 3300049575 Bacteria 1129
670 Ga0501039_0784040 3300049575 Bacteria 744
671 Ga0501040_0000785 3300049576 Bacteria 19752
672 Ga0501040_0007501 3300049576 Bacteria 7056
673 Ga0501040_0024646 3300049576 Bacteria 4039
674 Ga0501040_0025298 3300049576 Bacteria 3991
675 Ga0501040_0029703 3300049576 Bacteria 3690
676 Ga0501040_0052223 3300049576 Bacteria 2797
677 Ga0501040_0059568 3300049576 Bacteria 2623
678 Ga0501040_0072846 3300049576 Bacteria 2373
679 Ga0501040_0265090 3300049576 Bacteria 1226
680 Ga0501040_0274613 3300049576 Bacteria 1204
681 Ga0501040_0348809 3300049576 Bacteria 1060
682 Ga0501040_0430537 3300049576 Bacteria 949
683 Ga0501040_0518383 3300049576 Unclassified 859
684 Ga0501041_0000759 3300049577 Bacteria 17243
685 Ga0501041_0000812 3300049577 Bacteria 16745
686 Ga0501041_0005964 3300049577 Bacteria 7127
687 Ga0501041_0006962 3300049577 Bacteria 6633
688 Ga0501041_0026988 3300049577 Bacteria 3459
689 Ga0501041_0035281 3300049577 Bacteria 3030
690 Ga0501041_0090992 3300049577 Bacteria 1884
691 Ga0501041_0115017 3300049577 Bacteria 1670
692 Ga0501041_0244085 3300049577 Bacteria 1129
693 Ga0501041_0405228 3300049577 Bacteria 864
694 Ga0501041_0503439 3300049577 Bacteria 771
695 Ga0501042_0000504 3300049578 Bacteria 20325
696 Ga0501042_0001643 3300049578 Bacteria 13318
697 Ga0501042_0006408 3300049578 Bacteria 7633
698 Ga0501042_0044901 3300049578 Bacteria 3148
699 Ga0501042_0068497 3300049578 Bacteria 2538
700 Ga0501042_0094621 3300049578 Bacteria 2146
701 Ga0501042_0272575 3300049578 Bacteria 1222
702 Ga0501042_0291670 3300049578 Bacteria 1178
703 Ga0501042_0327871 3300049578 Bacteria 1106
704 Ga0501042_0370007 3300049578 Bacteria 1037
705 Ga0501042_0514263 3300049578 Bacteria 869
706 Ga0501042_0603488 3300049578 Bacteria 798
707 Ga0501042_1006182 3300049578 Bacteria 607
708 Ga0501042_1103803 3300049578 Bacteria 578
709 Ga0501042_1193239 3300049578 Bacteria 555
710 Ga0501042_1319602 3300049578 Bacteria 526
711 Ga0501043_0007699 3300049579 Bacteria 8530
712 Ga0501043_0016411 3300049579 Bacteria 5806
713 Ga0501043_0271505 3300049579 Bacteria 1302
714 Ga0501043_0315188 3300049579 Bacteria 1193
715 Ga0501043_1132799 3300049579 Bacteria 552
716 Ga0501043_1188617 3300049579 Bacteria 536
717 Ga0501046_0004094 3300049580 Bacteria 13285
718 Ga0501046_0005560 3300049580 Bacteria 11260
719 Ga0501046_0023951 3300049580 Bacteria 5013
720 Ga0501046_0025957 3300049580 Bacteria 4788
721 Ga0501046_0029128 3300049580 Bacteria 4492
722 Ga0501046_0040868 3300049580 Bacteria 3703
723 Ga0501046_0047264 3300049580 Bacteria 3412
724 Ga0501046_0895073 3300049580 Bacteria 619
725 Ga0501047_0012694 3300049581 Bacteria 7979
726 Ga0501047_0179649 3300049581 Bacteria 1983
727 Ga0501048_0008087 3300049582 Bacteria 7961
728 Ga0501048_0017750 3300049582 Bacteria 5236
729 Ga0501048_0019700 3300049582 Bacteria 4947
730 Ga0501048_0022677 3300049582 Bacteria 4589
731 Ga0501048_0034719 3300049582 Bacteria 3636
732 Ga0501048_0041802 3300049582 Bacteria 3283
733 Ga0501048_0142628 3300049582 Bacteria 1694
734 Ga0501048_0151861 3300049582 Bacteria 1638
735 Ga0501048_0354493 3300049582 Bacteria 1046
736 Ga0501048_0385645 3300049582 Bacteria 1001
737 Ga0501048_0592175 3300049582 Bacteria 796
738 Ga0501068_0011607 3300049584 Bacteria 4976
739 Ga0501068_0014374 3300049584 Bacteria 4524
740 Ga0501068_0020679 3300049584 Bacteria 3838
741 Ga0501068_0153425 3300049584 Bacteria 1448
742 Ga0501068_0188878 3300049584 Bacteria 1304
743 Ga0501068_0281611 3300049584 Unclassified 1063
744 Ga0501068_0320511 3300049584 Bacteria 994
745 Ga0501068_0394015 3300049584 Bacteria 892
746 Ga0501068_0394163 3300049584 Bacteria 892
747 Ga0501068_0496223 3300049584 Bacteria 792
748 Ga0501069_0005350 3300049585 Bacteria 6677
749 Ga0501069_0057589 3300049585 Bacteria 2167
750 Ga0501069_0083881 3300049585 Bacteria 1797
751 Ga0501069_0191753 3300049585 Bacteria 1183
752 Ga0501069_0405670 3300049585 Bacteria 807
753 Ga0501069_0902066 3300049585 Bacteria 538
754 Ga0501070_0002318 3300049586 Bacteria 16701
755 Ga0501070_0002602 3300049586 Bacteria 15769
756 Ga0501070_0003086 3300049586 Bacteria 14505
757 Ga0501070_0052792 3300049586 Bacteria 3374
758 Ga0501070_0054265 3300049586 Bacteria 3324
759 Ga0501070_0280994 3300049586 Bacteria 1358
760 Ga0501070_0561343 3300049586 Bacteria 913
761 Ga0501070_0683202 3300049586 Bacteria 813
762 Ga0501070_1003681 3300049586 Unclassified 647
763 Ga0501071_0000545 3300049587 Bacteria 19380
764 Ga0501071_0000787 3300049587 Bacteria 16887
765 Ga0501071_0001054 3300049587 Bacteria 15259
766 Ga0501071_0009639 3300049587 Bacteria 6445
767 Ga0501071_0014181 3300049587 Bacteria 5448
768 Ga0501071_0015392 3300049587 Bacteria 5251
769 Ga0501071_0016589 3300049587 Bacteria 5067
770 Ga0501071_0021976 3300049587 Bacteria 4446
771 Ga0501071_0022614 3300049587 Bacteria 4384
772 Ga0501071_0038298 3300049587 Bacteria 3426
773 Ga0501071_0084865 3300049587 Bacteria 2322
774 Ga0501071_0251806 3300049587 Bacteria 1333
775 Ga0501071_0616628 3300049587 Unclassified 834
776 Ga0501071_0620315 3300049587 Unclassified 832
777 Ga0501071_0711013 3300049587 Unclassified 774
778 Ga0501071_1028915 3300049587 Bacteria 636
779 Ga0501071_1225224 3300049587 Bacteria 580
780 Ga0501072_0000534 3300049588 Bacteria 27305
781 Ga0501072_0000940 3300049588 Bacteria 21452
782 Ga0501072_0003389 3300049588 Bacteria 11992
783 Ga0501072_0003761 3300049588 Bacteria 11457
784 Ga0501072_0004312 3300049588 Bacteria 10800
785 Ga0501072_0045577 3300049588 Bacteria 3448
786 Ga0501072_0047186 3300049588 Bacteria 3392
787 Ga0501072_0154071 3300049588 Bacteria 1832
788 Ga0501072_0294452 3300049588 Bacteria 1290
789 Ga0501072_0454268 3300049588 Bacteria 1014
790 Ga0501072_0595413 3300049588 Bacteria 872
791 Ga0501072_1024453 3300049588 Unclassified 643
792 Ga0501072_1098263 3300049588 Bacteria 619
793 Ga0501072_1453231 3300049588 Bacteria 530
794 Ga0501073_0003892 3300049589 Bacteria 11212
795 Ga0501073_0008573 3300049589 Bacteria 7582
796 Ga0501073_0082006 3300049589 Bacteria 2243
797 Ga0501073_0576918 3300049589 Bacteria 777
798 Ga0501074_0000933 3300049590 Bacteria 18810
799 Ga0501074_0048376 3300049590 Bacteria 3072
800 Ga0501074_0094709 3300049590 Bacteria 2138
801 Ga0501074_0111622 3300049590 Bacteria 1956
802 Ga0501074_0130833 3300049590 Bacteria 1795
803 Ga0501074_0134948 3300049590 Bacteria 1765
804 Ga0501074_0552390 3300049590 Unclassified 815
805 Ga0501074_0899457 3300049590 Bacteria 623
806 Ga0501075_0000765 3300049591 Bacteria 20070
807 Ga0501075_0002356 3300049591 Bacteria 12543
808 Ga0501075_0004561 3300049591 Bacteria 9390
809 Ga0501075_0006710 3300049591 Bacteria 7941
810 Ga0501075_0016972 3300049591 Bacteria 5252
811 Ga0501075_0025233 3300049591 Bacteria 4367
812 Ga0501075_0066505 3300049591 Bacteria 2720
813 Ga0501075_0108832 3300049591 Bacteria 2107
814 Ga0501075_0192315 3300049591 Bacteria 1556
815 Ga0501075_0306942 3300049591 Bacteria 1209
816 Ga0501075_0607970 3300049591 Bacteria 834
817 Ga0501075_0660795 3300049591 Bacteria 797
818 Ga0501075_0881628 3300049591 Bacteria 680
819 Ga0501076_0001754 3300049592 Bacteria 14659
820 Ga0501076_0002077 3300049592 Bacteria 13724
821 Ga0501076_0002252 3300049592 Bacteria 13204
822 Ga0501076_0003130 3300049592 Bacteria 11530
823 Ga0501076_0008401 3300049592 Bacteria 7565
824 Ga0501076_0010913 3300049592 Bacteria 6758
825 Ga0501076_0020135 3300049592 Bacteria 5105
826 Ga0501076_0044611 3300049592 Bacteria 3496
827 Ga0501076_0048861 3300049592 Bacteria 3343
828 Ga0501076_0166806 3300049592 Bacteria 1795
829 Ga0501076_0264849 3300049592 Bacteria 1407
830 Ga0501076_0454080 3300049592 Bacteria 1055
831 Ga0501076_0486181 3300049592 Bacteria 1017
832 Ga0501076_0680452 3300049592 Bacteria 849
833 Ga0501076_0715444 3300049592 Bacteria 826
834 Ga0501076_0902471 3300049592 Bacteria 728
835 Ga0501077_0001976 3300049593 Bacteria 12390
836 Ga0501077_0002417 3300049593 Bacteria 11209
837 Ga0501077_0004688 3300049593 Bacteria 8310
838 Ga0501077_0007289 3300049593 Bacteria 6824
839 Ga0501077_0014703 3300049593 Bacteria 4918
840 Ga0501077_0068525 3300049593 Bacteria 2249
841 Ga0501077_0135043 3300049593 Bacteria 1565
842 Ga0501077_0149323 3300049593 Bacteria 1483
843 Ga0501077_0251052 3300049593 Bacteria 1125
844 Ga0501077_0364784 3300049593 Bacteria 922
845 Ga0501077_0826738 3300049593 Bacteria 596
846 Ga0501225_0113375 3300049705 Bacteria 801
847 Ga0501079_0002313 3300049741 Bacteria 13801
848 Ga0501079_0003485 3300049741 Bacteria 11570
849 Ga0501079_0018502 3300049741 Bacteria 5323
850 Ga0501079_0024344 3300049741 Bacteria 4644
851 Ga0501079_0024745 3300049741 Bacteria 4607
852 Ga0501079_0027572 3300049741 Bacteria 4356
853 Ga0501079_0042445 3300049741 Bacteria 3512
854 Ga0501079_0179751 3300049741 Unclassified 1651
855 Ga0501079_0236580 3300049741 Bacteria 1427
856 Ga0501079_0307457 3300049741 Bacteria 1240
857 Ga0501079_0576108 3300049741 Bacteria 885
858 Ga0501079_0742448 3300049741 Bacteria 773
859 Ga0501079_0944173 3300049741 Bacteria 679
860 Ga0501079_1075010 3300049741 Bacteria 634
861 Ga0501079_1280245 3300049741 Bacteria 577
862 Ga0501080_0001292 3300049742 Bacteria 20823
863 Ga0501080_0004589 3300049742 Bacteria 12311
864 Ga0501080_0009468 3300049742 Bacteria 8884
865 Ga0501080_0015557 3300049742 Bacteria 7015
866 Ga0501080_0188504 3300049742 Bacteria 1896
867 Ga0501080_0213418 3300049742 Bacteria 1768
868 Ga0501080_0262952 3300049742 Bacteria 1572
869 Ga0501080_0408345 3300049742 Bacteria 1221
870 Ga0501080_1262825 3300049742 Bacteria 633
871 Ga0501080_1832621 3300049742 Bacteria 509
872 Ga0501081_0000178 3300049743 Bacteria 30143
873 Ga0501081_0003569 3300049743 Bacteria 9945
874 Ga0501081_0006630 3300049743 Bacteria 7526
875 Ga0501081_0010894 3300049743 Bacteria 5943
876 Ga0501081_0011534 3300049743 Bacteria 5782
877 Ga0501081_0027421 3300049743 Bacteria 3842
878 Ga0501081_0050391 3300049743 Bacteria 2868
879 Ga0501081_0054743 3300049743 Bacteria 2756
880 Ga0501081_0068693 3300049743 Bacteria 2467
881 Ga0501081_0484907 3300049743 Unclassified 920
882 Ga0501081_0490885 3300049743 Bacteria 915
883 Ga0501081_0704976 3300049743 Unclassified 758
884 Ga0501081_1200789 3300049743 Bacteria 575
885 Ga0501083_0062822 3300049744 Bacteria 2477
886 Ga0501083_0110053 3300049744 Bacteria 1811
887 Ga0501083_0173779 3300049744 Bacteria 1408
888 Ga0501083_0308597 3300049744 Bacteria 1029
889 Ga0501083_0605318 3300049744 Bacteria 713
890 Ga0501083_0997187 3300049744 Bacteria 545
891 Ga0501035_0007096 3300049822 Bacteria 10477
892 Ga0501035_0106576 3300049822 Bacteria 2457
893 Ga0501035_0388526 3300049822 Bacteria 1163
894 Ga0501035_0428607 3300049822 Bacteria 1097
895 Ga0501035_0431286 3300049822 Bacteria 1093
896 Ga0501035_0677495 3300049822 Bacteria 834
897 Ga0501035_0783113 3300049822 Bacteria 763
898 Ga0501044_0016386 3300049823 Bacteria 7958
899 Ga0501044_0040147 3300049823 Bacteria 4879
900 Ga0501044_0364336 3300049823 Bacteria 1363
901 Ga0501044_0553098 3300049823 Bacteria 1048
902 Ga0501044_0588216 3300049823 Bacteria 1007
903 Ga0501045_0001690 3300049824 Bacteria 14859
904 Ga0501045_0003702 3300049824 Bacteria 10515
905 Ga0501045_0004890 3300049824 Bacteria 9278
906 Ga0501045_0006370 3300049824 Bacteria 8169
907 Ga0501045_0007530 3300049824 Bacteria 7566
908 Ga0501045_0008943 3300049824 Bacteria 6995
909 Ga0501045_0022706 3300049824 Bacteria 4493
910 Ga0501045_0037680 3300049824 Bacteria 3516
911 Ga0501045_0058139 3300049824 Bacteria 2831
912 Ga0501045_0094213 3300049824 Bacteria 2215
913 Ga0501045_0263714 3300049824 Bacteria 1282
914 Ga0501045_0496898 3300049824 Unclassified 906
915 Ga0501045_0504035 3300049824 Bacteria 899
916 Ga0501045_0654527 3300049824 Bacteria 776
917 Ga0501045_0826465 3300049824 Bacteria 682
918 Ga0501204_035123 3300049850 Bacteria 712
919 nmdc:mga03683_121393_c1 3300050489 Bacteria 1162
920 nmdc:mga03683_55340_c1 3300050489 Bacteria 1666
921 nmdc:mga03n38_193044_c1 3300050490 Bacteria 1050
922 nmdc:mga03n38_33169_c1 3300050490 Bacteria 2194
923 nmdc:mga03n38_36953_c1 3300050490 Bacteria 2103
924 nmdc:mga00v17_109390_c1 3300050491 Bacteria 1752
925 nmdc:mga00v17_484830_c1 3300050491 Bacteria 802
926 nmdc:mga00v17_604429_c1 3300050491 Bacteria 707
927 nmdc:mga0yw44_1049155_c1 3300050492 Bacteria 551
928 nmdc:mga0yw44_119578_c1 3300050492 Bacteria 1696
929 nmdc:mga0yw44_165030_c1 3300050492 Bacteria 1452
930 nmdc:mga0yw44_365528_c1 3300050492 Bacteria 973
931 nmdc:mga0yw44_48412_c1 3300050492 Bacteria 2563
932 nmdc:mga06z11_129152_c1 3300050494 Bacteria 1417
933 nmdc:mga04h51_25951_c1 3300050495 Bacteria 1808
934 nmdc:mga07m45_598146_c1 3300050496 Bacteria 637
935 nmdc:mga05p37_1254526_c1 3300050507 Bacteria 760
936 nmdc:mga05p37_305953_c1 3300050507 Bacteria 1886
937 nmdc:mga05p37_31750_c1 3300050507 Bacteria 6455
938 nmdc:mga05p37_619657_c1 3300050507 Bacteria 1218
939 nmdc:mga05p37_68259_c1 3300050507 Bacteria 4372
940 nmdc:mga09592_1434329_c1 3300050508 Bacteria 564
941 nmdc:mga09592_187433_c1 3300050508 Bacteria 1790
942 nmdc:mga09592_297379_c1 3300050508 Bacteria 1400
943 nmdc:mga09592_356043_c1 3300050508 Bacteria 1267
944 nmdc:mga09592_492952_c1 3300050508 Bacteria 1055
945 nmdc:mga0qj67_128852_c1 3300050509 Bacteria 2048
946 nmdc:mga0qj67_252862_c1 3300050509 Bacteria 1430
947 nmdc:mga0qj67_315888_c1 3300050509 Bacteria 1265
948 nmdc:mga0qj67_374042_c1 3300050509 Bacteria 1151
949 nmdc:mga0qj67_648315_c1 3300050509 Bacteria 843
950 nmdc:mga0qj67_844300_c1 3300050509 Bacteria 724
951 nmdc:mga0qj67_917407_c1 3300050509 Bacteria 690
952 nmdc:mga06r32_219428_c1 3300050510 Bacteria 1890
953 nmdc:mga06r32_272114_c1 3300050510 Bacteria 1681
954 nmdc:mga06r32_33363_c1 3300050510 Bacteria 4849
955 nmdc:mga06r32_52497_c1 3300050510 Bacteria 3905
956 nmdc:mga06r32_89875_c1 3300050510 Bacteria 3000
957 nmdc:mga08y16_389974_c1 3300050511 Bacteria 1427
958 nmdc:mga08y16_581575_c1 3300050511 Bacteria 1130
959 nmdc:mga08y16_74620_c1 3300050511 Bacteria 3535
960 nmdc:mga0n895_222292_c1 3300050512 Bacteria 1917
961 nmdc:mga0rr50_346351_c1 3300050513 Bacteria 1249
962 nmdc:mga0rr50_892356_c1 3300050513 Bacteria 758
963 nmdc:mga0rr50_948481_c1 3300050513 Bacteria 733
964 nmdc:mga08x19_12713_c1 3300050514 Bacteria 5077
965 nmdc:mga08x19_683542_c1 3300050514 Bacteria 728
966 nmdc:mga08x19_800794_c1 3300050514 Bacteria 669
967 nmdc:mga0a205_704560_c1 3300050515 Bacteria 859
968 Ga0495601_0208155 3300053077 Bacteria 1278
969 Ga0495601_0615291 3300053077 Bacteria 696
970 Ga0495612_0134373 3300053078 Bacteria 1070
971 Ga0495612_0246829 3300053078 Bacteria 794
972 Ga0495612_0374825 3300053078 Bacteria 644
973 Ga0500635_0110502 3300053080 Bacteria 1020
974 Ga0500635_0427445 3300053080 Bacteria 525
975 Ga0495595_0039362 3300053084 Bacteria 2156
976 Ga0495595_0157766 3300053084 Bacteria 1118
977 Ga0495595_0177581 3300053084 Bacteria 1055
978 Ga0495595_0202593 3300053084 Bacteria 988
979 Ga0495619_0007373 3300053085 Bacteria 6967
980 Ga0495619_0022185 3300053085 Bacteria 4060
981 Ga0495619_0085163 3300053085 Bacteria 2134
982 Ga0495619_0148138 3300053085 Bacteria 1619
983 Ga0495619_0472678 3300053085 Bacteria 863
984 Ga0495619_0548370 3300053085 Bacteria 793
985 Ga0495619_0957582 3300053085 Bacteria 574
986 Ga0495619_1024400 3300053085 Bacteria 551
987 Ga0500646_0115826 3300053090 Bacteria 857
988 Ga0500566_0000443 3300053094 Bacteria 23094
989 Ga0500655_045931 3300053133 Bacteria 863
990 Ga0500616_0002763 3300053153 Bacteria 14173
991 Ga0501084_0000009 3300054114 Bacteria 194961
992 Ga0501084_0003222 3300054114 Bacteria 13216
993 Ga0501084_0007626 3300054114 Bacteria 8922
994 Ga0501084_0012792 3300054114 Bacteria 6952
995 Ga0501084_0017700 3300054114 Bacteria 5928
996 Ga0501084_0019565 3300054114 Bacteria 5641
997 Ga0501084_0034137 3300054114 Bacteria 4253
998 Ga0501084_0034773 3300054114 Bacteria 4213
999 Ga0501084_0055533 3300054114 Bacteria 3313
1000 Ga0501084_0184707 3300054114 Bacteria 1760
1001 Ga0501084_0215464 3300054114 Bacteria 1620
1002 Ga0501084_0299055 3300054114 Bacteria 1359
1003 Ga0501084_1281420 3300054114 Bacteria 614
1004 Ga0501084_1287531 3300054114 Unclassified 613
1005 Ga0590071_111381 3300059421 Bacteria 695
1006 Ga0590075_016083 3300059424 Bacteria 1839
1007 Ga0590077_046504 3300059426 Bacteria 971
1008 Ga0587084_063996 3300059477 Unclassified 680
1009 Ga0587084_072720 3300059477 Bacteria 652
1010 Ga0587066_032358 3300059490 Bacteria 940
1011 Ga0587073_0124465 3300059492 Bacteria 700
1012 Ga0587125_070311 3300059607 Bacteria 527
1013 Ga0587113_027502 3300059625 Bacteria 630
1014 Ga0587117_094234 3300059627 Bacteria 563
1015 Ga0587128_091992 3300059630 Bacteria 623
1016 Ga0587128_139972 3300059630 Unclassified 543
1017 Ga0587128_141435 3300059630 Bacteria 541
1018 Ga0587075_049985 3300059644 Bacteria 727
1019 Ga0587079_115479 3300059647 Bacteria 658
1020 Ga0587079_144066 3300059647 Unclassified 610
1021 Ga0587100_034130 3300059648 Bacteria 551
1022 Ga0587107_080079 3300059652 Bacteria 612
1023 Ga0587071_059809 3300060344 Bacteria 807
1024 Ga0501082_0001635 3300060353 Bacteria 19758
1025 Ga0501082_0005603 3300060353 Bacteria 10898
1026 Ga0501082_0008693 3300060353 Bacteria 8758
1027 Ga0501082_0010236 3300060353 Bacteria 8074
1028 Ga0501082_0018771 3300060353 Bacteria 5958
1029 Ga0501082_0021667 3300060353 Bacteria 5540
1030 Ga0501082_0081583 3300060353 Bacteria 2790
1031 Ga0501082_0179068 3300060353 Bacteria 1843
1032 Ga0501082_0276496 3300060353 Bacteria 1462
1033 Ga0501082_0441048 3300060353 Bacteria 1137
1034 Ga0501082_0451447 3300060353 Bacteria 1123
1035 Ga0501082_0663618 3300060353 Bacteria 913
1036 Ga0501082_0706473 3300060353 Bacteria 882
1037 Ga0501082_1164115 3300060353 Bacteria 674
1038 Ga0466962_0105642 3300061719 Bacteria 1354
1039 Ga0530510_0000984 3300061734 Bacteria 18861
1040 Ga0530510_0001714 3300061734 Bacteria 14898
1041 Ga0530510_0001976 3300061734 Bacteria 14048
1042 Ga0530510_0003814 3300061734 Bacteria 10389
1043 Ga0530510_0003983 3300061734 Bacteria 10192
1044 Ga0530510_0005385 3300061734 Bacteria 8856
1045 Ga0530510_0009528 3300061734 Bacteria 6810
1046 Ga0530510_0011077 3300061734 Bacteria 6326
1047 Ga0530510_0020233 3300061734 Bacteria 4732
1048 Ga0530510_0031036 3300061734 Bacteria 3841
1049 Ga0530510_0031408 3300061734 Bacteria 3819
1050 Ga0530510_0200878 3300061734 Bacteria 1480
1051 Ga0530510_0268463 3300061734 Bacteria 1273
1052 Ga0530510_0314895 3300061734 Bacteria 1172
1053 Ga0530510_0339940 3300061734 Bacteria 1127
1054 Ga0530510_0644595 3300061734 Bacteria 806
1055 Ga0530510_0786449 3300061734 Bacteria 726
1056 Ga0530510_0800685 3300061734 Unclassified 719
1057 Ga0530510_1518702 3300061734 Bacteria 514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0314895 Ga0530510_0314895_768_1160 88
2 3300039062 Ga0400483_006374 Ga0400483_006374_4907_5266 92
3 3300049591 Ga0501075_0660795 Ga0501075_0660795_105_554 93
4 3300035207 Ga0373942_0256721 Ga0373942_0256721_88_501 94
5 3300049850 Ga0501204_035123 Ga0501204_035123_134_520 95
6 3300005547 Ga0070693_100824062 Ga0070693_1008240621 96
7 3300005615 Ga0070702_100925012 Ga0070702_1009250121 96
8 3300009993 Ga0105028_102783 Ga0105028_1027832 96
9 3300050490 nmdc:mga03n38_193044_c1 nmdc:mga03n38_193044_c1_124_513 96
10 3300050495 nmdc:mga04h51_25951_c1 nmdc:mga04h51_25951_c1_432_821 96
11 3300009993 Ga0105028_101416 Ga0105028_1014163 97
12 3300011119 Ga0105246_10992831 Ga0105246_109928311 97
13 3300006048 Ga0075363_100321995 Ga0075363_1003219952 98
14 3300009147 Ga0114129_10290496 Ga0114129_102904962 98
15 3300014326 Ga0157380_11539729 Ga0157380_115397291 98
16 3300049586 Ga0501070_0002318 Ga0501070_0002318_4710_5126 98
17 3300049589 Ga0501073_0003892 Ga0501073_0003892_6114_6530 98
18 3300049705 Ga0501225_0113375 Ga0501225_0113375_137_523 98
19 3300049741 Ga0501079_0018502 Ga0501079_0018502_4622_5038 98
20 3300049742 Ga0501080_0015557 Ga0501080_0015557_6242_6658 98
21 3300049744 Ga0501083_0062822 Ga0501083_0062822_2026_2442 98
22 3300054114 Ga0501084_0007626 Ga0501084_0007626_362_778 98
23 3300005355 Ga0070671_100610725 Ga0070671_1006107252 99
24 3300049577 Ga0501041_0244085 Ga0501041_0244085_331_780 99
25 3300049587 Ga0501071_0620315 Ga0501071_0620315_144_593 99
26 3300049741 Ga0501079_0179751 Ga0501079_0179751_1040_1489 99
27 3300049568 Ga0501031_0012023 Ga0501031_0012023_1592_2041 100
28 3300049572 Ga0501036_0011148 Ga0501036_0011148_5847_6296 100
29 3300049573 Ga0501037_0120931 Ga0501037_0120931_1118_1567 100
30 3300049574 Ga0501038_0011836 Ga0501038_0011836_7359_7808 100
31 3300049575 Ga0501039_0007919 Ga0501039_0007919_81_530 100
32 3300049576 Ga0501040_0029703 Ga0501040_0029703_1373_1822 100
33 3300049578 Ga0501042_0006408 Ga0501042_0006408_7051_7500 100
34 3300049580 Ga0501046_0029128 Ga0501046_0029128_756_1205 100
35 3300049582 Ga0501048_0034719 Ga0501048_0034719_1589_2038 100
36 3300049587 Ga0501071_0021976 Ga0501071_0021976_3151_3600 100
37 3300049588 Ga0501072_0003761 Ga0501072_0003761_7197_7646 100
38 3300049590 Ga0501074_0048376 Ga0501074_0048376_2518_2967 100
39 3300049591 Ga0501075_0000765 Ga0501075_0000765_17353_17802 100
40 3300049592 Ga0501076_0020135 Ga0501076_0020135_1142_1591 100
41 3300049593 Ga0501077_0007289 Ga0501077_0007289_4293_4742 100
42 3300049741 Ga0501079_0002313 Ga0501079_0002313_12635_13084 100
43 3300049742 Ga0501080_1262825 Ga0501080_1262825_104_553 100
44 3300049743 Ga0501081_0003569 Ga0501081_0003569_9080_9529 100
45 3300049822 Ga0501035_0431286 Ga0501035_0431286_69_518 100
46 3300049824 Ga0501045_0008943 Ga0501045_0008943_2587_3036 100
47 3300053080 Ga0500635_0110502 Ga0500635_0110502_481_870 100
48 3300053090 Ga0500646_0115826 Ga0500646_0115826_209_598 100
49 3300054114 Ga0501084_0003222 Ga0501084_0003222_9896_10345 100
50 3300060353 Ga0501082_0005603 Ga0501082_0005603_1589_2038 100
51 3300061734 Ga0530510_0031036 Ga0530510_0031036_338_787 100
52 3300009177 Ga0105248_10853642 Ga0105248_108536421 101
53 3300014969 Ga0157376_11753242 Ga0157376_117532421 101
54 3300046461 Ga0495641_0310819 Ga0495641_0310819_136_525 102
55 3300048908 Ga0496105_0819588 Ga0496105_0819588_299_688 102
56 3300049823 Ga0501044_0553098 Ga0501044_0553098_644_1033 102
57 3300050489 nmdc:mga03683_55340_c1 nmdc:mga03683_55340_c1_793_1182 102
58 3300050492 nmdc:mga0yw44_1049155_c1 nmdc:mga0yw44_1049155_c1_17_406 102
59 3300005467 Ga0070706_100144692 Ga0070706_1001446924 103
60 3300005536 Ga0070697_100209557 Ga0070697_1002095572 103
61 3300005543 Ga0070672_101347882 Ga0070672_1013478821 103
62 3300005834 Ga0068851_10626331 Ga0068851_106263311 103
63 3300006038 Ga0075365_10178842 Ga0075365_101788422 103
64 3300006042 Ga0075368_10064509 Ga0075368_100645094 103
65 3300009176 Ga0105242_11310039 Ga0105242_113100392 103
66 3300013308 Ga0157375_11578069 Ga0157375_115780692 103
67 3300025910 Ga0207684_10727025 Ga0207684_107270252 103
68 3300005329 Ga0070683_101208140 Ga0070683_1012081402 104
69 3300005339 Ga0070660_100283627 Ga0070660_1002836273 104
70 3300005367 Ga0070667_100578598 Ga0070667_1005785981 104
71 3300005436 Ga0070713_101109849 Ga0070713_1011098491 104
72 3300005457 Ga0070662_101075910 Ga0070662_1010759102 104
73 3300005548 Ga0070665_100056101 Ga0070665_1000561012 104
74 3300005617 Ga0068859_101769379 Ga0068859_1017693792 104
75 3300005937 Ga0081455_10059279 Ga0081455_100592793 104
76 3300006931 Ga0097620_101769393 Ga0097620_1017693932 104
77 3300009176 Ga0105242_11485317 Ga0105242_114853172 104
78 3300013105 Ga0157369_10507310 Ga0157369_105073101 104
79 3300013297 Ga0157378_12082987 Ga0157378_120829872 104
80 3300014326 Ga0157380_11546930 Ga0157380_115469302 104
81 3300014969 Ga0157376_12053117 Ga0157376_120531171 104
82 3300020078 Ga0206352_11285469 Ga0206352_112854692 104
83 3300025908 Ga0207643_10631655 Ga0207643_106316552 104
84 3300025919 Ga0207657_10220837 Ga0207657_102208371 104
85 3300025929 Ga0207664_10958078 Ga0207664_109580781 104
86 3300025939 Ga0207665_10078645 Ga0207665_100786453 104
87 3300028381 Ga0268264_11054016 Ga0268264_110540162 104
88 3300032126 Ga0307415_100793002 Ga0307415_1007930022 104
89 3300035084 Ga0373928_0280948 Ga0373928_0280948_55_468 104
90 3300037418 Ga0395900_1836060 Ga0395900_1836060_73_486 104
91 3300039450 Ga0436363_1269616 Ga0436363_1269616_147_560 104
92 3300046616 Ga0495668_0584640 Ga0495668_0584640_21_434 104
93 3300048904 Ga0496101_0834134 Ga0496101_0834134_253_666 104
94 3300048912 Ga0496109_0626399 Ga0496109_0626399_558_971 104
95 3300048912 Ga0496109_1423156 Ga0496109_1423156_25_438 104
96 3300048914 Ga0496111_0086327 Ga0496111_0086327_1802_2215 104
97 3300048915 Ga0496112_0059723 Ga0496112_0059723_3176_3589 104
98 3300048916 Ga0496113_0749628 Ga0496113_0749628_24_437 104
99 3300049572 Ga0501036_0026040 Ga0501036_0026040_290_739 104
100 3300049573 Ga0501037_0536842 Ga0501037_0536842_235_684 104
101 3300049575 Ga0501039_0245352 Ga0501039_0245352_839_1288 104
102 3300049576 Ga0501040_0059568 Ga0501040_0059568_1223_1672 104
103 3300049576 Ga0501040_0274613 Ga0501040_0274613_507_956 104
104 3300049577 Ga0501041_0090992 Ga0501041_0090992_1274_1723 104
105 3300049578 Ga0501042_0291670 Ga0501042_0291670_131_580 104
106 3300049579 Ga0501043_1132799 Ga0501043_1132799_127_540 104
107 3300049584 Ga0501068_0394163 Ga0501068_0394163_339_788 104
108 3300049586 Ga0501070_0054265 Ga0501070_0054265_942_1355 104
109 3300049586 Ga0501070_0683202 Ga0501070_0683202_151_600 104
110 3300049587 Ga0501071_0014181 Ga0501071_0014181_305_754 104
111 3300049588 Ga0501072_1098263 Ga0501072_1098263_95_544 104
112 3300049591 Ga0501075_0607970 Ga0501075_0607970_356_805 104
113 3300049592 Ga0501076_0010913 Ga0501076_0010913_4216_4665 104
114 3300049593 Ga0501077_0068525 Ga0501077_0068525_171_620 104
115 3300049593 Ga0501077_0135043 Ga0501077_0135043_370_819 104
116 3300049741 Ga0501079_0944173 Ga0501079_0944173_32_481 104
117 3300049742 Ga0501080_0408345 Ga0501080_0408345_162_611 104
118 3300049743 Ga0501081_0050391 Ga0501081_0050391_1803_2252 104
119 3300049824 Ga0501045_0004890 Ga0501045_0004890_4174_4623 104
120 3300060353 Ga0501082_0021667 Ga0501082_0021667_4643_5092 104
121 3300061734 Ga0530510_0003814 Ga0530510_0003814_3383_3832 104
122 3300005842 Ga0068858_101321825 Ga0068858_1013218252 105
123 3300006042 Ga0075368_10005827 Ga0075368_100058273 105
124 3300006048 Ga0075363_100146624 Ga0075363_1001466242 105
125 3300006173 Ga0070716_100511822 Ga0070716_1005118221 105
126 3300006173 Ga0070716_100988566 Ga0070716_1009885662 105
127 3300006852 Ga0075433_10823643 Ga0075433_108236432 105
128 3300007076 Ga0075435_101706767 Ga0075435_1017067672 105
129 3300009098 Ga0105245_10996494 Ga0105245_109964942 105
130 3300009148 Ga0105243_11158237 Ga0105243_111582371 105
131 3300009176 Ga0105242_10141940 Ga0105242_101419403 105
132 3300009553 Ga0105249_10559792 Ga0105249_105597922 105
133 3300009987 Ga0105030_112130 Ga0105030_1121302 105
134 3300011119 Ga0105246_10238616 Ga0105246_102386162 105
135 3300014325 Ga0163163_11152365 Ga0163163_111523652 105
136 3300021384 Ga0213876_10293538 Ga0213876_102935382 105
137 3300025961 Ga0207712_10672225 Ga0207712_106722251 105
138 3300026041 Ga0207639_12188891 Ga0207639_121888911 105
139 3300026067 Ga0207678_10117462 Ga0207678_101174622 105
140 3300027866 Ga0209813_10015006 Ga0209813_100150063 105
141 3300028800 Ga0265338_10000404 Ga0265338_1000040451 105
142 3300031235 Ga0265330_10192244 Ga0265330_101922442 105
143 3300031239 Ga0265328_10271932 Ga0265328_102719322 105
144 3300031241 Ga0265325_10002389 Ga0265325_1000238910 105
145 3300031249 Ga0265339_10036862 Ga0265339_100368623 105
146 3300031250 Ga0265331_10052636 Ga0265331_100526361 105
147 3300031344 Ga0265316_10596465 Ga0265316_105964652 105
148 3300031595 Ga0265313_10000776 Ga0265313_1000077616 105
149 3300031711 Ga0265314_10092562 Ga0265314_100925622 105
150 3300031711 Ga0265314_10406592 Ga0265314_104065922 105
151 3300031712 Ga0265342_10156185 Ga0265342_101561851 105
152 3300039437 Ga0436365_0047787 Ga0436365_0047787_78_491 105
153 3300039437 Ga0436365_0921705 Ga0436365_0921705_116_529 105
154 3300039437 Ga0436365_1069374 Ga0436365_1069374_213_626 105
155 3300041459 Ga0451800_1088893 Ga0451800_1088893_83_499 105
156 3300046514 Ga0495618_0450888 Ga0495618_0450888_111_524 105
157 3300047315 Ga0495581_0627086 Ga0495581_0627086_163_576 105
158 3300047321 Ga0495676_0030448 Ga0495676_0030448_1907_2320 105
159 3300048911 Ga0496108_1604955 Ga0496108_1604955_33_446 105
160 3300048912 Ga0496109_0336309 Ga0496109_0336309_176_589 105
161 3300048913 Ga0496110_0130293 Ga0496110_0130293_1746_2159 105
162 3300048915 Ga0496112_0855883 Ga0496112_0855883_105_518 105
163 3300048916 Ga0496113_0320168 Ga0496113_0320168_542_955 105
164 3300048918 Ga0496115_0538106 Ga0496115_0538106_127_540 105
165 3300049569 Ga0501032_0686972 Ga0501032_0686972_150_563 105
166 3300050507 nmdc:mga05p37_1254526_c1 nmdc:mga05p37_1254526_c1_301_714 105
167 3300050511 nmdc:mga08y16_581575_c1 nmdc:mga08y16_581575_c1_659_1072 105
168 3300050513 nmdc:mga0rr50_948481_c1 nmdc:mga0rr50_948481_c1_241_654 105
169 3300054114 Ga0501084_0299055 Ga0501084_0299055_356_820 105
170 3300005331 Ga0070670_100234340 Ga0070670_1002343402 106
171 3300005347 Ga0070668_100374403 Ga0070668_1003744031 106
172 3300005367 Ga0070667_100133103 Ga0070667_1001331033 106
173 3300005547 Ga0070693_100194188 Ga0070693_1001941882 106
174 3300005719 Ga0068861_101688587 Ga0068861_1016885871 106
175 3300005840 Ga0068870_10416892 Ga0068870_104168922 106
176 3300005841 Ga0068863_100049247 Ga0068863_1000492474 106
177 3300005843 Ga0068860_100489451 Ga0068860_1004894512 106
178 3300006051 Ga0075364_10128715 Ga0075364_101287153 106
179 3300006058 Ga0075432_10343577 Ga0075432_103435771 106
180 3300006177 Ga0075362_10059418 Ga0075362_100594182 106
181 3300006852 Ga0075433_11254868 Ga0075433_112548682 106
182 3300006871 Ga0075434_100208023 Ga0075434_1002080232 106
183 3300013306 Ga0163162_10572152 Ga0163162_105721522 106
184 3300025907 Ga0207645_10530096 Ga0207645_105300962 106
185 3300025925 Ga0207650_10416118 Ga0207650_104161182 106
186 3300025986 Ga0207658_10619726 Ga0207658_106197261 106
187 3300026088 Ga0207641_10149980 Ga0207641_101499802 106
188 3300026095 Ga0207676_10124872 Ga0207676_101248723 106
189 3300026118 Ga0207675_100100627 Ga0207675_1001006274 106
190 3300027876 Ga0209974_10395855 Ga0209974_103958551 106
191 3300028380 Ga0268265_10932380 Ga0268265_109323802 106
192 3300028381 Ga0268264_10582892 Ga0268264_105828922 106
193 3300028556 Ga0265337_1106810 Ga0265337_11068102 106
194 3300031665 Ga0316575_10243186 Ga0316575_102431861 106
195 3300031727 Ga0316576_10165266 Ga0316576_101652662 106
196 3300031731 Ga0307405_11668919 Ga0307405_116689191 106
197 3300031852 Ga0307410_10503308 Ga0307410_105033082 106
198 3300032002 Ga0307416_101067272 Ga0307416_1010672722 106
199 3300036401 Ga0373937_0567628 Ga0373937_0567628_438_854 106
200 3300039450 Ga0436363_1371372 Ga0436363_1371372_125_541 106
201 3300041486 Ga0451807_2190932 Ga0451807_2190932_249_662 106
202 3300042436 Ga0439435_0305059 Ga0439435_0305059_51_500 106
203 3300046500 Ga0495596_0215373 Ga0495596_0215373_142_555 106
204 3300046525 Ga0495663_0042989 Ga0495663_0042989_331_744 106
205 3300047673 Ga0495593_0493308 Ga0495593_0493308_125_541 106
206 3300049568 Ga0501031_0001203 Ga0501031_0001203_7712_8161 106
207 3300049568 Ga0501031_0159369 Ga0501031_0159369_734_1183 106
208 3300049569 Ga0501032_0094265 Ga0501032_0094265_263_712 106
209 3300049570 Ga0501033_0111858 Ga0501033_0111858_1036_1485 106
210 3300049572 Ga0501036_0003005 Ga0501036_0003005_7814_8263 106
211 3300049572 Ga0501036_0561392 Ga0501036_0561392_282_695 106
212 3300049573 Ga0501037_0014066 Ga0501037_0014066_263_712 106
213 3300049574 Ga0501038_0070861 Ga0501038_0070861_1238_1687 106
214 3300049574 Ga0501038_0603558 Ga0501038_0603558_110_523 106
215 3300049575 Ga0501039_0010232 Ga0501039_0010232_1353_1802 106
216 3300049575 Ga0501039_0122257 Ga0501039_0122257_198_644 106
217 3300049576 Ga0501040_0007501 Ga0501040_0007501_5129_5578 106
218 3300049576 Ga0501040_0072846 Ga0501040_0072846_393_842 106
219 3300049577 Ga0501041_0000759 Ga0501041_0000759_6026_6475 106
220 3300049578 Ga0501042_0044901 Ga0501042_0044901_378_827 106
221 3300049578 Ga0501042_0094621 Ga0501042_0094621_531_980 106
222 3300049578 Ga0501042_0370007 Ga0501042_0370007_390_839 106
223 3300049579 Ga0501043_0007699 Ga0501043_0007699_3233_3682 106
224 3300049580 Ga0501046_0005560 Ga0501046_0005560_3086_3535 106
225 3300049582 Ga0501048_0017750 Ga0501048_0017750_3626_4075 106
226 3300049582 Ga0501048_0142628 Ga0501048_0142628_670_1116 106
227 3300049584 Ga0501068_0188878 Ga0501068_0188878_378_827 106
228 3300049584 Ga0501068_0281611 Ga0501068_0281611_460_909 106
229 3300049584 Ga0501068_0496223 Ga0501068_0496223_218_664 106
230 3300049585 Ga0501069_0057589 Ga0501069_0057589_1413_1862 106
231 3300049585 Ga0501069_0902066 Ga0501069_0902066_105_518 106
232 3300049586 Ga0501070_0280994 Ga0501070_0280994_768_1217 106
233 3300049587 Ga0501071_0000545 Ga0501071_0000545_18428_18877 106
234 3300049587 Ga0501071_0084865 Ga0501071_0084865_822_1271 106
235 3300049588 Ga0501072_0000940 Ga0501072_0000940_16020_16469 106
236 3300049588 Ga0501072_0047186 Ga0501072_0047186_1810_2256 106
237 3300049588 Ga0501072_0154071 Ga0501072_0154071_73_522 106
238 3300049589 Ga0501073_0082006 Ga0501073_0082006_270_719 106
239 3300049590 Ga0501074_0111622 Ga0501074_0111622_1356_1805 106
240 3300049590 Ga0501074_0899457 Ga0501074_0899457_89_535 106
241 3300049591 Ga0501075_0016972 Ga0501075_0016972_4479_4928 106
242 3300049591 Ga0501075_0066505 Ga0501075_0066505_268_717 106
243 3300049592 Ga0501076_0003130 Ga0501076_0003130_7832_8281 106
244 3300049592 Ga0501076_0166806 Ga0501076_0166806_1193_1642 106
245 3300049592 Ga0501076_0264849 Ga0501076_0264849_103_552 106
246 3300049592 Ga0501076_0715444 Ga0501076_0715444_147_593 106
247 3300049593 Ga0501077_0014703 Ga0501077_0014703_1340_1789 106
248 3300049593 Ga0501077_0149323 Ga0501077_0149323_490_939 106
249 3300049741 Ga0501079_0027572 Ga0501079_0027572_479_928 106
250 3300049742 Ga0501080_0004589 Ga0501080_0004589_9634_10083 106
251 3300049742 Ga0501080_0262952 Ga0501080_0262952_514_963 106
252 3300049743 Ga0501081_0027421 Ga0501081_0027421_1321_1770 106
253 3300049744 Ga0501083_0110053 Ga0501083_0110053_1087_1536 106
254 3300049822 Ga0501035_0007096 Ga0501035_0007096_3110_3559 106
255 3300049822 Ga0501035_0677495 Ga0501035_0677495_34_480 106
256 3300049823 Ga0501044_0588216 Ga0501044_0588216_253_702 106
257 3300049824 Ga0501045_0007530 Ga0501045_0007530_5480_5929 106
258 3300049824 Ga0501045_0058139 Ga0501045_0058139_2348_2797 106
259 3300049824 Ga0501045_0094213 Ga0501045_0094213_378_824 106
260 3300050489 nmdc:mga03683_121393_c1 nmdc:mga03683_121393_c1_377_790 106
261 3300050491 nmdc:mga00v17_109390_c1 nmdc:mga00v17_109390_c1_1043_1456 106
262 3300050492 nmdc:mga0yw44_165030_c1 nmdc:mga0yw44_165030_c1_620_1033 106
263 3300050512 nmdc:mga0n895_222292_c1 nmdc:mga0n895_222292_c1_634_1047 106
264 3300050513 nmdc:mga0rr50_892356_c1 nmdc:mga0rr50_892356_c1_240_653 106
265 3300050514 nmdc:mga08x19_800794_c1 nmdc:mga08x19_800794_c1_16_429 106
266 3300054114 Ga0501084_0017700 Ga0501084_0017700_5129_5578 106
267 3300054114 Ga0501084_0184707 Ga0501084_0184707_977_1426 106
268 3300059477 Ga0587084_063996 Ga0587084_063996_160_573 106
269 3300059630 Ga0587128_091992 Ga0587128_091992_174_587 106
270 3300060353 Ga0501082_0018771 Ga0501082_0018771_5159_5608 106
271 3300060353 Ga0501082_0179068 Ga0501082_0179068_915_1364 106
272 3300060353 Ga0501082_0276496 Ga0501082_0276496_435_881 106
273 3300061734 Ga0530510_0005385 Ga0530510_0005385_2808_3257 106
274 3300061734 Ga0530510_0011077 Ga0530510_0011077_1108_1557 106
275 3300061734 Ga0530510_0200878 Ga0530510_0200878_381_827 106
276 3300005355 Ga0070671_100000397 Ga0070671_10000039730 107
277 3300005356 Ga0070674_101036350 Ga0070674_1010363502 107
278 3300006051 Ga0075364_10287162 Ga0075364_102871622 107
279 3300006173 Ga0070716_100713316 Ga0070716_1007133162 107
280 3300009148 Ga0105243_11298584 Ga0105243_112985841 107
281 3300009177 Ga0105248_11644308 Ga0105248_116443082 107
282 3300014326 Ga0157380_11362156 Ga0157380_113621562 107
283 3300014326 Ga0157380_12579997 Ga0157380_125799972 107
284 3300014968 Ga0157379_11735212 Ga0157379_117352122 107
285 3300017792 Ga0163161_10690831 Ga0163161_106908312 107
286 3300025901 Ga0207688_10196196 Ga0207688_101961962 107
287 3300025929 Ga0207664_10911755 Ga0207664_109117552 107
288 3300025931 Ga0207644_10002764 Ga0207644_100027646 107
289 3300025931 Ga0207644_10625504 Ga0207644_106255042 107
290 3300025942 Ga0207689_10950670 Ga0207689_109506702 107
291 3300025961 Ga0207712_11558730 Ga0207712_115587301 107
292 3300026023 Ga0207677_11871196 Ga0207677_118711962 107
293 3300031901 Ga0307406_10258551 Ga0307406_102585512 107
294 3300031903 Ga0307407_10127235 Ga0307407_101272352 107
295 3300032002 Ga0307416_100069594 Ga0307416_1000695942 107
296 3300032004 Ga0307414_10040824 Ga0307414_100408244 107
297 3300032126 Ga0307415_100805671 Ga0307415_1008056712 107
298 3300032126 Ga0307415_101043610 Ga0307415_1010436102 107
299 3300036647 Ga0316582_0085568 Ga0316582_0085568_57_503 107
300 3300036712 Ga0316584_0241678 Ga0316584_0241678_510_959 107
301 3300038735 Ga0400485_07921 Ga0400485_07921_1080_1523 107
302 3300038742 Ga0400486_02192 Ga0400486_02192_1000_1443 107
303 3300039450 Ga0436363_0953663 Ga0436363_0953663_172_585 107
304 3300041463 Ga0451804_1080182 Ga0451804_1080182_76_492 107
305 3300042122 Ga0450920_010777 Ga0450920_010777_509_958 107
306 3300042157 Ga0439458_0168438 Ga0439458_0168438_39_455 107
307 3300042435 Ga0439434_0126408 Ga0439434_0126408_11_460 107
308 3300042531 Ga0450918_012076 Ga0450918_012076_204_653 107
309 3300046511 Ga0495608_0338831 Ga0495608_0338831_399_812 107
310 3300046794 Ga0495589_0084697 Ga0495589_0084697_851_1264 107
311 3300047323 Ga0495683_0452195 Ga0495683_0452195_31_444 107
312 3300048089 Ga0495614_0309896 Ga0495614_0309896_23_436 107
313 3300049568 Ga0501031_0008975 Ga0501031_0008975_565_1014 107
314 3300049568 Ga0501031_0057837 Ga0501031_0057837_1786_2235 107
315 3300049568 Ga0501031_0170134 Ga0501031_0170134_226_675 107
316 3300049568 Ga0501031_0406661 Ga0501031_0406661_317_766 107
317 3300049568 Ga0501031_0854621 Ga0501031_0854621_72_521 107
318 3300049570 Ga0501033_0004468 Ga0501033_0004468_2183_2632 107
319 3300049570 Ga0501033_0218832 Ga0501033_0218832_843_1292 107
320 3300049571 Ga0501034_0290609 Ga0501034_0290609_46_495 107
321 3300049572 Ga0501036_0013366 Ga0501036_0013366_4176_4625 107
322 3300049572 Ga0501036_0017186 Ga0501036_0017186_628_1077 107
323 3300049572 Ga0501036_0022688 Ga0501036_0022688_314_763 107
324 3300049572 Ga0501036_0239222 Ga0501036_0239222_784_1233 107
325 3300049573 Ga0501037_0014202 Ga0501037_0014202_2137_2586 107
326 3300049573 Ga0501037_1106280 Ga0501037_1106280_45_494 107
327 3300049574 Ga0501038_0025889 Ga0501038_0025889_3259_3708 107
328 3300049575 Ga0501039_0011747 Ga0501039_0011747_1833_2282 107
329 3300049575 Ga0501039_0171381 Ga0501039_0171381_909_1358 107
330 3300049575 Ga0501039_0184410 Ga0501039_0184410_767_1216 107
331 3300049575 Ga0501039_0214615 Ga0501039_0214615_935_1384 107
332 3300049576 Ga0501040_0024646 Ga0501040_0024646_1216_1665 107
333 3300049576 Ga0501040_0025298 Ga0501040_0025298_19_468 107
334 3300049576 Ga0501040_0052223 Ga0501040_0052223_780_1229 107
335 3300049576 Ga0501040_0265090 Ga0501040_0265090_539_988 107
336 3300049576 Ga0501040_0348809 Ga0501040_0348809_417_866 107
337 3300049576 Ga0501040_0430537 Ga0501040_0430537_451_900 107
338 3300049576 Ga0501040_0518383 Ga0501040_0518383_255_704 107
339 3300049577 Ga0501041_0000812 Ga0501041_0000812_6254_6703 107
340 3300049577 Ga0501041_0006962 Ga0501041_0006962_5611_6060 107
341 3300049577 Ga0501041_0026988 Ga0501041_0026988_624_1073 107
342 3300049577 Ga0501041_0035281 Ga0501041_0035281_2175_2624 107
343 3300049577 Ga0501041_0405228 Ga0501041_0405228_231_680 107
344 3300049577 Ga0501041_0503439 Ga0501041_0503439_263_712 107
345 3300049578 Ga0501042_0000504 Ga0501042_0000504_2186_2635 107
346 3300049578 Ga0501042_0001643 Ga0501042_0001643_4431_4880 107
347 3300049578 Ga0501042_0068497 Ga0501042_0068497_57_506 107
348 3300049578 Ga0501042_0327871 Ga0501042_0327871_635_1084 107
349 3300049578 Ga0501042_1006182 Ga0501042_1006182_35_484 107
350 3300049578 Ga0501042_1319602 Ga0501042_1319602_94_507 107
351 3300049579 Ga0501043_0271505 Ga0501043_0271505_91_540 107
352 3300049579 Ga0501043_0315188 Ga0501043_0315188_700_1149 107
353 3300049579 Ga0501043_1188617 Ga0501043_1188617_92_505 107
354 3300049580 Ga0501046_0004094 Ga0501046_0004094_8628_9077 107
355 3300049580 Ga0501046_0023951 Ga0501046_0023951_1060_1509 107
356 3300049582 Ga0501048_0019700 Ga0501048_0019700_4482_4931 107
357 3300049582 Ga0501048_0022677 Ga0501048_0022677_113_562 107
358 3300049582 Ga0501048_0385645 Ga0501048_0385645_85_534 107
359 3300049582 Ga0501048_0592175 Ga0501048_0592175_133_582 107
360 3300049584 Ga0501068_0020679 Ga0501068_0020679_3182_3631 107
361 3300049584 Ga0501068_0153425 Ga0501068_0153425_694_1143 107
362 3300049585 Ga0501069_0005350 Ga0501069_0005350_4831_5280 107
363 3300049585 Ga0501069_0191753 Ga0501069_0191753_591_1040 107
364 3300049586 Ga0501070_0052792 Ga0501070_0052792_829_1278 107
365 3300049586 Ga0501070_1003681 Ga0501070_1003681_52_501 107
366 3300049587 Ga0501071_0000787 Ga0501071_0000787_3422_3871 107
367 3300049587 Ga0501071_0001054 Ga0501071_0001054_3315_3764 107
368 3300049587 Ga0501071_0009639 Ga0501071_0009639_2947_3396 107
369 3300049587 Ga0501071_0015392 Ga0501071_0015392_212_661 107
370 3300049587 Ga0501071_0022614 Ga0501071_0022614_3449_3898 107
371 3300049587 Ga0501071_0616628 Ga0501071_0616628_71_520 107
372 3300049587 Ga0501071_0711013 Ga0501071_0711013_237_686 107
373 3300049588 Ga0501072_0003389 Ga0501072_0003389_8439_8888 107
374 3300049588 Ga0501072_0004312 Ga0501072_0004312_992_1441 107
375 3300049588 Ga0501072_0454268 Ga0501072_0454268_237_686 107
376 3300049588 Ga0501072_1024453 Ga0501072_1024453_61_510 107
377 3300049589 Ga0501073_0008573 Ga0501073_0008573_4220_4669 107
378 3300049590 Ga0501074_0000933 Ga0501074_0000933_7564_8013 107
379 3300049590 Ga0501074_0094709 Ga0501074_0094709_1150_1599 107
380 3300049590 Ga0501074_0130833 Ga0501074_0130833_182_631 107
381 3300049590 Ga0501074_0552390 Ga0501074_0552390_290_739 107
382 3300049591 Ga0501075_0004561 Ga0501075_0004561_954_1403 107
383 3300049591 Ga0501075_0006710 Ga0501075_0006710_4546_4995 107
384 3300049591 Ga0501075_0025233 Ga0501075_0025233_3248_3697 107
385 3300049591 Ga0501075_0108832 Ga0501075_0108832_737_1186 107
386 3300049591 Ga0501075_0306942 Ga0501075_0306942_360_809 107
387 3300049591 Ga0501075_0881628 Ga0501075_0881628_62_511 107
388 3300049592 Ga0501076_0001754 Ga0501076_0001754_9898_10347 107
389 3300049592 Ga0501076_0002077 Ga0501076_0002077_10653_11102 107
390 3300049592 Ga0501076_0044611 Ga0501076_0044611_1178_1627 107
391 3300049592 Ga0501076_0048861 Ga0501076_0048861_1261_1710 107
392 3300049592 Ga0501076_0454080 Ga0501076_0454080_217_666 107
393 3300049592 Ga0501076_0486181 Ga0501076_0486181_361_810 107
394 3300049593 Ga0501077_0001976 Ga0501077_0001976_6331_6780 107
395 3300049593 Ga0501077_0002417 Ga0501077_0002417_4047_4496 107
396 3300049593 Ga0501077_0251052 Ga0501077_0251052_13_462 107
397 3300049593 Ga0501077_0364784 Ga0501077_0364784_381_830 107
398 3300049741 Ga0501079_0024745 Ga0501079_0024745_3432_3881 107
399 3300049741 Ga0501079_0042445 Ga0501079_0042445_2953_3402 107
400 3300049741 Ga0501079_0307457 Ga0501079_0307457_140_589 107
401 3300049741 Ga0501079_0576108 Ga0501079_0576108_95_544 107
402 3300049741 Ga0501079_1075010 Ga0501079_1075010_14_427 107
403 3300049741 Ga0501079_1280245 Ga0501079_1280245_112_561 107
404 3300049742 Ga0501080_0001292 Ga0501080_0001292_18222_18671 107
405 3300049742 Ga0501080_0009468 Ga0501080_0009468_1409_1858 107
406 3300049742 Ga0501080_0188504 Ga0501080_0188504_903_1352 107
407 3300049743 Ga0501081_0000178 Ga0501081_0000178_18082_18531 107
408 3300049743 Ga0501081_0011534 Ga0501081_0011534_603_1052 107
409 3300049743 Ga0501081_0054743 Ga0501081_0054743_100_549 107
410 3300049743 Ga0501081_0068693 Ga0501081_0068693_125_574 107
411 3300049743 Ga0501081_0484907 Ga0501081_0484907_155_604 107
412 3300049743 Ga0501081_0490885 Ga0501081_0490885_34_483 107
413 3300049743 Ga0501081_0704976 Ga0501081_0704976_296_745 107
414 3300049744 Ga0501083_0173779 Ga0501083_0173779_479_928 107
415 3300049744 Ga0501083_0605318 Ga0501083_0605318_110_559 107
416 3300049822 Ga0501035_0106576 Ga0501035_0106576_679_1128 107
417 3300049822 Ga0501035_0388526 Ga0501035_0388526_163_612 107
418 3300049824 Ga0501045_0001690 Ga0501045_0001690_13349_13798 107
419 3300049824 Ga0501045_0003702 Ga0501045_0003702_4561_5010 107
420 3300049824 Ga0501045_0037680 Ga0501045_0037680_2780_3229 107
421 3300049824 Ga0501045_0263714 Ga0501045_0263714_819_1268 107
422 3300049824 Ga0501045_0504035 Ga0501045_0504035_387_836 107
423 3300050494 nmdc:mga06z11_129152_c1 nmdc:mga06z11_129152_c1_19_429 107
424 3300053078 Ga0495612_0246829 Ga0495612_0246829_198_611 107
425 3300054114 Ga0501084_0034137 Ga0501084_0034137_3075_3524 107
426 3300054114 Ga0501084_0034773 Ga0501084_0034773_3436_3885 107
427 3300054114 Ga0501084_0215464 Ga0501084_0215464_507_956 107
428 3300054114 Ga0501084_1287531 Ga0501084_1287531_54_503 107
429 3300060353 Ga0501082_0001635 Ga0501082_0001635_15702_16151 107
430 3300060353 Ga0501082_0010236 Ga0501082_0010236_2291_2740 107
431 3300060353 Ga0501082_0081583 Ga0501082_0081583_472_921 107
432 3300060353 Ga0501082_0441048 Ga0501082_0441048_307_756 107
433 3300060353 Ga0501082_0451447 Ga0501082_0451447_148_597 107
434 3300060353 Ga0501082_0706473 Ga0501082_0706473_412_861 107
435 3300061734 Ga0530510_0001976 Ga0530510_0001976_7991_8440 107
436 3300061734 Ga0530510_0020233 Ga0530510_0020233_438_887 107
437 3300061734 Ga0530510_0031408 Ga0530510_0031408_2773_3222 107
438 3300061734 Ga0530510_0268463 Ga0530510_0268463_779_1228 107
439 3300061734 Ga0530510_0644595 Ga0530510_0644595_326_775 107
440 3300061734 Ga0530510_0786449 Ga0530510_0786449_112_561 107
441 3300061734 Ga0530510_0800685 Ga0530510_0800685_216_665 107
442 3300005330 Ga0070690_100909737 Ga0070690_1009097372 108
443 3300005336 Ga0070680_101153123 Ga0070680_1011531232 108
444 3300005406 Ga0070703_10012438 Ga0070703_100124383 108
445 3300005440 Ga0070705_100048023 Ga0070705_1000480232 108
446 3300005444 Ga0070694_100733337 Ga0070694_1007333372 108
447 3300005445 Ga0070708_100002403 Ga0070708_10000240316 108
448 3300005445 Ga0070708_100877145 Ga0070708_1008771452 108
449 3300005456 Ga0070678_100738462 Ga0070678_1007384622 108
450 3300005458 Ga0070681_10011974 Ga0070681_100119742 108
451 3300005458 Ga0070681_10017995 Ga0070681_100179955 108
452 3300005467 Ga0070706_100086897 Ga0070706_1000868974 108
453 3300005471 Ga0070698_100814956 Ga0070698_1008149562 108
454 3300005546 Ga0070696_100280699 Ga0070696_1002806992 108
455 3300005614 Ga0068856_100702437 Ga0068856_1007024372 108
456 3300005718 Ga0068866_10358637 Ga0068866_103586372 108
457 3300006038 Ga0075365_10061270 Ga0075365_100612702 108
458 3300006852 Ga0075433_11011688 Ga0075433_110116881 108
459 3300006871 Ga0075434_100512893 Ga0075434_1005128932 108
460 3300009093 Ga0105240_11312613 Ga0105240_113126132 108
461 3300009101 Ga0105247_10983182 Ga0105247_109831821 108
462 3300011119 Ga0105246_10937704 Ga0105246_109377042 108
463 3300014326 Ga0157380_10541713 Ga0157380_105417132 108
464 3300014497 Ga0182008_10742053 Ga0182008_107420532 108
465 3300020070 Ga0206356_10392024 Ga0206356_103920242 108
466 3300020075 Ga0206349_1393095 Ga0206349_13930952 108
467 3300020080 Ga0206350_11397962 Ga0206350_113979622 108
468 3300022467 Ga0224712_10029818 Ga0224712_100298182 108
469 3300025885 Ga0207653_10088085 Ga0207653_100880852 108
470 3300025910 Ga0207684_10026536 Ga0207684_100265365 108
471 3300025912 Ga0207707_10003489 Ga0207707_1000348910 108
472 3300025912 Ga0207707_10026410 Ga0207707_100264106 108
473 3300025922 Ga0207646_11369174 Ga0207646_113691741 108
474 3300025949 Ga0207667_10610955 Ga0207667_106109552 108
475 3300026088 Ga0207641_10492193 Ga0207641_104921931 108
476 3300028800 Ga0265338_10607596 Ga0265338_106075962 108
477 3300031548 Ga0307408_100180627 Ga0307408_1001806273 108
478 3300031901 Ga0307406_10582699 Ga0307406_105826992 108
479 3300035083 Ga0373926_0333235 Ga0373926_0333235_41_454 108
480 3300035692 Ga0373935_0109742 Ga0373935_0109742_668_1081 108
481 3300035724 Ga0373933_0231936 Ga0373933_0231936_688_1101 108
482 3300035725 Ga0373947_0062015 Ga0373947_0062015_468_881 108
483 3300041405 Ga0439438_126189 Ga0439438_126189_64_477 108
484 3300041407 Ga0439447_084172 Ga0439447_084172_96_509 108
485 3300041408 Ga0439453_0036030 Ga0439453_0036030_474_887 108
486 3300042145 Ga0450906_047207 Ga0450906_047207_168_581 108
487 3300042184 Ga0450908_093698 Ga0450908_093698_123_536 108
488 3300044684 Ga0466966_0308943 Ga0466966_0308943_444_857 108
489 3300044684 Ga0466966_0362990 Ga0466966_0362990_379_792 108
490 3300044693 Ga0466961_0150203 Ga0466961_0150203_390_803 108
491 3300044694 Ga0466963_0271608 Ga0466963_0271608_580_993 108
492 3300045836 Ga0466958_0220396 Ga0466958_0220396_35_448 108
493 3300046455 Ga0495603_0483769 Ga0495603_0483769_193_606 108
494 3300046475 Ga0495639_0187872 Ga0495639_0187872_574_987 108
495 3300046533 Ga0495640_0200041 Ga0495640_0200041_393_806 108
496 3300046642 Ga0495634_0690592 Ga0495634_0690592_34_447 108
497 3300046663 Ga0495635_0158384 Ga0495635_0158384_620_1033 108
498 3300046690 Ga0495624_0655241 Ga0495624_0655241_187_600 108
499 3300047318 Ga0495636_0268267 Ga0495636_0268267_95_508 108
500 3300047471 Ga0495684_0166281 Ga0495684_0166281_1135_1548 108
501 3300049580 Ga0501046_0895073 Ga0501046_0895073_21_428 108
502 3300049587 Ga0501071_1225224 Ga0501071_1225224_75_488 108
503 3300049588 Ga0501072_0294452 Ga0501072_0294452_285_734 108
504 3300049588 Ga0501072_0595413 Ga0501072_0595413_402_815 108
505 3300049588 Ga0501072_1453231 Ga0501072_1453231_105_518 108
506 3300050492 nmdc:mga0yw44_365528_c1 nmdc:mga0yw44_365528_c1_541_954 108
507 3300050492 nmdc:mga0yw44_48412_c1 nmdc:mga0yw44_48412_c1_797_1213 108
508 3300050514 nmdc:mga08x19_683542_c1 nmdc:mga08x19_683542_c1_146_559 108
509 3300050515 nmdc:mga0a205_704560_c1 nmdc:mga0a205_704560_c1_87_500 108
510 3300053085 Ga0495619_0548370 Ga0495619_0548370_19_432 108
511 3300054114 Ga0501084_0055533 Ga0501084_0055533_430_879 108
512 3300059490 Ga0587066_032358 Ga0587066_032358_154_567 108
513 3300059492 Ga0587073_0124465 Ga0587073_0124465_210_623 108
514 3300059627 Ga0587117_094234 Ga0587117_094234_66_479 108
515 3300060344 Ga0587071_059809 Ga0587071_059809_49_462 108
516 3300061719 Ga0466962_0105642 Ga0466962_0105642_691_1104 108
517 3300061734 Ga0530510_1518702 Ga0530510_1518702_80_493 108
518 3300005455 Ga0070663_100795386 Ga0070663_1007953862 109
519 3300005614 Ga0068856_100510669 Ga0068856_1005106692 109
520 3300005618 Ga0068864_101036364 Ga0068864_1010363641 109
521 3300005843 Ga0068860_100732572 Ga0068860_1007325722 109
522 3300005985 Ga0081539_10088490 Ga0081539_100884902 109
523 3300006038 Ga0075365_10083302 Ga0075365_100833023 109
524 3300006173 Ga0070716_100946180 Ga0070716_1009461802 109
525 3300006186 Ga0075369_10188606 Ga0075369_101886062 109
526 3300006847 Ga0075431_100005694 Ga0075431_1000056944 109
527 3300006880 Ga0075429_100000064 Ga0075429_10000006428 109
528 3300009147 Ga0114129_10096511 Ga0114129_100965112 109
529 3300009551 Ga0105238_11341284 Ga0105238_113412842 109
530 3300009551 Ga0105238_11365354 Ga0105238_113653542 109
531 3300010159 Ga0099796_10550402 Ga0099796_105504021 109
532 3300011119 Ga0105246_10858821 Ga0105246_108588212 109
533 3300013105 Ga0157369_10192305 Ga0157369_101923052 109
534 3300014969 Ga0157376_10650702 Ga0157376_106507022 109
535 3300020075 Ga0206349_1233624 Ga0206349_12336242 109
536 3300035398 Ga0316574_0307818 Ga0316574_0307818_426_878 109
537 3300039437 Ga0436365_0454746 Ga0436365_0454746_145_558 109
538 3300039453 Ga0436362_0257499 Ga0436362_0257499_138_551 109
539 3300039453 Ga0436362_0777461 Ga0436362_0777461_92_505 109
540 3300039453 Ga0436362_1235245 Ga0436362_1235245_130_543 109
541 3300041453 Ga0451797_0697581 Ga0451797_0697581_70_483 109
542 3300041512 Ga0451853_3757407 Ga0451853_3757407_107_523 109
543 3300046455 Ga0495603_0748761 Ga0495603_0748761_50_463 109
544 3300046475 Ga0495639_0434685 Ga0495639_0434685_107_520 109
545 3300046511 Ga0495608_0133541 Ga0495608_0133541_560_976 109
546 3300046516 Ga0495628_0288221 Ga0495628_0288221_253_669 109
547 3300046529 Ga0495652_0389860 Ga0495652_0389860_251_667 109
548 3300046559 Ga0495667_0251753 Ga0495667_0251753_220_636 109
549 3300046559 Ga0495667_0426049 Ga0495667_0426049_359_772 109
550 3300046642 Ga0495634_0486677 Ga0495634_0486677_43_459 109
551 3300046678 Ga0495599_0319576 Ga0495599_0319576_499_915 109
552 3300046681 Ga0495647_0213001 Ga0495647_0213001_176_589 109
553 3300046683 Ga0495658_0070594 Ga0495658_0070594_1575_1988 109
554 3300046689 Ga0495613_0218459 Ga0495613_0218459_845_1261 109
555 3300047321 Ga0495676_0055288 Ga0495676_0055288_748_1161 109
556 3300047471 Ga0495684_0168031 Ga0495684_0168031_995_1411 109
557 3300048088 Ga0495602_0566538 Ga0495602_0566538_72_488 109
558 3300048907 Ga0496104_1260529 Ga0496104_1260529_55_468 109
559 3300048909 Ga0496106_0507014 Ga0496106_0507014_115_528 109
560 3300048911 Ga0496108_0089960 Ga0496108_0089960_797_1210 109
561 3300048912 Ga0496109_0024454 Ga0496109_0024454_3272_3685 109
562 3300048916 Ga0496113_0330638 Ga0496113_0330638_550_963 109
563 3300049162 Ga0501307_081704 Ga0501307_081704_61_477 109
564 3300049570 Ga0501033_0003012 Ga0501033_0003012_3132_3545 109
565 3300049585 Ga0501069_0083881 Ga0501069_0083881_759_1172 109
566 3300049744 Ga0501083_0997187 Ga0501083_0997187_20_433 109
567 3300049823 Ga0501044_0040147 Ga0501044_0040147_1161_1574 109
568 3300049824 Ga0501045_0496898 Ga0501045_0496898_452_865 109
569 3300050491 nmdc:mga00v17_484830_c1 nmdc:mga00v17_484830_c1_140_553 109
570 3300050509 nmdc:mga0qj67_315888_c1 nmdc:mga0qj67_315888_c1_574_987 109
571 3300053077 Ga0495601_0208155 Ga0495601_0208155_436_852 109
572 3300053084 Ga0495595_0157766 Ga0495595_0157766_593_1009 109
573 3300053085 Ga0495619_0085163 Ga0495619_0085163_845_1261 109
574 3300053085 Ga0495619_0957582 Ga0495619_0957582_18_431 109
575 3300053094 Ga0500566_0000443 Ga0500566_0000443_21713_22126 109
576 3300053133 Ga0500655_045931 Ga0500655_045931_383_799 109
577 3300005293 Ga0065715_11066122 Ga0065715_110661221 110
578 3300005328 Ga0070676_10232303 Ga0070676_102323032 110
579 3300005337 Ga0070682_100588518 Ga0070682_1005885182 110
580 3300005338 Ga0068868_100626281 Ga0068868_1006262812 110
581 3300005343 Ga0070687_100690722 Ga0070687_1006907221 110
582 3300005347 Ga0070668_100443719 Ga0070668_1004437192 110
583 3300005353 Ga0070669_101804822 Ga0070669_1018048221 110
584 3300005364 Ga0070673_100085202 Ga0070673_1000852023 110
585 3300005366 Ga0070659_101086781 Ga0070659_1010867811 110
586 3300005366 Ga0070659_101233882 Ga0070659_1012338822 110
587 3300005406 Ga0070703_10271845 Ga0070703_102718451 110
588 3300005434 Ga0070709_10962166 Ga0070709_109621661 110
589 3300005435 Ga0070714_101304250 Ga0070714_1013042502 110
590 3300005436 Ga0070713_100285018 Ga0070713_1002850182 110
591 3300005436 Ga0070713_100351102 Ga0070713_1003511022 110
592 3300005437 Ga0070710_10130697 Ga0070710_101306973 110
593 3300005438 Ga0070701_10409034 Ga0070701_104090341 110
594 3300005445 Ga0070708_101488566 Ga0070708_1014885661 110
595 3300005455 Ga0070663_100444355 Ga0070663_1004443551 110
596 3300005456 Ga0070678_100446881 Ga0070678_1004468812 110
597 3300005456 Ga0070678_100572092 Ga0070678_1005720922 110
598 3300005456 Ga0070678_101558569 Ga0070678_1015585691 110
599 3300005458 Ga0070681_10372019 Ga0070681_103720193 110
600 3300005458 Ga0070681_11086252 Ga0070681_110862522 110
601 3300005459 Ga0068867_100407840 Ga0068867_1004078402 110
602 3300005459 Ga0068867_100926061 Ga0068867_1009260611 110
603 3300005467 Ga0070706_100017012 Ga0070706_1000170124 110
604 3300005467 Ga0070706_100219158 Ga0070706_1002191581 110
605 3300005468 Ga0070707_100167078 Ga0070707_1001670783 110
606 3300005518 Ga0070699_100079282 Ga0070699_1000792824 110
607 3300005518 Ga0070699_100947875 Ga0070699_1009478752 110
608 3300005535 Ga0070684_100258533 Ga0070684_1002585331 110
609 3300005536 Ga0070697_100058072 Ga0070697_1000580722 110
610 3300005544 Ga0070686_100498444 Ga0070686_1004984442 110
611 3300005544 Ga0070686_100550004 Ga0070686_1005500042 110
612 3300005546 Ga0070696_100439545 Ga0070696_1004395452 110
613 3300005546 Ga0070696_100473731 Ga0070696_1004737312 110
614 3300005615 Ga0070702_100670671 Ga0070702_1006706712 110
615 3300005937 Ga0081455_10031164 Ga0081455_100311645 110
616 3300005981 Ga0081538_10056089 Ga0081538_100560893 110
617 3300005983 Ga0081540_1056255 Ga0081540_10562552 110
618 3300005985 Ga0081539_10091344 Ga0081539_100913443 110
619 3300006028 Ga0070717_10733988 Ga0070717_107339882 110
620 3300006038 Ga0075365_10460727 Ga0075365_104607272 110
621 3300006048 Ga0075363_100001656 Ga0075363_1000016563 110
622 3300006051 Ga0075364_10467578 Ga0075364_104675782 110
623 3300006194 Ga0075427_10050259 Ga0075427_100502592 110
624 3300006237 Ga0097621_100202557 Ga0097621_1002025572 110
625 3300006844 Ga0075428_100319779 Ga0075428_1003197792 110
626 3300006844 Ga0075428_100983146 Ga0075428_1009831462 110
627 3300006847 Ga0075431_100221244 Ga0075431_1002212443 110
628 3300006880 Ga0075429_100132174 Ga0075429_1001321742 110
629 3300006880 Ga0075429_100294671 Ga0075429_1002946712 110
630 3300006881 Ga0068865_101539842 Ga0068865_1015398422 110
631 3300006931 Ga0097620_100492833 Ga0097620_1004928332 110
632 3300007788 Ga0099795_10090457 Ga0099795_100904572 110
633 3300009094 Ga0111539_10782521 Ga0111539_107825212 110
634 3300009098 Ga0105245_10005614 Ga0105245_100056148 110
635 3300009098 Ga0105245_10856129 Ga0105245_108561292 110
636 3300009098 Ga0105245_10872225 Ga0105245_108722251 110
637 3300009098 Ga0105245_11396855 Ga0105245_113968551 110
638 3300009147 Ga0114129_10307886 Ga0114129_103078863 110
639 3300009147 Ga0114129_10952600 Ga0114129_109526002 110
640 3300009147 Ga0114129_12018827 Ga0114129_120188272 110
641 3300009176 Ga0105242_10335343 Ga0105242_103353432 110
642 3300009176 Ga0105242_10452210 Ga0105242_104522102 110
643 3300009551 Ga0105238_11016882 Ga0105238_110168821 110
644 3300009551 Ga0105238_11194181 Ga0105238_111941811 110
645 3300009553 Ga0105249_10269630 Ga0105249_102696303 110
646 3300009553 Ga0105249_10917164 Ga0105249_109171642 110
647 3300009987 Ga0105030_120303 Ga0105030_1203032 110
648 3300010375 Ga0105239_10162302 Ga0105239_101623022 110
649 3300011119 Ga0105246_11119678 Ga0105246_111196782 110
650 3300012508 Ga0157315_1006333 Ga0157315_10063332 110
651 3300013102 Ga0157371_10523371 Ga0157371_105233712 110
652 3300013306 Ga0163162_10520701 Ga0163162_105207013 110
653 3300013307 Ga0157372_11200469 Ga0157372_112004691 110
654 3300014325 Ga0163163_11559741 Ga0163163_115597412 110
655 3300014326 Ga0157380_10891018 Ga0157380_108910181 110
656 3300014968 Ga0157379_10719827 Ga0157379_107198272 110
657 3300014969 Ga0157376_11063357 Ga0157376_110633572 110
658 3300017792 Ga0163161_10421597 Ga0163161_104215972 110
659 3300020069 Ga0197907_11295313 Ga0197907_112953132 110
660 3300020070 Ga0206356_10711293 Ga0206356_107112932 110
661 3300020070 Ga0206356_11711064 Ga0206356_117110642 110
662 3300020078 Ga0206352_10456902 Ga0206352_104569022 110
663 3300020081 Ga0206354_10531322 Ga0206354_105313221 110
664 3300020081 Ga0206354_11239045 Ga0206354_112390452 110
665 3300025899 Ga0207642_10573688 Ga0207642_105736882 110
666 3300025907 Ga0207645_10312000 Ga0207645_103120002 110
667 3300025910 Ga0207684_10026643 Ga0207684_100266434 110
668 3300025910 Ga0207684_10182567 Ga0207684_101825672 110
669 3300025911 Ga0207654_10450814 Ga0207654_104508141 110
670 3300025911 Ga0207654_10527263 Ga0207654_105272631 110
671 3300025912 Ga0207707_10076663 Ga0207707_100766634 110
672 3300025912 Ga0207707_10212961 Ga0207707_102129611 110
673 3300025918 Ga0207662_10534384 Ga0207662_105343842 110
674 3300025922 Ga0207646_10675813 Ga0207646_106758132 110
675 3300025924 Ga0207694_10776513 Ga0207694_107765131 110
676 3300025927 Ga0207687_10001161 Ga0207687_1000116120 110
677 3300025928 Ga0207700_10253632 Ga0207700_102536323 110
678 3300025928 Ga0207700_10819284 Ga0207700_108192842 110
679 3300025929 Ga0207664_11206537 Ga0207664_112065371 110
680 3300025934 Ga0207686_10608619 Ga0207686_106086192 110
681 3300025934 Ga0207686_10922113 Ga0207686_109221132 110
682 3300025934 Ga0207686_11286582 Ga0207686_112865821 110
683 3300025937 Ga0207669_11322070 Ga0207669_113220701 110
684 3300025939 Ga0207665_10480049 Ga0207665_104800492 110
685 3300025941 Ga0207711_11006564 Ga0207711_110065642 110
686 3300025942 Ga0207689_10646740 Ga0207689_106467402 110
687 3300025960 Ga0207651_10101839 Ga0207651_101018393 110
688 3300025961 Ga0207712_12137861 Ga0207712_121378611 110
689 3300025986 Ga0207658_12018461 Ga0207658_120184611 110
690 3300026067 Ga0207678_10279158 Ga0207678_102791581 110
691 3300026078 Ga0207702_11974517 Ga0207702_119745171 110
692 3300026088 Ga0207641_10498067 Ga0207641_104980672 110
693 3300026089 Ga0207648_10515627 Ga0207648_105156272 110
694 3300026095 Ga0207676_10441689 Ga0207676_104416891 110
695 3300026118 Ga0207675_100403950 Ga0207675_1004039502 110
696 3300026118 Ga0207675_100585287 Ga0207675_1005852872 110
697 3300026118 Ga0207675_101104445 Ga0207675_1011044452 110
698 3300026121 Ga0207683_10647202 Ga0207683_106472022 110
699 3300026121 Ga0207683_10684896 Ga0207683_106848962 110
700 3300027907 Ga0207428_10300348 Ga0207428_103003482 110
701 3300028654 Ga0265322_10115326 Ga0265322_101153262 110
702 3300031240 Ga0265320_10520267 Ga0265320_105202671 110
703 3300031251 Ga0265327_10034891 Ga0265327_100348913 110
704 3300031251 Ga0265327_10059187 Ga0265327_100591873 110
705 3300031251 Ga0265327_10267202 Ga0265327_102672021 110
706 3300031727 Ga0316576_10012357 Ga0316576_100123574 110
707 3300031727 Ga0316576_10054211 Ga0316576_100542114 110
708 3300031728 Ga0316578_10012581 Ga0316578_100125812 110
709 3300031733 Ga0316577_10010865 Ga0316577_100108654 110
710 3300031733 Ga0316577_10174856 Ga0316577_101748562 110
711 3300032126 Ga0307415_100945856 Ga0307415_1009458562 110
712 3300035083 Ga0373926_0355644 Ga0373926_0355644_104_517 110
713 3300035085 Ga0373929_0074432 Ga0373929_0074432_120_533 110
714 3300035089 Ga0373944_0372451 Ga0373944_0372451_46_459 110
715 3300035114 Ga0373939_0076157 Ga0373939_0076157_534_947 110
716 3300035116 Ga0373945_0384129 Ga0373945_0384129_153_566 110
717 3300035170 Ga0373943_0272790 Ga0373943_0272790_318_731 110
718 3300035171 Ga0373946_0114699 Ga0373946_0114699_650_1063 110
719 3300035398 Ga0316574_0115231 Ga0316574_0115231_1257_1709 110
720 3300035691 Ga0373931_0013527 Ga0373931_0013527_655_1068 110
721 3300035692 Ga0373935_0098909 Ga0373935_0098909_1477_1890 110
722 3300035692 Ga0373935_0176449 Ga0373935_0176449_715_1128 110
723 3300035724 Ga0373933_0774017 Ga0373933_0774017_80_493 110
724 3300035725 Ga0373947_0167346 Ga0373947_0167346_31_444 110
725 3300036401 Ga0373937_0421046 Ga0373937_0421046_427_840 110
726 3300036401 Ga0373937_1389207 Ga0373937_1389207_114_527 110
727 3300036647 Ga0316582_0456259 Ga0316582_0456259_271_687 110
728 3300036712 Ga0316584_0016841 Ga0316584_0016841_1676_2125 110
729 3300037068 Ga0373925_0167156 Ga0373925_0167156_860_1273 110
730 3300037068 Ga0373925_1106298 Ga0373925_1106298_183_596 110
731 3300037418 Ga0395900_0992021 Ga0395900_0992021_202_615 110
732 3300039062 Ga0400483_102644 Ga0400483_102644_542_958 110
733 3300039062 Ga0400483_286448 Ga0400483_286448_224_640 110
734 3300039437 Ga0436365_0055491 Ga0436365_0055491_614_1027 110
735 3300039438 Ga0436360_0714011 Ga0436360_0714011_537_950 110
736 3300039453 Ga0436362_0822080 Ga0436362_0822080_28_441 110
737 3300039453 Ga0436362_1097698 Ga0436362_1097698_313_726 110
738 3300039453 Ga0436362_1259949 Ga0436362_1259949_1498_1911 110
739 3300041406 Ga0439439_0035272 Ga0439439_0035272_220_633 110
740 3300041458 Ga0451798_0038043 Ga0451798_0038043_75_488 110
741 3300041459 Ga0451800_1225528 Ga0451800_1225528_37_450 110
742 3300041492 Ga0451835_0911484 Ga0451835_0911484_39_452 110
743 3300041492 Ga0451835_1221373 Ga0451835_1221373_45_458 110
744 3300041496 Ga0451839_1338875 Ga0451839_1338875_112_525 110
745 3300041507 Ga0451851_0358739 Ga0451851_0358739_79_492 110
746 3300041512 Ga0451853_0327854 Ga0451853_0327854_30_443 110
747 3300042003 Ga0439443_028594 Ga0439443_028594_153_569 110
748 3300042005 Ga0439448_0003737 Ga0439448_0003737_2806_3222 110
749 3300042006 Ga0439432_176514 Ga0439432_176514_48_461 110
750 3300042008 Ga0439450_000313 Ga0439450_000313_4425_4841 110
751 3300042016 Ga0439463_004804 Ga0439463_004804_1378_1794 110
752 3300042437 Ga0439444_0022164 Ga0439444_0022164_575_991 110
753 3300042439 Ga0439464_0001455 Ga0439464_0001455_2510_2926 110
754 3300042461 Ga0439460_0170586 Ga0439460_0170586_240_656 110
755 3300046454 Ga0495592_0121987 Ga0495592_0121987_1349_1762 110
756 3300046461 Ga0495641_0209791 Ga0495641_0209791_265_678 110
757 3300046462 Ga0495651_0484363 Ga0495651_0484363_149_562 110
758 3300046463 Ga0495653_0459294 Ga0495653_0459294_246_659 110
759 3300046463 Ga0495653_0538478 Ga0495653_0538478_44_457 110
760 3300046463 Ga0495653_0939132 Ga0495653_0939132_66_479 110
761 3300046473 Ga0495582_0232496 Ga0495582_0232496_307_720 110
762 3300046474 Ga0495605_0179163 Ga0495605_0179163_142_555 110
763 3300046475 Ga0495639_0256549 Ga0495639_0256549_271_684 110
764 3300046476 Ga0495662_0310985 Ga0495662_0310985_11_424 110
765 3300046477 Ga0495664_0055799 Ga0495664_0055799_1771_2184 110
766 3300046499 Ga0495594_0220000 Ga0495594_0220000_620_1033 110
767 3300046506 Ga0495583_0205470 Ga0495583_0205470_236_649 110
768 3300046511 Ga0495608_0269690 Ga0495608_0269690_192_605 110
769 3300046511 Ga0495608_0326738 Ga0495608_0326738_233_646 110
770 3300046514 Ga0495618_0229067 Ga0495618_0229067_154_567 110
771 3300046514 Ga0495618_0685726 Ga0495618_0685726_169_582 110
772 3300046514 Ga0495618_0769535 Ga0495618_0769535_132_545 110
773 3300046516 Ga0495628_0008870 Ga0495628_0008870_6159_6572 110
774 3300046516 Ga0495628_0606226 Ga0495628_0606226_100_513 110
775 3300046517 Ga0495630_0035254 Ga0495630_0035254_748_1161 110
776 3300046517 Ga0495630_0047489 Ga0495630_0047489_1819_2232 110
777 3300046517 Ga0495630_0183085 Ga0495630_0183085_105_518 110
778 3300046517 Ga0495630_0267231 Ga0495630_0267231_585_998 110
779 3300046517 Ga0495630_1017009 Ga0495630_1017009_205_618 110
780 3300046523 Ga0495644_0068240 Ga0495644_0068240_353_766 110
781 3300046526 Ga0495666_0026231 Ga0495666_0026231_1021_1434 110
782 3300046529 Ga0495652_0364853 Ga0495652_0364853_249_662 110
783 3300046533 Ga0495640_0009407 Ga0495640_0009407_5440_5853 110
784 3300046533 Ga0495640_0478650 Ga0495640_0478650_292_705 110
785 3300046535 Ga0495586_0079237 Ga0495586_0079237_329_742 110
786 3300046535 Ga0495586_0103943 Ga0495586_0103943_891_1304 110
787 3300046543 Ga0495645_0504983 Ga0495645_0504983_312_725 110
788 3300046557 Ga0495622_0206976 Ga0495622_0206976_321_734 110
789 3300046559 Ga0495667_0167708 Ga0495667_0167708_84_497 110
790 3300046616 Ga0495668_0710132 Ga0495668_0710132_39_452 110
791 3300046642 Ga0495634_0349714 Ga0495634_0349714_143_556 110
792 3300046660 Ga0495625_0755924 Ga0495625_0755924_80_493 110
793 3300046663 Ga0495635_0123357 Ga0495635_0123357_825_1238 110
794 3300046679 Ga0495623_0503952 Ga0495623_0503952_85_498 110
795 3300046680 Ga0495646_0151615 Ga0495646_0151615_92_505 110
796 3300046681 Ga0495647_0226600 Ga0495647_0226600_285_698 110
797 3300046681 Ga0495647_0502102 Ga0495647_0502102_22_435 110
798 3300046683 Ga0495658_0065406 Ga0495658_0065406_205_618 110
799 3300046683 Ga0495658_0315551 Ga0495658_0315551_319_732 110
800 3300046683 Ga0495658_0500872 Ga0495658_0500872_230_643 110
801 3300046683 Ga0495658_0803079 Ga0495658_0803079_94_507 110
802 3300046689 Ga0495613_0140617 Ga0495613_0140617_305_718 110
803 3300046689 Ga0495613_0341201 Ga0495613_0341201_76_489 110
804 3300046690 Ga0495624_0341277 Ga0495624_0341277_164_577 110
805 3300046690 Ga0495624_0356345 Ga0495624_0356345_159_572 110
806 3300046692 Ga0495671_0175655 Ga0495671_0175655_503_916 110
807 3300046692 Ga0495671_0216872 Ga0495671_0216872_134_547 110
808 3300046794 Ga0495589_0305226 Ga0495589_0305226_303_716 110
809 3300047315 Ga0495581_0526248 Ga0495581_0526248_128_541 110
810 3300047317 Ga0495604_0228747 Ga0495604_0228747_39_452 110
811 3300047317 Ga0495604_0798526 Ga0495604_0798526_164_577 110
812 3300047318 Ga0495636_0479457 Ga0495636_0479457_75_488 110
813 3300047318 Ga0495636_0602818 Ga0495636_0602818_108_521 110
814 3300047319 Ga0495674_0177649 Ga0495674_0177649_1017_1430 110
815 3300047319 Ga0495674_0179513 Ga0495674_0179513_1159_1572 110
816 3300047319 Ga0495674_0627550 Ga0495674_0627550_180_593 110
817 3300047320 Ga0495672_0093189 Ga0495672_0093189_1092_1505 110
818 3300047321 Ga0495676_0059179 Ga0495676_0059179_1684_2097 110
819 3300047321 Ga0495676_0611527 Ga0495676_0611527_143_556 110
820 3300047322 Ga0495680_0085474 Ga0495680_0085474_1892_2305 110
821 3300047444 Ga0495675_0295112 Ga0495675_0295112_298_711 110
822 3300047445 Ga0495677_0214575 Ga0495677_0214575_153_566 110
823 3300047446 Ga0495679_145206 Ga0495679_145206_71_484 110
824 3300047447 Ga0495685_207671 Ga0495685_207671_84_497 110
825 3300047471 Ga0495684_0654022 Ga0495684_0654022_261_674 110
826 3300047472 Ga0495686_0228577 Ga0495686_0228577_410_823 110
827 3300047673 Ga0495593_0680819 Ga0495593_0680819_88_501 110
828 3300048088 Ga0495602_0340328 Ga0495602_0340328_245_658 110
829 3300048088 Ga0495602_0501203 Ga0495602_0501203_401_814 110
830 3300048088 Ga0495602_0677115 Ga0495602_0677115_114_527 110
831 3300048089 Ga0495614_0178375 Ga0495614_0178375_255_668 110
832 3300048090 Ga0495615_0091603 Ga0495615_0091603_95_508 110
833 3300048091 Ga0495626_0192685 Ga0495626_0192685_350_763 110
834 3300048903 Ga0496100_1067533 Ga0496100_1067533_53_466 110
835 3300048904 Ga0496101_0057951 Ga0496101_0057951_2084_2497 110
836 3300048904 Ga0496101_0760405 Ga0496101_0760405_69_482 110
837 3300048904 Ga0496101_1336702 Ga0496101_1336702_52_465 110
838 3300048905 Ga0496102_0022327 Ga0496102_0022327_4662_5075 110
839 3300048905 Ga0496102_0063259 Ga0496102_0063259_1064_1477 110
840 3300048906 Ga0496103_0149470 Ga0496103_0149470_355_768 110
841 3300048907 Ga0496104_0002399 Ga0496104_0002399_15653_16066 110
842 3300048907 Ga0496104_0035101 Ga0496104_0035101_2864_3277 110
843 3300048907 Ga0496104_0263493 Ga0496104_0263493_66_479 110
844 3300048908 Ga0496105_0203836 Ga0496105_0203836_249_662 110
845 3300048909 Ga0496106_0136190 Ga0496106_0136190_1205_1618 110
846 3300048910 Ga0496107_0025907 Ga0496107_0025907_1729_2142 110
847 3300048911 Ga0496108_0624172 Ga0496108_0624172_285_698 110
848 3300048911 Ga0496108_0737966 Ga0496108_0737966_231_644 110
849 3300048911 Ga0496108_0864987 Ga0496108_0864987_182_595 110
850 3300048912 Ga0496109_0067024 Ga0496109_0067024_1161_1574 110
851 3300048912 Ga0496109_0469254 Ga0496109_0469254_348_761 110
852 3300048913 Ga0496110_0578736 Ga0496110_0578736_231_644 110
853 3300048913 Ga0496110_0689981 Ga0496110_0689981_188_601 110
854 3300048913 Ga0496110_1238087 Ga0496110_1238087_28_441 110
855 3300048914 Ga0496111_0301316 Ga0496111_0301316_587_1000 110
856 3300048915 Ga0496112_0323264 Ga0496112_0323264_987_1400 110
857 3300048915 Ga0496112_0601856 Ga0496112_0601856_429_842 110
858 3300048915 Ga0496112_0840751 Ga0496112_0840751_325_738 110
859 3300048916 Ga0496113_0184622 Ga0496113_0184622_205_618 110
860 3300048916 Ga0496113_0431891 Ga0496113_0431891_313_726 110
861 3300048917 Ga0496114_0970744 Ga0496114_0970744_76_489 110
862 3300048917 Ga0496114_1022791 Ga0496114_1022791_245_658 110
863 3300048917 Ga0496114_1655216 Ga0496114_1655216_56_469 110
864 3300048918 Ga0496115_0012220 Ga0496115_0012220_4949_5362 110
865 3300049569 Ga0501032_0274713 Ga0501032_0274713_293_706 110
866 3300049571 Ga0501034_0343081 Ga0501034_0343081_617_1033 110
867 3300049572 Ga0501036_0366897 Ga0501036_0366897_376_789 110
868 3300049574 Ga0501038_0160072 Ga0501038_0160072_301_714 110
869 3300049575 Ga0501039_0367929 Ga0501039_0367929_261_674 110
870 3300049578 Ga0501042_0603488 Ga0501042_0603488_235_648 110
871 3300049578 Ga0501042_1103803 Ga0501042_1103803_85_498 110
872 3300049578 Ga0501042_1193239 Ga0501042_1193239_122_535 110
873 3300049580 Ga0501046_0047264 Ga0501046_0047264_2362_2775 110
874 3300049581 Ga0501047_0012694 Ga0501047_0012694_1325_1738 110
875 3300049581 Ga0501047_0179649 Ga0501047_0179649_310_726 110
876 3300049582 Ga0501048_0354493 Ga0501048_0354493_19_432 110
877 3300049584 Ga0501068_0320511 Ga0501068_0320511_415_828 110
878 3300049586 Ga0501070_0003086 Ga0501070_0003086_7693_8106 110
879 3300049587 Ga0501071_1028915 Ga0501071_1028915_133_546 110
880 3300049589 Ga0501073_0576918 Ga0501073_0576918_30_443 110
881 3300049592 Ga0501076_0680452 Ga0501076_0680452_174_587 110
882 3300049593 Ga0501077_0826738 Ga0501077_0826738_34_447 110
883 3300049741 Ga0501079_0742448 Ga0501079_0742448_25_438 110
884 3300049742 Ga0501080_0213418 Ga0501080_0213418_764_1177 110
885 3300049743 Ga0501081_1200789 Ga0501081_1200789_64_477 110
886 3300049822 Ga0501035_0428607 Ga0501035_0428607_303_716 110
887 3300049822 Ga0501035_0783113 Ga0501035_0783113_88_501 110
888 3300049824 Ga0501045_0826465 Ga0501045_0826465_69_482 110
889 3300050490 nmdc:mga03n38_33169_c1 nmdc:mga03n38_33169_c1_379_792 110
890 3300050491 nmdc:mga00v17_604429_c1 nmdc:mga00v17_604429_c1_10_423 110
891 3300050492 nmdc:mga0yw44_119578_c1 nmdc:mga0yw44_119578_c1_616_1032 110
892 3300050496 nmdc:mga07m45_598146_c1 nmdc:mga07m45_598146_c1_137_550 110
893 3300050507 nmdc:mga05p37_305953_c1 nmdc:mga05p37_305953_c1_250_663 110
894 3300050507 nmdc:mga05p37_31750_c1 nmdc:mga05p37_31750_c1_1585_1998 110
895 3300050507 nmdc:mga05p37_619657_c1 nmdc:mga05p37_619657_c1_342_755 110
896 3300050508 nmdc:mga09592_1434329_c1 nmdc:mga09592_1434329_c1_23_436 110
897 3300050508 nmdc:mga09592_187433_c1 nmdc:mga09592_187433_c1_267_680 110
898 3300050508 nmdc:mga09592_297379_c1 nmdc:mga09592_297379_c1_49_462 110
899 3300050509 nmdc:mga0qj67_252862_c1 nmdc:mga0qj67_252862_c1_14_427 110
900 3300050509 nmdc:mga0qj67_374042_c1 nmdc:mga0qj67_374042_c1_691_1104 110
901 3300050509 nmdc:mga0qj67_844300_c1 nmdc:mga0qj67_844300_c1_150_563 110
902 3300050509 nmdc:mga0qj67_917407_c1 nmdc:mga0qj67_917407_c1_30_443 110
903 3300050510 nmdc:mga06r32_33363_c1 nmdc:mga06r32_33363_c1_3005_3418 110
904 3300050510 nmdc:mga06r32_52497_c1 nmdc:mga06r32_52497_c1_2971_3387 110
905 3300050511 nmdc:mga08y16_389974_c1 nmdc:mga08y16_389974_c1_476_889 110
906 3300050513 nmdc:mga0rr50_346351_c1 nmdc:mga0rr50_346351_c1_144_557 110
907 3300050514 nmdc:mga08x19_12713_c1 nmdc:mga08x19_12713_c1_311_724 110
908 3300053077 Ga0495601_0615291 Ga0495601_0615291_252_665 110
909 3300053078 Ga0495612_0134373 Ga0495612_0134373_322_735 110
910 3300053078 Ga0495612_0374825 Ga0495612_0374825_207_620 110
911 3300053080 Ga0500635_0427445 Ga0500635_0427445_14_427 110
912 3300053084 Ga0495595_0039362 Ga0495595_0039362_114_527 110
913 3300053084 Ga0495595_0177581 Ga0495595_0177581_264_677 110
914 3300053084 Ga0495595_0202593 Ga0495595_0202593_130_543 110
915 3300053085 Ga0495619_0007373 Ga0495619_0007373_1285_1698 110
916 3300053085 Ga0495619_0022185 Ga0495619_0022185_146_559 110
917 3300053085 Ga0495619_0148138 Ga0495619_0148138_1054_1467 110
918 3300053085 Ga0495619_0472678 Ga0495619_0472678_278_691 110
919 3300053085 Ga0495619_1024400 Ga0495619_1024400_65_478 110
920 3300053153 Ga0500616_0002763 Ga0500616_0002763_1166_1579 110
921 3300054114 Ga0501084_0000009 Ga0501084_0000009_90838_91251 110
922 3300054114 Ga0501084_1281420 Ga0501084_1281420_157_570 110
923 3300059421 Ga0590071_111381 Ga0590071_111381_26_439 110
924 3300059477 Ga0587084_072720 Ga0587084_072720_80_493 110
925 3300059625 Ga0587113_027502 Ga0587113_027502_56_469 110
926 3300059630 Ga0587128_139972 Ga0587128_139972_29_442 110
927 3300059630 Ga0587128_141435 Ga0587128_141435_71_484 110
928 3300059644 Ga0587075_049985 Ga0587075_049985_74_487 110
929 3300059647 Ga0587079_144066 Ga0587079_144066_119_532 110
930 3300059648 Ga0587100_034130 Ga0587100_034130_40_453 110
931 3300060353 Ga0501082_0663618 Ga0501082_0663618_214_627 110
932 3300061734 Ga0530510_0003983 Ga0530510_0003983_9157_9570 110
933 3300061734 Ga0530510_0339940 Ga0530510_0339940_248_661 110
934 3300003911 JGI25405J52794_10010920 JGI25405J52794_100109202 111
935 3300005937 Ga0081455_10010519 Ga0081455_100105199 111
936 3300005937 Ga0081455_10967213 Ga0081455_109672131 111
937 3300005981 Ga0081538_10000033 Ga0081538_1000003327 111
938 3300005981 Ga0081538_10010515 Ga0081538_100105156 111
939 3300006051 Ga0075364_10374037 Ga0075364_103740372 111
940 3300006177 Ga0075362_10064178 Ga0075362_100641782 111
941 3300006177 Ga0075362_10138128 Ga0075362_101381282 111
942 3300006177 Ga0075362_10140823 Ga0075362_101408232 111
943 3300006846 Ga0075430_100285432 Ga0075430_1002854322 111
944 3300006847 Ga0075431_100186693 Ga0075431_1001866933 111
945 3300006880 Ga0075429_100508597 Ga0075429_1005085972 111
946 3300009094 Ga0111539_10000426 Ga0111539_100004262 111
947 3300009551 Ga0105238_12587005 Ga0105238_125870051 111
948 3300013306 Ga0163162_10643004 Ga0163162_106430042 111
949 3300017792 Ga0163161_10333236 Ga0163161_103332361 111
950 3300027907 Ga0207428_10008172 Ga0207428_1000817210 111
951 3300027907 Ga0207428_10234082 Ga0207428_102340822 111
952 3300028800 Ga0265338_10193405 Ga0265338_101934052 111
953 3300031249 Ga0265339_10579177 Ga0265339_105791771 111
954 3300031691 Ga0316579_10017298 Ga0316579_100172983 111
955 3300031727 Ga0316576_10027706 Ga0316576_100277063 111
956 3300031727 Ga0316576_10235728 Ga0316576_102357282 111
957 3300031733 Ga0316577_10128256 Ga0316577_101282562 111
958 3300031903 Ga0307407_10964967 Ga0307407_109649672 111
959 3300032126 Ga0307415_100306253 Ga0307415_1003062532 111
960 3300032126 Ga0307415_100579662 Ga0307415_1005796622 111
961 3300032137 Ga0316585_10086067 Ga0316585_100860671 111
962 3300032139 Ga0316580_10021572 Ga0316580_100215722 111
963 3300035398 Ga0316574_0016888 Ga0316574_0016888_2020_2439 111
964 3300035398 Ga0316574_0030977 Ga0316574_0030977_73_489 111
965 3300035398 Ga0316574_0166622 Ga0316574_0166622_633_1049 111
966 3300036712 Ga0316584_0038830 Ga0316584_0038830_1269_1688 111
967 3300036712 Ga0316584_0119260 Ga0316584_0119260_1208_1627 111
968 3300038735 Ga0400485_07726 Ga0400485_07726_3502_3918 111
969 3300039062 Ga0400483_119634 Ga0400483_119634_5472_5888 111
970 3300039062 Ga0400483_135474 Ga0400483_135474_12716_13132 111
971 3300039062 Ga0400483_271686 Ga0400483_271686_1647_2063 111
972 3300039437 Ga0436365_0956643 Ga0436365_0956643_128_544 111
973 3300041460 Ga0451802_0197124 Ga0451802_0197124_201_617 111
974 3300041505 Ga0451849_0525999 Ga0451849_0525999_26_442 111
975 3300042126 Ga0450888_073165 Ga0450888_073165_83_499 111
976 3300042533 Ga0450901_010290 Ga0450901_010290_460_876 111
977 3300047320 Ga0495672_0000884 Ga0495672_0000884_19541_19957 111
978 3300049569 Ga0501032_0001203 Ga0501032_0001203_13330_13746 111
979 3300049569 Ga0501032_0029797 Ga0501032_0029797_2988_3404 111
980 3300049570 Ga0501033_0003829 Ga0501033_0003829_8821_9237 111
981 3300049570 Ga0501033_0018735 Ga0501033_0018735_1288_1704 111
982 3300049571 Ga0501034_0002750 Ga0501034_0002750_6574_6990 111
983 3300049571 Ga0501034_0224578 Ga0501034_0224578_329_745 111
984 3300049571 Ga0501034_0302154 Ga0501034_0302154_273_689 111
985 3300049571 Ga0501034_0316360 Ga0501034_0316360_425_841 111
986 3300049572 Ga0501036_0026119 Ga0501036_0026119_1169_1585 111
987 3300049572 Ga0501036_0440942 Ga0501036_0440942_28_444 111
988 3300049573 Ga0501037_0098580 Ga0501037_0098580_1420_1836 111
989 3300049574 Ga0501038_0043269 Ga0501038_0043269_3318_3734 111
990 3300049574 Ga0501038_0328419 Ga0501038_0328419_263_679 111
991 3300049575 Ga0501039_0006601 Ga0501039_0006601_6693_7109 111
992 3300049575 Ga0501039_0010828 Ga0501039_0010828_189_605 111
993 3300049575 Ga0501039_0082281 Ga0501039_0082281_1505_1921 111
994 3300049575 Ga0501039_0784040 Ga0501039_0784040_37_453 111
995 3300049576 Ga0501040_0000785 Ga0501040_0000785_7425_7841 111
996 3300049577 Ga0501041_0005964 Ga0501041_0005964_2900_3316 111
997 3300049577 Ga0501041_0115017 Ga0501041_0115017_712_1128 111
998 3300049578 Ga0501042_0272575 Ga0501042_0272575_216_632 111
999 3300049578 Ga0501042_0514263 Ga0501042_0514263_259_675 111
1000 3300049579 Ga0501043_0016411 Ga0501043_0016411_495_911 111
1001 3300049580 Ga0501046_0025957 Ga0501046_0025957_1060_1476 111
1002 3300049580 Ga0501046_0040868 Ga0501046_0040868_416_832 111
1003 3300049582 Ga0501048_0008087 Ga0501048_0008087_1561_1977 111
1004 3300049582 Ga0501048_0041802 Ga0501048_0041802_219_635 111
1005 3300049582 Ga0501048_0151861 Ga0501048_0151861_449_865 111
1006 3300049584 Ga0501068_0011607 Ga0501068_0011607_1019_1435 111
1007 3300049584 Ga0501068_0014374 Ga0501068_0014374_366_782 111
1008 3300049584 Ga0501068_0394015 Ga0501068_0394015_365_781 111
1009 3300049585 Ga0501069_0405670 Ga0501069_0405670_232_648 111
1010 3300049586 Ga0501070_0002602 Ga0501070_0002602_2013_2429 111
1011 3300049586 Ga0501070_0561343 Ga0501070_0561343_272_688 111
1012 3300049587 Ga0501071_0016589 Ga0501071_0016589_1380_1796 111
1013 3300049587 Ga0501071_0038298 Ga0501071_0038298_817_1233 111
1014 3300049587 Ga0501071_0251806 Ga0501071_0251806_165_581 111
1015 3300049588 Ga0501072_0000534 Ga0501072_0000534_6751_7167 111
1016 3300049588 Ga0501072_0045577 Ga0501072_0045577_354_770 111
1017 3300049590 Ga0501074_0134948 Ga0501074_0134948_250_666 111
1018 3300049591 Ga0501075_0002356 Ga0501075_0002356_7322_7738 111
1019 3300049591 Ga0501075_0192315 Ga0501075_0192315_165_581 111
1020 3300049592 Ga0501076_0002252 Ga0501076_0002252_11738_12154 111
1021 3300049592 Ga0501076_0008401 Ga0501076_0008401_2890_3306 111
1022 3300049592 Ga0501076_0902471 Ga0501076_0902471_34_450 111
1023 3300049593 Ga0501077_0004688 Ga0501077_0004688_7116_7532 111
1024 3300049741 Ga0501079_0003485 Ga0501079_0003485_8471_8887 111
1025 3300049741 Ga0501079_0024344 Ga0501079_0024344_3222_3638 111
1026 3300049741 Ga0501079_0236580 Ga0501079_0236580_181_597 111
1027 3300049742 Ga0501080_1832621 Ga0501080_1832621_39_455 111
1028 3300049743 Ga0501081_0006630 Ga0501081_0006630_5650_6066 111
1029 3300049743 Ga0501081_0010894 Ga0501081_0010894_4015_4431 111
1030 3300049744 Ga0501083_0308597 Ga0501083_0308597_571_987 111
1031 3300049823 Ga0501044_0016386 Ga0501044_0016386_6782_7198 111
1032 3300049823 Ga0501044_0364336 Ga0501044_0364336_316_732 111
1033 3300049824 Ga0501045_0006370 Ga0501045_0006370_6668_7084 111
1034 3300049824 Ga0501045_0022706 Ga0501045_0022706_1422_1838 111
1035 3300049824 Ga0501045_0654527 Ga0501045_0654527_210_626 111
1036 3300050490 nmdc:mga03n38_36953_c1 nmdc:mga03n38_36953_c1_785_1201 111
1037 3300050507 nmdc:mga05p37_68259_c1 nmdc:mga05p37_68259_c1_2726_3142 111
1038 3300050508 nmdc:mga09592_356043_c1 nmdc:mga09592_356043_c1_75_491 111
1039 3300050508 nmdc:mga09592_492952_c1 nmdc:mga09592_492952_c1_307_723 111
1040 3300050509 nmdc:mga0qj67_128852_c1 nmdc:mga0qj67_128852_c1_649_1065 111
1041 3300050509 nmdc:mga0qj67_648315_c1 nmdc:mga0qj67_648315_c1_229_645 111
1042 3300050510 nmdc:mga06r32_219428_c1 nmdc:mga06r32_219428_c1_70_486 111
1043 3300050510 nmdc:mga06r32_272114_c1 nmdc:mga06r32_272114_c1_702_1118 111
1044 3300050510 nmdc:mga06r32_89875_c1 nmdc:mga06r32_89875_c1_1583_1999 111
1045 3300050511 nmdc:mga08y16_74620_c1 nmdc:mga08y16_74620_c1_935_1351 111
1046 3300054114 Ga0501084_0012792 Ga0501084_0012792_6033_6449 111
1047 3300054114 Ga0501084_0019565 Ga0501084_0019565_200_616 111
1048 3300059424 Ga0590075_016083 Ga0590075_016083_537_953 111
1049 3300059426 Ga0590077_046504 Ga0590077_046504_219_635 111
1050 3300059607 Ga0587125_070311 Ga0587125_070311_64_480 111
1051 3300059647 Ga0587079_115479 Ga0587079_115479_172_588 111
1052 3300059652 Ga0587107_080079 Ga0587107_080079_102_518 111
1053 3300060353 Ga0501082_0008693 Ga0501082_0008693_5904_6320 111
1054 3300060353 Ga0501082_1164115 Ga0501082_1164115_86_502 111
1055 3300061734 Ga0530510_0000984 Ga0530510_0000984_5895_6311 111
1056 3300061734 Ga0530510_0001714 Ga0530510_0001714_13047_13463 111
1057 3300061734 Ga0530510_0009528 Ga0530510_0009528_1558_1974 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12838

Fer4_7

4Fe-4S dicluster domain

43

107

0.71

Feature Viewer

pLDDT pTM Quality
53.03 0.22 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map