F489221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1058 | 429 | 2116 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100613846|Ga0070694_1006138461 |
| Length | 229 |
| Sequence | MAMSSRRKSKGSAFFGIESSMDDKLAIREVIENWALWRDAGDWTRFATVWHDDGWMTATWFQGPASKFIEVSRAGFERGVSILHFLGGFTCDVVGTRAIAQTKMTINQRAAVDGLEVDVVCTGRFYDFLEKRATSPERPKGVEGWAIVRRQPIYEKDRMDPVEPSRRLMLDVTLLNRFPEGYRHLAYLQSRNGFTIKDGLPGVRGAAVETLYAEGRAWLDGSAKPGTPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 243 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 245 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 246 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 247 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 248 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 249 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 250 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 251 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 252 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 253 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 254 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 255 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 256 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 257 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 258 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 359 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 401 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 402 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 404 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 405 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 407 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 408 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 414 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 415 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 416 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 417 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 418 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 419 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 420 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 421 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 422 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 423 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 424 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 425 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 426 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 427 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 428 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 429 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 0 |
| Isolates | 1.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.44 |
| Nodule | 0.28 |
| Rhizoplane | 6.9 |
| Rhizosphere | 84.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070694_100613846 | 3300005444 | Bacteria | 877 |
| 2 | JGI24739J22299_10107787 | 3300001989 | Bacteria | 837 |
| 3 | JGI24737J22298_10112773 | 3300001990 | Bacteria | 804 |
| 4 | JGI24735J21928_10018386 | 3300002067 | Bacteria | 2155 |
| 5 | JGI25156J39149_1000248 | 3300002705 | Bacteria | 37257 |
| 6 | JGI25406J46586_10002668 | 3300003203 | Bacteria | 8406 |
| 7 | JGI25406J46586_10003549 | 3300003203 | Bacteria | 7311 |
| 8 | JGI25406J46586_10007672 | 3300003203 | Bacteria | 4907 |
| 9 | JGI25165J46597_1000574 | 3300003214 | Bacteria | 32806 |
| 10 | Ga0055533_1000072 | 3300003756 | Bacteria | 144571 |
| 11 | Ga0055532_1000013 | 3300003758 | Bacteria | 380677 |
| 12 | Ga0055525_1007827 | 3300003759 | Bacteria | 903 |
| 13 | Ga0055527_1000010 | 3300003760 | Bacteria | 380677 |
| 14 | Ga0055535_1000010 | 3300003761 | Bacteria | 380677 |
| 15 | Ga0055542_1000016 | 3300003762 | Bacteria | 380677 |
| 16 | Ga0055542_1026608 | 3300003762 | Bacteria | 777 |
| 17 | Ga0055529_1000012 | 3300003763 | Bacteria | 380677 |
| 18 | Ga0065714_10091560 | 3300005288 | Bacteria | 1869 |
| 19 | Ga0065704_10083607 | 3300005289 | Bacteria | 3441 |
| 20 | Ga0065712_10006820 | 3300005290 | Bacteria | 4608 |
| 21 | Ga0065712_10016138 | 3300005290 | Bacteria | 1886 |
| 22 | Ga0065712_10070478 | 3300005290 | Bacteria | 5970 |
| 23 | Ga0065712_10231442 | 3300005290 | Bacteria | 1010 |
| 24 | Ga0065715_10012428 | 3300005293 | Bacteria | 2402 |
| 25 | Ga0065715_10180962 | 3300005293 | Bacteria | 1477 |
| 26 | Ga0065715_10386856 | 3300005293 | Bacteria | 899 |
| 27 | Ga0065715_10424106 | 3300005293 | Bacteria | 854 |
| 28 | Ga0065707_10053290 | 3300005295 | Bacteria | 917 |
| 29 | Ga0065707_10101782 | 3300005295 | Bacteria | 2845 |
| 30 | Ga0065707_10119254 | 3300005295 | Bacteria | 2164 |
| 31 | Ga0065707_10156092 | 3300005295 | Bacteria | 1607 |
| 32 | Ga0070658_10407788 | 3300005327 | Bacteria | 1168 |
| 33 | Ga0070658_10689235 | 3300005327 | Bacteria | 887 |
| 34 | Ga0070676_10002320 | 3300005328 | Bacteria | 9733 |
| 35 | Ga0070676_10003564 | 3300005328 | Bacteria | 8141 |
| 36 | Ga0070676_10481106 | 3300005328 | Bacteria | 878 |
| 37 | Ga0070683_100001511 | 3300005329 | Bacteria | 17965 |
| 38 | Ga0070683_100093027 | 3300005329 | Bacteria | 2832 |
| 39 | Ga0070690_100045970 | 3300005330 | Bacteria | 2775 |
| 40 | Ga0070670_100004942 | 3300005331 | Bacteria | 11217 |
| 41 | Ga0070670_100008476 | 3300005331 | Bacteria | 8766 |
| 42 | Ga0070670_100015711 | 3300005331 | Bacteria | 6499 |
| 43 | Ga0070670_100016749 | 3300005331 | Bacteria | 6291 |
| 44 | Ga0070670_100025631 | 3300005331 | Bacteria | 5072 |
| 45 | Ga0070670_100040227 | 3300005331 | Bacteria | 4020 |
| 46 | Ga0070670_100140073 | 3300005331 | Bacteria | 2092 |
| 47 | Ga0070677_10001442 | 3300005333 | Bacteria | 7540 |
| 48 | Ga0070677_10012697 | 3300005333 | Bacteria | 2929 |
| 49 | Ga0070677_10016155 | 3300005333 | Bacteria | 2655 |
| 50 | Ga0070677_10054133 | 3300005333 | Bacteria | 1634 |
| 51 | Ga0070677_10057448 | 3300005333 | Bacteria | 1594 |
| 52 | Ga0070677_10170562 | 3300005333 | Bacteria | 1028 |
| 53 | Ga0068869_100000636 | 3300005334 | Bacteria | 19801 |
| 54 | Ga0068869_100010733 | 3300005334 | Bacteria | 5981 |
| 55 | Ga0070666_10037394 | 3300005335 | Bacteria | 3227 |
| 56 | Ga0070666_10098969 | 3300005335 | Bacteria | 2008 |
| 57 | Ga0070666_10159326 | 3300005335 | Bacteria | 1577 |
| 58 | Ga0070666_10617191 | 3300005335 | Bacteria | 792 |
| 59 | Ga0070680_100425508 | 3300005336 | Bacteria | 1133 |
| 60 | Ga0070680_100742470 | 3300005336 | Bacteria | 845 |
| 61 | Ga0070682_100133645 | 3300005337 | Bacteria | 1682 |
| 62 | Ga0068868_100005280 | 3300005338 | Bacteria | 9073 |
| 63 | Ga0068868_100051330 | 3300005338 | Bacteria | 3243 |
| 64 | Ga0068868_100285549 | 3300005338 | Bacteria | 1398 |
| 65 | Ga0068868_100385215 | 3300005338 | Bacteria | 1207 |
| 66 | Ga0070660_100155954 | 3300005339 | Bacteria | 1837 |
| 67 | Ga0070689_100022070 | 3300005340 | Bacteria | 4749 |
| 68 | Ga0070689_100070852 | 3300005340 | Bacteria | 2723 |
| 69 | Ga0070689_100071477 | 3300005340 | Bacteria | 2711 |
| 70 | Ga0070689_100133773 | 3300005340 | Bacteria | 1990 |
| 71 | Ga0070691_10191866 | 3300005341 | Bacteria | 1069 |
| 72 | Ga0070687_100162866 | 3300005343 | Bacteria | 1320 |
| 73 | Ga0070687_100235737 | 3300005343 | Bacteria | 1129 |
| 74 | Ga0070687_100454371 | 3300005343 | Bacteria | 853 |
| 75 | Ga0070687_100497900 | 3300005343 | Bacteria | 820 |
| 76 | Ga0070661_100097788 | 3300005344 | Bacteria | 2180 |
| 77 | Ga0070661_100760269 | 3300005344 | Bacteria | 793 |
| 78 | Ga0070661_100784227 | 3300005344 | Bacteria | 781 |
| 79 | Ga0070692_10418763 | 3300005345 | Bacteria | 850 |
| 80 | Ga0070668_100011962 | 3300005347 | Bacteria | 6464 |
| 81 | Ga0070668_100054514 | 3300005347 | Bacteria | 3084 |
| 82 | Ga0070668_100125172 | 3300005347 | Bacteria | 2058 |
| 83 | Ga0070668_100495818 | 3300005347 | Bacteria | 1056 |
| 84 | Ga0070669_100044184 | 3300005353 | Bacteria | 3246 |
| 85 | Ga0070669_100089680 | 3300005353 | Bacteria | 2303 |
| 86 | Ga0070669_100130402 | 3300005353 | Bacteria | 1928 |
| 87 | Ga0070669_100137887 | 3300005353 | Bacteria | 1878 |
| 88 | Ga0070669_100534833 | 3300005353 | Bacteria | 976 |
| 89 | Ga0070675_100002214 | 3300005354 | Bacteria | 14424 |
| 90 | Ga0070675_100020327 | 3300005354 | Bacteria | 5298 |
| 91 | Ga0070675_100021755 | 3300005354 | Bacteria | 5123 |
| 92 | Ga0070675_100029636 | 3300005354 | Bacteria | 4415 |
| 93 | Ga0070675_100058127 | 3300005354 | Bacteria | 3189 |
| 94 | Ga0070675_100072500 | 3300005354 | Bacteria | 2859 |
| 95 | Ga0070675_100082834 | 3300005354 | Bacteria | 2677 |
| 96 | Ga0070671_100001454 | 3300005355 | Bacteria | 17685 |
| 97 | Ga0070671_100002792 | 3300005355 | Bacteria | 13563 |
| 98 | Ga0070671_100013815 | 3300005355 | Bacteria | 6515 |
| 99 | Ga0070671_100121326 | 3300005355 | Bacteria | 2200 |
| 100 | Ga0070671_100354688 | 3300005355 | Bacteria | 1252 |
| 101 | Ga0070671_100591182 | 3300005355 | Bacteria | 959 |
| 102 | Ga0070674_100002446 | 3300005356 | Bacteria | 10278 |
| 103 | Ga0070674_100009598 | 3300005356 | Bacteria | 5801 |
| 104 | Ga0070673_100014728 | 3300005364 | Bacteria | 5462 |
| 105 | Ga0070673_100045761 | 3300005364 | Bacteria | 3396 |
| 106 | Ga0070673_100096433 | 3300005364 | Bacteria | 2427 |
| 107 | Ga0070673_100166698 | 3300005364 | Bacteria | 1877 |
| 108 | Ga0070673_100266442 | 3300005364 | Bacteria | 1498 |
| 109 | Ga0070688_100067700 | 3300005365 | Bacteria | 2275 |
| 110 | Ga0070688_100083578 | 3300005365 | Bacteria | 2072 |
| 111 | Ga0070688_100230611 | 3300005365 | Bacteria | 1309 |
| 112 | Ga0070688_100789145 | 3300005365 | Bacteria | 742 |
| 113 | Ga0070659_100960025 | 3300005366 | Bacteria | 749 |
| 114 | Ga0070667_100013338 | 3300005367 | Bacteria | 6790 |
| 115 | Ga0070667_100013687 | 3300005367 | Bacteria | 6705 |
| 116 | Ga0070667_100461173 | 3300005367 | Bacteria | 1162 |
| 117 | Ga0070667_100589365 | 3300005367 | Bacteria | 1024 |
| 118 | Ga0070667_101123193 | 3300005367 | Bacteria | 735 |
| 119 | Ga0070703_10087234 | 3300005406 | Bacteria | 1075 |
| 120 | Ga0070703_10163234 | 3300005406 | Bacteria | 847 |
| 121 | Ga0070714_100016398 | 3300005435 | Bacteria | 5980 |
| 122 | Ga0070713_100197518 | 3300005436 | Bacteria | 1815 |
| 123 | Ga0070710_10289093 | 3300005437 | Bacteria | 1066 |
| 124 | Ga0070701_10001212 | 3300005438 | Bacteria | 9466 |
| 125 | Ga0070701_10012555 | 3300005438 | Bacteria | 3825 |
| 126 | Ga0070701_10036822 | 3300005438 | Bacteria | 2467 |
| 127 | Ga0070701_10104672 | 3300005438 | Bacteria | 1572 |
| 128 | Ga0070701_10245475 | 3300005438 | Bacteria | 1079 |
| 129 | Ga0070705_100127384 | 3300005440 | Bacteria | 1655 |
| 130 | Ga0070705_100370526 | 3300005440 | Bacteria | 1051 |
| 131 | Ga0070700_100009403 | 3300005441 | Bacteria | 5364 |
| 132 | Ga0070700_100041415 | 3300005441 | Bacteria | 2823 |
| 133 | Ga0070700_100053608 | 3300005441 | Bacteria | 2518 |
| 134 | Ga0070700_100093815 | 3300005441 | Bacteria | 1964 |
| 135 | Ga0070700_100102712 | 3300005441 | Bacteria | 1886 |
| 136 | Ga0070694_100024635 | 3300005444 | Bacteria | 3885 |
| 137 | Ga0070694_100084166 | 3300005444 | Bacteria | 2218 |
| 138 | Ga0070694_100115318 | 3300005444 | Bacteria | 1919 |
| 139 | Ga0070663_100244721 | 3300005455 | Bacteria | 1417 |
| 140 | Ga0070663_100244735 | 3300005455 | Bacteria | 1417 |
| 141 | Ga0070663_100828910 | 3300005455 | Bacteria | 795 |
| 142 | Ga0070678_100023233 | 3300005456 | Bacteria | 4128 |
| 143 | Ga0070678_100070710 | 3300005456 | Bacteria | 2610 |
| 144 | Ga0070678_100238264 | 3300005456 | Bacteria | 1520 |
| 145 | Ga0070678_100285081 | 3300005456 | Bacteria | 1398 |
| 146 | Ga0070662_100008793 | 3300005457 | Bacteria | 6587 |
| 147 | Ga0070662_100028944 | 3300005457 | Bacteria | 3861 |
| 148 | Ga0070662_100209520 | 3300005457 | Unclassified | 1550 |
| 149 | Ga0070662_100481546 | 3300005457 | Bacteria | 1033 |
| 150 | Ga0070681_10128013 | 3300005458 | Bacteria | 2472 |
| 151 | Ga0068867_100006351 | 3300005459 | Bacteria | 8356 |
| 152 | Ga0068867_100013786 | 3300005459 | Bacteria | 5723 |
| 153 | Ga0068867_100027480 | 3300005459 | Bacteria | 4090 |
| 154 | Ga0070685_10072920 | 3300005466 | Bacteria | 2039 |
| 155 | Ga0070706_100023229 | 3300005467 | Bacteria | 5713 |
| 156 | Ga0070706_100553613 | 3300005467 | Bacteria | 1070 |
| 157 | Ga0070698_100028630 | 3300005471 | Bacteria | 5785 |
| 158 | Ga0070698_100195970 | 3300005471 | Bacteria | 1957 |
| 159 | Ga0070699_100144595 | 3300005518 | Bacteria | 2101 |
| 160 | Ga0070699_100233093 | 3300005518 | Unclassified | 1642 |
| 161 | Ga0070679_100004020 | 3300005530 | Bacteria | 13550 |
| 162 | Ga0070684_100117928 | 3300005535 | Bacteria | 2385 |
| 163 | Ga0070672_100011370 | 3300005543 | Bacteria | 6207 |
| 164 | Ga0070672_100014821 | 3300005543 | Bacteria | 5533 |
| 165 | Ga0070672_100025638 | 3300005543 | Bacteria | 4376 |
| 166 | Ga0070672_100095959 | 3300005543 | Bacteria | 2398 |
| 167 | Ga0070672_100100864 | 3300005543 | Bacteria | 2341 |
| 168 | Ga0070672_100148723 | 3300005543 | Bacteria | 1936 |
| 169 | Ga0070672_100293241 | 3300005543 | Bacteria | 1378 |
| 170 | Ga0070672_100564991 | 3300005543 | Bacteria | 989 |
| 171 | Ga0070672_100569262 | 3300005543 | Bacteria | 985 |
| 172 | Ga0070686_100020370 | 3300005544 | Bacteria | 3923 |
| 173 | Ga0070686_100062784 | 3300005544 | Bacteria | 2405 |
| 174 | Ga0070686_100078939 | 3300005544 | Bacteria | 2175 |
| 175 | Ga0070686_100167999 | 3300005544 | Bacteria | 1549 |
| 176 | Ga0070695_100377521 | 3300005545 | Bacteria | 1069 |
| 177 | Ga0070696_100165918 | 3300005546 | Bacteria | 1630 |
| 178 | Ga0070693_100003087 | 3300005547 | Bacteria | 7728 |
| 179 | Ga0070665_100062597 | 3300005548 | Bacteria | 3731 |
| 180 | Ga0070665_100090553 | 3300005548 | Bacteria | 3065 |
| 181 | Ga0070665_100244281 | 3300005548 | Bacteria | 1796 |
| 182 | Ga0070665_100288066 | 3300005548 | Bacteria | 1645 |
| 183 | Ga0070665_100569614 | 3300005548 | Bacteria | 1145 |
| 184 | Ga0070665_100701411 | 3300005548 | Bacteria | 1025 |
| 185 | Ga0070665_100971368 | 3300005548 | Bacteria | 862 |
| 186 | Ga0070665_101201713 | 3300005548 | Bacteria | 769 |
| 187 | Ga0070704_100079697 | 3300005549 | Bacteria | 2406 |
| 188 | Ga0070704_100963245 | 3300005549 | Bacteria | 770 |
| 189 | Ga0070664_100022668 | 3300005564 | Bacteria | 5178 |
| 190 | Ga0070664_100061497 | 3300005564 | Bacteria | 3200 |
| 191 | Ga0070664_100196318 | 3300005564 | Bacteria | 1799 |
| 192 | Ga0070664_100251307 | 3300005564 | Bacteria | 1589 |
| 193 | Ga0068857_100315076 | 3300005577 | Bacteria | 1444 |
| 194 | Ga0068857_100457495 | 3300005577 | Bacteria | 1194 |
| 195 | Ga0068854_100499670 | 3300005578 | Bacteria | 1024 |
| 196 | Ga0068856_100088638 | 3300005614 | Bacteria | 3077 |
| 197 | Ga0068856_100210088 | 3300005614 | Bacteria | 1961 |
| 198 | Ga0070702_100032319 | 3300005615 | Bacteria | 2871 |
| 199 | Ga0070702_100065327 | 3300005615 | Bacteria | 2131 |
| 200 | Ga0068859_100011569 | 3300005617 | Bacteria | 8873 |
| 201 | Ga0068859_100068418 | 3300005617 | Bacteria | 3585 |
| 202 | Ga0068859_100090595 | 3300005617 | Bacteria | 3109 |
| 203 | Ga0068859_100302546 | 3300005617 | Bacteria | 1693 |
| 204 | Ga0068859_100382228 | 3300005617 | Bacteria | 1503 |
| 205 | Ga0068859_100447447 | 3300005617 | Bacteria | 1388 |
| 206 | Ga0068864_100001780 | 3300005618 | Bacteria | 17689 |
| 207 | Ga0068864_100005066 | 3300005618 | Bacteria | 10791 |
| 208 | Ga0068864_100034829 | 3300005618 | Bacteria | 4284 |
| 209 | Ga0068864_100087042 | 3300005618 | Bacteria | 2750 |
| 210 | Ga0068864_100095173 | 3300005618 | Bacteria | 2633 |
| 211 | Ga0068864_100107584 | 3300005618 | Bacteria | 2480 |
| 212 | Ga0068864_100117037 | 3300005618 | Bacteria | 2379 |
| 213 | Ga0068864_100484472 | 3300005618 | Bacteria | 1188 |
| 214 | Ga0068866_10001987 | 3300005718 | Bacteria | 8525 |
| 215 | Ga0068866_10571906 | 3300005718 | Bacteria | 759 |
| 216 | Ga0068861_100030062 | 3300005719 | Bacteria | 3979 |
| 217 | Ga0068861_100101615 | 3300005719 | Bacteria | 2287 |
| 218 | Ga0068861_100131470 | 3300005719 | Bacteria | 2032 |
| 219 | Ga0068861_100170581 | 3300005719 | Bacteria | 1803 |
| 220 | Ga0068861_100270592 | 3300005719 | Bacteria | 1459 |
| 221 | Ga0068861_100811567 | 3300005719 | Bacteria | 879 |
| 222 | Ga0068870_10130425 | 3300005840 | Unclassified | 1459 |
| 223 | Ga0068870_10201931 | 3300005840 | Bacteria | 1206 |
| 224 | Ga0068870_10296470 | 3300005840 | Bacteria | 1019 |
| 225 | Ga0068863_100002522 | 3300005841 | Bacteria | 18174 |
| 226 | Ga0068863_100011364 | 3300005841 | Bacteria | 8621 |
| 227 | Ga0068863_100030794 | 3300005841 | Bacteria | 5124 |
| 228 | Ga0068863_100048634 | 3300005841 | Bacteria | 4021 |
| 229 | Ga0068863_100241991 | 3300005841 | Bacteria | 1742 |
| 230 | Ga0068858_100020959 | 3300005842 | Bacteria | 6107 |
| 231 | Ga0068858_100040023 | 3300005842 | Bacteria | 4346 |
| 232 | Ga0068858_100194527 | 3300005842 | Bacteria | 1916 |
| 233 | Ga0068860_100035450 | 3300005843 | Bacteria | 4785 |
| 234 | Ga0068860_100398260 | 3300005843 | Bacteria | 1362 |
| 235 | Ga0068862_100004252 | 3300005844 | Bacteria | 12128 |
| 236 | Ga0068862_100136660 | 3300005844 | Bacteria | 2173 |
| 237 | Ga0068862_100167129 | 3300005844 | Bacteria | 1967 |
| 238 | Ga0068862_100210662 | 3300005844 | Bacteria | 1756 |
| 239 | Ga0068862_100269801 | 3300005844 | Bacteria | 1556 |
| 240 | Ga0068862_100678890 | 3300005844 | Bacteria | 996 |
| 241 | Ga0081455_10164011 | 3300005937 | Bacteria | 1700 |
| 242 | Ga0081539_10000133 | 3300005985 | Bacteria | 173855 |
| 243 | Ga0081539_10000219 | 3300005985 | Bacteria | 134405 |
| 244 | Ga0081539_10000329 | 3300005985 | Bacteria | 105307 |
| 245 | Ga0081539_10034885 | 3300005985 | Bacteria | 3033 |
| 246 | Ga0070717_10017715 | 3300006028 | Bacteria | 5548 |
| 247 | Ga0075365_10235248 | 3300006038 | Bacteria | 1286 |
| 248 | Ga0075368_10011966 | 3300006042 | Bacteria | 3166 |
| 249 | Ga0075432_10184399 | 3300006058 | Bacteria | 818 |
| 250 | Ga0070716_100004079 | 3300006173 | Bacteria | 6931 |
| 251 | Ga0070716_100575976 | 3300006173 | Bacteria | 843 |
| 252 | Ga0070712_100058058 | 3300006175 | Bacteria | 2721 |
| 253 | Ga0075367_10009828 | 3300006178 | Bacteria | 5012 |
| 254 | Ga0075369_10018775 | 3300006186 | Bacteria | 2818 |
| 255 | Ga0097621_100044809 | 3300006237 | Bacteria | 3570 |
| 256 | Ga0097621_100189922 | 3300006237 | Bacteria | 1779 |
| 257 | Ga0097621_100236392 | 3300006237 | Bacteria | 1596 |
| 258 | Ga0097621_100308406 | 3300006237 | Bacteria | 1399 |
| 259 | Ga0097621_100489620 | 3300006237 | Bacteria | 1113 |
| 260 | Ga0075370_10059103 | 3300006353 | Bacteria | 2181 |
| 261 | Ga0068871_100029013 | 3300006358 | Bacteria | 4343 |
| 262 | Ga0068871_100054420 | 3300006358 | Bacteria | 3247 |
| 263 | Ga0068871_100321061 | 3300006358 | Bacteria | 1364 |
| 264 | Ga0068871_100548120 | 3300006358 | Bacteria | 1047 |
| 265 | Ga0075428_100001611 | 3300006844 | Bacteria | 24116 |
| 266 | Ga0075428_100010461 | 3300006844 | Bacteria | 10306 |
| 267 | Ga0075428_100021049 | 3300006844 | Bacteria | 7223 |
| 268 | Ga0075428_100086365 | 3300006844 | Bacteria | 3422 |
| 269 | Ga0075428_100109854 | 3300006844 | Unclassified | 3004 |
| 270 | Ga0075428_100123006 | 3300006844 | Bacteria | 2824 |
| 271 | Ga0075428_100681423 | 3300006844 | Bacteria | 1096 |
| 272 | Ga0075428_100939087 | 3300006844 | Bacteria | 917 |
| 273 | Ga0075430_100001888 | 3300006846 | Bacteria | 17166 |
| 274 | Ga0075430_100034162 | 3300006846 | Bacteria | 4315 |
| 275 | Ga0075430_100035431 | 3300006846 | Bacteria | 4233 |
| 276 | Ga0075430_100287170 | 3300006846 | Bacteria | 1361 |
| 277 | Ga0075431_100002059 | 3300006847 | Bacteria | 19211 |
| 278 | Ga0075431_100006116 | 3300006847 | Bacteria | 11940 |
| 279 | Ga0075431_100009127 | 3300006847 | Bacteria | 9944 |
| 280 | Ga0075431_100131533 | 3300006847 | Bacteria | 2581 |
| 281 | Ga0075431_100150260 | 3300006847 | Bacteria | 2399 |
| 282 | Ga0075431_100402312 | 3300006847 | Bacteria | 1370 |
| 283 | Ga0075431_100619702 | 3300006847 | Bacteria | 1064 |
| 284 | Ga0075431_100658646 | 3300006847 | Bacteria | 1027 |
| 285 | Ga0075433_10000801 | 3300006852 | Bacteria | 21822 |
| 286 | Ga0075433_10045435 | 3300006852 | Bacteria | 3818 |
| 287 | Ga0075434_100002267 | 3300006871 | Bacteria | 16831 |
| 288 | Ga0075434_100013753 | 3300006871 | Bacteria | 7717 |
| 289 | Ga0075434_100219281 | 3300006871 | Bacteria | 1922 |
| 290 | Ga0075434_100287895 | 3300006871 | Bacteria | 1663 |
| 291 | Ga0075434_100491521 | 3300006871 | Bacteria | 1248 |
| 292 | Ga0075434_100747771 | 3300006871 | Bacteria | 995 |
| 293 | Ga0075429_100000003 | 3300006880 | Bacteria | 130377 |
| 294 | Ga0075429_100027367 | 3300006880 | Bacteria | 4949 |
| 295 | Ga0075429_100079124 | 3300006880 | Bacteria | 2866 |
| 296 | Ga0075429_100481456 | 3300006880 | Bacteria | 1087 |
| 297 | Ga0068865_100003497 | 3300006881 | Bacteria | 9418 |
| 298 | Ga0068865_100095760 | 3300006881 | Bacteria | 2163 |
| 299 | Ga0068865_100675780 | 3300006881 | Bacteria | 880 |
| 300 | Ga0068865_100692360 | 3300006881 | Bacteria | 870 |
| 301 | Ga0075436_100624904 | 3300006914 | Bacteria | 794 |
| 302 | Ga0097620_100011569 | 3300006931 | Bacteria | 8873 |
| 303 | Ga0097620_100068420 | 3300006931 | Bacteria | 3585 |
| 304 | Ga0097620_100090594 | 3300006931 | Bacteria | 3109 |
| 305 | Ga0097620_100302581 | 3300006931 | Bacteria | 1693 |
| 306 | Ga0097620_100382233 | 3300006931 | Bacteria | 1503 |
| 307 | Ga0097620_100447504 | 3300006931 | Bacteria | 1388 |
| 308 | Ga0075435_100022855 | 3300007076 | Bacteria | 4828 |
| 309 | Ga0075435_100032377 | 3300007076 | Bacteria | 4128 |
| 310 | Ga0075435_100235757 | 3300007076 | Unclassified | 1555 |
| 311 | Ga0099794_10016714 | 3300007265 | Bacteria | 3258 |
| 312 | Ga0099794_10028304 | 3300007265 | Bacteria | 2606 |
| 313 | Ga0099794_10233801 | 3300007265 | Bacteria | 946 |
| 314 | Ga0099795_10049790 | 3300007788 | Unclassified | 1521 |
| 315 | Ga0105251_10004768 | 3300009011 | Bacteria | 9077 |
| 316 | Ga0105251_10106747 | 3300009011 | Bacteria | 1278 |
| 317 | Ga0105244_10053926 | 3300009036 | Bacteria | 2041 |
| 318 | Ga0105250_10050215 | 3300009092 | Bacteria | 1674 |
| 319 | Ga0105240_10000052 | 3300009093 | Bacteria | 232583 |
| 320 | Ga0105240_10178832 | 3300009093 | Bacteria | 2505 |
| 321 | Ga0105240_10196055 | 3300009093 | Bacteria | 2371 |
| 322 | Ga0111539_10002454 | 3300009094 | Bacteria | 24635 |
| 323 | Ga0111539_10010352 | 3300009094 | Bacteria | 11741 |
| 324 | Ga0111539_10019309 | 3300009094 | Bacteria | 8415 |
| 325 | Ga0111539_10044276 | 3300009094 | Bacteria | 5333 |
| 326 | Ga0111539_10099831 | 3300009094 | Bacteria | 3408 |
| 327 | Ga0111539_10119705 | 3300009094 | Bacteria | 3085 |
| 328 | Ga0111539_10144534 | 3300009094 | Bacteria | 2784 |
| 329 | Ga0111539_10146808 | 3300009094 | Bacteria | 2761 |
| 330 | Ga0111539_10455079 | 3300009094 | Bacteria | 1490 |
| 331 | Ga0111539_10512928 | 3300009094 | Bacteria | 1397 |
| 332 | Ga0111539_11149196 | 3300009094 | Unclassified | 902 |
| 333 | Ga0105245_10010732 | 3300009098 | Bacteria | 7969 |
| 334 | Ga0105245_10018846 | 3300009098 | Bacteria | 6039 |
| 335 | Ga0105245_10045439 | 3300009098 | Bacteria | 3923 |
| 336 | Ga0105245_10066233 | 3300009098 | Bacteria | 3269 |
| 337 | Ga0105245_10367897 | 3300009098 | Bacteria | 1429 |
| 338 | Ga0105245_10511475 | 3300009098 | Bacteria | 1218 |
| 339 | Ga0105247_10032737 | 3300009101 | Bacteria | 3159 |
| 340 | Ga0105247_10034709 | 3300009101 | Bacteria | 3072 |
| 341 | Ga0114129_10007207 | 3300009147 | Bacteria | 15824 |
| 342 | Ga0114129_10035772 | 3300009147 | Bacteria | 7014 |
| 343 | Ga0114129_10064405 | 3300009147 | Bacteria | 5115 |
| 344 | Ga0114129_10129102 | 3300009147 | Bacteria | 3474 |
| 345 | Ga0114129_10299571 | 3300009147 | Bacteria | 2143 |
| 346 | Ga0114129_10443250 | 3300009147 | Bacteria | 1704 |
| 347 | Ga0114129_10682177 | 3300009147 | Bacteria | 1323 |
| 348 | Ga0114129_10860476 | 3300009147 | Bacteria | 1152 |
| 349 | Ga0105243_10013712 | 3300009148 | Bacteria | 6131 |
| 350 | Ga0105243_10206281 | 3300009148 | Bacteria | 1727 |
| 351 | Ga0105243_10357035 | 3300009148 | Bacteria | 1344 |
| 352 | Ga0105243_11099763 | 3300009148 | Bacteria | 803 |
| 353 | Ga0105242_10000995 | 3300009176 | Bacteria | 22203 |
| 354 | Ga0105242_10014788 | 3300009176 | Bacteria | 6043 |
| 355 | Ga0105242_10140644 | 3300009176 | Bacteria | 2094 |
| 356 | Ga0105242_10233566 | 3300009176 | Bacteria | 1649 |
| 357 | Ga0105242_11265572 | 3300009176 | Bacteria | 760 |
| 358 | Ga0105248_10015744 | 3300009177 | Bacteria | 8335 |
| 359 | Ga0105248_10114285 | 3300009177 | Bacteria | 3045 |
| 360 | Ga0105248_10646780 | 3300009177 | Bacteria | 1193 |
| 361 | Ga0105248_10880245 | 3300009177 | Bacteria | 1011 |
| 362 | Ga0105248_10999923 | 3300009177 | Bacteria | 945 |
| 363 | Ga0105238_10015828 | 3300009551 | Bacteria | 7636 |
| 364 | Ga0105238_10018756 | 3300009551 | Bacteria | 7045 |
| 365 | Ga0105249_10002175 | 3300009553 | Bacteria | 16984 |
| 366 | Ga0105249_10094139 | 3300009553 | Bacteria | 2807 |
| 367 | Ga0105249_10294467 | 3300009553 | Bacteria | 1625 |
| 368 | Ga0105239_10006686 | 3300010375 | Bacteria | 13321 |
| 369 | Ga0105239_10180676 | 3300010375 | Bacteria | 2361 |
| 370 | Ga0105239_10668536 | 3300010375 | Bacteria | 1187 |
| 371 | Ga0105239_11093409 | 3300010375 | Bacteria | 918 |
| 372 | Ga0105246_10002402 | 3300011119 | Bacteria | 11304 |
| 373 | Ga0105246_10011917 | 3300011119 | Bacteria | 5410 |
| 374 | Ga0105246_10107651 | 3300011119 | Bacteria | 2042 |
| 375 | Ga0157371_10103662 | 3300013102 | Bacteria | 2018 |
| 376 | Ga0157369_10607568 | 3300013105 | Bacteria | 1129 |
| 377 | Ga0157374_10084063 | 3300013296 | Bacteria | 3025 |
| 378 | Ga0157374_10450589 | 3300013296 | Bacteria | 1288 |
| 379 | Ga0157378_10193094 | 3300013297 | Bacteria | 1922 |
| 380 | Ga0163162_10000812 | 3300013306 | Bacteria | 28975 |
| 381 | Ga0163162_10000983 | 3300013306 | Bacteria | 26506 |
| 382 | Ga0163162_10066581 | 3300013306 | Bacteria | 3651 |
| 383 | Ga0163162_10180331 | 3300013306 | Bacteria | 2238 |
| 384 | Ga0163162_10203652 | 3300013306 | Bacteria | 2108 |
| 385 | Ga0163162_10263680 | 3300013306 | Bacteria | 1854 |
| 386 | Ga0157372_10425241 | 3300013307 | Bacteria | 1548 |
| 387 | Ga0157375_10058921 | 3300013308 | Bacteria | 3802 |
| 388 | Ga0157375_10183834 | 3300013308 | Bacteria | 2243 |
| 389 | Ga0157375_10453555 | 3300013308 | Bacteria | 1448 |
| 390 | Ga0157375_10480974 | 3300013308 | Bacteria | 1407 |
| 391 | Ga0157375_10894412 | 3300013308 | Bacteria | 1032 |
| 392 | Ga0163163_10003481 | 3300014325 | Bacteria | 13370 |
| 393 | Ga0163163_10010402 | 3300014325 | Bacteria | 8365 |
| 394 | Ga0163163_10029715 | 3300014325 | Bacteria | 5260 |
| 395 | Ga0163163_10377683 | 3300014325 | Bacteria | 1475 |
| 396 | Ga0163163_10457212 | 3300014325 | Unclassified | 1337 |
| 397 | Ga0163163_10509394 | 3300014325 | Bacteria | 1265 |
| 398 | Ga0163163_10718761 | 3300014325 | Bacteria | 1062 |
| 399 | Ga0163163_11127638 | 3300014325 | Bacteria | 847 |
| 400 | Ga0157380_10003751 | 3300014326 | Bacteria | 10451 |
| 401 | Ga0157380_10010778 | 3300014326 | Bacteria | 6587 |
| 402 | Ga0157380_10065936 | 3300014326 | Bacteria | 2912 |
| 403 | Ga0157380_10083289 | 3300014326 | Bacteria | 2620 |
| 404 | Ga0157380_10132656 | 3300014326 | Bacteria | 2128 |
| 405 | Ga0157380_10208511 | 3300014326 | Bacteria | 1740 |
| 406 | Ga0157380_10403381 | 3300014326 | Bacteria | 1298 |
| 407 | Ga0157380_10818195 | 3300014326 | Bacteria | 950 |
| 408 | Ga0157380_11025110 | 3300014326 | Bacteria | 860 |
| 409 | Ga0157377_10040201 | 3300014745 | Bacteria | 2588 |
| 410 | Ga0157377_10072700 | 3300014745 | Bacteria | 1991 |
| 411 | Ga0157377_10098737 | 3300014745 | Bacteria | 1736 |
| 412 | Ga0157377_10182669 | 3300014745 | Bacteria | 1320 |
| 413 | Ga0157377_10185263 | 3300014745 | Bacteria | 1312 |
| 414 | Ga0157377_10518398 | 3300014745 | Unclassified | 836 |
| 415 | Ga0157379_10011611 | 3300014968 | Bacteria | 7691 |
| 416 | Ga0157379_10062893 | 3300014968 | Bacteria | 3319 |
| 417 | Ga0157379_10072571 | 3300014968 | Bacteria | 3080 |
| 418 | Ga0157379_10182322 | 3300014968 | Bacteria | 1897 |
| 419 | Ga0157379_10307695 | 3300014968 | Bacteria | 1445 |
| 420 | Ga0157376_10020581 | 3300014969 | Bacteria | 5107 |
| 421 | Ga0157376_10039405 | 3300014969 | Bacteria | 3853 |
| 422 | Ga0157376_10201781 | 3300014969 | Bacteria | 1830 |
| 423 | Ga0157376_10284885 | 3300014969 | Bacteria | 1558 |
| 424 | Ga0157376_11429408 | 3300014969 | Bacteria | 724 |
| 425 | Ga0183367_1021 | 3300015688 | Bacteria | 82913 |
| 426 | Ga0163161_10205192 | 3300017792 | Bacteria | 1520 |
| 427 | Ga0163161_10252644 | 3300017792 | Bacteria | 1374 |
| 428 | Ga0163161_10577674 | 3300017792 | Bacteria | 924 |
| 429 | Ga0163161_10988685 | 3300017792 | Bacteria | 718 |
| 430 | Ga0213875_10189291 | 3300021388 | Bacteria | 967 |
| 431 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 432 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 433 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 434 | Ga0209563_100803 | 3300025230 | Bacteria | 9422 |
| 435 | Ga0207427_100610 | 3300025231 | Bacteria | 17768 |
| 436 | Ga0209258_100042 | 3300025242 | Bacteria | 380729 |
| 437 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 438 | Ga0209148_1001617 | 3300025254 | Bacteria | 10460 |
| 439 | Ga0209759_1000051 | 3300025256 | Bacteria | 214016 |
| 440 | Ga0209233_1000033 | 3300025261 | Bacteria | 596094 |
| 441 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 442 | Ga0209455_1003782 | 3300025272 | Bacteria | 5207 |
| 443 | Ga0207426_1002893 | 3300025302 | Bacteria | 10143 |
| 444 | Ga0207697_10002977 | 3300025315 | Bacteria | 8550 |
| 445 | Ga0207696_1083552 | 3300025711 | Bacteria | 880 |
| 446 | Ga0207655_1107740 | 3300025728 | Bacteria | 947 |
| 447 | Ga0207713_1003152 | 3300025735 | Bacteria | 11432 |
| 448 | Ga0207682_10002341 | 3300025893 | Bacteria | 8544 |
| 449 | Ga0207682_10004751 | 3300025893 | Bacteria | 5635 |
| 450 | Ga0207682_10023842 | 3300025893 | Bacteria | 2420 |
| 451 | Ga0207682_10052188 | 3300025893 | Bacteria | 1694 |
| 452 | Ga0207682_10160522 | 3300025893 | Bacteria | 1018 |
| 453 | Ga0207642_10015889 | 3300025899 | Bacteria | 2820 |
| 454 | Ga0207642_10190645 | 3300025899 | Bacteria | 1125 |
| 455 | Ga0207642_10360604 | 3300025899 | Bacteria | 860 |
| 456 | Ga0207688_10006362 | 3300025901 | Bacteria | 6431 |
| 457 | Ga0207680_10065152 | 3300025903 | Bacteria | 2236 |
| 458 | Ga0207680_10083605 | 3300025903 | Bacteria | 2012 |
| 459 | Ga0207680_10117970 | 3300025903 | Bacteria | 1732 |
| 460 | Ga0207680_10202828 | 3300025903 | Bacteria | 1352 |
| 461 | Ga0207680_10206685 | 3300025903 | Bacteria | 1341 |
| 462 | Ga0207680_10260425 | 3300025903 | Bacteria | 1200 |
| 463 | Ga0207680_10503058 | 3300025903 | Bacteria | 863 |
| 464 | Ga0207645_10002246 | 3300025907 | Bacteria | 15364 |
| 465 | Ga0207645_10008417 | 3300025907 | Bacteria | 7196 |
| 466 | Ga0207645_10062340 | 3300025907 | Bacteria | 2382 |
| 467 | Ga0207645_10252954 | 3300025907 | Bacteria | 1166 |
| 468 | Ga0207645_10698976 | 3300025907 | Bacteria | 689 |
| 469 | Ga0207643_10003472 | 3300025908 | Bacteria | 8482 |
| 470 | Ga0207643_10018291 | 3300025908 | Bacteria | 3838 |
| 471 | Ga0207643_10022591 | 3300025908 | Bacteria | 3464 |
| 472 | Ga0207705_10412066 | 3300025909 | Bacteria | 1046 |
| 473 | Ga0207707_10015561 | 3300025912 | Bacteria | 6626 |
| 474 | Ga0207695_10000122 | 3300025913 | Bacteria | 232677 |
| 475 | Ga0207695_10489659 | 3300025913 | Bacteria | 1112 |
| 476 | Ga0207693_10365787 | 3300025915 | Bacteria | 1128 |
| 477 | Ga0207662_10012068 | 3300025918 | Bacteria | 4807 |
| 478 | Ga0207662_10073842 | 3300025918 | Bacteria | 2069 |
| 479 | Ga0207662_10104897 | 3300025918 | Bacteria | 1756 |
| 480 | Ga0207662_10112459 | 3300025918 | Bacteria | 1699 |
| 481 | Ga0207649_10039184 | 3300025920 | Bacteria | 2871 |
| 482 | Ga0207649_10044717 | 3300025920 | Bacteria | 2712 |
| 483 | Ga0207649_10573246 | 3300025920 | Bacteria | 866 |
| 484 | Ga0207652_10034319 | 3300025921 | Bacteria | 4275 |
| 485 | Ga0207646_10737788 | 3300025922 | Bacteria | 879 |
| 486 | Ga0207681_10007823 | 3300025923 | Bacteria | 6547 |
| 487 | Ga0207681_10083805 | 3300025923 | Bacteria | 2258 |
| 488 | Ga0207681_10136394 | 3300025923 | Bacteria | 1822 |
| 489 | Ga0207681_10138337 | 3300025923 | Bacteria | 1810 |
| 490 | Ga0207681_10156419 | 3300025923 | Bacteria | 1713 |
| 491 | Ga0207681_10238915 | 3300025923 | Bacteria | 1413 |
| 492 | Ga0207681_10624100 | 3300025923 | Bacteria | 892 |
| 493 | Ga0207694_10064635 | 3300025924 | Bacteria | 2851 |
| 494 | Ga0207650_10009090 | 3300025925 | Bacteria | 6792 |
| 495 | Ga0207650_10033256 | 3300025925 | Bacteria | 3733 |
| 496 | Ga0207650_10090786 | 3300025925 | Bacteria | 2333 |
| 497 | Ga0207650_10108457 | 3300025925 | Bacteria | 2146 |
| 498 | Ga0207650_10199055 | 3300025925 | Bacteria | 1604 |
| 499 | Ga0207650_10442469 | 3300025925 | Bacteria | 1081 |
| 500 | Ga0207659_10004973 | 3300025926 | Bacteria | 8056 |
| 501 | Ga0207659_10006385 | 3300025926 | Bacteria | 7220 |
| 502 | Ga0207659_10013335 | 3300025926 | Bacteria | 5260 |
| 503 | Ga0207659_10055287 | 3300025926 | Bacteria | 2838 |
| 504 | Ga0207659_10111952 | 3300025926 | Bacteria | 2076 |
| 505 | Ga0207659_10180228 | 3300025926 | Bacteria | 1673 |
| 506 | Ga0207659_10182752 | 3300025926 | Bacteria | 1663 |
| 507 | Ga0207659_10341527 | 3300025926 | Bacteria | 1240 |
| 508 | Ga0207659_10351646 | 3300025926 | Bacteria | 1223 |
| 509 | Ga0207659_10438091 | 3300025926 | Bacteria | 1099 |
| 510 | Ga0207659_10627831 | 3300025926 | Bacteria | 917 |
| 511 | Ga0207687_10010576 | 3300025927 | Bacteria | 6030 |
| 512 | Ga0207687_10042407 | 3300025927 | Bacteria | 3130 |
| 513 | Ga0207687_10099426 | 3300025927 | Bacteria | 2137 |
| 514 | Ga0207687_10330053 | 3300025927 | Bacteria | 1237 |
| 515 | Ga0207644_10001383 | 3300025931 | Bacteria | 15632 |
| 516 | Ga0207644_10010956 | 3300025931 | Bacteria | 5989 |
| 517 | Ga0207644_10138546 | 3300025931 | Bacteria | 1871 |
| 518 | Ga0207644_10489248 | 3300025931 | Bacteria | 1014 |
| 519 | Ga0207644_10519047 | 3300025931 | Bacteria | 984 |
| 520 | Ga0207706_10017818 | 3300025933 | Bacteria | 6398 |
| 521 | Ga0207706_10042151 | 3300025933 | Bacteria | 4045 |
| 522 | Ga0207706_10125175 | 3300025933 | Bacteria | 2261 |
| 523 | Ga0207706_10338780 | 3300025933 | Bacteria | 1308 |
| 524 | Ga0207706_10436838 | 3300025933 | Bacteria | 1133 |
| 525 | Ga0207686_10006341 | 3300025934 | Bacteria | 6364 |
| 526 | Ga0207686_10020936 | 3300025934 | Bacteria | 3744 |
| 527 | Ga0207686_10150778 | 3300025934 | Bacteria | 1618 |
| 528 | Ga0207709_10019504 | 3300025935 | Bacteria | 3815 |
| 529 | Ga0207670_10072365 | 3300025936 | Bacteria | 2386 |
| 530 | Ga0207670_10136996 | 3300025936 | Bacteria | 1801 |
| 531 | Ga0207670_10271752 | 3300025936 | Bacteria | 1318 |
| 532 | Ga0207669_10001682 | 3300025937 | Bacteria | 9406 |
| 533 | Ga0207669_10008072 | 3300025937 | Bacteria | 4924 |
| 534 | Ga0207669_10031054 | 3300025937 | Bacteria | 2979 |
| 535 | Ga0207669_10198446 | 3300025937 | Bacteria | 1454 |
| 536 | Ga0207669_10732587 | 3300025937 | Bacteria | 815 |
| 537 | Ga0207704_10051920 | 3300025938 | Bacteria | 2483 |
| 538 | Ga0207665_10010830 | 3300025939 | Bacteria | 5987 |
| 539 | Ga0207691_10002388 | 3300025940 | Bacteria | 18369 |
| 540 | Ga0207691_10002501 | 3300025940 | Bacteria | 17980 |
| 541 | Ga0207691_10028705 | 3300025940 | Bacteria | 5206 |
| 542 | Ga0207691_10047283 | 3300025940 | Bacteria | 3948 |
| 543 | Ga0207691_10085355 | 3300025940 | Bacteria | 2833 |
| 544 | Ga0207691_10117477 | 3300025940 | Bacteria | 2360 |
| 545 | Ga0207711_10023625 | 3300025941 | Bacteria | 5147 |
| 546 | Ga0207711_10393258 | 3300025941 | Bacteria | 1287 |
| 547 | Ga0207689_10008126 | 3300025942 | Bacteria | 9153 |
| 548 | Ga0207689_10086901 | 3300025942 | Bacteria | 2569 |
| 549 | Ga0207689_10098421 | 3300025942 | Bacteria | 2403 |
| 550 | Ga0207661_10007758 | 3300025944 | Bacteria | 7642 |
| 551 | Ga0207679_10045357 | 3300025945 | Bacteria | 3178 |
| 552 | Ga0207679_10128089 | 3300025945 | Bacteria | 2032 |
| 553 | Ga0207679_10233718 | 3300025945 | Bacteria | 1554 |
| 554 | Ga0207651_10029303 | 3300025960 | Bacteria | 3486 |
| 555 | Ga0207651_10030907 | 3300025960 | Bacteria | 3417 |
| 556 | Ga0207651_10044042 | 3300025960 | Bacteria | 2983 |
| 557 | Ga0207651_10050741 | 3300025960 | Bacteria | 2819 |
| 558 | Ga0207651_10109329 | 3300025960 | Bacteria | 2071 |
| 559 | Ga0207651_10192585 | 3300025960 | Bacteria | 1627 |
| 560 | Ga0207651_10372508 | 3300025960 | Bacteria | 1208 |
| 561 | Ga0207712_10149313 | 3300025961 | Bacteria | 1803 |
| 562 | Ga0207712_10273781 | 3300025961 | Bacteria | 1375 |
| 563 | Ga0207712_10406206 | 3300025961 | Bacteria | 1146 |
| 564 | Ga0207712_11143657 | 3300025961 | Unclassified | 694 |
| 565 | Ga0207668_10173833 | 3300025972 | Bacteria | 1692 |
| 566 | Ga0207668_10218632 | 3300025972 | Bacteria | 1528 |
| 567 | Ga0207640_10592203 | 3300025981 | Bacteria | 937 |
| 568 | Ga0207658_10014143 | 3300025986 | Bacteria | 5466 |
| 569 | Ga0207658_10136890 | 3300025986 | Bacteria | 1976 |
| 570 | Ga0207658_11057546 | 3300025986 | Bacteria | 741 |
| 571 | Ga0207658_11367649 | 3300025986 | Bacteria | 648 |
| 572 | Ga0207677_10096242 | 3300026023 | Bacteria | 2166 |
| 573 | Ga0207703_10039720 | 3300026035 | Bacteria | 3762 |
| 574 | Ga0207703_10117183 | 3300026035 | Bacteria | 2281 |
| 575 | Ga0207678_10077130 | 3300026067 | Bacteria | 2854 |
| 576 | Ga0207678_10516119 | 3300026067 | Bacteria | 1043 |
| 577 | Ga0207678_10851361 | 3300026067 | Bacteria | 806 |
| 578 | Ga0207678_11040186 | 3300026067 | Bacteria | 725 |
| 579 | Ga0207708_10026855 | 3300026075 | Bacteria | 4358 |
| 580 | Ga0207708_10035413 | 3300026075 | Bacteria | 3799 |
| 581 | Ga0207708_10060464 | 3300026075 | Bacteria | 2892 |
| 582 | Ga0207708_10063996 | 3300026075 | Bacteria | 2810 |
| 583 | Ga0207708_10412034 | 3300026075 | Bacteria | 1119 |
| 584 | Ga0207708_11003099 | 3300026075 | Bacteria | 725 |
| 585 | Ga0207702_10024939 | 3300026078 | Bacteria | 4962 |
| 586 | Ga0207702_10039177 | 3300026078 | Bacteria | 3970 |
| 587 | Ga0207702_10735214 | 3300026078 | Bacteria | 973 |
| 588 | Ga0207641_10013055 | 3300026088 | Bacteria | 6813 |
| 589 | Ga0207641_10016365 | 3300026088 | Bacteria | 6071 |
| 590 | Ga0207641_10016663 | 3300026088 | Bacteria | 6017 |
| 591 | Ga0207641_10042754 | 3300026088 | Bacteria | 3802 |
| 592 | Ga0207641_10527283 | 3300026088 | Bacteria | 1149 |
| 593 | Ga0207648_10003093 | 3300026089 | Bacteria | 17578 |
| 594 | Ga0207648_10054704 | 3300026089 | Bacteria | 3485 |
| 595 | Ga0207648_10138782 | 3300026089 | Bacteria | 2142 |
| 596 | Ga0207648_10218035 | 3300026089 | Unclassified | 1695 |
| 597 | Ga0207648_10246016 | 3300026089 | Bacteria | 1594 |
| 598 | Ga0207676_10000881 | 3300026095 | Bacteria | 23317 |
| 599 | Ga0207676_10023698 | 3300026095 | Bacteria | 4533 |
| 600 | Ga0207676_10043399 | 3300026095 | Bacteria | 3462 |
| 601 | Ga0207676_10075913 | 3300026095 | Bacteria | 2713 |
| 602 | Ga0207676_10146877 | 3300026095 | Bacteria | 2026 |
| 603 | Ga0207676_10259134 | 3300026095 | Bacteria | 1569 |
| 604 | Ga0207676_10585833 | 3300026095 | Bacteria | 1070 |
| 605 | Ga0207676_10743179 | 3300026095 | Bacteria | 953 |
| 606 | Ga0207674_10057329 | 3300026116 | Bacteria | 3949 |
| 607 | Ga0207674_10400681 | 3300026116 | Bacteria | 1326 |
| 608 | Ga0207675_100013285 | 3300026118 | Bacteria | 7688 |
| 609 | Ga0207675_100017706 | 3300026118 | Bacteria | 6647 |
| 610 | Ga0207675_100039464 | 3300026118 | Bacteria | 4406 |
| 611 | Ga0207675_100047554 | 3300026118 | Bacteria | 4005 |
| 612 | Ga0207675_100135806 | 3300026118 | Bacteria | 2333 |
| 613 | Ga0207675_100213364 | 3300026118 | Bacteria | 1857 |
| 614 | Ga0207675_100861745 | 3300026118 | Bacteria | 921 |
| 615 | Ga0207683_10001982 | 3300026121 | Bacteria | 18116 |
| 616 | Ga0207683_10029975 | 3300026121 | Bacteria | 4713 |
| 617 | Ga0207683_10060121 | 3300026121 | Bacteria | 3339 |
| 618 | Ga0207683_10150402 | 3300026121 | Bacteria | 2101 |
| 619 | Ga0207683_10156372 | 3300026121 | Bacteria | 2059 |
| 620 | Ga0207683_10186772 | 3300026121 | Bacteria | 1881 |
| 621 | Ga0207683_10219559 | 3300026121 | Bacteria | 1732 |
| 622 | Ga0207683_10294142 | 3300026121 | Bacteria | 1485 |
| 623 | Ga0207683_10304561 | 3300026121 | Bacteria | 1458 |
| 624 | Ga0207683_10469585 | 3300026121 | Bacteria | 1161 |
| 625 | Ga0209588_1001197 | 3300027671 | Bacteria | 6707 |
| 626 | Ga0209588_1062266 | 3300027671 | Bacteria | 1206 |
| 627 | Ga0209971_1042278 | 3300027682 | Bacteria | 1097 |
| 628 | Ga0209813_10021546 | 3300027866 | Bacteria | 1813 |
| 629 | Ga0207428_10010695 | 3300027907 | Bacteria | 8184 |
| 630 | Ga0207428_10015486 | 3300027907 | Bacteria | 6596 |
| 631 | Ga0207428_10086811 | 3300027907 | Bacteria | 2435 |
| 632 | Ga0207428_10091287 | 3300027907 | Bacteria | 2364 |
| 633 | Ga0207428_10121070 | 3300027907 | Unclassified | 2006 |
| 634 | Ga0207428_10127367 | 3300027907 | Bacteria | 1950 |
| 635 | Ga0207428_10494480 | 3300027907 | Bacteria | 889 |
| 636 | Ga0268266_10120852 | 3300028379 | Bacteria | 2331 |
| 637 | Ga0268266_10498621 | 3300028379 | Bacteria | 1162 |
| 638 | Ga0268266_10851542 | 3300028379 | Bacteria | 881 |
| 639 | Ga0268266_10929321 | 3300028379 | Bacteria | 841 |
| 640 | Ga0268265_10027299 | 3300028380 | Bacteria | 4073 |
| 641 | Ga0268265_10063693 | 3300028380 | Bacteria | 2838 |
| 642 | Ga0268265_10144242 | 3300028380 | Bacteria | 1998 |
| 643 | Ga0268265_10340100 | 3300028380 | Bacteria | 1366 |
| 644 | Ga0268265_10673305 | 3300028380 | Bacteria | 997 |
| 645 | Ga0268265_11019859 | 3300028380 | Bacteria | 818 |
| 646 | Ga0268265_11034458 | 3300028380 | Bacteria | 813 |
| 647 | Ga0268264_10024489 | 3300028381 | Bacteria | 4928 |
| 648 | Ga0268264_10029081 | 3300028381 | Bacteria | 4525 |
| 649 | Ga0268264_10468847 | 3300028381 | Bacteria | 1223 |
| 650 | Ga0307511_10000753 | 3300030521 | Bacteria | 34607 |
| 651 | Ga0265320_10132298 | 3300031240 | Bacteria | 1133 |
| 652 | Ga0307513_10007242 | 3300031456 | Bacteria | 14407 |
| 653 | Ga0307408_100079340 | 3300031548 | Bacteria | 2449 |
| 654 | Ga0307408_100905245 | 3300031548 | Bacteria | 808 |
| 655 | Ga0316575_10062868 | 3300031665 | Bacteria | 1485 |
| 656 | Ga0265314_10002259 | 3300031711 | Bacteria | 19948 |
| 657 | Ga0307516_10438510 | 3300031730 | Bacteria | 963 |
| 658 | Ga0307405_10014597 | 3300031731 | Bacteria | 4229 |
| 659 | Ga0307405_10015195 | 3300031731 | Bacteria | 4162 |
| 660 | Ga0307405_10035416 | 3300031731 | Bacteria | 2981 |
| 661 | Ga0307413_10006412 | 3300031824 | Bacteria | 5368 |
| 662 | Ga0307413_10160631 | 3300031824 | Bacteria | 1578 |
| 663 | Ga0307518_10249959 | 3300031838 | Bacteria | 1128 |
| 664 | Ga0307410_10109505 | 3300031852 | Bacteria | 1996 |
| 665 | Ga0307410_10142863 | 3300031852 | Bacteria | 1773 |
| 666 | Ga0307410_10477230 | 3300031852 | Bacteria | 1022 |
| 667 | Ga0307407_10025679 | 3300031903 | Bacteria | 3108 |
| 668 | Ga0307407_10091770 | 3300031903 | Bacteria | 1863 |
| 669 | Ga0307412_10011434 | 3300031911 | Bacteria | 5144 |
| 670 | Ga0307412_10394406 | 3300031911 | Bacteria | 1125 |
| 671 | Ga0307409_100326842 | 3300031995 | Bacteria | 1437 |
| 672 | Ga0307409_100571376 | 3300031995 | Bacteria | 1113 |
| 673 | Ga0307416_100017210 | 3300032002 | Bacteria | 5049 |
| 674 | Ga0307416_100030947 | 3300032002 | Bacteria | 4023 |
| 675 | Ga0307414_10026496 | 3300032004 | Bacteria | 3732 |
| 676 | Ga0307414_10529761 | 3300032004 | Bacteria | 1047 |
| 677 | Ga0307411_10048678 | 3300032005 | Bacteria | 2749 |
| 678 | Ga0307411_10123136 | 3300032005 | Bacteria | 1880 |
| 679 | Ga0307415_100049190 | 3300032126 | Bacteria | 2849 |
| 680 | Ga0307415_100051773 | 3300032126 | Bacteria | 2789 |
| 681 | Ga0307507_10036513 | 3300033179 | Bacteria | 5021 |
| 682 | Ga0373938_0008859 | 3300034957 | Bacteria | 1807 |
| 683 | Ga0373952_0021108 | 3300035092 | Bacteria | 1372 |
| 684 | Ga0373939_0054799 | 3300035114 | Bacteria | 1250 |
| 685 | Ga0373955_0072642 | 3300035172 | Bacteria | 1927 |
| 686 | Ga0316574_0196335 | 3300035398 | Bacteria | 1297 |
| 687 | Ga0373931_0026585 | 3300035691 | Bacteria | 2947 |
| 688 | Ga0373933_0264667 | 3300035724 | Bacteria | 1109 |
| 689 | Ga0373937_0211861 | 3300036401 | Bacteria | 1823 |
| 690 | Ga0373937_0387602 | 3300036401 | Bacteria | 1325 |
| 691 | Ga0373937_0443544 | 3300036401 | Bacteria | 1232 |
| 692 | Ga0373925_0043043 | 3300037068 | Bacteria | 3351 |
| 693 | Ga0373925_0229822 | 3300037068 | Bacteria | 1483 |
| 694 | Ga0395898_0077282 | 3300037466 | Bacteria | 3214 |
| 695 | Ga0436364_1036432 | 3300037853 | Bacteria | 2248 |
| 696 | Ga0395901_0233293 | 3300038443 | Bacteria | 1921 |
| 697 | Ga0395901_0540294 | 3300038443 | Bacteria | 1182 |
| 698 | Ga0436365_0897074 | 3300039437 | Bacteria | 6301 |
| 699 | Ga0439461_0074718 | 3300041410 | Bacteria | 791 |
| 700 | Ga0451800_0886097 | 3300041459 | Bacteria | 964 |
| 701 | Ga0451833_0106998 | 3300041491 | Bacteria | 2216 |
| 702 | Ga0451833_0113201 | 3300041491 | Bacteria | 986 |
| 703 | Ga0451835_0659563 | 3300041492 | Bacteria | 1591 |
| 704 | Ga0451837_1544089 | 3300041494 | Bacteria | 987 |
| 705 | Ga0451841_1451426 | 3300041498 | Unclassified | 1630 |
| 706 | Ga0451845_0982859 | 3300041501 | Bacteria | 1336 |
| 707 | Ga0451847_0527546 | 3300041503 | Bacteria | 883 |
| 708 | Ga0451849_0684911 | 3300041505 | Bacteria | 1059 |
| 709 | Ga0451853_0301670 | 3300041512 | Bacteria | 2337 |
| 710 | Ga0451853_0751866 | 3300041512 | Bacteria | 6538 |
| 711 | Ga0451853_0912580 | 3300041512 | Bacteria | 1868 |
| 712 | Ga0451853_1156423 | 3300041512 | Bacteria | 2182 |
| 713 | Ga0439441_001360 | 3300042001 | Bacteria | 3166 |
| 714 | Ga0439441_021743 | 3300042001 | Bacteria | 1187 |
| 715 | Ga0439455_0025760 | 3300042012 | Bacteria | 1431 |
| 716 | Ga0450894_025984 | 3300042131 | Bacteria | 803 |
| 717 | Ga0450903_000057 | 3300042138 | Bacteria | 22728 |
| 718 | Ga0450905_015167 | 3300042142 | Bacteria | 1104 |
| 719 | Ga0439458_0000582 | 3300042157 | Bacteria | 9402 |
| 720 | Ga0439458_0087065 | 3300042157 | Bacteria | 801 |
| 721 | Ga0439458_0097807 | 3300042157 | Bacteria | 760 |
| 722 | Ga0439435_0175842 | 3300042436 | Bacteria | 697 |
| 723 | Ga0451577_0217584 | 3300042876 | Bacteria | 1726 |
| 724 | Ga0439440_0047346 | 3300042993 | Bacteria | 1065 |
| 725 | Ga0466963_0044773 | 3300044694 | Bacteria | 2913 |
| 726 | Ga0466963_0193507 | 3300044694 | Bacteria | 1421 |
| 727 | Ga0466963_0255863 | 3300044694 | Bacteria | 1229 |
| 728 | Ga0466963_0359694 | 3300044694 | Bacteria | 1025 |
| 729 | Ga0466957_0029088 | 3300044842 | Bacteria | 3293 |
| 730 | Ga0466957_0166653 | 3300044842 | Bacteria | 1433 |
| 731 | Ga0451576_0036785 | 3300045051 | Bacteria | 5187 |
| 732 | Ga0451576_0122617 | 3300045051 | Bacteria | 2706 |
| 733 | Ga0451576_0212864 | 3300045051 | Bacteria | 2018 |
| 734 | Ga0451576_0425588 | 3300045051 | Bacteria | 1393 |
| 735 | Ga0451576_0573630 | 3300045051 | Bacteria | 1185 |
| 736 | Ga0466958_0094533 | 3300045836 | Bacteria | 1852 |
| 737 | Ga0466967_0000816 | 3300045976 | Bacteria | 16359 |
| 738 | Ga0466967_0025195 | 3300045976 | Bacteria | 4902 |
| 739 | Ga0466967_0144481 | 3300045976 | Bacteria | 2218 |
| 740 | Ga0466967_0546623 | 3300045976 | Bacteria | 1140 |
| 741 | Ga0466967_0656997 | 3300045976 | Bacteria | 1037 |
| 742 | Ga0495603_0099165 | 3300046455 | Bacteria | 1701 |
| 743 | Ga0495590_0003033 | 3300046457 | Bacteria | 6884 |
| 744 | Ga0495591_001035 | 3300046458 | Bacteria | 18772 |
| 745 | Ga0495629_0001977 | 3300046459 | Bacteria | 15974 |
| 746 | Ga0495629_0015038 | 3300046459 | Bacteria | 5562 |
| 747 | Ga0495638_0028495 | 3300046460 | Bacteria | 3605 |
| 748 | Ga0495638_0065401 | 3300046460 | Bacteria | 2238 |
| 749 | Ga0495641_0160117 | 3300046461 | Bacteria | 1007 |
| 750 | Ga0495651_0005248 | 3300046462 | Bacteria | 9875 |
| 751 | Ga0495651_0268289 | 3300046462 | Bacteria | 1158 |
| 752 | Ga0495651_0601545 | 3300046462 | Bacteria | 694 |
| 753 | Ga0495653_0069531 | 3300046463 | Bacteria | 2637 |
| 754 | Ga0495653_0160337 | 3300046463 | Bacteria | 1562 |
| 755 | Ga0495650_0091868 | 3300046471 | Bacteria | 1153 |
| 756 | Ga0495580_0037031 | 3300046472 | Bacteria | 3502 |
| 757 | Ga0495582_0090462 | 3300046473 | Unclassified | 1706 |
| 758 | Ga0495582_0309051 | 3300046473 | Bacteria | 909 |
| 759 | Ga0495605_0000934 | 3300046474 | Bacteria | 20011 |
| 760 | Ga0495605_0010293 | 3300046474 | Bacteria | 5236 |
| 761 | Ga0495664_0008090 | 3300046477 | Bacteria | 5855 |
| 762 | Ga0495585_0011450 | 3300046492 | Bacteria | 5246 |
| 763 | Ga0495596_0005499 | 3300046500 | Bacteria | 5972 |
| 764 | Ga0495596_0115288 | 3300046500 | Bacteria | 1043 |
| 765 | Ga0495607_0036690 | 3300046501 | Bacteria | 2951 |
| 766 | Ga0495583_0084127 | 3300046506 | Bacteria | 1379 |
| 767 | Ga0495606_0100852 | 3300046507 | Bacteria | 1758 |
| 768 | Ga0495608_0047546 | 3300046511 | Bacteria | 2852 |
| 769 | Ga0495618_0027141 | 3300046514 | Bacteria | 3564 |
| 770 | Ga0495618_0233666 | 3300046514 | Bacteria | 1157 |
| 771 | Ga0495620_0073462 | 3300046515 | Bacteria | 1394 |
| 772 | Ga0495628_0111598 | 3300046516 | Unclassified | 2102 |
| 773 | Ga0495630_0068242 | 3300046517 | Bacteria | 2673 |
| 774 | Ga0495643_0215155 | 3300046522 | Bacteria | 915 |
| 775 | Ga0495644_0090261 | 3300046523 | Bacteria | 1156 |
| 776 | Ga0495648_0110409 | 3300046524 | Unclassified | 1497 |
| 777 | Ga0495663_0031396 | 3300046525 | Bacteria | 1578 |
| 778 | Ga0495666_0027494 | 3300046526 | Unclassified | 2799 |
| 779 | Ga0495642_0066665 | 3300046528 | Bacteria | 1500 |
| 780 | Ga0495642_0074851 | 3300046528 | Bacteria | 1420 |
| 781 | Ga0495652_0166497 | 3300046529 | Unclassified | 1705 |
| 782 | Ga0495652_0369207 | 3300046529 | Bacteria | 1023 |
| 783 | Ga0495665_0002074 | 3300046531 | Bacteria | 10844 |
| 784 | Ga0495665_0178497 | 3300046531 | Bacteria | 1104 |
| 785 | Ga0495640_0005656 | 3300046533 | Bacteria | 9941 |
| 786 | Ga0495586_0047806 | 3300046535 | Bacteria | 2311 |
| 787 | Ga0495586_0166608 | 3300046535 | Bacteria | 1244 |
| 788 | Ga0495598_0008709 | 3300046537 | Bacteria | 2372 |
| 789 | Ga0495621_0012727 | 3300046539 | Bacteria | 2628 |
| 790 | Ga0495597_0003168 | 3300046542 | Bacteria | 9835 |
| 791 | Ga0495667_0108041 | 3300046559 | Bacteria | 1798 |
| 792 | Ga0495656_0054209 | 3300046615 | Bacteria | 1725 |
| 793 | Ga0495611_0149401 | 3300046648 | Bacteria | 1091 |
| 794 | Ga0495625_0416655 | 3300046660 | Bacteria | 836 |
| 795 | Ga0495625_0460319 | 3300046660 | Bacteria | 784 |
| 796 | Ga0495635_0041581 | 3300046663 | Bacteria | 3175 |
| 797 | Ga0495661_0085354 | 3300046665 | Unclassified | 1809 |
| 798 | Ga0495588_0223461 | 3300046674 | Bacteria | 994 |
| 799 | Ga0495588_0346391 | 3300046674 | Bacteria | 781 |
| 800 | Ga0495599_0225155 | 3300046678 | Unclassified | 1146 |
| 801 | Ga0495623_0003527 | 3300046679 | Bacteria | 10356 |
| 802 | Ga0495646_0048950 | 3300046680 | Bacteria | 2566 |
| 803 | Ga0495647_0053054 | 3300046681 | Bacteria | 1580 |
| 804 | Ga0495647_0064337 | 3300046681 | Bacteria | 1454 |
| 805 | Ga0495658_0024122 | 3300046683 | Bacteria | 3236 |
| 806 | Ga0495658_0026743 | 3300046683 | Bacteria | 3096 |
| 807 | Ga0495658_0208941 | 3300046683 | Bacteria | 1219 |
| 808 | Ga0495669_0000700 | 3300046684 | Bacteria | 14630 |
| 809 | Ga0495669_0000910 | 3300046684 | Bacteria | 12403 |
| 810 | Ga0495613_0070806 | 3300046689 | Bacteria | 2542 |
| 811 | Ga0495613_0640866 | 3300046689 | Bacteria | 704 |
| 812 | Ga0495624_0318665 | 3300046690 | Bacteria | 936 |
| 813 | Ga0495670_0008683 | 3300046691 | Bacteria | 5001 |
| 814 | Ga0495671_0034390 | 3300046692 | Bacteria | 2577 |
| 815 | Ga0495649_0086290 | 3300046694 | Bacteria | 1675 |
| 816 | Ga0495589_0007026 | 3300046794 | Bacteria | 5905 |
| 817 | Ga0495589_0029041 | 3300046794 | Bacteria | 2788 |
| 818 | Ga0495589_0037586 | 3300046794 | Bacteria | 2425 |
| 819 | Ga0495600_0002767 | 3300046809 | Bacteria | 10167 |
| 820 | Ga0495581_0137766 | 3300047315 | Unclassified | 1423 |
| 821 | Ga0495636_0024130 | 3300047318 | Bacteria | 2464 |
| 822 | Ga0495674_0032323 | 3300047319 | Bacteria | 4746 |
| 823 | Ga0495674_0071538 | 3300047319 | Bacteria | 2993 |
| 824 | Ga0495674_0274251 | 3300047319 | Bacteria | 1383 |
| 825 | Ga0495674_0598746 | 3300047319 | Bacteria | 873 |
| 826 | Ga0495676_0004511 | 3300047321 | Bacteria | 12733 |
| 827 | Ga0495676_0029551 | 3300047321 | Bacteria | 4665 |
| 828 | Ga0495680_0494148 | 3300047322 | Bacteria | 831 |
| 829 | Ga0495683_0003800 | 3300047323 | Bacteria | 8718 |
| 830 | Ga0495683_0008921 | 3300047323 | Bacteria | 5351 |
| 831 | Ga0495675_0000565 | 3300047444 | Bacteria | 23906 |
| 832 | Ga0495675_0282685 | 3300047444 | Bacteria | 989 |
| 833 | Ga0495677_0232995 | 3300047445 | Bacteria | 718 |
| 834 | Ga0495679_004891 | 3300047446 | Bacteria | 6047 |
| 835 | Ga0495679_041605 | 3300047446 | Bacteria | 1422 |
| 836 | Ga0495685_050243 | 3300047447 | Bacteria | 1415 |
| 837 | Ga0495673_0005324 | 3300047469 | Bacteria | 7806 |
| 838 | Ga0495684_0076879 | 3300047471 | Bacteria | 2535 |
| 839 | Ga0495593_0004290 | 3300047673 | Bacteria | 8477 |
| 840 | Ga0495614_0010984 | 3300048089 | Bacteria | 3984 |
| 841 | Ga0495614_0029926 | 3300048089 | Bacteria | 2343 |
| 842 | Ga0495626_0151335 | 3300048091 | Bacteria | 978 |
| 843 | Ga0496100_0004806 | 3300048903 | Bacteria | 7216 |
| 844 | Ga0496100_0019087 | 3300048903 | Bacteria | 4083 |
| 845 | Ga0496100_0019193 | 3300048903 | Bacteria | 4073 |
| 846 | Ga0496100_0049972 | 3300048903 | Bacteria | 2707 |
| 847 | Ga0496100_0261046 | 3300048903 | Bacteria | 1284 |
| 848 | Ga0496101_0002482 | 3300048904 | Bacteria | 11324 |
| 849 | Ga0496101_0021889 | 3300048904 | Bacteria | 4393 |
| 850 | Ga0496101_0123812 | 3300048904 | Bacteria | 1957 |
| 851 | Ga0496101_0155205 | 3300048904 | Bacteria | 1753 |
| 852 | Ga0496101_0309097 | 3300048904 | Bacteria | 1239 |
| 853 | Ga0496101_0425349 | 3300048904 | Bacteria | 1047 |
| 854 | Ga0496102_0008128 | 3300048905 | Bacteria | 8978 |
| 855 | Ga0496102_0013990 | 3300048905 | Bacteria | 6966 |
| 856 | Ga0496102_0054604 | 3300048905 | Bacteria | 3643 |
| 857 | Ga0496102_0140040 | 3300048905 | Bacteria | 2268 |
| 858 | Ga0496102_0190365 | 3300048905 | Bacteria | 1933 |
| 859 | Ga0496102_0676745 | 3300048905 | Bacteria | 955 |
| 860 | Ga0496102_0771723 | 3300048905 | Bacteria | 884 |
| 861 | Ga0496103_0005096 | 3300048906 | Bacteria | 7914 |
| 862 | Ga0496103_0009801 | 3300048906 | Bacteria | 5672 |
| 863 | Ga0496103_0180849 | 3300048906 | Bacteria | 1355 |
| 864 | Ga0496104_0000254 | 3300048907 | Bacteria | 47479 |
| 865 | Ga0496104_0109985 | 3300048907 | Bacteria | 2641 |
| 866 | Ga0496104_0116676 | 3300048907 | Bacteria | 2562 |
| 867 | Ga0496104_0237288 | 3300048907 | Bacteria | 1735 |
| 868 | Ga0496104_0492963 | 3300048907 | Bacteria | 1136 |
| 869 | Ga0496105_0000055 | 3300048908 | Bacteria | 88389 |
| 870 | Ga0496105_0057708 | 3300048908 | Bacteria | 3205 |
| 871 | Ga0496105_0131065 | 3300048908 | Bacteria | 2067 |
| 872 | Ga0496105_0173723 | 3300048908 | Bacteria | 1766 |
| 873 | Ga0496105_0191675 | 3300048908 | Bacteria | 1671 |
| 874 | Ga0496105_0309968 | 3300048908 | Bacteria | 1267 |
| 875 | Ga0496106_0016808 | 3300048909 | Bacteria | 5412 |
| 876 | Ga0496106_0030254 | 3300048909 | Bacteria | 4038 |
| 877 | Ga0496106_0588380 | 3300048909 | Bacteria | 892 |
| 878 | Ga0496107_0072351 | 3300048910 | Bacteria | 2506 |
| 879 | Ga0496108_0004970 | 3300048911 | Bacteria | 10746 |
| 880 | Ga0496108_0193806 | 3300048911 | Bacteria | 1762 |
| 881 | Ga0496108_0477731 | 3300048911 | Bacteria | 1089 |
| 882 | Ga0496108_0571444 | 3300048911 | Bacteria | 986 |
| 883 | Ga0496109_0001932 | 3300048912 | Bacteria | 17223 |
| 884 | Ga0496109_0032387 | 3300048912 | Bacteria | 4699 |
| 885 | Ga0496109_0058727 | 3300048912 | Bacteria | 3514 |
| 886 | Ga0496109_0131121 | 3300048912 | Bacteria | 2339 |
| 887 | Ga0496109_0147363 | 3300048912 | Bacteria | 2203 |
| 888 | Ga0496109_0235468 | 3300048912 | Bacteria | 1723 |
| 889 | Ga0496109_0299021 | 3300048912 | Bacteria | 1517 |
| 890 | Ga0496109_0306005 | 3300048912 | Bacteria | 1499 |
| 891 | Ga0496109_0341261 | 3300048912 | Bacteria | 1414 |
| 892 | Ga0496110_0001472 | 3300048913 | Bacteria | 17050 |
| 893 | Ga0496110_0039557 | 3300048913 | Bacteria | 4106 |
| 894 | Ga0496110_0041197 | 3300048913 | Bacteria | 4029 |
| 895 | Ga0496110_0359531 | 3300048913 | Bacteria | 1326 |
| 896 | Ga0496110_0433090 | 3300048913 | Bacteria | 1199 |
| 897 | Ga0496111_0000582 | 3300048914 | Bacteria | 19124 |
| 898 | Ga0496111_0008397 | 3300048914 | Bacteria | 6832 |
| 899 | Ga0496111_0014348 | 3300048914 | Bacteria | 5410 |
| 900 | Ga0496111_0194248 | 3300048914 | Bacteria | 1509 |
| 901 | Ga0496112_0003831 | 3300048915 | Bacteria | 12562 |
| 902 | Ga0496112_0017806 | 3300048915 | Bacteria | 6686 |
| 903 | Ga0496112_0050753 | 3300048915 | Bacteria | 4068 |
| 904 | Ga0496112_0173777 | 3300048915 | Bacteria | 2120 |
| 905 | Ga0496113_0003115 | 3300048916 | Bacteria | 9861 |
| 906 | Ga0496113_0163173 | 3300048916 | Bacteria | 1762 |
| 907 | Ga0496113_0241533 | 3300048916 | Bacteria | 1441 |
| 908 | Ga0496114_0000256 | 3300048917 | Bacteria | 38442 |
| 909 | Ga0496114_0002392 | 3300048917 | Bacteria | 14278 |
| 910 | Ga0496114_0010753 | 3300048917 | Bacteria | 7283 |
| 911 | Ga0496114_0023237 | 3300048917 | Bacteria | 5058 |
| 912 | Ga0496115_0014234 | 3300048918 | Bacteria | 6020 |
| 913 | Ga0496115_0057171 | 3300048918 | Bacteria | 3137 |
| 914 | Ga0496115_0239039 | 3300048918 | Bacteria | 1497 |
| 915 | Ga0496116_0017931 | 3300048919 | Bacteria | 5474 |
| 916 | Ga0496117_0043335 | 3300048920 | Bacteria | 3273 |
| 917 | Ga0496118_0043853 | 3300048921 | Bacteria | 3510 |
| 918 | Ga0496119_0034893 | 3300048922 | Bacteria | 3303 |
| 919 | Ga0496121_0288112 | 3300048924 | Bacteria | 1120 |
| 920 | Ga0496122_0006936 | 3300048925 | Bacteria | 12779 |
| 921 | Ga0496122_0021302 | 3300048925 | Bacteria | 5808 |
| 922 | Ga0496123_0036840 | 3300048926 | Bacteria | 3461 |
| 923 | Ga0496123_0063746 | 3300048926 | Bacteria | 2352 |
| 924 | Ga0496124_0007274 | 3300048927 | Bacteria | 11809 |
| 925 | Ga0496125_0149213 | 3300048928 | Bacteria | 1609 |
| 926 | Ga0495678_120675 | 3300049459 | Bacteria | 881 |
| 927 | Ga0495678_155781 | 3300049459 | Bacteria | 734 |
| 928 | Ga0495682_0019468 | 3300049460 | Bacteria | 2552 |
| 929 | Ga0501036_0071471 | 3300049572 | Bacteria | 2934 |
| 930 | Ga0501036_0516667 | 3300049572 | Bacteria | 993 |
| 931 | Ga0501038_0929688 | 3300049574 | Bacteria | 641 |
| 932 | Ga0501039_0015411 | 3300049575 | Bacteria | 5851 |
| 933 | Ga0501040_0232926 | 3300049576 | Bacteria | 1312 |
| 934 | Ga0501041_0041077 | 3300049577 | Bacteria | 2808 |
| 935 | Ga0501041_0087947 | 3300049577 | Bacteria | 1918 |
| 936 | Ga0501042_0216076 | 3300049578 | Bacteria | 1383 |
| 937 | Ga0501042_0262230 | 3300049578 | Bacteria | 1247 |
| 938 | Ga0501042_0282845 | 3300049578 | Bacteria | 1198 |
| 939 | Ga0501043_0594918 | 3300049579 | Bacteria | 818 |
| 940 | Ga0501046_0061065 | 3300049580 | Bacteria | 2949 |
| 941 | Ga0501046_0095129 | 3300049580 | Bacteria | 2289 |
| 942 | Ga0501046_0646507 | 3300049580 | Bacteria | 748 |
| 943 | Ga0501068_0456634 | 3300049584 | Bacteria | 827 |
| 944 | Ga0501068_0660744 | 3300049584 | Bacteria | 683 |
| 945 | Ga0501070_0384482 | 3300049586 | Bacteria | 1137 |
| 946 | Ga0501071_0114502 | 3300049587 | Bacteria | 1995 |
| 947 | Ga0501072_0043951 | 3300049588 | Bacteria | 3512 |
| 948 | Ga0501072_0104955 | 3300049588 | Bacteria | 2247 |
| 949 | Ga0501072_0340127 | 3300049588 | Bacteria | 1192 |
| 950 | Ga0501072_0479312 | 3300049588 | Bacteria | 984 |
| 951 | Ga0501073_0112136 | 3300049589 | Bacteria | 1892 |
| 952 | Ga0501074_0116165 | 3300049590 | Bacteria | 1914 |
| 953 | Ga0501075_0044302 | 3300049591 | Bacteria | 3338 |
| 954 | Ga0501075_0048868 | 3300049591 | Bacteria | 3179 |
| 955 | Ga0501075_0156544 | 3300049591 | Bacteria | 1737 |
| 956 | Ga0501077_0132464 | 3300049593 | Bacteria | 1581 |
| 957 | Ga0501079_0045574 | 3300049741 | Bacteria | 3384 |
| 958 | Ga0501079_0161403 | 3300049741 | Bacteria | 1748 |
| 959 | Ga0501080_0092730 | 3300049742 | Bacteria | 2805 |
| 960 | Ga0501080_0901047 | 3300049742 | Bacteria | 771 |
| 961 | Ga0501081_0168045 | 3300049743 | Bacteria | 1583 |
| 962 | Ga0501081_0230254 | 3300049743 | Bacteria | 1349 |
| 963 | Ga0501081_0234212 | 3300049743 | Bacteria | 1338 |
| 964 | Ga0501081_0419559 | 3300049743 | Bacteria | 992 |
| 965 | Ga0501081_0475767 | 3300049743 | Bacteria | 929 |
| 966 | Ga0501045_0002197 | 3300049824 | Bacteria | 13227 |
| 967 | Ga0501045_0251204 | 3300049824 | Bacteria | 1316 |
| 968 | nmdc:mga0yw44_132265_c1 | 3300050492 | Bacteria | 1616 |
| 969 | nmdc:mga0k408_135494_c1 | 3300050493 | Bacteria | 1463 |
| 970 | nmdc:mga06z11_280989_c1 | 3300050494 | Bacteria | 986 |
| 971 | nmdc:mga06z11_577633_c1 | 3300050494 | Bacteria | 683 |
| 972 | nmdc:mga06z11_679_c1 | 3300050494 | Bacteria | 12406 |
| 973 | nmdc:mga04h51_20907_c1 | 3300050495 | Bacteria | 1962 |
| 974 | nmdc:mga07m45_254691_c1 | 3300050496 | Bacteria | 1021 |
| 975 | nmdc:mga05p37_1561296_c1 | 3300050507 | Bacteria | 653 |
| 976 | nmdc:mga05p37_19865_c1 | 3300050507 | Bacteria | 8128 |
| 977 | nmdc:mga05p37_244386_c1 | 3300050507 | Bacteria | 2156 |
| 978 | nmdc:mga05p37_31350_c1 | 3300050507 | Bacteria | 6493 |
| 979 | nmdc:mga05p37_501778_c1 | 3300050507 | Bacteria | 1392 |
| 980 | nmdc:mga05p37_77_c1 | 3300050507 | Bacteria | 86224 |
| 981 | nmdc:mga05p37_931815_c1 | 3300050507 | Unclassified | 932 |
| 982 | nmdc:mga09592_13099_c1 | 3300050508 | Bacteria | 4949 |
| 983 | nmdc:mga09592_15462_c1 | 3300050508 | Bacteria | 6236 |
| 984 | nmdc:mga09592_184713_c1 | 3300050508 | Bacteria | 1804 |
| 985 | nmdc:mga09592_355_c1 | 3300050508 | Bacteria | 33629 |
| 986 | nmdc:mga09592_71811_c1 | 3300050508 | Bacteria | 2938 |
| 987 | nmdc:mga0qj67_1010_c1 | 3300050509 | Bacteria | 19413 |
| 988 | nmdc:mga0qj67_24922_c1 | 3300050509 | Bacteria | 4616 |
| 989 | nmdc:mga0qj67_278487_c1 | 3300050509 | Bacteria | 1356 |
| 990 | nmdc:mga0qj67_6148_c1 | 3300050509 | Bacteria | 4271 |
| 991 | nmdc:mga06r32_11689_c1 | 3300050510 | Bacteria | 7902 |
| 992 | nmdc:mga06r32_13206_c1 | 3300050510 | Bacteria | 7480 |
| 993 | nmdc:mga06r32_19481_c1 | 3300050510 | Bacteria | 6229 |
| 994 | nmdc:mga06r32_3055_c1 | 3300050510 | Bacteria | 14984 |
| 995 | nmdc:mga06r32_34053_c1 | 3300050510 | Bacteria | 4802 |
| 996 | nmdc:mga06r32_479995_c1 | 3300050510 | Bacteria | 1221 |
| 997 | nmdc:mga06r32_48368_c1 | 3300050510 | Bacteria | 4064 |
| 998 | nmdc:mga06r32_7651_c1 | 3300050510 | Bacteria | 9715 |
| 999 | nmdc:mga08y16_1023228_c1 | 3300050511 | Bacteria | 805 |
| 1000 | nmdc:mga08y16_11017_c1 | 3300050511 | Bacteria | 9494 |
| 1001 | nmdc:mga08y16_136746_c1 | 3300050511 | Bacteria | 2547 |
| 1002 | nmdc:mga08y16_1998_c1 | 3300050511 | Bacteria | 20844 |
| 1003 | nmdc:mga08y16_23677_c1 | 3300050511 | Bacteria | 6484 |
| 1004 | nmdc:mga08y16_28383_c1 | 3300050511 | Bacteria | 5899 |
| 1005 | nmdc:mga08y16_337277_c1 | 3300050511 | Bacteria | 1550 |
| 1006 | nmdc:mga08y16_34274_c1 | 3300050511 | Bacteria | 5333 |
| 1007 | nmdc:mga08y16_465022_c1 | 3300050511 | Bacteria | 1289 |
| 1008 | nmdc:mga08y16_5088_c1 | 3300050511 | Bacteria | 13743 |
| 1009 | nmdc:mga08y16_529794_c1 | 3300050511 | Bacteria | 1194 |
| 1010 | nmdc:mga08y16_534504_c1 | 3300050511 | Bacteria | 1188 |
| 1011 | nmdc:mga0n895_221418_c1 | 3300050512 | Bacteria | 1921 |
| 1012 | nmdc:mga0n895_2763_c1 | 3300050512 | Bacteria | 13867 |
| 1013 | nmdc:mga0n895_314639_c1 | 3300050512 | Bacteria | 1586 |
| 1014 | nmdc:mga0n895_323329_c1 | 3300050512 | Bacteria | 1563 |
| 1015 | nmdc:mga0n895_38591_c1 | 3300050512 | Bacteria | 4629 |
| 1016 | nmdc:mga0n895_670615_c1 | 3300050512 | Bacteria | 1034 |
| 1017 | nmdc:mga0rr50_223001_c1 | 3300050513 | Unclassified | 1557 |
| 1018 | nmdc:mga0rr50_419358_c1 | 3300050513 | Bacteria | 1132 |
| 1019 | nmdc:mga0rr50_43386_c1 | 3300050513 | Bacteria | 3291 |
| 1020 | nmdc:mga08x19_424945_c1 | 3300050514 | Bacteria | 934 |
| 1021 | nmdc:mga0a205_1255_c1 | 3300050515 | Bacteria | 21291 |
| 1022 | nmdc:mga0a205_139416_c1 | 3300050515 | Bacteria | 2325 |
| 1023 | nmdc:mga0a205_172419_c1 | 3300050515 | Bacteria | 2059 |
| 1024 | nmdc:mga0a205_282111_c1 | 3300050515 | Bacteria | 1536 |
| 1025 | nmdc:mga0a205_38623_c2 | 3300050515 | Bacteria | 2250 |
| 1026 | nmdc:mga0sz30_10569_c2 | 3300050516 | Bacteria | 2516 |
| 1027 | Ga0495595_0447612 | 3300053084 | Bacteria | 656 |
| 1028 | Ga0500646_0002708 | 3300053090 | Bacteria | 4576 |
| 1029 | Ga0500583_0143396 | 3300053092 | Bacteria | 1187 |
| 1030 | Ga0500641_0013330 | 3300053096 | Bacteria | 3019 |
| 1031 | Ga0500555_015156 | 3300053103 | Bacteria | 2223 |
| 1032 | Ga0500655_018992 | 3300053133 | Bacteria | 1278 |
| 1033 | Ga0500568_0036062 | 3300053139 | Bacteria | 2015 |
| 1034 | Ga0500577_0041098 | 3300053142 | Bacteria | 1685 |
| 1035 | Ga0500588_0022165 | 3300053146 | Bacteria | 1726 |
| 1036 | Ga0500604_0001071 | 3300053151 | Bacteria | 7638 |
| 1037 | Ga0500616_0112259 | 3300053153 | Bacteria | 1315 |
| 1038 | Ga0500616_0222851 | 3300053153 | Bacteria | 821 |
| 1039 | Ga0500622_0262428 | 3300053156 | Bacteria | 753 |
| 1040 | Ga0501084_0051953 | 3300054114 | Bacteria | 3430 |
| 1041 | Ga0501082_0424376 | 3300060353 | Bacteria | 1161 |
| 1042 | Ga0530510_0002185 | 3300061734 | Bacteria | 13421 |
| 1043 | 2515683618 | 2515154122 | Bacteria | 8609520 |
| 1044 | 2559426437 | 2558860280 | Bacteria | 11429938 |
| 1045 | 2585318149 | 2582581314 | Bacteria | 11452267 |
| 1046 | 2644267346 | 2643221647 | Bacteria | 10741251 |
| 1047 | 2753266154 | 2751185782 | Bacteria | 11227053 |
| 1048 | 2786673840 | 2786546132 | Bacteria | 10419719 |
| 1049 | 2792841141 | 2791355137 | Bacteria | 9654227 |
| 1050 | 2862385991 | 2862382967 | Bacteria | 10317375 |
| 1051 | 2877676336 | 2877676314 | Bacteria | 9512378 |
| 1052 | 2895517722 | 2895511927 | Bacteria | 6802080 |
| 1053 | 2902685056 | 2902682994 | Bacteria | 8951596 |
| 1054 | 2904485921 | 2904483920 | Bacteria | 7545285 |
| 1055 | 2919532694 | 2919527303 | Bacteria | 7718827 |
| 1056 | 2954700888 | 2954691527 | Bacteria | 10720516 |
| 1057 | 2954706458 | 2954701450 | Bacteria | 10834262 |
| 1058 | 8008559133 | 8008558824 | Bacteria | 10610750 |
| 1059 | Ga0070694_100613846 | |||
| 1060 | JGI24739J22299_10107787 | |||
| 1061 | JGI24737J22298_10112773 | |||
| 1062 | JGI24735J21928_10018386 | |||
| 1063 | JGI25156J39149_1000248 | |||
| 1064 | JGI25406J46586_10002668 | |||
| 1065 | JGI25406J46586_10003549 | |||
| 1066 | JGI25406J46586_10007672 | |||
| 1067 | JGI25165J46597_1000574 | |||
| 1068 | Ga0055533_1000072 | |||
| 1069 | Ga0055532_1000013 | |||
| 1070 | Ga0055525_1007827 | |||
| 1071 | Ga0055527_1000010 | |||
| 1072 | Ga0055535_1000010 | |||
| 1073 | Ga0055542_1000016 | |||
| 1074 | Ga0055542_1026608 | |||
| 1075 | Ga0055529_1000012 | |||
| 1076 | Ga0065714_10091560 | |||
| 1077 | Ga0065704_10083607 | |||
| 1078 | Ga0065712_10006820 | |||
| 1079 | Ga0065712_10016138 | |||
| 1080 | Ga0065712_10070478 | |||
| 1081 | Ga0065712_10231442 | |||
| 1082 | Ga0065715_10012428 | |||
| 1083 | Ga0065715_10180962 | |||
| 1084 | Ga0065715_10386856 | |||
| 1085 | Ga0065715_10424106 | |||
| 1086 | Ga0065707_10053290 | |||
| 1087 | Ga0065707_10101782 | |||
| 1088 | Ga0065707_10119254 | |||
| 1089 | Ga0065707_10156092 | |||
| 1090 | Ga0070658_10407788 | |||
| 1091 | Ga0070658_10689235 | |||
| 1092 | Ga0070676_10002320 | |||
| 1093 | Ga0070676_10003564 | |||
| 1094 | Ga0070676_10481106 | |||
| 1095 | Ga0070683_100001511 | |||
| 1096 | Ga0070683_100093027 | |||
| 1097 | Ga0070690_100045970 | |||
| 1098 | Ga0070670_100004942 | |||
| 1099 | Ga0070670_100008476 | |||
| 1100 | Ga0070670_100015711 | |||
| 1101 | Ga0070670_100016749 | |||
| 1102 | Ga0070670_100025631 | |||
| 1103 | Ga0070670_100040227 | |||
| 1104 | Ga0070670_100140073 | |||
| 1105 | Ga0070677_10001442 | |||
| 1106 | Ga0070677_10012697 | |||
| 1107 | Ga0070677_10016155 | |||
| 1108 | Ga0070677_10054133 | |||
| 1109 | Ga0070677_10057448 | |||
| 1110 | Ga0070677_10170562 | |||
| 1111 | Ga0068869_100000636 | |||
| 1112 | Ga0068869_100010733 | |||
| 1113 | Ga0070666_10037394 | |||
| 1114 | Ga0070666_10098969 | |||
| 1115 | Ga0070666_10159326 | |||
| 1116 | Ga0070666_10617191 | |||
| 1117 | Ga0070680_100425508 | |||
| 1118 | Ga0070680_100742470 | |||
| 1119 | Ga0070682_100133645 | |||
| 1120 | Ga0068868_100005280 | |||
| 1121 | Ga0068868_100051330 | |||
| 1122 | Ga0068868_100285549 | |||
| 1123 | Ga0068868_100385215 | |||
| 1124 | Ga0070660_100155954 | |||
| 1125 | Ga0070689_100022070 | |||
| 1126 | Ga0070689_100070852 | |||
| 1127 | Ga0070689_100071477 | |||
| 1128 | Ga0070689_100133773 | |||
| 1129 | Ga0070691_10191866 | |||
| 1130 | Ga0070687_100162866 | |||
| 1131 | Ga0070687_100235737 | |||
| 1132 | Ga0070687_100454371 | |||
| 1133 | Ga0070687_100497900 | |||
| 1134 | Ga0070661_100097788 | |||
| 1135 | Ga0070661_100760269 | |||
| 1136 | Ga0070661_100784227 | |||
| 1137 | Ga0070692_10418763 | |||
| 1138 | Ga0070668_100011962 | |||
| 1139 | Ga0070668_100054514 | |||
| 1140 | Ga0070668_100125172 | |||
| 1141 | Ga0070668_100495818 | |||
| 1142 | Ga0070669_100044184 | |||
| 1143 | Ga0070669_100089680 | |||
| 1144 | Ga0070669_100130402 | |||
| 1145 | Ga0070669_100137887 | |||
| 1146 | Ga0070669_100534833 | |||
| 1147 | Ga0070675_100002214 | |||
| 1148 | Ga0070675_100020327 | |||
| 1149 | Ga0070675_100021755 | |||
| 1150 | Ga0070675_100029636 | |||
| 1151 | Ga0070675_100058127 | |||
| 1152 | Ga0070675_100072500 | |||
| 1153 | Ga0070675_100082834 | |||
| 1154 | Ga0070671_100001454 | |||
| 1155 | Ga0070671_100002792 | |||
| 1156 | Ga0070671_100013815 | |||
| 1157 | Ga0070671_100121326 | |||
| 1158 | Ga0070671_100354688 | |||
| 1159 | Ga0070671_100591182 | |||
| 1160 | Ga0070674_100002446 | |||
| 1161 | Ga0070674_100009598 | |||
| 1162 | Ga0070673_100014728 | |||
| 1163 | Ga0070673_100045761 | |||
| 1164 | Ga0070673_100096433 | |||
| 1165 | Ga0070673_100166698 | |||
| 1166 | Ga0070673_100266442 | |||
| 1167 | Ga0070688_100067700 | |||
| 1168 | Ga0070688_100083578 | |||
| 1169 | Ga0070688_100230611 | |||
| 1170 | Ga0070688_100789145 | |||
| 1171 | Ga0070659_100960025 | |||
| 1172 | Ga0070667_100013338 | |||
| 1173 | Ga0070667_100013687 | |||
| 1174 | Ga0070667_100461173 | |||
| 1175 | Ga0070667_100589365 | |||
| 1176 | Ga0070667_101123193 | |||
| 1177 | Ga0070703_10087234 | |||
| 1178 | Ga0070703_10163234 | |||
| 1179 | Ga0070714_100016398 | |||
| 1180 | Ga0070713_100197518 | |||
| 1181 | Ga0070710_10289093 | |||
| 1182 | Ga0070701_10001212 | |||
| 1183 | Ga0070701_10012555 | |||
| 1184 | Ga0070701_10036822 | |||
| 1185 | Ga0070701_10104672 | |||
| 1186 | Ga0070701_10245475 | |||
| 1187 | Ga0070705_100127384 | |||
| 1188 | Ga0070705_100370526 | |||
| 1189 | Ga0070700_100009403 | |||
| 1190 | Ga0070700_100041415 | |||
| 1191 | Ga0070700_100053608 | |||
| 1192 | Ga0070700_100093815 | |||
| 1193 | Ga0070700_100102712 | |||
| 1194 | Ga0070694_100024635 | |||
| 1195 | Ga0070694_100084166 | |||
| 1196 | Ga0070694_100115318 | |||
| 1197 | Ga0070663_100244721 | |||
| 1198 | Ga0070663_100244735 | |||
| 1199 | Ga0070663_100828910 | |||
| 1200 | Ga0070678_100023233 | |||
| 1201 | Ga0070678_100070710 | |||
| 1202 | Ga0070678_100238264 | |||
| 1203 | Ga0070678_100285081 | |||
| 1204 | Ga0070662_100008793 | |||
| 1205 | Ga0070662_100028944 | |||
| 1206 | Ga0070662_100209520 | |||
| 1207 | Ga0070662_100481546 | |||
| 1208 | Ga0070681_10128013 | |||
| 1209 | Ga0068867_100006351 | |||
| 1210 | Ga0068867_100013786 | |||
| 1211 | Ga0068867_100027480 | |||
| 1212 | Ga0070685_10072920 | |||
| 1213 | Ga0070706_100023229 | |||
| 1214 | Ga0070706_100553613 | |||
| 1215 | Ga0070698_100028630 | |||
| 1216 | Ga0070698_100195970 | |||
| 1217 | Ga0070699_100144595 | |||
| 1218 | Ga0070699_100233093 | |||
| 1219 | Ga0070679_100004020 | |||
| 1220 | Ga0070684_100117928 | |||
| 1221 | Ga0070672_100011370 | |||
| 1222 | Ga0070672_100014821 | |||
| 1223 | Ga0070672_100025638 | |||
| 1224 | Ga0070672_100095959 | |||
| 1225 | Ga0070672_100100864 | |||
| 1226 | Ga0070672_100148723 | |||
| 1227 | Ga0070672_100293241 | |||
| 1228 | Ga0070672_100564991 | |||
| 1229 | Ga0070672_100569262 | |||
| 1230 | Ga0070686_100020370 | |||
| 1231 | Ga0070686_100062784 | |||
| 1232 | Ga0070686_100078939 | |||
| 1233 | Ga0070686_100167999 | |||
| 1234 | Ga0070695_100377521 | |||
| 1235 | Ga0070696_100165918 | |||
| 1236 | Ga0070693_100003087 | |||
| 1237 | Ga0070665_100062597 | |||
| 1238 | Ga0070665_100090553 | |||
| 1239 | Ga0070665_100244281 | |||
| 1240 | Ga0070665_100288066 | |||
| 1241 | Ga0070665_100569614 | |||
| 1242 | Ga0070665_100701411 | |||
| 1243 | Ga0070665_100971368 | |||
| 1244 | Ga0070665_101201713 | |||
| 1245 | Ga0070704_100079697 | |||
| 1246 | Ga0070704_100963245 | |||
| 1247 | Ga0070664_100022668 | |||
| 1248 | Ga0070664_100061497 | |||
| 1249 | Ga0070664_100196318 | |||
| 1250 | Ga0070664_100251307 | |||
| 1251 | Ga0068857_100315076 | |||
| 1252 | Ga0068857_100457495 | |||
| 1253 | Ga0068854_100499670 | |||
| 1254 | Ga0068856_100088638 | |||
| 1255 | Ga0068856_100210088 | |||
| 1256 | Ga0070702_100032319 | |||
| 1257 | Ga0070702_100065327 | |||
| 1258 | Ga0068859_100011569 | |||
| 1259 | Ga0068859_100068418 | |||
| 1260 | Ga0068859_100090595 | |||
| 1261 | Ga0068859_100302546 | |||
| 1262 | Ga0068859_100382228 | |||
| 1263 | Ga0068859_100447447 | |||
| 1264 | Ga0068864_100001780 | |||
| 1265 | Ga0068864_100005066 | |||
| 1266 | Ga0068864_100034829 | |||
| 1267 | Ga0068864_100087042 | |||
| 1268 | Ga0068864_100095173 | |||
| 1269 | Ga0068864_100107584 | |||
| 1270 | Ga0068864_100117037 | |||
| 1271 | Ga0068864_100484472 | |||
| 1272 | Ga0068866_10001987 | |||
| 1273 | Ga0068866_10571906 | |||
| 1274 | Ga0068861_100030062 | |||
| 1275 | Ga0068861_100101615 | |||
| 1276 | Ga0068861_100131470 | |||
| 1277 | Ga0068861_100170581 | |||
| 1278 | Ga0068861_100270592 | |||
| 1279 | Ga0068861_100811567 | |||
| 1280 | Ga0068870_10130425 | |||
| 1281 | Ga0068870_10201931 | |||
| 1282 | Ga0068870_10296470 | |||
| 1283 | Ga0068863_100002522 | |||
| 1284 | Ga0068863_100011364 | |||
| 1285 | Ga0068863_100030794 | |||
| 1286 | Ga0068863_100048634 | |||
| 1287 | Ga0068863_100241991 | |||
| 1288 | Ga0068858_100020959 | |||
| 1289 | Ga0068858_100040023 | |||
| 1290 | Ga0068858_100194527 | |||
| 1291 | Ga0068860_100035450 | |||
| 1292 | Ga0068860_100398260 | |||
| 1293 | Ga0068862_100004252 | |||
| 1294 | Ga0068862_100136660 | |||
| 1295 | Ga0068862_100167129 | |||
| 1296 | Ga0068862_100210662 | |||
| 1297 | Ga0068862_100269801 | |||
| 1298 | Ga0068862_100678890 | |||
| 1299 | Ga0081455_10164011 | |||
| 1300 | Ga0081539_10000133 | |||
| 1301 | Ga0081539_10000219 | |||
| 1302 | Ga0081539_10000329 | |||
| 1303 | Ga0081539_10034885 | |||
| 1304 | Ga0070717_10017715 | |||
| 1305 | Ga0075365_10235248 | |||
| 1306 | Ga0075368_10011966 | |||
| 1307 | Ga0075432_10184399 | |||
| 1308 | Ga0070716_100004079 | |||
| 1309 | Ga0070716_100575976 | |||
| 1310 | Ga0070712_100058058 | |||
| 1311 | Ga0075367_10009828 | |||
| 1312 | Ga0075369_10018775 | |||
| 1313 | Ga0097621_100044809 | |||
| 1314 | Ga0097621_100189922 | |||
| 1315 | Ga0097621_100236392 | |||
| 1316 | Ga0097621_100308406 | |||
| 1317 | Ga0097621_100489620 | |||
| 1318 | Ga0075370_10059103 | |||
| 1319 | Ga0068871_100029013 | |||
| 1320 | Ga0068871_100054420 | |||
| 1321 | Ga0068871_100321061 | |||
| 1322 | Ga0068871_100548120 | |||
| 1323 | Ga0075428_100001611 | |||
| 1324 | Ga0075428_100010461 | |||
| 1325 | Ga0075428_100021049 | |||
| 1326 | Ga0075428_100086365 | |||
| 1327 | Ga0075428_100109854 | |||
| 1328 | Ga0075428_100123006 | |||
| 1329 | Ga0075428_100681423 | |||
| 1330 | Ga0075428_100939087 | |||
| 1331 | Ga0075430_100001888 | |||
| 1332 | Ga0075430_100034162 | |||
| 1333 | Ga0075430_100035431 | |||
| 1334 | Ga0075430_100287170 | |||
| 1335 | Ga0075431_100002059 | |||
| 1336 | Ga0075431_100006116 | |||
| 1337 | Ga0075431_100009127 | |||
| 1338 | Ga0075431_100131533 | |||
| 1339 | Ga0075431_100150260 | |||
| 1340 | Ga0075431_100402312 | |||
| 1341 | Ga0075431_100619702 | |||
| 1342 | Ga0075431_100658646 | |||
| 1343 | Ga0075433_10000801 | |||
| 1344 | Ga0075433_10045435 | |||
| 1345 | Ga0075434_100002267 | |||
| 1346 | Ga0075434_100013753 | |||
| 1347 | Ga0075434_100219281 | |||
| 1348 | Ga0075434_100287895 | |||
| 1349 | Ga0075434_100491521 | |||
| 1350 | Ga0075434_100747771 | |||
| 1351 | Ga0075429_100000003 | |||
| 1352 | Ga0075429_100027367 | |||
| 1353 | Ga0075429_100079124 | |||
| 1354 | Ga0075429_100481456 | |||
| 1355 | Ga0068865_100003497 | |||
| 1356 | Ga0068865_100095760 | |||
| 1357 | Ga0068865_100675780 | |||
| 1358 | Ga0068865_100692360 | |||
| 1359 | Ga0075436_100624904 | |||
| 1360 | Ga0097620_100011569 | |||
| 1361 | Ga0097620_100068420 | |||
| 1362 | Ga0097620_100090594 | |||
| 1363 | Ga0097620_100302581 | |||
| 1364 | Ga0097620_100382233 | |||
| 1365 | Ga0097620_100447504 | |||
| 1366 | Ga0075435_100022855 | |||
| 1367 | Ga0075435_100032377 | |||
| 1368 | Ga0075435_100235757 | |||
| 1369 | Ga0099794_10016714 | |||
| 1370 | Ga0099794_10028304 | |||
| 1371 | Ga0099794_10233801 | |||
| 1372 | Ga0099795_10049790 | |||
| 1373 | Ga0105251_10004768 | |||
| 1374 | Ga0105251_10106747 | |||
| 1375 | Ga0105244_10053926 | |||
| 1376 | Ga0105250_10050215 | |||
| 1377 | Ga0105240_10000052 | |||
| 1378 | Ga0105240_10178832 | |||
| 1379 | Ga0105240_10196055 | |||
| 1380 | Ga0111539_10002454 | |||
| 1381 | Ga0111539_10010352 | |||
| 1382 | Ga0111539_10019309 | |||
| 1383 | Ga0111539_10044276 | |||
| 1384 | Ga0111539_10099831 | |||
| 1385 | Ga0111539_10119705 | |||
| 1386 | Ga0111539_10144534 | |||
| 1387 | Ga0111539_10146808 | |||
| 1388 | Ga0111539_10455079 | |||
| 1389 | Ga0111539_10512928 | |||
| 1390 | Ga0111539_11149196 | |||
| 1391 | Ga0105245_10010732 | |||
| 1392 | Ga0105245_10018846 | |||
| 1393 | Ga0105245_10045439 | |||
| 1394 | Ga0105245_10066233 | |||
| 1395 | Ga0105245_10367897 | |||
| 1396 | Ga0105245_10511475 | |||
| 1397 | Ga0105247_10032737 | |||
| 1398 | Ga0105247_10034709 | |||
| 1399 | Ga0114129_10007207 | |||
| 1400 | Ga0114129_10035772 | |||
| 1401 | Ga0114129_10064405 | |||
| 1402 | Ga0114129_10129102 | |||
| 1403 | Ga0114129_10299571 | |||
| 1404 | Ga0114129_10443250 | |||
| 1405 | Ga0114129_10682177 | |||
| 1406 | Ga0114129_10860476 | |||
| 1407 | Ga0105243_10013712 | |||
| 1408 | Ga0105243_10206281 | |||
| 1409 | Ga0105243_10357035 | |||
| 1410 | Ga0105243_11099763 | |||
| 1411 | Ga0105242_10000995 | |||
| 1412 | Ga0105242_10014788 | |||
| 1413 | Ga0105242_10140644 | |||
| 1414 | Ga0105242_10233566 | |||
| 1415 | Ga0105242_11265572 | |||
| 1416 | Ga0105248_10015744 | |||
| 1417 | Ga0105248_10114285 | |||
| 1418 | Ga0105248_10646780 | |||
| 1419 | Ga0105248_10880245 | |||
| 1420 | Ga0105248_10999923 | |||
| 1421 | Ga0105238_10015828 | |||
| 1422 | Ga0105238_10018756 | |||
| 1423 | Ga0105249_10002175 | |||
| 1424 | Ga0105249_10094139 | |||
| 1425 | Ga0105249_10294467 | |||
| 1426 | Ga0105239_10006686 | |||
| 1427 | Ga0105239_10180676 | |||
| 1428 | Ga0105239_10668536 | |||
| 1429 | Ga0105239_11093409 | |||
| 1430 | Ga0105246_10002402 | |||
| 1431 | Ga0105246_10011917 | |||
| 1432 | Ga0105246_10107651 | |||
| 1433 | Ga0157371_10103662 | |||
| 1434 | Ga0157369_10607568 | |||
| 1435 | Ga0157374_10084063 | |||
| 1436 | Ga0157374_10450589 | |||
| 1437 | Ga0157378_10193094 | |||
| 1438 | Ga0163162_10000812 | |||
| 1439 | Ga0163162_10000983 | |||
| 1440 | Ga0163162_10066581 | |||
| 1441 | Ga0163162_10180331 | |||
| 1442 | Ga0163162_10203652 | |||
| 1443 | Ga0163162_10263680 | |||
| 1444 | Ga0157372_10425241 | |||
| 1445 | Ga0157375_10058921 | |||
| 1446 | Ga0157375_10183834 | |||
| 1447 | Ga0157375_10453555 | |||
| 1448 | Ga0157375_10480974 | |||
| 1449 | Ga0157375_10894412 | |||
| 1450 | Ga0163163_10003481 | |||
| 1451 | Ga0163163_10010402 | |||
| 1452 | Ga0163163_10029715 | |||
| 1453 | Ga0163163_10377683 | |||
| 1454 | Ga0163163_10457212 | |||
| 1455 | Ga0163163_10509394 | |||
| 1456 | Ga0163163_10718761 | |||
| 1457 | Ga0163163_11127638 | |||
| 1458 | Ga0157380_10003751 | |||
| 1459 | Ga0157380_10010778 | |||
| 1460 | Ga0157380_10065936 | |||
| 1461 | Ga0157380_10083289 | |||
| 1462 | Ga0157380_10132656 | |||
| 1463 | Ga0157380_10208511 | |||
| 1464 | Ga0157380_10403381 | |||
| 1465 | Ga0157380_10818195 | |||
| 1466 | Ga0157380_11025110 | |||
| 1467 | Ga0157377_10040201 | |||
| 1468 | Ga0157377_10072700 | |||
| 1469 | Ga0157377_10098737 | |||
| 1470 | Ga0157377_10182669 | |||
| 1471 | Ga0157377_10185263 | |||
| 1472 | Ga0157377_10518398 | |||
| 1473 | Ga0157379_10011611 | |||
| 1474 | Ga0157379_10062893 | |||
| 1475 | Ga0157379_10072571 | |||
| 1476 | Ga0157379_10182322 | |||
| 1477 | Ga0157379_10307695 | |||
| 1478 | Ga0157376_10020581 | |||
| 1479 | Ga0157376_10039405 | |||
| 1480 | Ga0157376_10201781 | |||
| 1481 | Ga0157376_10284885 | |||
| 1482 | Ga0157376_11429408 | |||
| 1483 | Ga0183367_1021 | |||
| 1484 | Ga0163161_10205192 | |||
| 1485 | Ga0163161_10252644 | |||
| 1486 | Ga0163161_10577674 | |||
| 1487 | Ga0163161_10988685 | |||
| 1488 | Ga0213875_10189291 | |||
| 1489 | Ga0209674_100011 | |||
| 1490 | Ga0209672_100002 | |||
| 1491 | Ga0209147_100003 | |||
| 1492 | Ga0209563_100803 | |||
| 1493 | Ga0207427_100610 | |||
| 1494 | Ga0209258_100042 | |||
| 1495 | Ga0209148_1000006 | |||
| 1496 | Ga0209148_1001617 | |||
| 1497 | Ga0209759_1000051 | |||
| 1498 | Ga0209233_1000033 | |||
| 1499 | Ga0209455_1000003 | |||
| 1500 | Ga0209455_1003782 | |||
| 1501 | Ga0207426_1002893 | |||
| 1502 | Ga0207697_10002977 | |||
| 1503 | Ga0207696_1083552 | |||
| 1504 | Ga0207655_1107740 | |||
| 1505 | Ga0207713_1003152 | |||
| 1506 | Ga0207682_10002341 | |||
| 1507 | Ga0207682_10004751 | |||
| 1508 | Ga0207682_10023842 | |||
| 1509 | Ga0207682_10052188 | |||
| 1510 | Ga0207682_10160522 | |||
| 1511 | Ga0207642_10015889 | |||
| 1512 | Ga0207642_10190645 | |||
| 1513 | Ga0207642_10360604 | |||
| 1514 | Ga0207688_10006362 | |||
| 1515 | Ga0207680_10065152 | |||
| 1516 | Ga0207680_10083605 | |||
| 1517 | Ga0207680_10117970 | |||
| 1518 | Ga0207680_10202828 | |||
| 1519 | Ga0207680_10206685 | |||
| 1520 | Ga0207680_10260425 | |||
| 1521 | Ga0207680_10503058 | |||
| 1522 | Ga0207645_10002246 | |||
| 1523 | Ga0207645_10008417 | |||
| 1524 | Ga0207645_10062340 | |||
| 1525 | Ga0207645_10252954 | |||
| 1526 | Ga0207645_10698976 | |||
| 1527 | Ga0207643_10003472 | |||
| 1528 | Ga0207643_10018291 | |||
| 1529 | Ga0207643_10022591 | |||
| 1530 | Ga0207705_10412066 | |||
| 1531 | Ga0207707_10015561 | |||
| 1532 | Ga0207695_10000122 | |||
| 1533 | Ga0207695_10489659 | |||
| 1534 | Ga0207693_10365787 | |||
| 1535 | Ga0207662_10012068 | |||
| 1536 | Ga0207662_10073842 | |||
| 1537 | Ga0207662_10104897 | |||
| 1538 | Ga0207662_10112459 | |||
| 1539 | Ga0207649_10039184 | |||
| 1540 | Ga0207649_10044717 | |||
| 1541 | Ga0207649_10573246 | |||
| 1542 | Ga0207652_10034319 | |||
| 1543 | Ga0207646_10737788 | |||
| 1544 | Ga0207681_10007823 | |||
| 1545 | Ga0207681_10083805 | |||
| 1546 | Ga0207681_10136394 | |||
| 1547 | Ga0207681_10138337 | |||
| 1548 | Ga0207681_10156419 | |||
| 1549 | Ga0207681_10238915 | |||
| 1550 | Ga0207681_10624100 | |||
| 1551 | Ga0207694_10064635 | |||
| 1552 | Ga0207650_10009090 | |||
| 1553 | Ga0207650_10033256 | |||
| 1554 | Ga0207650_10090786 | |||
| 1555 | Ga0207650_10108457 | |||
| 1556 | Ga0207650_10199055 | |||
| 1557 | Ga0207650_10442469 | |||
| 1558 | Ga0207659_10004973 | |||
| 1559 | Ga0207659_10006385 | |||
| 1560 | Ga0207659_10013335 | |||
| 1561 | Ga0207659_10055287 | |||
| 1562 | Ga0207659_10111952 | |||
| 1563 | Ga0207659_10180228 | |||
| 1564 | Ga0207659_10182752 | |||
| 1565 | Ga0207659_10341527 | |||
| 1566 | Ga0207659_10351646 | |||
| 1567 | Ga0207659_10438091 | |||
| 1568 | Ga0207659_10627831 | |||
| 1569 | Ga0207687_10010576 | |||
| 1570 | Ga0207687_10042407 | |||
| 1571 | Ga0207687_10099426 | |||
| 1572 | Ga0207687_10330053 | |||
| 1573 | Ga0207644_10001383 | |||
| 1574 | Ga0207644_10010956 | |||
| 1575 | Ga0207644_10138546 | |||
| 1576 | Ga0207644_10489248 | |||
| 1577 | Ga0207644_10519047 | |||
| 1578 | Ga0207706_10017818 | |||
| 1579 | Ga0207706_10042151 | |||
| 1580 | Ga0207706_10125175 | |||
| 1581 | Ga0207706_10338780 | |||
| 1582 | Ga0207706_10436838 | |||
| 1583 | Ga0207686_10006341 | |||
| 1584 | Ga0207686_10020936 | |||
| 1585 | Ga0207686_10150778 | |||
| 1586 | Ga0207709_10019504 | |||
| 1587 | Ga0207670_10072365 | |||
| 1588 | Ga0207670_10136996 | |||
| 1589 | Ga0207670_10271752 | |||
| 1590 | Ga0207669_10001682 | |||
| 1591 | Ga0207669_10008072 | |||
| 1592 | Ga0207669_10031054 | |||
| 1593 | Ga0207669_10198446 | |||
| 1594 | Ga0207669_10732587 | |||
| 1595 | Ga0207704_10051920 | |||
| 1596 | Ga0207665_10010830 | |||
| 1597 | Ga0207691_10002388 | |||
| 1598 | Ga0207691_10002501 | |||
| 1599 | Ga0207691_10028705 | |||
| 1600 | Ga0207691_10047283 | |||
| 1601 | Ga0207691_10085355 | |||
| 1602 | Ga0207691_10117477 | |||
| 1603 | Ga0207711_10023625 | |||
| 1604 | Ga0207711_10393258 | |||
| 1605 | Ga0207689_10008126 | |||
| 1606 | Ga0207689_10086901 | |||
| 1607 | Ga0207689_10098421 | |||
| 1608 | Ga0207661_10007758 | |||
| 1609 | Ga0207679_10045357 | |||
| 1610 | Ga0207679_10128089 | |||
| 1611 | Ga0207679_10233718 | |||
| 1612 | Ga0207651_10029303 | |||
| 1613 | Ga0207651_10030907 | |||
| 1614 | Ga0207651_10044042 | |||
| 1615 | Ga0207651_10050741 | |||
| 1616 | Ga0207651_10109329 | |||
| 1617 | Ga0207651_10192585 | |||
| 1618 | Ga0207651_10372508 | |||
| 1619 | Ga0207712_10149313 | |||
| 1620 | Ga0207712_10273781 | |||
| 1621 | Ga0207712_10406206 | |||
| 1622 | Ga0207712_11143657 | |||
| 1623 | Ga0207668_10173833 | |||
| 1624 | Ga0207668_10218632 | |||
| 1625 | Ga0207640_10592203 | |||
| 1626 | Ga0207658_10014143 | |||
| 1627 | Ga0207658_10136890 | |||
| 1628 | Ga0207658_11057546 | |||
| 1629 | Ga0207658_11367649 | |||
| 1630 | Ga0207677_10096242 | |||
| 1631 | Ga0207703_10039720 | |||
| 1632 | Ga0207703_10117183 | |||
| 1633 | Ga0207678_10077130 | |||
| 1634 | Ga0207678_10516119 | |||
| 1635 | Ga0207678_10851361 | |||
| 1636 | Ga0207678_11040186 | |||
| 1637 | Ga0207708_10026855 | |||
| 1638 | Ga0207708_10035413 | |||
| 1639 | Ga0207708_10060464 | |||
| 1640 | Ga0207708_10063996 | |||
| 1641 | Ga0207708_10412034 | |||
| 1642 | Ga0207708_11003099 | |||
| 1643 | Ga0207702_10024939 | |||
| 1644 | Ga0207702_10039177 | |||
| 1645 | Ga0207702_10735214 | |||
| 1646 | Ga0207641_10013055 | |||
| 1647 | Ga0207641_10016365 | |||
| 1648 | Ga0207641_10016663 | |||
| 1649 | Ga0207641_10042754 | |||
| 1650 | Ga0207641_10527283 | |||
| 1651 | Ga0207648_10003093 | |||
| 1652 | Ga0207648_10054704 | |||
| 1653 | Ga0207648_10138782 | |||
| 1654 | Ga0207648_10218035 | |||
| 1655 | Ga0207648_10246016 | |||
| 1656 | Ga0207676_10000881 | |||
| 1657 | Ga0207676_10023698 | |||
| 1658 | Ga0207676_10043399 | |||
| 1659 | Ga0207676_10075913 | |||
| 1660 | Ga0207676_10146877 | |||
| 1661 | Ga0207676_10259134 | |||
| 1662 | Ga0207676_10585833 | |||
| 1663 | Ga0207676_10743179 | |||
| 1664 | Ga0207674_10057329 | |||
| 1665 | Ga0207674_10400681 | |||
| 1666 | Ga0207675_100013285 | |||
| 1667 | Ga0207675_100017706 | |||
| 1668 | Ga0207675_100039464 | |||
| 1669 | Ga0207675_100047554 | |||
| 1670 | Ga0207675_100135806 | |||
| 1671 | Ga0207675_100213364 | |||
| 1672 | Ga0207675_100861745 | |||
| 1673 | Ga0207683_10001982 | |||
| 1674 | Ga0207683_10029975 | |||
| 1675 | Ga0207683_10060121 | |||
| 1676 | Ga0207683_10150402 | |||
| 1677 | Ga0207683_10156372 | |||
| 1678 | Ga0207683_10186772 | |||
| 1679 | Ga0207683_10219559 | |||
| 1680 | Ga0207683_10294142 | |||
| 1681 | Ga0207683_10304561 | |||
| 1682 | Ga0207683_10469585 | |||
| 1683 | Ga0209588_1001197 | |||
| 1684 | Ga0209588_1062266 | |||
| 1685 | Ga0209971_1042278 | |||
| 1686 | Ga0209813_10021546 | |||
| 1687 | Ga0207428_10010695 | |||
| 1688 | Ga0207428_10015486 | |||
| 1689 | Ga0207428_10086811 | |||
| 1690 | Ga0207428_10091287 | |||
| 1691 | Ga0207428_10121070 | |||
| 1692 | Ga0207428_10127367 | |||
| 1693 | Ga0207428_10494480 | |||
| 1694 | Ga0268266_10120852 | |||
| 1695 | Ga0268266_10498621 | |||
| 1696 | Ga0268266_10851542 | |||
| 1697 | Ga0268266_10929321 | |||
| 1698 | Ga0268265_10027299 | |||
| 1699 | Ga0268265_10063693 | |||
| 1700 | Ga0268265_10144242 | |||
| 1701 | Ga0268265_10340100 | |||
| 1702 | Ga0268265_10673305 | |||
| 1703 | Ga0268265_11019859 | |||
| 1704 | Ga0268265_11034458 | |||
| 1705 | Ga0268264_10024489 | |||
| 1706 | Ga0268264_10029081 | |||
| 1707 | Ga0268264_10468847 | |||
| 1708 | Ga0307511_10000753 | |||
| 1709 | Ga0265320_10132298 | |||
| 1710 | Ga0307513_10007242 | |||
| 1711 | Ga0307408_100079340 | |||
| 1712 | Ga0307408_100905245 | |||
| 1713 | Ga0316575_10062868 | |||
| 1714 | Ga0265314_10002259 | |||
| 1715 | Ga0307516_10438510 | |||
| 1716 | Ga0307405_10014597 | |||
| 1717 | Ga0307405_10015195 | |||
| 1718 | Ga0307405_10035416 | |||
| 1719 | Ga0307413_10006412 | |||
| 1720 | Ga0307413_10160631 | |||
| 1721 | Ga0307518_10249959 | |||
| 1722 | Ga0307410_10109505 | |||
| 1723 | Ga0307410_10142863 | |||
| 1724 | Ga0307410_10477230 | |||
| 1725 | Ga0307407_10025679 | |||
| 1726 | Ga0307407_10091770 | |||
| 1727 | Ga0307412_10011434 | |||
| 1728 | Ga0307412_10394406 | |||
| 1729 | Ga0307409_100326842 | |||
| 1730 | Ga0307409_100571376 | |||
| 1731 | Ga0307416_100017210 | |||
| 1732 | Ga0307416_100030947 | |||
| 1733 | Ga0307414_10026496 | |||
| 1734 | Ga0307414_10529761 | |||
| 1735 | Ga0307411_10048678 | |||
| 1736 | Ga0307411_10123136 | |||
| 1737 | Ga0307415_100049190 | |||
| 1738 | Ga0307415_100051773 | |||
| 1739 | Ga0307507_10036513 | |||
| 1740 | Ga0373938_0008859 | |||
| 1741 | Ga0373952_0021108 | |||
| 1742 | Ga0373939_0054799 | |||
| 1743 | Ga0373955_0072642 | |||
| 1744 | Ga0316574_0196335 | |||
| 1745 | Ga0373931_0026585 | |||
| 1746 | Ga0373933_0264667 | |||
| 1747 | Ga0373937_0211861 | |||
| 1748 | Ga0373937_0387602 | |||
| 1749 | Ga0373937_0443544 | |||
| 1750 | Ga0373925_0043043 | |||
| 1751 | Ga0373925_0229822 | |||
| 1752 | Ga0395898_0077282 | |||
| 1753 | Ga0436364_1036432 | |||
| 1754 | Ga0395901_0233293 | |||
| 1755 | Ga0395901_0540294 | |||
| 1756 | Ga0436365_0897074 | |||
| 1757 | Ga0439461_0074718 | |||
| 1758 | Ga0451800_0886097 | |||
| 1759 | Ga0451833_0106998 | |||
| 1760 | Ga0451833_0113201 | |||
| 1761 | Ga0451835_0659563 | |||
| 1762 | Ga0451837_1544089 | |||
| 1763 | Ga0451841_1451426 | |||
| 1764 | Ga0451845_0982859 | |||
| 1765 | Ga0451847_0527546 | |||
| 1766 | Ga0451849_0684911 | |||
| 1767 | Ga0451853_0301670 | |||
| 1768 | Ga0451853_0751866 | |||
| 1769 | Ga0451853_0912580 | |||
| 1770 | Ga0451853_1156423 | |||
| 1771 | Ga0439441_001360 | |||
| 1772 | Ga0439441_021743 | |||
| 1773 | Ga0439455_0025760 | |||
| 1774 | Ga0450894_025984 | |||
| 1775 | Ga0450903_000057 | |||
| 1776 | Ga0450905_015167 | |||
| 1777 | Ga0439458_0000582 | |||
| 1778 | Ga0439458_0087065 | |||
| 1779 | Ga0439458_0097807 | |||
| 1780 | Ga0439435_0175842 | |||
| 1781 | Ga0451577_0217584 | |||
| 1782 | Ga0439440_0047346 | |||
| 1783 | Ga0466963_0044773 | |||
| 1784 | Ga0466963_0193507 | |||
| 1785 | Ga0466963_0255863 | |||
| 1786 | Ga0466963_0359694 | |||
| 1787 | Ga0466957_0029088 | |||
| 1788 | Ga0466957_0166653 | |||
| 1789 | Ga0451576_0036785 | |||
| 1790 | Ga0451576_0122617 | |||
| 1791 | Ga0451576_0212864 | |||
| 1792 | Ga0451576_0425588 | |||
| 1793 | Ga0451576_0573630 | |||
| 1794 | Ga0466958_0094533 | |||
| 1795 | Ga0466967_0000816 | |||
| 1796 | Ga0466967_0025195 | |||
| 1797 | Ga0466967_0144481 | |||
| 1798 | Ga0466967_0546623 | |||
| 1799 | Ga0466967_0656997 | |||
| 1800 | Ga0495603_0099165 | |||
| 1801 | Ga0495590_0003033 | |||
| 1802 | Ga0495591_001035 | |||
| 1803 | Ga0495629_0001977 | |||
| 1804 | Ga0495629_0015038 | |||
| 1805 | Ga0495638_0028495 | |||
| 1806 | Ga0495638_0065401 | |||
| 1807 | Ga0495641_0160117 | |||
| 1808 | Ga0495651_0005248 | |||
| 1809 | Ga0495651_0268289 | |||
| 1810 | Ga0495651_0601545 | |||
| 1811 | Ga0495653_0069531 | |||
| 1812 | Ga0495653_0160337 | |||
| 1813 | Ga0495650_0091868 | |||
| 1814 | Ga0495580_0037031 | |||
| 1815 | Ga0495582_0090462 | |||
| 1816 | Ga0495582_0309051 | |||
| 1817 | Ga0495605_0000934 | |||
| 1818 | Ga0495605_0010293 | |||
| 1819 | Ga0495664_0008090 | |||
| 1820 | Ga0495585_0011450 | |||
| 1821 | Ga0495596_0005499 | |||
| 1822 | Ga0495596_0115288 | |||
| 1823 | Ga0495607_0036690 | |||
| 1824 | Ga0495583_0084127 | |||
| 1825 | Ga0495606_0100852 | |||
| 1826 | Ga0495608_0047546 | |||
| 1827 | Ga0495618_0027141 | |||
| 1828 | Ga0495618_0233666 | |||
| 1829 | Ga0495620_0073462 | |||
| 1830 | Ga0495628_0111598 | |||
| 1831 | Ga0495630_0068242 | |||
| 1832 | Ga0495643_0215155 | |||
| 1833 | Ga0495644_0090261 | |||
| 1834 | Ga0495648_0110409 | |||
| 1835 | Ga0495663_0031396 | |||
| 1836 | Ga0495666_0027494 | |||
| 1837 | Ga0495642_0066665 | |||
| 1838 | Ga0495642_0074851 | |||
| 1839 | Ga0495652_0166497 | |||
| 1840 | Ga0495652_0369207 | |||
| 1841 | Ga0495665_0002074 | |||
| 1842 | Ga0495665_0178497 | |||
| 1843 | Ga0495640_0005656 | |||
| 1844 | Ga0495586_0047806 | |||
| 1845 | Ga0495586_0166608 | |||
| 1846 | Ga0495598_0008709 | |||
| 1847 | Ga0495621_0012727 | |||
| 1848 | Ga0495597_0003168 | |||
| 1849 | Ga0495667_0108041 | |||
| 1850 | Ga0495656_0054209 | |||
| 1851 | Ga0495611_0149401 | |||
| 1852 | Ga0495625_0416655 | |||
| 1853 | Ga0495625_0460319 | |||
| 1854 | Ga0495635_0041581 | |||
| 1855 | Ga0495661_0085354 | |||
| 1856 | Ga0495588_0223461 | |||
| 1857 | Ga0495588_0346391 | |||
| 1858 | Ga0495599_0225155 | |||
| 1859 | Ga0495623_0003527 | |||
| 1860 | Ga0495646_0048950 | |||
| 1861 | Ga0495647_0053054 | |||
| 1862 | Ga0495647_0064337 | |||
| 1863 | Ga0495658_0024122 | |||
| 1864 | Ga0495658_0026743 | |||
| 1865 | Ga0495658_0208941 | |||
| 1866 | Ga0495669_0000700 | |||
| 1867 | Ga0495669_0000910 | |||
| 1868 | Ga0495613_0070806 | |||
| 1869 | Ga0495613_0640866 | |||
| 1870 | Ga0495624_0318665 | |||
| 1871 | Ga0495670_0008683 | |||
| 1872 | Ga0495671_0034390 | |||
| 1873 | Ga0495649_0086290 | |||
| 1874 | Ga0495589_0007026 | |||
| 1875 | Ga0495589_0029041 | |||
| 1876 | Ga0495589_0037586 | |||
| 1877 | Ga0495600_0002767 | |||
| 1878 | Ga0495581_0137766 | |||
| 1879 | Ga0495636_0024130 | |||
| 1880 | Ga0495674_0032323 | |||
| 1881 | Ga0495674_0071538 | |||
| 1882 | Ga0495674_0274251 | |||
| 1883 | Ga0495674_0598746 | |||
| 1884 | Ga0495676_0004511 | |||
| 1885 | Ga0495676_0029551 | |||
| 1886 | Ga0495680_0494148 | |||
| 1887 | Ga0495683_0003800 | |||
| 1888 | Ga0495683_0008921 | |||
| 1889 | Ga0495675_0000565 | |||
| 1890 | Ga0495675_0282685 | |||
| 1891 | Ga0495677_0232995 | |||
| 1892 | Ga0495679_004891 | |||
| 1893 | Ga0495679_041605 | |||
| 1894 | Ga0495685_050243 | |||
| 1895 | Ga0495673_0005324 | |||
| 1896 | Ga0495684_0076879 | |||
| 1897 | Ga0495593_0004290 | |||
| 1898 | Ga0495614_0010984 | |||
| 1899 | Ga0495614_0029926 | |||
| 1900 | Ga0495626_0151335 | |||
| 1901 | Ga0496100_0004806 | |||
| 1902 | Ga0496100_0019087 | |||
| 1903 | Ga0496100_0019193 | |||
| 1904 | Ga0496100_0049972 | |||
| 1905 | Ga0496100_0261046 | |||
| 1906 | Ga0496101_0002482 | |||
| 1907 | Ga0496101_0021889 | |||
| 1908 | Ga0496101_0123812 | |||
| 1909 | Ga0496101_0155205 | |||
| 1910 | Ga0496101_0309097 | |||
| 1911 | Ga0496101_0425349 | |||
| 1912 | Ga0496102_0008128 | |||
| 1913 | Ga0496102_0013990 | |||
| 1914 | Ga0496102_0054604 | |||
| 1915 | Ga0496102_0140040 | |||
| 1916 | Ga0496102_0190365 | |||
| 1917 | Ga0496102_0676745 | |||
| 1918 | Ga0496102_0771723 | |||
| 1919 | Ga0496103_0005096 | |||
| 1920 | Ga0496103_0009801 | |||
| 1921 | Ga0496103_0180849 | |||
| 1922 | Ga0496104_0000254 | |||
| 1923 | Ga0496104_0109985 | |||
| 1924 | Ga0496104_0116676 | |||
| 1925 | Ga0496104_0237288 | |||
| 1926 | Ga0496104_0492963 | |||
| 1927 | Ga0496105_0000055 | |||
| 1928 | Ga0496105_0057708 | |||
| 1929 | Ga0496105_0131065 | |||
| 1930 | Ga0496105_0173723 | |||
| 1931 | Ga0496105_0191675 | |||
| 1932 | Ga0496105_0309968 | |||
| 1933 | Ga0496106_0016808 | |||
| 1934 | Ga0496106_0030254 | |||
| 1935 | Ga0496106_0588380 | |||
| 1936 | Ga0496107_0072351 | |||
| 1937 | Ga0496108_0004970 | |||
| 1938 | Ga0496108_0193806 | |||
| 1939 | Ga0496108_0477731 | |||
| 1940 | Ga0496108_0571444 | |||
| 1941 | Ga0496109_0001932 | |||
| 1942 | Ga0496109_0032387 | |||
| 1943 | Ga0496109_0058727 | |||
| 1944 | Ga0496109_0131121 | |||
| 1945 | Ga0496109_0147363 | |||
| 1946 | Ga0496109_0235468 | |||
| 1947 | Ga0496109_0299021 | |||
| 1948 | Ga0496109_0306005 | |||
| 1949 | Ga0496109_0341261 | |||
| 1950 | Ga0496110_0001472 | |||
| 1951 | Ga0496110_0039557 | |||
| 1952 | Ga0496110_0041197 | |||
| 1953 | Ga0496110_0359531 | |||
| 1954 | Ga0496110_0433090 | |||
| 1955 | Ga0496111_0000582 | |||
| 1956 | Ga0496111_0008397 | |||
| 1957 | Ga0496111_0014348 | |||
| 1958 | Ga0496111_0194248 | |||
| 1959 | Ga0496112_0003831 | |||
| 1960 | Ga0496112_0017806 | |||
| 1961 | Ga0496112_0050753 | |||
| 1962 | Ga0496112_0173777 | |||
| 1963 | Ga0496113_0003115 | |||
| 1964 | Ga0496113_0163173 | |||
| 1965 | Ga0496113_0241533 | |||
| 1966 | Ga0496114_0000256 | |||
| 1967 | Ga0496114_0002392 | |||
| 1968 | Ga0496114_0010753 | |||
| 1969 | Ga0496114_0023237 | |||
| 1970 | Ga0496115_0014234 | |||
| 1971 | Ga0496115_0057171 | |||
| 1972 | Ga0496115_0239039 | |||
| 1973 | Ga0496116_0017931 | |||
| 1974 | Ga0496117_0043335 | |||
| 1975 | Ga0496118_0043853 | |||
| 1976 | Ga0496119_0034893 | |||
| 1977 | Ga0496121_0288112 | |||
| 1978 | Ga0496122_0006936 | |||
| 1979 | Ga0496122_0021302 | |||
| 1980 | Ga0496123_0036840 | |||
| 1981 | Ga0496123_0063746 | |||
| 1982 | Ga0496124_0007274 | |||
| 1983 | Ga0496125_0149213 | |||
| 1984 | Ga0495678_120675 | |||
| 1985 | Ga0495678_155781 | |||
| 1986 | Ga0495682_0019468 | |||
| 1987 | Ga0501036_0071471 | |||
| 1988 | Ga0501036_0516667 | |||
| 1989 | Ga0501038_0929688 | |||
| 1990 | Ga0501039_0015411 | |||
| 1991 | Ga0501040_0232926 | |||
| 1992 | Ga0501041_0041077 | |||
| 1993 | Ga0501041_0087947 | |||
| 1994 | Ga0501042_0216076 | |||
| 1995 | Ga0501042_0262230 | |||
| 1996 | Ga0501042_0282845 | |||
| 1997 | Ga0501043_0594918 | |||
| 1998 | Ga0501046_0061065 | |||
| 1999 | Ga0501046_0095129 | |||
| 2000 | Ga0501046_0646507 | |||
| 2001 | Ga0501068_0456634 | |||
| 2002 | Ga0501068_0660744 | |||
| 2003 | Ga0501070_0384482 | |||
| 2004 | Ga0501071_0114502 | |||
| 2005 | Ga0501072_0043951 | |||
| 2006 | Ga0501072_0104955 | |||
| 2007 | Ga0501072_0340127 | |||
| 2008 | Ga0501072_0479312 | |||
| 2009 | Ga0501073_0112136 | |||
| 2010 | Ga0501074_0116165 | |||
| 2011 | Ga0501075_0044302 | |||
| 2012 | Ga0501075_0048868 | |||
| 2013 | Ga0501075_0156544 | |||
| 2014 | Ga0501077_0132464 | |||
| 2015 | Ga0501079_0045574 | |||
| 2016 | Ga0501079_0161403 | |||
| 2017 | Ga0501080_0092730 | |||
| 2018 | Ga0501080_0901047 | |||
| 2019 | Ga0501081_0168045 | |||
| 2020 | Ga0501081_0230254 | |||
| 2021 | Ga0501081_0234212 | |||
| 2022 | Ga0501081_0419559 | |||
| 2023 | Ga0501081_0475767 | |||
| 2024 | Ga0501045_0002197 | |||
| 2025 | Ga0501045_0251204 | |||
| 2026 | nmdc:mga0yw44_132265_c1 | |||
| 2027 | nmdc:mga0k408_135494_c1 | |||
| 2028 | nmdc:mga06z11_280989_c1 | |||
| 2029 | nmdc:mga06z11_577633_c1 | |||
| 2030 | nmdc:mga06z11_679_c1 | |||
| 2031 | nmdc:mga04h51_20907_c1 | |||
| 2032 | nmdc:mga07m45_254691_c1 | |||
| 2033 | nmdc:mga05p37_1561296_c1 | |||
| 2034 | nmdc:mga05p37_19865_c1 | |||
| 2035 | nmdc:mga05p37_244386_c1 | |||
| 2036 | nmdc:mga05p37_31350_c1 | |||
| 2037 | nmdc:mga05p37_501778_c1 | |||
| 2038 | nmdc:mga05p37_77_c1 | |||
| 2039 | nmdc:mga05p37_931815_c1 | |||
| 2040 | nmdc:mga09592_13099_c1 | |||
| 2041 | nmdc:mga09592_15462_c1 | |||
| 2042 | nmdc:mga09592_184713_c1 | |||
| 2043 | nmdc:mga09592_355_c1 | |||
| 2044 | nmdc:mga09592_71811_c1 | |||
| 2045 | nmdc:mga0qj67_1010_c1 | |||
| 2046 | nmdc:mga0qj67_24922_c1 | |||
| 2047 | nmdc:mga0qj67_278487_c1 | |||
| 2048 | nmdc:mga0qj67_6148_c1 | |||
| 2049 | nmdc:mga06r32_11689_c1 | |||
| 2050 | nmdc:mga06r32_13206_c1 | |||
| 2051 | nmdc:mga06r32_19481_c1 | |||
| 2052 | nmdc:mga06r32_3055_c1 | |||
| 2053 | nmdc:mga06r32_34053_c1 | |||
| 2054 | nmdc:mga06r32_479995_c1 | |||
| 2055 | nmdc:mga06r32_48368_c1 | |||
| 2056 | nmdc:mga06r32_7651_c1 | |||
| 2057 | nmdc:mga08y16_1023228_c1 | |||
| 2058 | nmdc:mga08y16_11017_c1 | |||
| 2059 | nmdc:mga08y16_136746_c1 | |||
| 2060 | nmdc:mga08y16_1998_c1 | |||
| 2061 | nmdc:mga08y16_23677_c1 | |||
| 2062 | nmdc:mga08y16_28383_c1 | |||
| 2063 | nmdc:mga08y16_337277_c1 | |||
| 2064 | nmdc:mga08y16_34274_c1 | |||
| 2065 | nmdc:mga08y16_465022_c1 | |||
| 2066 | nmdc:mga08y16_5088_c1 | |||
| 2067 | nmdc:mga08y16_529794_c1 | |||
| 2068 | nmdc:mga08y16_534504_c1 | |||
| 2069 | nmdc:mga0n895_221418_c1 | |||
| 2070 | nmdc:mga0n895_2763_c1 | |||
| 2071 | nmdc:mga0n895_314639_c1 | |||
| 2072 | nmdc:mga0n895_323329_c1 | |||
| 2073 | nmdc:mga0n895_38591_c1 | |||
| 2074 | nmdc:mga0n895_670615_c1 | |||
| 2075 | nmdc:mga0rr50_223001_c1 | |||
| 2076 | nmdc:mga0rr50_419358_c1 | |||
| 2077 | nmdc:mga0rr50_43386_c1 | |||
| 2078 | nmdc:mga08x19_424945_c1 | |||
| 2079 | nmdc:mga0a205_1255_c1 | |||
| 2080 | nmdc:mga0a205_139416_c1 | |||
| 2081 | nmdc:mga0a205_172419_c1 | |||
| 2082 | nmdc:mga0a205_282111_c1 | |||
| 2083 | nmdc:mga0a205_38623_c2 | |||
| 2084 | nmdc:mga0sz30_10569_c2 | |||
| 2085 | Ga0495595_0447612 | |||
| 2086 | Ga0500646_0002708 | |||
| 2087 | Ga0500583_0143396 | |||
| 2088 | Ga0500641_0013330 | |||
| 2089 | Ga0500555_015156 | |||
| 2090 | Ga0500655_018992 | |||
| 2091 | Ga0500568_0036062 | |||
| 2092 | Ga0500577_0041098 | |||
| 2093 | Ga0500588_0022165 | |||
| 2094 | Ga0500604_0001071 | |||
| 2095 | Ga0500616_0112259 | |||
| 2096 | Ga0500616_0222851 | |||
| 2097 | Ga0500622_0262428 | |||
| 2098 | Ga0501084_0051953 | |||
| 2099 | Ga0501082_0424376 | |||
| 2100 | Ga0530510_0002185 | |||
| 2101 | 2515683618 | |||
| 2102 | 2559426437 | |||
| 2103 | 2585318149 | |||
| 2104 | 2644267346 | |||
| 2105 | 2753266154 | |||
| 2106 | 2786673840 | |||
| 2107 | 2792841141 | |||
| 2108 | 2862385991 | |||
| 2109 | 2877676336 | |||
| 2110 | 2895517722 | |||
| 2111 | 2902685056 | |||
| 2112 | 2904485921 | |||
| 2113 | 2919532694 | |||
| 2114 | 2954700888 | |||
| 2115 | 2954706458 | |||
| 2116 | 8008559133 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jmv-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol | 0.9491 | 1 | 199 |
| 7jmr-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis | 0.9477 | 1 | 199 |
| 7jmv-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol | 0.9445 | 1 | 199 |
| 7jmr-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis | 0.9431 | 1 | 199 |
| 7kd9-assembly2.cif.gz_C | crystal structure of gallic acid decarboxylase from arxula adeninivorans | 0.9201 | 1 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WL25_11_145_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8743 | 1 | 127 | 3.10.450.50 |
| 5stdA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8423 | 5 | 133 | 3.10.450.50 |
| 1idpA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8275 | 5 | 133 | 3.10.450.50 |
| af_P9WL25_11_145_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8198 | 1 | 127 | 3.10.450.50 |
| af_O07237_11_153_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.819 | 6 | 139 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P7B700-F1-model_v4 | SnoaL-like domain-containing protein | 0.996 | 1 | 199 |
|
| AF-A0A1Y0BLM0-F1-model_v4 | J507 | 0.996 | 2 | 197 |
|
| AF-A0A7W6U417-F1-model_v4 | deleted | 0.9959 | 5 | 162 |
|
| AF-A0A523U914-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9954 | 5 | 196 |
|
| AF-A0A1H6NW08-F1-model_v4 | deleted | 0.9951 | 1 | 199 |
|