F489221

General Info

Members Datasets Scaffolds Average Seq Length
1058 429 2116 203

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100613846|Ga0070694_1006138461
Length 229
Sequence MAMSSRRKSKGSAFFGIESSMDDKLAIREVIENWALWRDAGDWTRFATVWHDDGWMTATWFQGPASKFIEVSRAGFERGVSILHFLGGFTCDVVGTRAIAQTKMTINQRAAVDGLEVDVVCTGRFYDFLEKRATSPERPKGVEGWAIVRRQPIYEKDRMDPVEPSRRLMLDVTLLNRFPEGYRHLAYLQSRNGFTIKDGLPGVRGAAVETLYAEGRAWLDGSAKPGTPL

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
243 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
244 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
245 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
248 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
249 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
250 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
253 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
254 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
255 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
256 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
257 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
268 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
293 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
294 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
308 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
330 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
331 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
332 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
401 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
404 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
407 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
408 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
409 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
410 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
415 2558860280 Kutzneria sp. 744 Isolate Unclassified
416 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
417 2643221647 Streptomyces sp. Root369 Isolate Unclassified
418 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
419 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
420 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
421 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
422 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
423 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
424 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
425 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
426 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
427 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
428 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
429 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0.28
Rhizoplane 6.9
Rhizosphere 84.5
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100613846 3300005444 Bacteria 877
2 JGI24739J22299_10107787 3300001989 Bacteria 837
3 JGI24737J22298_10112773 3300001990 Bacteria 804
4 JGI24735J21928_10018386 3300002067 Bacteria 2155
5 JGI25156J39149_1000248 3300002705 Bacteria 37257
6 JGI25406J46586_10002668 3300003203 Bacteria 8406
7 JGI25406J46586_10003549 3300003203 Bacteria 7311
8 JGI25406J46586_10007672 3300003203 Bacteria 4907
9 JGI25165J46597_1000574 3300003214 Bacteria 32806
10 Ga0055533_1000072 3300003756 Bacteria 144571
11 Ga0055532_1000013 3300003758 Bacteria 380677
12 Ga0055525_1007827 3300003759 Bacteria 903
13 Ga0055527_1000010 3300003760 Bacteria 380677
14 Ga0055535_1000010 3300003761 Bacteria 380677
15 Ga0055542_1000016 3300003762 Bacteria 380677
16 Ga0055542_1026608 3300003762 Bacteria 777
17 Ga0055529_1000012 3300003763 Bacteria 380677
18 Ga0065714_10091560 3300005288 Bacteria 1869
19 Ga0065704_10083607 3300005289 Bacteria 3441
20 Ga0065712_10006820 3300005290 Bacteria 4608
21 Ga0065712_10016138 3300005290 Bacteria 1886
22 Ga0065712_10070478 3300005290 Bacteria 5970
23 Ga0065712_10231442 3300005290 Bacteria 1010
24 Ga0065715_10012428 3300005293 Bacteria 2402
25 Ga0065715_10180962 3300005293 Bacteria 1477
26 Ga0065715_10386856 3300005293 Bacteria 899
27 Ga0065715_10424106 3300005293 Bacteria 854
28 Ga0065707_10053290 3300005295 Bacteria 917
29 Ga0065707_10101782 3300005295 Bacteria 2845
30 Ga0065707_10119254 3300005295 Bacteria 2164
31 Ga0065707_10156092 3300005295 Bacteria 1607
32 Ga0070658_10407788 3300005327 Bacteria 1168
33 Ga0070658_10689235 3300005327 Bacteria 887
34 Ga0070676_10002320 3300005328 Bacteria 9733
35 Ga0070676_10003564 3300005328 Bacteria 8141
36 Ga0070676_10481106 3300005328 Bacteria 878
37 Ga0070683_100001511 3300005329 Bacteria 17965
38 Ga0070683_100093027 3300005329 Bacteria 2832
39 Ga0070690_100045970 3300005330 Bacteria 2775
40 Ga0070670_100004942 3300005331 Bacteria 11217
41 Ga0070670_100008476 3300005331 Bacteria 8766
42 Ga0070670_100015711 3300005331 Bacteria 6499
43 Ga0070670_100016749 3300005331 Bacteria 6291
44 Ga0070670_100025631 3300005331 Bacteria 5072
45 Ga0070670_100040227 3300005331 Bacteria 4020
46 Ga0070670_100140073 3300005331 Bacteria 2092
47 Ga0070677_10001442 3300005333 Bacteria 7540
48 Ga0070677_10012697 3300005333 Bacteria 2929
49 Ga0070677_10016155 3300005333 Bacteria 2655
50 Ga0070677_10054133 3300005333 Bacteria 1634
51 Ga0070677_10057448 3300005333 Bacteria 1594
52 Ga0070677_10170562 3300005333 Bacteria 1028
53 Ga0068869_100000636 3300005334 Bacteria 19801
54 Ga0068869_100010733 3300005334 Bacteria 5981
55 Ga0070666_10037394 3300005335 Bacteria 3227
56 Ga0070666_10098969 3300005335 Bacteria 2008
57 Ga0070666_10159326 3300005335 Bacteria 1577
58 Ga0070666_10617191 3300005335 Bacteria 792
59 Ga0070680_100425508 3300005336 Bacteria 1133
60 Ga0070680_100742470 3300005336 Bacteria 845
61 Ga0070682_100133645 3300005337 Bacteria 1682
62 Ga0068868_100005280 3300005338 Bacteria 9073
63 Ga0068868_100051330 3300005338 Bacteria 3243
64 Ga0068868_100285549 3300005338 Bacteria 1398
65 Ga0068868_100385215 3300005338 Bacteria 1207
66 Ga0070660_100155954 3300005339 Bacteria 1837
67 Ga0070689_100022070 3300005340 Bacteria 4749
68 Ga0070689_100070852 3300005340 Bacteria 2723
69 Ga0070689_100071477 3300005340 Bacteria 2711
70 Ga0070689_100133773 3300005340 Bacteria 1990
71 Ga0070691_10191866 3300005341 Bacteria 1069
72 Ga0070687_100162866 3300005343 Bacteria 1320
73 Ga0070687_100235737 3300005343 Bacteria 1129
74 Ga0070687_100454371 3300005343 Bacteria 853
75 Ga0070687_100497900 3300005343 Bacteria 820
76 Ga0070661_100097788 3300005344 Bacteria 2180
77 Ga0070661_100760269 3300005344 Bacteria 793
78 Ga0070661_100784227 3300005344 Bacteria 781
79 Ga0070692_10418763 3300005345 Bacteria 850
80 Ga0070668_100011962 3300005347 Bacteria 6464
81 Ga0070668_100054514 3300005347 Bacteria 3084
82 Ga0070668_100125172 3300005347 Bacteria 2058
83 Ga0070668_100495818 3300005347 Bacteria 1056
84 Ga0070669_100044184 3300005353 Bacteria 3246
85 Ga0070669_100089680 3300005353 Bacteria 2303
86 Ga0070669_100130402 3300005353 Bacteria 1928
87 Ga0070669_100137887 3300005353 Bacteria 1878
88 Ga0070669_100534833 3300005353 Bacteria 976
89 Ga0070675_100002214 3300005354 Bacteria 14424
90 Ga0070675_100020327 3300005354 Bacteria 5298
91 Ga0070675_100021755 3300005354 Bacteria 5123
92 Ga0070675_100029636 3300005354 Bacteria 4415
93 Ga0070675_100058127 3300005354 Bacteria 3189
94 Ga0070675_100072500 3300005354 Bacteria 2859
95 Ga0070675_100082834 3300005354 Bacteria 2677
96 Ga0070671_100001454 3300005355 Bacteria 17685
97 Ga0070671_100002792 3300005355 Bacteria 13563
98 Ga0070671_100013815 3300005355 Bacteria 6515
99 Ga0070671_100121326 3300005355 Bacteria 2200
100 Ga0070671_100354688 3300005355 Bacteria 1252
101 Ga0070671_100591182 3300005355 Bacteria 959
102 Ga0070674_100002446 3300005356 Bacteria 10278
103 Ga0070674_100009598 3300005356 Bacteria 5801
104 Ga0070673_100014728 3300005364 Bacteria 5462
105 Ga0070673_100045761 3300005364 Bacteria 3396
106 Ga0070673_100096433 3300005364 Bacteria 2427
107 Ga0070673_100166698 3300005364 Bacteria 1877
108 Ga0070673_100266442 3300005364 Bacteria 1498
109 Ga0070688_100067700 3300005365 Bacteria 2275
110 Ga0070688_100083578 3300005365 Bacteria 2072
111 Ga0070688_100230611 3300005365 Bacteria 1309
112 Ga0070688_100789145 3300005365 Bacteria 742
113 Ga0070659_100960025 3300005366 Bacteria 749
114 Ga0070667_100013338 3300005367 Bacteria 6790
115 Ga0070667_100013687 3300005367 Bacteria 6705
116 Ga0070667_100461173 3300005367 Bacteria 1162
117 Ga0070667_100589365 3300005367 Bacteria 1024
118 Ga0070667_101123193 3300005367 Bacteria 735
119 Ga0070703_10087234 3300005406 Bacteria 1075
120 Ga0070703_10163234 3300005406 Bacteria 847
121 Ga0070714_100016398 3300005435 Bacteria 5980
122 Ga0070713_100197518 3300005436 Bacteria 1815
123 Ga0070710_10289093 3300005437 Bacteria 1066
124 Ga0070701_10001212 3300005438 Bacteria 9466
125 Ga0070701_10012555 3300005438 Bacteria 3825
126 Ga0070701_10036822 3300005438 Bacteria 2467
127 Ga0070701_10104672 3300005438 Bacteria 1572
128 Ga0070701_10245475 3300005438 Bacteria 1079
129 Ga0070705_100127384 3300005440 Bacteria 1655
130 Ga0070705_100370526 3300005440 Bacteria 1051
131 Ga0070700_100009403 3300005441 Bacteria 5364
132 Ga0070700_100041415 3300005441 Bacteria 2823
133 Ga0070700_100053608 3300005441 Bacteria 2518
134 Ga0070700_100093815 3300005441 Bacteria 1964
135 Ga0070700_100102712 3300005441 Bacteria 1886
136 Ga0070694_100024635 3300005444 Bacteria 3885
137 Ga0070694_100084166 3300005444 Bacteria 2218
138 Ga0070694_100115318 3300005444 Bacteria 1919
139 Ga0070663_100244721 3300005455 Bacteria 1417
140 Ga0070663_100244735 3300005455 Bacteria 1417
141 Ga0070663_100828910 3300005455 Bacteria 795
142 Ga0070678_100023233 3300005456 Bacteria 4128
143 Ga0070678_100070710 3300005456 Bacteria 2610
144 Ga0070678_100238264 3300005456 Bacteria 1520
145 Ga0070678_100285081 3300005456 Bacteria 1398
146 Ga0070662_100008793 3300005457 Bacteria 6587
147 Ga0070662_100028944 3300005457 Bacteria 3861
148 Ga0070662_100209520 3300005457 Unclassified 1550
149 Ga0070662_100481546 3300005457 Bacteria 1033
150 Ga0070681_10128013 3300005458 Bacteria 2472
151 Ga0068867_100006351 3300005459 Bacteria 8356
152 Ga0068867_100013786 3300005459 Bacteria 5723
153 Ga0068867_100027480 3300005459 Bacteria 4090
154 Ga0070685_10072920 3300005466 Bacteria 2039
155 Ga0070706_100023229 3300005467 Bacteria 5713
156 Ga0070706_100553613 3300005467 Bacteria 1070
157 Ga0070698_100028630 3300005471 Bacteria 5785
158 Ga0070698_100195970 3300005471 Bacteria 1957
159 Ga0070699_100144595 3300005518 Bacteria 2101
160 Ga0070699_100233093 3300005518 Unclassified 1642
161 Ga0070679_100004020 3300005530 Bacteria 13550
162 Ga0070684_100117928 3300005535 Bacteria 2385
163 Ga0070672_100011370 3300005543 Bacteria 6207
164 Ga0070672_100014821 3300005543 Bacteria 5533
165 Ga0070672_100025638 3300005543 Bacteria 4376
166 Ga0070672_100095959 3300005543 Bacteria 2398
167 Ga0070672_100100864 3300005543 Bacteria 2341
168 Ga0070672_100148723 3300005543 Bacteria 1936
169 Ga0070672_100293241 3300005543 Bacteria 1378
170 Ga0070672_100564991 3300005543 Bacteria 989
171 Ga0070672_100569262 3300005543 Bacteria 985
172 Ga0070686_100020370 3300005544 Bacteria 3923
173 Ga0070686_100062784 3300005544 Bacteria 2405
174 Ga0070686_100078939 3300005544 Bacteria 2175
175 Ga0070686_100167999 3300005544 Bacteria 1549
176 Ga0070695_100377521 3300005545 Bacteria 1069
177 Ga0070696_100165918 3300005546 Bacteria 1630
178 Ga0070693_100003087 3300005547 Bacteria 7728
179 Ga0070665_100062597 3300005548 Bacteria 3731
180 Ga0070665_100090553 3300005548 Bacteria 3065
181 Ga0070665_100244281 3300005548 Bacteria 1796
182 Ga0070665_100288066 3300005548 Bacteria 1645
183 Ga0070665_100569614 3300005548 Bacteria 1145
184 Ga0070665_100701411 3300005548 Bacteria 1025
185 Ga0070665_100971368 3300005548 Bacteria 862
186 Ga0070665_101201713 3300005548 Bacteria 769
187 Ga0070704_100079697 3300005549 Bacteria 2406
188 Ga0070704_100963245 3300005549 Bacteria 770
189 Ga0070664_100022668 3300005564 Bacteria 5178
190 Ga0070664_100061497 3300005564 Bacteria 3200
191 Ga0070664_100196318 3300005564 Bacteria 1799
192 Ga0070664_100251307 3300005564 Bacteria 1589
193 Ga0068857_100315076 3300005577 Bacteria 1444
194 Ga0068857_100457495 3300005577 Bacteria 1194
195 Ga0068854_100499670 3300005578 Bacteria 1024
196 Ga0068856_100088638 3300005614 Bacteria 3077
197 Ga0068856_100210088 3300005614 Bacteria 1961
198 Ga0070702_100032319 3300005615 Bacteria 2871
199 Ga0070702_100065327 3300005615 Bacteria 2131
200 Ga0068859_100011569 3300005617 Bacteria 8873
201 Ga0068859_100068418 3300005617 Bacteria 3585
202 Ga0068859_100090595 3300005617 Bacteria 3109
203 Ga0068859_100302546 3300005617 Bacteria 1693
204 Ga0068859_100382228 3300005617 Bacteria 1503
205 Ga0068859_100447447 3300005617 Bacteria 1388
206 Ga0068864_100001780 3300005618 Bacteria 17689
207 Ga0068864_100005066 3300005618 Bacteria 10791
208 Ga0068864_100034829 3300005618 Bacteria 4284
209 Ga0068864_100087042 3300005618 Bacteria 2750
210 Ga0068864_100095173 3300005618 Bacteria 2633
211 Ga0068864_100107584 3300005618 Bacteria 2480
212 Ga0068864_100117037 3300005618 Bacteria 2379
213 Ga0068864_100484472 3300005618 Bacteria 1188
214 Ga0068866_10001987 3300005718 Bacteria 8525
215 Ga0068866_10571906 3300005718 Bacteria 759
216 Ga0068861_100030062 3300005719 Bacteria 3979
217 Ga0068861_100101615 3300005719 Bacteria 2287
218 Ga0068861_100131470 3300005719 Bacteria 2032
219 Ga0068861_100170581 3300005719 Bacteria 1803
220 Ga0068861_100270592 3300005719 Bacteria 1459
221 Ga0068861_100811567 3300005719 Bacteria 879
222 Ga0068870_10130425 3300005840 Unclassified 1459
223 Ga0068870_10201931 3300005840 Bacteria 1206
224 Ga0068870_10296470 3300005840 Bacteria 1019
225 Ga0068863_100002522 3300005841 Bacteria 18174
226 Ga0068863_100011364 3300005841 Bacteria 8621
227 Ga0068863_100030794 3300005841 Bacteria 5124
228 Ga0068863_100048634 3300005841 Bacteria 4021
229 Ga0068863_100241991 3300005841 Bacteria 1742
230 Ga0068858_100020959 3300005842 Bacteria 6107
231 Ga0068858_100040023 3300005842 Bacteria 4346
232 Ga0068858_100194527 3300005842 Bacteria 1916
233 Ga0068860_100035450 3300005843 Bacteria 4785
234 Ga0068860_100398260 3300005843 Bacteria 1362
235 Ga0068862_100004252 3300005844 Bacteria 12128
236 Ga0068862_100136660 3300005844 Bacteria 2173
237 Ga0068862_100167129 3300005844 Bacteria 1967
238 Ga0068862_100210662 3300005844 Bacteria 1756
239 Ga0068862_100269801 3300005844 Bacteria 1556
240 Ga0068862_100678890 3300005844 Bacteria 996
241 Ga0081455_10164011 3300005937 Bacteria 1700
242 Ga0081539_10000133 3300005985 Bacteria 173855
243 Ga0081539_10000219 3300005985 Bacteria 134405
244 Ga0081539_10000329 3300005985 Bacteria 105307
245 Ga0081539_10034885 3300005985 Bacteria 3033
246 Ga0070717_10017715 3300006028 Bacteria 5548
247 Ga0075365_10235248 3300006038 Bacteria 1286
248 Ga0075368_10011966 3300006042 Bacteria 3166
249 Ga0075432_10184399 3300006058 Bacteria 818
250 Ga0070716_100004079 3300006173 Bacteria 6931
251 Ga0070716_100575976 3300006173 Bacteria 843
252 Ga0070712_100058058 3300006175 Bacteria 2721
253 Ga0075367_10009828 3300006178 Bacteria 5012
254 Ga0075369_10018775 3300006186 Bacteria 2818
255 Ga0097621_100044809 3300006237 Bacteria 3570
256 Ga0097621_100189922 3300006237 Bacteria 1779
257 Ga0097621_100236392 3300006237 Bacteria 1596
258 Ga0097621_100308406 3300006237 Bacteria 1399
259 Ga0097621_100489620 3300006237 Bacteria 1113
260 Ga0075370_10059103 3300006353 Bacteria 2181
261 Ga0068871_100029013 3300006358 Bacteria 4343
262 Ga0068871_100054420 3300006358 Bacteria 3247
263 Ga0068871_100321061 3300006358 Bacteria 1364
264 Ga0068871_100548120 3300006358 Bacteria 1047
265 Ga0075428_100001611 3300006844 Bacteria 24116
266 Ga0075428_100010461 3300006844 Bacteria 10306
267 Ga0075428_100021049 3300006844 Bacteria 7223
268 Ga0075428_100086365 3300006844 Bacteria 3422
269 Ga0075428_100109854 3300006844 Unclassified 3004
270 Ga0075428_100123006 3300006844 Bacteria 2824
271 Ga0075428_100681423 3300006844 Bacteria 1096
272 Ga0075428_100939087 3300006844 Bacteria 917
273 Ga0075430_100001888 3300006846 Bacteria 17166
274 Ga0075430_100034162 3300006846 Bacteria 4315
275 Ga0075430_100035431 3300006846 Bacteria 4233
276 Ga0075430_100287170 3300006846 Bacteria 1361
277 Ga0075431_100002059 3300006847 Bacteria 19211
278 Ga0075431_100006116 3300006847 Bacteria 11940
279 Ga0075431_100009127 3300006847 Bacteria 9944
280 Ga0075431_100131533 3300006847 Bacteria 2581
281 Ga0075431_100150260 3300006847 Bacteria 2399
282 Ga0075431_100402312 3300006847 Bacteria 1370
283 Ga0075431_100619702 3300006847 Bacteria 1064
284 Ga0075431_100658646 3300006847 Bacteria 1027
285 Ga0075433_10000801 3300006852 Bacteria 21822
286 Ga0075433_10045435 3300006852 Bacteria 3818
287 Ga0075434_100002267 3300006871 Bacteria 16831
288 Ga0075434_100013753 3300006871 Bacteria 7717
289 Ga0075434_100219281 3300006871 Bacteria 1922
290 Ga0075434_100287895 3300006871 Bacteria 1663
291 Ga0075434_100491521 3300006871 Bacteria 1248
292 Ga0075434_100747771 3300006871 Bacteria 995
293 Ga0075429_100000003 3300006880 Bacteria 130377
294 Ga0075429_100027367 3300006880 Bacteria 4949
295 Ga0075429_100079124 3300006880 Bacteria 2866
296 Ga0075429_100481456 3300006880 Bacteria 1087
297 Ga0068865_100003497 3300006881 Bacteria 9418
298 Ga0068865_100095760 3300006881 Bacteria 2163
299 Ga0068865_100675780 3300006881 Bacteria 880
300 Ga0068865_100692360 3300006881 Bacteria 870
301 Ga0075436_100624904 3300006914 Bacteria 794
302 Ga0097620_100011569 3300006931 Bacteria 8873
303 Ga0097620_100068420 3300006931 Bacteria 3585
304 Ga0097620_100090594 3300006931 Bacteria 3109
305 Ga0097620_100302581 3300006931 Bacteria 1693
306 Ga0097620_100382233 3300006931 Bacteria 1503
307 Ga0097620_100447504 3300006931 Bacteria 1388
308 Ga0075435_100022855 3300007076 Bacteria 4828
309 Ga0075435_100032377 3300007076 Bacteria 4128
310 Ga0075435_100235757 3300007076 Unclassified 1555
311 Ga0099794_10016714 3300007265 Bacteria 3258
312 Ga0099794_10028304 3300007265 Bacteria 2606
313 Ga0099794_10233801 3300007265 Bacteria 946
314 Ga0099795_10049790 3300007788 Unclassified 1521
315 Ga0105251_10004768 3300009011 Bacteria 9077
316 Ga0105251_10106747 3300009011 Bacteria 1278
317 Ga0105244_10053926 3300009036 Bacteria 2041
318 Ga0105250_10050215 3300009092 Bacteria 1674
319 Ga0105240_10000052 3300009093 Bacteria 232583
320 Ga0105240_10178832 3300009093 Bacteria 2505
321 Ga0105240_10196055 3300009093 Bacteria 2371
322 Ga0111539_10002454 3300009094 Bacteria 24635
323 Ga0111539_10010352 3300009094 Bacteria 11741
324 Ga0111539_10019309 3300009094 Bacteria 8415
325 Ga0111539_10044276 3300009094 Bacteria 5333
326 Ga0111539_10099831 3300009094 Bacteria 3408
327 Ga0111539_10119705 3300009094 Bacteria 3085
328 Ga0111539_10144534 3300009094 Bacteria 2784
329 Ga0111539_10146808 3300009094 Bacteria 2761
330 Ga0111539_10455079 3300009094 Bacteria 1490
331 Ga0111539_10512928 3300009094 Bacteria 1397
332 Ga0111539_11149196 3300009094 Unclassified 902
333 Ga0105245_10010732 3300009098 Bacteria 7969
334 Ga0105245_10018846 3300009098 Bacteria 6039
335 Ga0105245_10045439 3300009098 Bacteria 3923
336 Ga0105245_10066233 3300009098 Bacteria 3269
337 Ga0105245_10367897 3300009098 Bacteria 1429
338 Ga0105245_10511475 3300009098 Bacteria 1218
339 Ga0105247_10032737 3300009101 Bacteria 3159
340 Ga0105247_10034709 3300009101 Bacteria 3072
341 Ga0114129_10007207 3300009147 Bacteria 15824
342 Ga0114129_10035772 3300009147 Bacteria 7014
343 Ga0114129_10064405 3300009147 Bacteria 5115
344 Ga0114129_10129102 3300009147 Bacteria 3474
345 Ga0114129_10299571 3300009147 Bacteria 2143
346 Ga0114129_10443250 3300009147 Bacteria 1704
347 Ga0114129_10682177 3300009147 Bacteria 1323
348 Ga0114129_10860476 3300009147 Bacteria 1152
349 Ga0105243_10013712 3300009148 Bacteria 6131
350 Ga0105243_10206281 3300009148 Bacteria 1727
351 Ga0105243_10357035 3300009148 Bacteria 1344
352 Ga0105243_11099763 3300009148 Bacteria 803
353 Ga0105242_10000995 3300009176 Bacteria 22203
354 Ga0105242_10014788 3300009176 Bacteria 6043
355 Ga0105242_10140644 3300009176 Bacteria 2094
356 Ga0105242_10233566 3300009176 Bacteria 1649
357 Ga0105242_11265572 3300009176 Bacteria 760
358 Ga0105248_10015744 3300009177 Bacteria 8335
359 Ga0105248_10114285 3300009177 Bacteria 3045
360 Ga0105248_10646780 3300009177 Bacteria 1193
361 Ga0105248_10880245 3300009177 Bacteria 1011
362 Ga0105248_10999923 3300009177 Bacteria 945
363 Ga0105238_10015828 3300009551 Bacteria 7636
364 Ga0105238_10018756 3300009551 Bacteria 7045
365 Ga0105249_10002175 3300009553 Bacteria 16984
366 Ga0105249_10094139 3300009553 Bacteria 2807
367 Ga0105249_10294467 3300009553 Bacteria 1625
368 Ga0105239_10006686 3300010375 Bacteria 13321
369 Ga0105239_10180676 3300010375 Bacteria 2361
370 Ga0105239_10668536 3300010375 Bacteria 1187
371 Ga0105239_11093409 3300010375 Bacteria 918
372 Ga0105246_10002402 3300011119 Bacteria 11304
373 Ga0105246_10011917 3300011119 Bacteria 5410
374 Ga0105246_10107651 3300011119 Bacteria 2042
375 Ga0157371_10103662 3300013102 Bacteria 2018
376 Ga0157369_10607568 3300013105 Bacteria 1129
377 Ga0157374_10084063 3300013296 Bacteria 3025
378 Ga0157374_10450589 3300013296 Bacteria 1288
379 Ga0157378_10193094 3300013297 Bacteria 1922
380 Ga0163162_10000812 3300013306 Bacteria 28975
381 Ga0163162_10000983 3300013306 Bacteria 26506
382 Ga0163162_10066581 3300013306 Bacteria 3651
383 Ga0163162_10180331 3300013306 Bacteria 2238
384 Ga0163162_10203652 3300013306 Bacteria 2108
385 Ga0163162_10263680 3300013306 Bacteria 1854
386 Ga0157372_10425241 3300013307 Bacteria 1548
387 Ga0157375_10058921 3300013308 Bacteria 3802
388 Ga0157375_10183834 3300013308 Bacteria 2243
389 Ga0157375_10453555 3300013308 Bacteria 1448
390 Ga0157375_10480974 3300013308 Bacteria 1407
391 Ga0157375_10894412 3300013308 Bacteria 1032
392 Ga0163163_10003481 3300014325 Bacteria 13370
393 Ga0163163_10010402 3300014325 Bacteria 8365
394 Ga0163163_10029715 3300014325 Bacteria 5260
395 Ga0163163_10377683 3300014325 Bacteria 1475
396 Ga0163163_10457212 3300014325 Unclassified 1337
397 Ga0163163_10509394 3300014325 Bacteria 1265
398 Ga0163163_10718761 3300014325 Bacteria 1062
399 Ga0163163_11127638 3300014325 Bacteria 847
400 Ga0157380_10003751 3300014326 Bacteria 10451
401 Ga0157380_10010778 3300014326 Bacteria 6587
402 Ga0157380_10065936 3300014326 Bacteria 2912
403 Ga0157380_10083289 3300014326 Bacteria 2620
404 Ga0157380_10132656 3300014326 Bacteria 2128
405 Ga0157380_10208511 3300014326 Bacteria 1740
406 Ga0157380_10403381 3300014326 Bacteria 1298
407 Ga0157380_10818195 3300014326 Bacteria 950
408 Ga0157380_11025110 3300014326 Bacteria 860
409 Ga0157377_10040201 3300014745 Bacteria 2588
410 Ga0157377_10072700 3300014745 Bacteria 1991
411 Ga0157377_10098737 3300014745 Bacteria 1736
412 Ga0157377_10182669 3300014745 Bacteria 1320
413 Ga0157377_10185263 3300014745 Bacteria 1312
414 Ga0157377_10518398 3300014745 Unclassified 836
415 Ga0157379_10011611 3300014968 Bacteria 7691
416 Ga0157379_10062893 3300014968 Bacteria 3319
417 Ga0157379_10072571 3300014968 Bacteria 3080
418 Ga0157379_10182322 3300014968 Bacteria 1897
419 Ga0157379_10307695 3300014968 Bacteria 1445
420 Ga0157376_10020581 3300014969 Bacteria 5107
421 Ga0157376_10039405 3300014969 Bacteria 3853
422 Ga0157376_10201781 3300014969 Bacteria 1830
423 Ga0157376_10284885 3300014969 Bacteria 1558
424 Ga0157376_11429408 3300014969 Bacteria 724
425 Ga0183367_1021 3300015688 Bacteria 82913
426 Ga0163161_10205192 3300017792 Bacteria 1520
427 Ga0163161_10252644 3300017792 Bacteria 1374
428 Ga0163161_10577674 3300017792 Bacteria 924
429 Ga0163161_10988685 3300017792 Bacteria 718
430 Ga0213875_10189291 3300021388 Bacteria 967
431 Ga0209674_100011 3300025226 Bacteria 997175
432 Ga0209672_100002 3300025228 Bacteria 1733325
433 Ga0209147_100003 3300025229 Bacteria 1733325
434 Ga0209563_100803 3300025230 Bacteria 9422
435 Ga0207427_100610 3300025231 Bacteria 17768
436 Ga0209258_100042 3300025242 Bacteria 380729
437 Ga0209148_1000006 3300025254 Bacteria 1733325
438 Ga0209148_1001617 3300025254 Bacteria 10460
439 Ga0209759_1000051 3300025256 Bacteria 214016
440 Ga0209233_1000033 3300025261 Bacteria 596094
441 Ga0209455_1000003 3300025272 Bacteria 1471893
442 Ga0209455_1003782 3300025272 Bacteria 5207
443 Ga0207426_1002893 3300025302 Bacteria 10143
444 Ga0207697_10002977 3300025315 Bacteria 8550
445 Ga0207696_1083552 3300025711 Bacteria 880
446 Ga0207655_1107740 3300025728 Bacteria 947
447 Ga0207713_1003152 3300025735 Bacteria 11432
448 Ga0207682_10002341 3300025893 Bacteria 8544
449 Ga0207682_10004751 3300025893 Bacteria 5635
450 Ga0207682_10023842 3300025893 Bacteria 2420
451 Ga0207682_10052188 3300025893 Bacteria 1694
452 Ga0207682_10160522 3300025893 Bacteria 1018
453 Ga0207642_10015889 3300025899 Bacteria 2820
454 Ga0207642_10190645 3300025899 Bacteria 1125
455 Ga0207642_10360604 3300025899 Bacteria 860
456 Ga0207688_10006362 3300025901 Bacteria 6431
457 Ga0207680_10065152 3300025903 Bacteria 2236
458 Ga0207680_10083605 3300025903 Bacteria 2012
459 Ga0207680_10117970 3300025903 Bacteria 1732
460 Ga0207680_10202828 3300025903 Bacteria 1352
461 Ga0207680_10206685 3300025903 Bacteria 1341
462 Ga0207680_10260425 3300025903 Bacteria 1200
463 Ga0207680_10503058 3300025903 Bacteria 863
464 Ga0207645_10002246 3300025907 Bacteria 15364
465 Ga0207645_10008417 3300025907 Bacteria 7196
466 Ga0207645_10062340 3300025907 Bacteria 2382
467 Ga0207645_10252954 3300025907 Bacteria 1166
468 Ga0207645_10698976 3300025907 Bacteria 689
469 Ga0207643_10003472 3300025908 Bacteria 8482
470 Ga0207643_10018291 3300025908 Bacteria 3838
471 Ga0207643_10022591 3300025908 Bacteria 3464
472 Ga0207705_10412066 3300025909 Bacteria 1046
473 Ga0207707_10015561 3300025912 Bacteria 6626
474 Ga0207695_10000122 3300025913 Bacteria 232677
475 Ga0207695_10489659 3300025913 Bacteria 1112
476 Ga0207693_10365787 3300025915 Bacteria 1128
477 Ga0207662_10012068 3300025918 Bacteria 4807
478 Ga0207662_10073842 3300025918 Bacteria 2069
479 Ga0207662_10104897 3300025918 Bacteria 1756
480 Ga0207662_10112459 3300025918 Bacteria 1699
481 Ga0207649_10039184 3300025920 Bacteria 2871
482 Ga0207649_10044717 3300025920 Bacteria 2712
483 Ga0207649_10573246 3300025920 Bacteria 866
484 Ga0207652_10034319 3300025921 Bacteria 4275
485 Ga0207646_10737788 3300025922 Bacteria 879
486 Ga0207681_10007823 3300025923 Bacteria 6547
487 Ga0207681_10083805 3300025923 Bacteria 2258
488 Ga0207681_10136394 3300025923 Bacteria 1822
489 Ga0207681_10138337 3300025923 Bacteria 1810
490 Ga0207681_10156419 3300025923 Bacteria 1713
491 Ga0207681_10238915 3300025923 Bacteria 1413
492 Ga0207681_10624100 3300025923 Bacteria 892
493 Ga0207694_10064635 3300025924 Bacteria 2851
494 Ga0207650_10009090 3300025925 Bacteria 6792
495 Ga0207650_10033256 3300025925 Bacteria 3733
496 Ga0207650_10090786 3300025925 Bacteria 2333
497 Ga0207650_10108457 3300025925 Bacteria 2146
498 Ga0207650_10199055 3300025925 Bacteria 1604
499 Ga0207650_10442469 3300025925 Bacteria 1081
500 Ga0207659_10004973 3300025926 Bacteria 8056
501 Ga0207659_10006385 3300025926 Bacteria 7220
502 Ga0207659_10013335 3300025926 Bacteria 5260
503 Ga0207659_10055287 3300025926 Bacteria 2838
504 Ga0207659_10111952 3300025926 Bacteria 2076
505 Ga0207659_10180228 3300025926 Bacteria 1673
506 Ga0207659_10182752 3300025926 Bacteria 1663
507 Ga0207659_10341527 3300025926 Bacteria 1240
508 Ga0207659_10351646 3300025926 Bacteria 1223
509 Ga0207659_10438091 3300025926 Bacteria 1099
510 Ga0207659_10627831 3300025926 Bacteria 917
511 Ga0207687_10010576 3300025927 Bacteria 6030
512 Ga0207687_10042407 3300025927 Bacteria 3130
513 Ga0207687_10099426 3300025927 Bacteria 2137
514 Ga0207687_10330053 3300025927 Bacteria 1237
515 Ga0207644_10001383 3300025931 Bacteria 15632
516 Ga0207644_10010956 3300025931 Bacteria 5989
517 Ga0207644_10138546 3300025931 Bacteria 1871
518 Ga0207644_10489248 3300025931 Bacteria 1014
519 Ga0207644_10519047 3300025931 Bacteria 984
520 Ga0207706_10017818 3300025933 Bacteria 6398
521 Ga0207706_10042151 3300025933 Bacteria 4045
522 Ga0207706_10125175 3300025933 Bacteria 2261
523 Ga0207706_10338780 3300025933 Bacteria 1308
524 Ga0207706_10436838 3300025933 Bacteria 1133
525 Ga0207686_10006341 3300025934 Bacteria 6364
526 Ga0207686_10020936 3300025934 Bacteria 3744
527 Ga0207686_10150778 3300025934 Bacteria 1618
528 Ga0207709_10019504 3300025935 Bacteria 3815
529 Ga0207670_10072365 3300025936 Bacteria 2386
530 Ga0207670_10136996 3300025936 Bacteria 1801
531 Ga0207670_10271752 3300025936 Bacteria 1318
532 Ga0207669_10001682 3300025937 Bacteria 9406
533 Ga0207669_10008072 3300025937 Bacteria 4924
534 Ga0207669_10031054 3300025937 Bacteria 2979
535 Ga0207669_10198446 3300025937 Bacteria 1454
536 Ga0207669_10732587 3300025937 Bacteria 815
537 Ga0207704_10051920 3300025938 Bacteria 2483
538 Ga0207665_10010830 3300025939 Bacteria 5987
539 Ga0207691_10002388 3300025940 Bacteria 18369
540 Ga0207691_10002501 3300025940 Bacteria 17980
541 Ga0207691_10028705 3300025940 Bacteria 5206
542 Ga0207691_10047283 3300025940 Bacteria 3948
543 Ga0207691_10085355 3300025940 Bacteria 2833
544 Ga0207691_10117477 3300025940 Bacteria 2360
545 Ga0207711_10023625 3300025941 Bacteria 5147
546 Ga0207711_10393258 3300025941 Bacteria 1287
547 Ga0207689_10008126 3300025942 Bacteria 9153
548 Ga0207689_10086901 3300025942 Bacteria 2569
549 Ga0207689_10098421 3300025942 Bacteria 2403
550 Ga0207661_10007758 3300025944 Bacteria 7642
551 Ga0207679_10045357 3300025945 Bacteria 3178
552 Ga0207679_10128089 3300025945 Bacteria 2032
553 Ga0207679_10233718 3300025945 Bacteria 1554
554 Ga0207651_10029303 3300025960 Bacteria 3486
555 Ga0207651_10030907 3300025960 Bacteria 3417
556 Ga0207651_10044042 3300025960 Bacteria 2983
557 Ga0207651_10050741 3300025960 Bacteria 2819
558 Ga0207651_10109329 3300025960 Bacteria 2071
559 Ga0207651_10192585 3300025960 Bacteria 1627
560 Ga0207651_10372508 3300025960 Bacteria 1208
561 Ga0207712_10149313 3300025961 Bacteria 1803
562 Ga0207712_10273781 3300025961 Bacteria 1375
563 Ga0207712_10406206 3300025961 Bacteria 1146
564 Ga0207712_11143657 3300025961 Unclassified 694
565 Ga0207668_10173833 3300025972 Bacteria 1692
566 Ga0207668_10218632 3300025972 Bacteria 1528
567 Ga0207640_10592203 3300025981 Bacteria 937
568 Ga0207658_10014143 3300025986 Bacteria 5466
569 Ga0207658_10136890 3300025986 Bacteria 1976
570 Ga0207658_11057546 3300025986 Bacteria 741
571 Ga0207658_11367649 3300025986 Bacteria 648
572 Ga0207677_10096242 3300026023 Bacteria 2166
573 Ga0207703_10039720 3300026035 Bacteria 3762
574 Ga0207703_10117183 3300026035 Bacteria 2281
575 Ga0207678_10077130 3300026067 Bacteria 2854
576 Ga0207678_10516119 3300026067 Bacteria 1043
577 Ga0207678_10851361 3300026067 Bacteria 806
578 Ga0207678_11040186 3300026067 Bacteria 725
579 Ga0207708_10026855 3300026075 Bacteria 4358
580 Ga0207708_10035413 3300026075 Bacteria 3799
581 Ga0207708_10060464 3300026075 Bacteria 2892
582 Ga0207708_10063996 3300026075 Bacteria 2810
583 Ga0207708_10412034 3300026075 Bacteria 1119
584 Ga0207708_11003099 3300026075 Bacteria 725
585 Ga0207702_10024939 3300026078 Bacteria 4962
586 Ga0207702_10039177 3300026078 Bacteria 3970
587 Ga0207702_10735214 3300026078 Bacteria 973
588 Ga0207641_10013055 3300026088 Bacteria 6813
589 Ga0207641_10016365 3300026088 Bacteria 6071
590 Ga0207641_10016663 3300026088 Bacteria 6017
591 Ga0207641_10042754 3300026088 Bacteria 3802
592 Ga0207641_10527283 3300026088 Bacteria 1149
593 Ga0207648_10003093 3300026089 Bacteria 17578
594 Ga0207648_10054704 3300026089 Bacteria 3485
595 Ga0207648_10138782 3300026089 Bacteria 2142
596 Ga0207648_10218035 3300026089 Unclassified 1695
597 Ga0207648_10246016 3300026089 Bacteria 1594
598 Ga0207676_10000881 3300026095 Bacteria 23317
599 Ga0207676_10023698 3300026095 Bacteria 4533
600 Ga0207676_10043399 3300026095 Bacteria 3462
601 Ga0207676_10075913 3300026095 Bacteria 2713
602 Ga0207676_10146877 3300026095 Bacteria 2026
603 Ga0207676_10259134 3300026095 Bacteria 1569
604 Ga0207676_10585833 3300026095 Bacteria 1070
605 Ga0207676_10743179 3300026095 Bacteria 953
606 Ga0207674_10057329 3300026116 Bacteria 3949
607 Ga0207674_10400681 3300026116 Bacteria 1326
608 Ga0207675_100013285 3300026118 Bacteria 7688
609 Ga0207675_100017706 3300026118 Bacteria 6647
610 Ga0207675_100039464 3300026118 Bacteria 4406
611 Ga0207675_100047554 3300026118 Bacteria 4005
612 Ga0207675_100135806 3300026118 Bacteria 2333
613 Ga0207675_100213364 3300026118 Bacteria 1857
614 Ga0207675_100861745 3300026118 Bacteria 921
615 Ga0207683_10001982 3300026121 Bacteria 18116
616 Ga0207683_10029975 3300026121 Bacteria 4713
617 Ga0207683_10060121 3300026121 Bacteria 3339
618 Ga0207683_10150402 3300026121 Bacteria 2101
619 Ga0207683_10156372 3300026121 Bacteria 2059
620 Ga0207683_10186772 3300026121 Bacteria 1881
621 Ga0207683_10219559 3300026121 Bacteria 1732
622 Ga0207683_10294142 3300026121 Bacteria 1485
623 Ga0207683_10304561 3300026121 Bacteria 1458
624 Ga0207683_10469585 3300026121 Bacteria 1161
625 Ga0209588_1001197 3300027671 Bacteria 6707
626 Ga0209588_1062266 3300027671 Bacteria 1206
627 Ga0209971_1042278 3300027682 Bacteria 1097
628 Ga0209813_10021546 3300027866 Bacteria 1813
629 Ga0207428_10010695 3300027907 Bacteria 8184
630 Ga0207428_10015486 3300027907 Bacteria 6596
631 Ga0207428_10086811 3300027907 Bacteria 2435
632 Ga0207428_10091287 3300027907 Bacteria 2364
633 Ga0207428_10121070 3300027907 Unclassified 2006
634 Ga0207428_10127367 3300027907 Bacteria 1950
635 Ga0207428_10494480 3300027907 Bacteria 889
636 Ga0268266_10120852 3300028379 Bacteria 2331
637 Ga0268266_10498621 3300028379 Bacteria 1162
638 Ga0268266_10851542 3300028379 Bacteria 881
639 Ga0268266_10929321 3300028379 Bacteria 841
640 Ga0268265_10027299 3300028380 Bacteria 4073
641 Ga0268265_10063693 3300028380 Bacteria 2838
642 Ga0268265_10144242 3300028380 Bacteria 1998
643 Ga0268265_10340100 3300028380 Bacteria 1366
644 Ga0268265_10673305 3300028380 Bacteria 997
645 Ga0268265_11019859 3300028380 Bacteria 818
646 Ga0268265_11034458 3300028380 Bacteria 813
647 Ga0268264_10024489 3300028381 Bacteria 4928
648 Ga0268264_10029081 3300028381 Bacteria 4525
649 Ga0268264_10468847 3300028381 Bacteria 1223
650 Ga0307511_10000753 3300030521 Bacteria 34607
651 Ga0265320_10132298 3300031240 Bacteria 1133
652 Ga0307513_10007242 3300031456 Bacteria 14407
653 Ga0307408_100079340 3300031548 Bacteria 2449
654 Ga0307408_100905245 3300031548 Bacteria 808
655 Ga0316575_10062868 3300031665 Bacteria 1485
656 Ga0265314_10002259 3300031711 Bacteria 19948
657 Ga0307516_10438510 3300031730 Bacteria 963
658 Ga0307405_10014597 3300031731 Bacteria 4229
659 Ga0307405_10015195 3300031731 Bacteria 4162
660 Ga0307405_10035416 3300031731 Bacteria 2981
661 Ga0307413_10006412 3300031824 Bacteria 5368
662 Ga0307413_10160631 3300031824 Bacteria 1578
663 Ga0307518_10249959 3300031838 Bacteria 1128
664 Ga0307410_10109505 3300031852 Bacteria 1996
665 Ga0307410_10142863 3300031852 Bacteria 1773
666 Ga0307410_10477230 3300031852 Bacteria 1022
667 Ga0307407_10025679 3300031903 Bacteria 3108
668 Ga0307407_10091770 3300031903 Bacteria 1863
669 Ga0307412_10011434 3300031911 Bacteria 5144
670 Ga0307412_10394406 3300031911 Bacteria 1125
671 Ga0307409_100326842 3300031995 Bacteria 1437
672 Ga0307409_100571376 3300031995 Bacteria 1113
673 Ga0307416_100017210 3300032002 Bacteria 5049
674 Ga0307416_100030947 3300032002 Bacteria 4023
675 Ga0307414_10026496 3300032004 Bacteria 3732
676 Ga0307414_10529761 3300032004 Bacteria 1047
677 Ga0307411_10048678 3300032005 Bacteria 2749
678 Ga0307411_10123136 3300032005 Bacteria 1880
679 Ga0307415_100049190 3300032126 Bacteria 2849
680 Ga0307415_100051773 3300032126 Bacteria 2789
681 Ga0307507_10036513 3300033179 Bacteria 5021
682 Ga0373938_0008859 3300034957 Bacteria 1807
683 Ga0373952_0021108 3300035092 Bacteria 1372
684 Ga0373939_0054799 3300035114 Bacteria 1250
685 Ga0373955_0072642 3300035172 Bacteria 1927
686 Ga0316574_0196335 3300035398 Bacteria 1297
687 Ga0373931_0026585 3300035691 Bacteria 2947
688 Ga0373933_0264667 3300035724 Bacteria 1109
689 Ga0373937_0211861 3300036401 Bacteria 1823
690 Ga0373937_0387602 3300036401 Bacteria 1325
691 Ga0373937_0443544 3300036401 Bacteria 1232
692 Ga0373925_0043043 3300037068 Bacteria 3351
693 Ga0373925_0229822 3300037068 Bacteria 1483
694 Ga0395898_0077282 3300037466 Bacteria 3214
695 Ga0436364_1036432 3300037853 Bacteria 2248
696 Ga0395901_0233293 3300038443 Bacteria 1921
697 Ga0395901_0540294 3300038443 Bacteria 1182
698 Ga0436365_0897074 3300039437 Bacteria 6301
699 Ga0439461_0074718 3300041410 Bacteria 791
700 Ga0451800_0886097 3300041459 Bacteria 964
701 Ga0451833_0106998 3300041491 Bacteria 2216
702 Ga0451833_0113201 3300041491 Bacteria 986
703 Ga0451835_0659563 3300041492 Bacteria 1591
704 Ga0451837_1544089 3300041494 Bacteria 987
705 Ga0451841_1451426 3300041498 Unclassified 1630
706 Ga0451845_0982859 3300041501 Bacteria 1336
707 Ga0451847_0527546 3300041503 Bacteria 883
708 Ga0451849_0684911 3300041505 Bacteria 1059
709 Ga0451853_0301670 3300041512 Bacteria 2337
710 Ga0451853_0751866 3300041512 Bacteria 6538
711 Ga0451853_0912580 3300041512 Bacteria 1868
712 Ga0451853_1156423 3300041512 Bacteria 2182
713 Ga0439441_001360 3300042001 Bacteria 3166
714 Ga0439441_021743 3300042001 Bacteria 1187
715 Ga0439455_0025760 3300042012 Bacteria 1431
716 Ga0450894_025984 3300042131 Bacteria 803
717 Ga0450903_000057 3300042138 Bacteria 22728
718 Ga0450905_015167 3300042142 Bacteria 1104
719 Ga0439458_0000582 3300042157 Bacteria 9402
720 Ga0439458_0087065 3300042157 Bacteria 801
721 Ga0439458_0097807 3300042157 Bacteria 760
722 Ga0439435_0175842 3300042436 Bacteria 697
723 Ga0451577_0217584 3300042876 Bacteria 1726
724 Ga0439440_0047346 3300042993 Bacteria 1065
725 Ga0466963_0044773 3300044694 Bacteria 2913
726 Ga0466963_0193507 3300044694 Bacteria 1421
727 Ga0466963_0255863 3300044694 Bacteria 1229
728 Ga0466963_0359694 3300044694 Bacteria 1025
729 Ga0466957_0029088 3300044842 Bacteria 3293
730 Ga0466957_0166653 3300044842 Bacteria 1433
731 Ga0451576_0036785 3300045051 Bacteria 5187
732 Ga0451576_0122617 3300045051 Bacteria 2706
733 Ga0451576_0212864 3300045051 Bacteria 2018
734 Ga0451576_0425588 3300045051 Bacteria 1393
735 Ga0451576_0573630 3300045051 Bacteria 1185
736 Ga0466958_0094533 3300045836 Bacteria 1852
737 Ga0466967_0000816 3300045976 Bacteria 16359
738 Ga0466967_0025195 3300045976 Bacteria 4902
739 Ga0466967_0144481 3300045976 Bacteria 2218
740 Ga0466967_0546623 3300045976 Bacteria 1140
741 Ga0466967_0656997 3300045976 Bacteria 1037
742 Ga0495603_0099165 3300046455 Bacteria 1701
743 Ga0495590_0003033 3300046457 Bacteria 6884
744 Ga0495591_001035 3300046458 Bacteria 18772
745 Ga0495629_0001977 3300046459 Bacteria 15974
746 Ga0495629_0015038 3300046459 Bacteria 5562
747 Ga0495638_0028495 3300046460 Bacteria 3605
748 Ga0495638_0065401 3300046460 Bacteria 2238
749 Ga0495641_0160117 3300046461 Bacteria 1007
750 Ga0495651_0005248 3300046462 Bacteria 9875
751 Ga0495651_0268289 3300046462 Bacteria 1158
752 Ga0495651_0601545 3300046462 Bacteria 694
753 Ga0495653_0069531 3300046463 Bacteria 2637
754 Ga0495653_0160337 3300046463 Bacteria 1562
755 Ga0495650_0091868 3300046471 Bacteria 1153
756 Ga0495580_0037031 3300046472 Bacteria 3502
757 Ga0495582_0090462 3300046473 Unclassified 1706
758 Ga0495582_0309051 3300046473 Bacteria 909
759 Ga0495605_0000934 3300046474 Bacteria 20011
760 Ga0495605_0010293 3300046474 Bacteria 5236
761 Ga0495664_0008090 3300046477 Bacteria 5855
762 Ga0495585_0011450 3300046492 Bacteria 5246
763 Ga0495596_0005499 3300046500 Bacteria 5972
764 Ga0495596_0115288 3300046500 Bacteria 1043
765 Ga0495607_0036690 3300046501 Bacteria 2951
766 Ga0495583_0084127 3300046506 Bacteria 1379
767 Ga0495606_0100852 3300046507 Bacteria 1758
768 Ga0495608_0047546 3300046511 Bacteria 2852
769 Ga0495618_0027141 3300046514 Bacteria 3564
770 Ga0495618_0233666 3300046514 Bacteria 1157
771 Ga0495620_0073462 3300046515 Bacteria 1394
772 Ga0495628_0111598 3300046516 Unclassified 2102
773 Ga0495630_0068242 3300046517 Bacteria 2673
774 Ga0495643_0215155 3300046522 Bacteria 915
775 Ga0495644_0090261 3300046523 Bacteria 1156
776 Ga0495648_0110409 3300046524 Unclassified 1497
777 Ga0495663_0031396 3300046525 Bacteria 1578
778 Ga0495666_0027494 3300046526 Unclassified 2799
779 Ga0495642_0066665 3300046528 Bacteria 1500
780 Ga0495642_0074851 3300046528 Bacteria 1420
781 Ga0495652_0166497 3300046529 Unclassified 1705
782 Ga0495652_0369207 3300046529 Bacteria 1023
783 Ga0495665_0002074 3300046531 Bacteria 10844
784 Ga0495665_0178497 3300046531 Bacteria 1104
785 Ga0495640_0005656 3300046533 Bacteria 9941
786 Ga0495586_0047806 3300046535 Bacteria 2311
787 Ga0495586_0166608 3300046535 Bacteria 1244
788 Ga0495598_0008709 3300046537 Bacteria 2372
789 Ga0495621_0012727 3300046539 Bacteria 2628
790 Ga0495597_0003168 3300046542 Bacteria 9835
791 Ga0495667_0108041 3300046559 Bacteria 1798
792 Ga0495656_0054209 3300046615 Bacteria 1725
793 Ga0495611_0149401 3300046648 Bacteria 1091
794 Ga0495625_0416655 3300046660 Bacteria 836
795 Ga0495625_0460319 3300046660 Bacteria 784
796 Ga0495635_0041581 3300046663 Bacteria 3175
797 Ga0495661_0085354 3300046665 Unclassified 1809
798 Ga0495588_0223461 3300046674 Bacteria 994
799 Ga0495588_0346391 3300046674 Bacteria 781
800 Ga0495599_0225155 3300046678 Unclassified 1146
801 Ga0495623_0003527 3300046679 Bacteria 10356
802 Ga0495646_0048950 3300046680 Bacteria 2566
803 Ga0495647_0053054 3300046681 Bacteria 1580
804 Ga0495647_0064337 3300046681 Bacteria 1454
805 Ga0495658_0024122 3300046683 Bacteria 3236
806 Ga0495658_0026743 3300046683 Bacteria 3096
807 Ga0495658_0208941 3300046683 Bacteria 1219
808 Ga0495669_0000700 3300046684 Bacteria 14630
809 Ga0495669_0000910 3300046684 Bacteria 12403
810 Ga0495613_0070806 3300046689 Bacteria 2542
811 Ga0495613_0640866 3300046689 Bacteria 704
812 Ga0495624_0318665 3300046690 Bacteria 936
813 Ga0495670_0008683 3300046691 Bacteria 5001
814 Ga0495671_0034390 3300046692 Bacteria 2577
815 Ga0495649_0086290 3300046694 Bacteria 1675
816 Ga0495589_0007026 3300046794 Bacteria 5905
817 Ga0495589_0029041 3300046794 Bacteria 2788
818 Ga0495589_0037586 3300046794 Bacteria 2425
819 Ga0495600_0002767 3300046809 Bacteria 10167
820 Ga0495581_0137766 3300047315 Unclassified 1423
821 Ga0495636_0024130 3300047318 Bacteria 2464
822 Ga0495674_0032323 3300047319 Bacteria 4746
823 Ga0495674_0071538 3300047319 Bacteria 2993
824 Ga0495674_0274251 3300047319 Bacteria 1383
825 Ga0495674_0598746 3300047319 Bacteria 873
826 Ga0495676_0004511 3300047321 Bacteria 12733
827 Ga0495676_0029551 3300047321 Bacteria 4665
828 Ga0495680_0494148 3300047322 Bacteria 831
829 Ga0495683_0003800 3300047323 Bacteria 8718
830 Ga0495683_0008921 3300047323 Bacteria 5351
831 Ga0495675_0000565 3300047444 Bacteria 23906
832 Ga0495675_0282685 3300047444 Bacteria 989
833 Ga0495677_0232995 3300047445 Bacteria 718
834 Ga0495679_004891 3300047446 Bacteria 6047
835 Ga0495679_041605 3300047446 Bacteria 1422
836 Ga0495685_050243 3300047447 Bacteria 1415
837 Ga0495673_0005324 3300047469 Bacteria 7806
838 Ga0495684_0076879 3300047471 Bacteria 2535
839 Ga0495593_0004290 3300047673 Bacteria 8477
840 Ga0495614_0010984 3300048089 Bacteria 3984
841 Ga0495614_0029926 3300048089 Bacteria 2343
842 Ga0495626_0151335 3300048091 Bacteria 978
843 Ga0496100_0004806 3300048903 Bacteria 7216
844 Ga0496100_0019087 3300048903 Bacteria 4083
845 Ga0496100_0019193 3300048903 Bacteria 4073
846 Ga0496100_0049972 3300048903 Bacteria 2707
847 Ga0496100_0261046 3300048903 Bacteria 1284
848 Ga0496101_0002482 3300048904 Bacteria 11324
849 Ga0496101_0021889 3300048904 Bacteria 4393
850 Ga0496101_0123812 3300048904 Bacteria 1957
851 Ga0496101_0155205 3300048904 Bacteria 1753
852 Ga0496101_0309097 3300048904 Bacteria 1239
853 Ga0496101_0425349 3300048904 Bacteria 1047
854 Ga0496102_0008128 3300048905 Bacteria 8978
855 Ga0496102_0013990 3300048905 Bacteria 6966
856 Ga0496102_0054604 3300048905 Bacteria 3643
857 Ga0496102_0140040 3300048905 Bacteria 2268
858 Ga0496102_0190365 3300048905 Bacteria 1933
859 Ga0496102_0676745 3300048905 Bacteria 955
860 Ga0496102_0771723 3300048905 Bacteria 884
861 Ga0496103_0005096 3300048906 Bacteria 7914
862 Ga0496103_0009801 3300048906 Bacteria 5672
863 Ga0496103_0180849 3300048906 Bacteria 1355
864 Ga0496104_0000254 3300048907 Bacteria 47479
865 Ga0496104_0109985 3300048907 Bacteria 2641
866 Ga0496104_0116676 3300048907 Bacteria 2562
867 Ga0496104_0237288 3300048907 Bacteria 1735
868 Ga0496104_0492963 3300048907 Bacteria 1136
869 Ga0496105_0000055 3300048908 Bacteria 88389
870 Ga0496105_0057708 3300048908 Bacteria 3205
871 Ga0496105_0131065 3300048908 Bacteria 2067
872 Ga0496105_0173723 3300048908 Bacteria 1766
873 Ga0496105_0191675 3300048908 Bacteria 1671
874 Ga0496105_0309968 3300048908 Bacteria 1267
875 Ga0496106_0016808 3300048909 Bacteria 5412
876 Ga0496106_0030254 3300048909 Bacteria 4038
877 Ga0496106_0588380 3300048909 Bacteria 892
878 Ga0496107_0072351 3300048910 Bacteria 2506
879 Ga0496108_0004970 3300048911 Bacteria 10746
880 Ga0496108_0193806 3300048911 Bacteria 1762
881 Ga0496108_0477731 3300048911 Bacteria 1089
882 Ga0496108_0571444 3300048911 Bacteria 986
883 Ga0496109_0001932 3300048912 Bacteria 17223
884 Ga0496109_0032387 3300048912 Bacteria 4699
885 Ga0496109_0058727 3300048912 Bacteria 3514
886 Ga0496109_0131121 3300048912 Bacteria 2339
887 Ga0496109_0147363 3300048912 Bacteria 2203
888 Ga0496109_0235468 3300048912 Bacteria 1723
889 Ga0496109_0299021 3300048912 Bacteria 1517
890 Ga0496109_0306005 3300048912 Bacteria 1499
891 Ga0496109_0341261 3300048912 Bacteria 1414
892 Ga0496110_0001472 3300048913 Bacteria 17050
893 Ga0496110_0039557 3300048913 Bacteria 4106
894 Ga0496110_0041197 3300048913 Bacteria 4029
895 Ga0496110_0359531 3300048913 Bacteria 1326
896 Ga0496110_0433090 3300048913 Bacteria 1199
897 Ga0496111_0000582 3300048914 Bacteria 19124
898 Ga0496111_0008397 3300048914 Bacteria 6832
899 Ga0496111_0014348 3300048914 Bacteria 5410
900 Ga0496111_0194248 3300048914 Bacteria 1509
901 Ga0496112_0003831 3300048915 Bacteria 12562
902 Ga0496112_0017806 3300048915 Bacteria 6686
903 Ga0496112_0050753 3300048915 Bacteria 4068
904 Ga0496112_0173777 3300048915 Bacteria 2120
905 Ga0496113_0003115 3300048916 Bacteria 9861
906 Ga0496113_0163173 3300048916 Bacteria 1762
907 Ga0496113_0241533 3300048916 Bacteria 1441
908 Ga0496114_0000256 3300048917 Bacteria 38442
909 Ga0496114_0002392 3300048917 Bacteria 14278
910 Ga0496114_0010753 3300048917 Bacteria 7283
911 Ga0496114_0023237 3300048917 Bacteria 5058
912 Ga0496115_0014234 3300048918 Bacteria 6020
913 Ga0496115_0057171 3300048918 Bacteria 3137
914 Ga0496115_0239039 3300048918 Bacteria 1497
915 Ga0496116_0017931 3300048919 Bacteria 5474
916 Ga0496117_0043335 3300048920 Bacteria 3273
917 Ga0496118_0043853 3300048921 Bacteria 3510
918 Ga0496119_0034893 3300048922 Bacteria 3303
919 Ga0496121_0288112 3300048924 Bacteria 1120
920 Ga0496122_0006936 3300048925 Bacteria 12779
921 Ga0496122_0021302 3300048925 Bacteria 5808
922 Ga0496123_0036840 3300048926 Bacteria 3461
923 Ga0496123_0063746 3300048926 Bacteria 2352
924 Ga0496124_0007274 3300048927 Bacteria 11809
925 Ga0496125_0149213 3300048928 Bacteria 1609
926 Ga0495678_120675 3300049459 Bacteria 881
927 Ga0495678_155781 3300049459 Bacteria 734
928 Ga0495682_0019468 3300049460 Bacteria 2552
929 Ga0501036_0071471 3300049572 Bacteria 2934
930 Ga0501036_0516667 3300049572 Bacteria 993
931 Ga0501038_0929688 3300049574 Bacteria 641
932 Ga0501039_0015411 3300049575 Bacteria 5851
933 Ga0501040_0232926 3300049576 Bacteria 1312
934 Ga0501041_0041077 3300049577 Bacteria 2808
935 Ga0501041_0087947 3300049577 Bacteria 1918
936 Ga0501042_0216076 3300049578 Bacteria 1383
937 Ga0501042_0262230 3300049578 Bacteria 1247
938 Ga0501042_0282845 3300049578 Bacteria 1198
939 Ga0501043_0594918 3300049579 Bacteria 818
940 Ga0501046_0061065 3300049580 Bacteria 2949
941 Ga0501046_0095129 3300049580 Bacteria 2289
942 Ga0501046_0646507 3300049580 Bacteria 748
943 Ga0501068_0456634 3300049584 Bacteria 827
944 Ga0501068_0660744 3300049584 Bacteria 683
945 Ga0501070_0384482 3300049586 Bacteria 1137
946 Ga0501071_0114502 3300049587 Bacteria 1995
947 Ga0501072_0043951 3300049588 Bacteria 3512
948 Ga0501072_0104955 3300049588 Bacteria 2247
949 Ga0501072_0340127 3300049588 Bacteria 1192
950 Ga0501072_0479312 3300049588 Bacteria 984
951 Ga0501073_0112136 3300049589 Bacteria 1892
952 Ga0501074_0116165 3300049590 Bacteria 1914
953 Ga0501075_0044302 3300049591 Bacteria 3338
954 Ga0501075_0048868 3300049591 Bacteria 3179
955 Ga0501075_0156544 3300049591 Bacteria 1737
956 Ga0501077_0132464 3300049593 Bacteria 1581
957 Ga0501079_0045574 3300049741 Bacteria 3384
958 Ga0501079_0161403 3300049741 Bacteria 1748
959 Ga0501080_0092730 3300049742 Bacteria 2805
960 Ga0501080_0901047 3300049742 Bacteria 771
961 Ga0501081_0168045 3300049743 Bacteria 1583
962 Ga0501081_0230254 3300049743 Bacteria 1349
963 Ga0501081_0234212 3300049743 Bacteria 1338
964 Ga0501081_0419559 3300049743 Bacteria 992
965 Ga0501081_0475767 3300049743 Bacteria 929
966 Ga0501045_0002197 3300049824 Bacteria 13227
967 Ga0501045_0251204 3300049824 Bacteria 1316
968 nmdc:mga0yw44_132265_c1 3300050492 Bacteria 1616
969 nmdc:mga0k408_135494_c1 3300050493 Bacteria 1463
970 nmdc:mga06z11_280989_c1 3300050494 Bacteria 986
971 nmdc:mga06z11_577633_c1 3300050494 Bacteria 683
972 nmdc:mga06z11_679_c1 3300050494 Bacteria 12406
973 nmdc:mga04h51_20907_c1 3300050495 Bacteria 1962
974 nmdc:mga07m45_254691_c1 3300050496 Bacteria 1021
975 nmdc:mga05p37_1561296_c1 3300050507 Bacteria 653
976 nmdc:mga05p37_19865_c1 3300050507 Bacteria 8128
977 nmdc:mga05p37_244386_c1 3300050507 Bacteria 2156
978 nmdc:mga05p37_31350_c1 3300050507 Bacteria 6493
979 nmdc:mga05p37_501778_c1 3300050507 Bacteria 1392
980 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
981 nmdc:mga05p37_931815_c1 3300050507 Unclassified 932
982 nmdc:mga09592_13099_c1 3300050508 Bacteria 4949
983 nmdc:mga09592_15462_c1 3300050508 Bacteria 6236
984 nmdc:mga09592_184713_c1 3300050508 Bacteria 1804
985 nmdc:mga09592_355_c1 3300050508 Bacteria 33629
986 nmdc:mga09592_71811_c1 3300050508 Bacteria 2938
987 nmdc:mga0qj67_1010_c1 3300050509 Bacteria 19413
988 nmdc:mga0qj67_24922_c1 3300050509 Bacteria 4616
989 nmdc:mga0qj67_278487_c1 3300050509 Bacteria 1356
990 nmdc:mga0qj67_6148_c1 3300050509 Bacteria 4271
991 nmdc:mga06r32_11689_c1 3300050510 Bacteria 7902
992 nmdc:mga06r32_13206_c1 3300050510 Bacteria 7480
993 nmdc:mga06r32_19481_c1 3300050510 Bacteria 6229
994 nmdc:mga06r32_3055_c1 3300050510 Bacteria 14984
995 nmdc:mga06r32_34053_c1 3300050510 Bacteria 4802
996 nmdc:mga06r32_479995_c1 3300050510 Bacteria 1221
997 nmdc:mga06r32_48368_c1 3300050510 Bacteria 4064
998 nmdc:mga06r32_7651_c1 3300050510 Bacteria 9715
999 nmdc:mga08y16_1023228_c1 3300050511 Bacteria 805
1000 nmdc:mga08y16_11017_c1 3300050511 Bacteria 9494
1001 nmdc:mga08y16_136746_c1 3300050511 Bacteria 2547
1002 nmdc:mga08y16_1998_c1 3300050511 Bacteria 20844
1003 nmdc:mga08y16_23677_c1 3300050511 Bacteria 6484
1004 nmdc:mga08y16_28383_c1 3300050511 Bacteria 5899
1005 nmdc:mga08y16_337277_c1 3300050511 Bacteria 1550
1006 nmdc:mga08y16_34274_c1 3300050511 Bacteria 5333
1007 nmdc:mga08y16_465022_c1 3300050511 Bacteria 1289
1008 nmdc:mga08y16_5088_c1 3300050511 Bacteria 13743
1009 nmdc:mga08y16_529794_c1 3300050511 Bacteria 1194
1010 nmdc:mga08y16_534504_c1 3300050511 Bacteria 1188
1011 nmdc:mga0n895_221418_c1 3300050512 Bacteria 1921
1012 nmdc:mga0n895_2763_c1 3300050512 Bacteria 13867
1013 nmdc:mga0n895_314639_c1 3300050512 Bacteria 1586
1014 nmdc:mga0n895_323329_c1 3300050512 Bacteria 1563
1015 nmdc:mga0n895_38591_c1 3300050512 Bacteria 4629
1016 nmdc:mga0n895_670615_c1 3300050512 Bacteria 1034
1017 nmdc:mga0rr50_223001_c1 3300050513 Unclassified 1557
1018 nmdc:mga0rr50_419358_c1 3300050513 Bacteria 1132
1019 nmdc:mga0rr50_43386_c1 3300050513 Bacteria 3291
1020 nmdc:mga08x19_424945_c1 3300050514 Bacteria 934
1021 nmdc:mga0a205_1255_c1 3300050515 Bacteria 21291
1022 nmdc:mga0a205_139416_c1 3300050515 Bacteria 2325
1023 nmdc:mga0a205_172419_c1 3300050515 Bacteria 2059
1024 nmdc:mga0a205_282111_c1 3300050515 Bacteria 1536
1025 nmdc:mga0a205_38623_c2 3300050515 Bacteria 2250
1026 nmdc:mga0sz30_10569_c2 3300050516 Bacteria 2516
1027 Ga0495595_0447612 3300053084 Bacteria 656
1028 Ga0500646_0002708 3300053090 Bacteria 4576
1029 Ga0500583_0143396 3300053092 Bacteria 1187
1030 Ga0500641_0013330 3300053096 Bacteria 3019
1031 Ga0500555_015156 3300053103 Bacteria 2223
1032 Ga0500655_018992 3300053133 Bacteria 1278
1033 Ga0500568_0036062 3300053139 Bacteria 2015
1034 Ga0500577_0041098 3300053142 Bacteria 1685
1035 Ga0500588_0022165 3300053146 Bacteria 1726
1036 Ga0500604_0001071 3300053151 Bacteria 7638
1037 Ga0500616_0112259 3300053153 Bacteria 1315
1038 Ga0500616_0222851 3300053153 Bacteria 821
1039 Ga0500622_0262428 3300053156 Bacteria 753
1040 Ga0501084_0051953 3300054114 Bacteria 3430
1041 Ga0501082_0424376 3300060353 Bacteria 1161
1042 Ga0530510_0002185 3300061734 Bacteria 13421
1043 2515683618 2515154122 Bacteria 8609520
1044 2559426437 2558860280 Bacteria 11429938
1045 2585318149 2582581314 Bacteria 11452267
1046 2644267346 2643221647 Bacteria 10741251
1047 2753266154 2751185782 Bacteria 11227053
1048 2786673840 2786546132 Bacteria 10419719
1049 2792841141 2791355137 Bacteria 9654227
1050 2862385991 2862382967 Bacteria 10317375
1051 2877676336 2877676314 Bacteria 9512378
1052 2895517722 2895511927 Bacteria 6802080
1053 2902685056 2902682994 Bacteria 8951596
1054 2904485921 2904483920 Bacteria 7545285
1055 2919532694 2919527303 Bacteria 7718827
1056 2954700888 2954691527 Bacteria 10720516
1057 2954706458 2954701450 Bacteria 10834262
1058 8008559133 8008558824 Bacteria 10610750
1059 Ga0070694_100613846
1060 JGI24739J22299_10107787
1061 JGI24737J22298_10112773
1062 JGI24735J21928_10018386
1063 JGI25156J39149_1000248
1064 JGI25406J46586_10002668
1065 JGI25406J46586_10003549
1066 JGI25406J46586_10007672
1067 JGI25165J46597_1000574
1068 Ga0055533_1000072
1069 Ga0055532_1000013
1070 Ga0055525_1007827
1071 Ga0055527_1000010
1072 Ga0055535_1000010
1073 Ga0055542_1000016
1074 Ga0055542_1026608
1075 Ga0055529_1000012
1076 Ga0065714_10091560
1077 Ga0065704_10083607
1078 Ga0065712_10006820
1079 Ga0065712_10016138
1080 Ga0065712_10070478
1081 Ga0065712_10231442
1082 Ga0065715_10012428
1083 Ga0065715_10180962
1084 Ga0065715_10386856
1085 Ga0065715_10424106
1086 Ga0065707_10053290
1087 Ga0065707_10101782
1088 Ga0065707_10119254
1089 Ga0065707_10156092
1090 Ga0070658_10407788
1091 Ga0070658_10689235
1092 Ga0070676_10002320
1093 Ga0070676_10003564
1094 Ga0070676_10481106
1095 Ga0070683_100001511
1096 Ga0070683_100093027
1097 Ga0070690_100045970
1098 Ga0070670_100004942
1099 Ga0070670_100008476
1100 Ga0070670_100015711
1101 Ga0070670_100016749
1102 Ga0070670_100025631
1103 Ga0070670_100040227
1104 Ga0070670_100140073
1105 Ga0070677_10001442
1106 Ga0070677_10012697
1107 Ga0070677_10016155
1108 Ga0070677_10054133
1109 Ga0070677_10057448
1110 Ga0070677_10170562
1111 Ga0068869_100000636
1112 Ga0068869_100010733
1113 Ga0070666_10037394
1114 Ga0070666_10098969
1115 Ga0070666_10159326
1116 Ga0070666_10617191
1117 Ga0070680_100425508
1118 Ga0070680_100742470
1119 Ga0070682_100133645
1120 Ga0068868_100005280
1121 Ga0068868_100051330
1122 Ga0068868_100285549
1123 Ga0068868_100385215
1124 Ga0070660_100155954
1125 Ga0070689_100022070
1126 Ga0070689_100070852
1127 Ga0070689_100071477
1128 Ga0070689_100133773
1129 Ga0070691_10191866
1130 Ga0070687_100162866
1131 Ga0070687_100235737
1132 Ga0070687_100454371
1133 Ga0070687_100497900
1134 Ga0070661_100097788
1135 Ga0070661_100760269
1136 Ga0070661_100784227
1137 Ga0070692_10418763
1138 Ga0070668_100011962
1139 Ga0070668_100054514
1140 Ga0070668_100125172
1141 Ga0070668_100495818
1142 Ga0070669_100044184
1143 Ga0070669_100089680
1144 Ga0070669_100130402
1145 Ga0070669_100137887
1146 Ga0070669_100534833
1147 Ga0070675_100002214
1148 Ga0070675_100020327
1149 Ga0070675_100021755
1150 Ga0070675_100029636
1151 Ga0070675_100058127
1152 Ga0070675_100072500
1153 Ga0070675_100082834
1154 Ga0070671_100001454
1155 Ga0070671_100002792
1156 Ga0070671_100013815
1157 Ga0070671_100121326
1158 Ga0070671_100354688
1159 Ga0070671_100591182
1160 Ga0070674_100002446
1161 Ga0070674_100009598
1162 Ga0070673_100014728
1163 Ga0070673_100045761
1164 Ga0070673_100096433
1165 Ga0070673_100166698
1166 Ga0070673_100266442
1167 Ga0070688_100067700
1168 Ga0070688_100083578
1169 Ga0070688_100230611
1170 Ga0070688_100789145
1171 Ga0070659_100960025
1172 Ga0070667_100013338
1173 Ga0070667_100013687
1174 Ga0070667_100461173
1175 Ga0070667_100589365
1176 Ga0070667_101123193
1177 Ga0070703_10087234
1178 Ga0070703_10163234
1179 Ga0070714_100016398
1180 Ga0070713_100197518
1181 Ga0070710_10289093
1182 Ga0070701_10001212
1183 Ga0070701_10012555
1184 Ga0070701_10036822
1185 Ga0070701_10104672
1186 Ga0070701_10245475
1187 Ga0070705_100127384
1188 Ga0070705_100370526
1189 Ga0070700_100009403
1190 Ga0070700_100041415
1191 Ga0070700_100053608
1192 Ga0070700_100093815
1193 Ga0070700_100102712
1194 Ga0070694_100024635
1195 Ga0070694_100084166
1196 Ga0070694_100115318
1197 Ga0070663_100244721
1198 Ga0070663_100244735
1199 Ga0070663_100828910
1200 Ga0070678_100023233
1201 Ga0070678_100070710
1202 Ga0070678_100238264
1203 Ga0070678_100285081
1204 Ga0070662_100008793
1205 Ga0070662_100028944
1206 Ga0070662_100209520
1207 Ga0070662_100481546
1208 Ga0070681_10128013
1209 Ga0068867_100006351
1210 Ga0068867_100013786
1211 Ga0068867_100027480
1212 Ga0070685_10072920
1213 Ga0070706_100023229
1214 Ga0070706_100553613
1215 Ga0070698_100028630
1216 Ga0070698_100195970
1217 Ga0070699_100144595
1218 Ga0070699_100233093
1219 Ga0070679_100004020
1220 Ga0070684_100117928
1221 Ga0070672_100011370
1222 Ga0070672_100014821
1223 Ga0070672_100025638
1224 Ga0070672_100095959
1225 Ga0070672_100100864
1226 Ga0070672_100148723
1227 Ga0070672_100293241
1228 Ga0070672_100564991
1229 Ga0070672_100569262
1230 Ga0070686_100020370
1231 Ga0070686_100062784
1232 Ga0070686_100078939
1233 Ga0070686_100167999
1234 Ga0070695_100377521
1235 Ga0070696_100165918
1236 Ga0070693_100003087
1237 Ga0070665_100062597
1238 Ga0070665_100090553
1239 Ga0070665_100244281
1240 Ga0070665_100288066
1241 Ga0070665_100569614
1242 Ga0070665_100701411
1243 Ga0070665_100971368
1244 Ga0070665_101201713
1245 Ga0070704_100079697
1246 Ga0070704_100963245
1247 Ga0070664_100022668
1248 Ga0070664_100061497
1249 Ga0070664_100196318
1250 Ga0070664_100251307
1251 Ga0068857_100315076
1252 Ga0068857_100457495
1253 Ga0068854_100499670
1254 Ga0068856_100088638
1255 Ga0068856_100210088
1256 Ga0070702_100032319
1257 Ga0070702_100065327
1258 Ga0068859_100011569
1259 Ga0068859_100068418
1260 Ga0068859_100090595
1261 Ga0068859_100302546
1262 Ga0068859_100382228
1263 Ga0068859_100447447
1264 Ga0068864_100001780
1265 Ga0068864_100005066
1266 Ga0068864_100034829
1267 Ga0068864_100087042
1268 Ga0068864_100095173
1269 Ga0068864_100107584
1270 Ga0068864_100117037
1271 Ga0068864_100484472
1272 Ga0068866_10001987
1273 Ga0068866_10571906
1274 Ga0068861_100030062
1275 Ga0068861_100101615
1276 Ga0068861_100131470
1277 Ga0068861_100170581
1278 Ga0068861_100270592
1279 Ga0068861_100811567
1280 Ga0068870_10130425
1281 Ga0068870_10201931
1282 Ga0068870_10296470
1283 Ga0068863_100002522
1284 Ga0068863_100011364
1285 Ga0068863_100030794
1286 Ga0068863_100048634
1287 Ga0068863_100241991
1288 Ga0068858_100020959
1289 Ga0068858_100040023
1290 Ga0068858_100194527
1291 Ga0068860_100035450
1292 Ga0068860_100398260
1293 Ga0068862_100004252
1294 Ga0068862_100136660
1295 Ga0068862_100167129
1296 Ga0068862_100210662
1297 Ga0068862_100269801
1298 Ga0068862_100678890
1299 Ga0081455_10164011
1300 Ga0081539_10000133
1301 Ga0081539_10000219
1302 Ga0081539_10000329
1303 Ga0081539_10034885
1304 Ga0070717_10017715
1305 Ga0075365_10235248
1306 Ga0075368_10011966
1307 Ga0075432_10184399
1308 Ga0070716_100004079
1309 Ga0070716_100575976
1310 Ga0070712_100058058
1311 Ga0075367_10009828
1312 Ga0075369_10018775
1313 Ga0097621_100044809
1314 Ga0097621_100189922
1315 Ga0097621_100236392
1316 Ga0097621_100308406
1317 Ga0097621_100489620
1318 Ga0075370_10059103
1319 Ga0068871_100029013
1320 Ga0068871_100054420
1321 Ga0068871_100321061
1322 Ga0068871_100548120
1323 Ga0075428_100001611
1324 Ga0075428_100010461
1325 Ga0075428_100021049
1326 Ga0075428_100086365
1327 Ga0075428_100109854
1328 Ga0075428_100123006
1329 Ga0075428_100681423
1330 Ga0075428_100939087
1331 Ga0075430_100001888
1332 Ga0075430_100034162
1333 Ga0075430_100035431
1334 Ga0075430_100287170
1335 Ga0075431_100002059
1336 Ga0075431_100006116
1337 Ga0075431_100009127
1338 Ga0075431_100131533
1339 Ga0075431_100150260
1340 Ga0075431_100402312
1341 Ga0075431_100619702
1342 Ga0075431_100658646
1343 Ga0075433_10000801
1344 Ga0075433_10045435
1345 Ga0075434_100002267
1346 Ga0075434_100013753
1347 Ga0075434_100219281
1348 Ga0075434_100287895
1349 Ga0075434_100491521
1350 Ga0075434_100747771
1351 Ga0075429_100000003
1352 Ga0075429_100027367
1353 Ga0075429_100079124
1354 Ga0075429_100481456
1355 Ga0068865_100003497
1356 Ga0068865_100095760
1357 Ga0068865_100675780
1358 Ga0068865_100692360
1359 Ga0075436_100624904
1360 Ga0097620_100011569
1361 Ga0097620_100068420
1362 Ga0097620_100090594
1363 Ga0097620_100302581
1364 Ga0097620_100382233
1365 Ga0097620_100447504
1366 Ga0075435_100022855
1367 Ga0075435_100032377
1368 Ga0075435_100235757
1369 Ga0099794_10016714
1370 Ga0099794_10028304
1371 Ga0099794_10233801
1372 Ga0099795_10049790
1373 Ga0105251_10004768
1374 Ga0105251_10106747
1375 Ga0105244_10053926
1376 Ga0105250_10050215
1377 Ga0105240_10000052
1378 Ga0105240_10178832
1379 Ga0105240_10196055
1380 Ga0111539_10002454
1381 Ga0111539_10010352
1382 Ga0111539_10019309
1383 Ga0111539_10044276
1384 Ga0111539_10099831
1385 Ga0111539_10119705
1386 Ga0111539_10144534
1387 Ga0111539_10146808
1388 Ga0111539_10455079
1389 Ga0111539_10512928
1390 Ga0111539_11149196
1391 Ga0105245_10010732
1392 Ga0105245_10018846
1393 Ga0105245_10045439
1394 Ga0105245_10066233
1395 Ga0105245_10367897
1396 Ga0105245_10511475
1397 Ga0105247_10032737
1398 Ga0105247_10034709
1399 Ga0114129_10007207
1400 Ga0114129_10035772
1401 Ga0114129_10064405
1402 Ga0114129_10129102
1403 Ga0114129_10299571
1404 Ga0114129_10443250
1405 Ga0114129_10682177
1406 Ga0114129_10860476
1407 Ga0105243_10013712
1408 Ga0105243_10206281
1409 Ga0105243_10357035
1410 Ga0105243_11099763
1411 Ga0105242_10000995
1412 Ga0105242_10014788
1413 Ga0105242_10140644
1414 Ga0105242_10233566
1415 Ga0105242_11265572
1416 Ga0105248_10015744
1417 Ga0105248_10114285
1418 Ga0105248_10646780
1419 Ga0105248_10880245
1420 Ga0105248_10999923
1421 Ga0105238_10015828
1422 Ga0105238_10018756
1423 Ga0105249_10002175
1424 Ga0105249_10094139
1425 Ga0105249_10294467
1426 Ga0105239_10006686
1427 Ga0105239_10180676
1428 Ga0105239_10668536
1429 Ga0105239_11093409
1430 Ga0105246_10002402
1431 Ga0105246_10011917
1432 Ga0105246_10107651
1433 Ga0157371_10103662
1434 Ga0157369_10607568
1435 Ga0157374_10084063
1436 Ga0157374_10450589
1437 Ga0157378_10193094
1438 Ga0163162_10000812
1439 Ga0163162_10000983
1440 Ga0163162_10066581
1441 Ga0163162_10180331
1442 Ga0163162_10203652
1443 Ga0163162_10263680
1444 Ga0157372_10425241
1445 Ga0157375_10058921
1446 Ga0157375_10183834
1447 Ga0157375_10453555
1448 Ga0157375_10480974
1449 Ga0157375_10894412
1450 Ga0163163_10003481
1451 Ga0163163_10010402
1452 Ga0163163_10029715
1453 Ga0163163_10377683
1454 Ga0163163_10457212
1455 Ga0163163_10509394
1456 Ga0163163_10718761
1457 Ga0163163_11127638
1458 Ga0157380_10003751
1459 Ga0157380_10010778
1460 Ga0157380_10065936
1461 Ga0157380_10083289
1462 Ga0157380_10132656
1463 Ga0157380_10208511
1464 Ga0157380_10403381
1465 Ga0157380_10818195
1466 Ga0157380_11025110
1467 Ga0157377_10040201
1468 Ga0157377_10072700
1469 Ga0157377_10098737
1470 Ga0157377_10182669
1471 Ga0157377_10185263
1472 Ga0157377_10518398
1473 Ga0157379_10011611
1474 Ga0157379_10062893
1475 Ga0157379_10072571
1476 Ga0157379_10182322
1477 Ga0157379_10307695
1478 Ga0157376_10020581
1479 Ga0157376_10039405
1480 Ga0157376_10201781
1481 Ga0157376_10284885
1482 Ga0157376_11429408
1483 Ga0183367_1021
1484 Ga0163161_10205192
1485 Ga0163161_10252644
1486 Ga0163161_10577674
1487 Ga0163161_10988685
1488 Ga0213875_10189291
1489 Ga0209674_100011
1490 Ga0209672_100002
1491 Ga0209147_100003
1492 Ga0209563_100803
1493 Ga0207427_100610
1494 Ga0209258_100042
1495 Ga0209148_1000006
1496 Ga0209148_1001617
1497 Ga0209759_1000051
1498 Ga0209233_1000033
1499 Ga0209455_1000003
1500 Ga0209455_1003782
1501 Ga0207426_1002893
1502 Ga0207697_10002977
1503 Ga0207696_1083552
1504 Ga0207655_1107740
1505 Ga0207713_1003152
1506 Ga0207682_10002341
1507 Ga0207682_10004751
1508 Ga0207682_10023842
1509 Ga0207682_10052188
1510 Ga0207682_10160522
1511 Ga0207642_10015889
1512 Ga0207642_10190645
1513 Ga0207642_10360604
1514 Ga0207688_10006362
1515 Ga0207680_10065152
1516 Ga0207680_10083605
1517 Ga0207680_10117970
1518 Ga0207680_10202828
1519 Ga0207680_10206685
1520 Ga0207680_10260425
1521 Ga0207680_10503058
1522 Ga0207645_10002246
1523 Ga0207645_10008417
1524 Ga0207645_10062340
1525 Ga0207645_10252954
1526 Ga0207645_10698976
1527 Ga0207643_10003472
1528 Ga0207643_10018291
1529 Ga0207643_10022591
1530 Ga0207705_10412066
1531 Ga0207707_10015561
1532 Ga0207695_10000122
1533 Ga0207695_10489659
1534 Ga0207693_10365787
1535 Ga0207662_10012068
1536 Ga0207662_10073842
1537 Ga0207662_10104897
1538 Ga0207662_10112459
1539 Ga0207649_10039184
1540 Ga0207649_10044717
1541 Ga0207649_10573246
1542 Ga0207652_10034319
1543 Ga0207646_10737788
1544 Ga0207681_10007823
1545 Ga0207681_10083805
1546 Ga0207681_10136394
1547 Ga0207681_10138337
1548 Ga0207681_10156419
1549 Ga0207681_10238915
1550 Ga0207681_10624100
1551 Ga0207694_10064635
1552 Ga0207650_10009090
1553 Ga0207650_10033256
1554 Ga0207650_10090786
1555 Ga0207650_10108457
1556 Ga0207650_10199055
1557 Ga0207650_10442469
1558 Ga0207659_10004973
1559 Ga0207659_10006385
1560 Ga0207659_10013335
1561 Ga0207659_10055287
1562 Ga0207659_10111952
1563 Ga0207659_10180228
1564 Ga0207659_10182752
1565 Ga0207659_10341527
1566 Ga0207659_10351646
1567 Ga0207659_10438091
1568 Ga0207659_10627831
1569 Ga0207687_10010576
1570 Ga0207687_10042407
1571 Ga0207687_10099426
1572 Ga0207687_10330053
1573 Ga0207644_10001383
1574 Ga0207644_10010956
1575 Ga0207644_10138546
1576 Ga0207644_10489248
1577 Ga0207644_10519047
1578 Ga0207706_10017818
1579 Ga0207706_10042151
1580 Ga0207706_10125175
1581 Ga0207706_10338780
1582 Ga0207706_10436838
1583 Ga0207686_10006341
1584 Ga0207686_10020936
1585 Ga0207686_10150778
1586 Ga0207709_10019504
1587 Ga0207670_10072365
1588 Ga0207670_10136996
1589 Ga0207670_10271752
1590 Ga0207669_10001682
1591 Ga0207669_10008072
1592 Ga0207669_10031054
1593 Ga0207669_10198446
1594 Ga0207669_10732587
1595 Ga0207704_10051920
1596 Ga0207665_10010830
1597 Ga0207691_10002388
1598 Ga0207691_10002501
1599 Ga0207691_10028705
1600 Ga0207691_10047283
1601 Ga0207691_10085355
1602 Ga0207691_10117477
1603 Ga0207711_10023625
1604 Ga0207711_10393258
1605 Ga0207689_10008126
1606 Ga0207689_10086901
1607 Ga0207689_10098421
1608 Ga0207661_10007758
1609 Ga0207679_10045357
1610 Ga0207679_10128089
1611 Ga0207679_10233718
1612 Ga0207651_10029303
1613 Ga0207651_10030907
1614 Ga0207651_10044042
1615 Ga0207651_10050741
1616 Ga0207651_10109329
1617 Ga0207651_10192585
1618 Ga0207651_10372508
1619 Ga0207712_10149313
1620 Ga0207712_10273781
1621 Ga0207712_10406206
1622 Ga0207712_11143657
1623 Ga0207668_10173833
1624 Ga0207668_10218632
1625 Ga0207640_10592203
1626 Ga0207658_10014143
1627 Ga0207658_10136890
1628 Ga0207658_11057546
1629 Ga0207658_11367649
1630 Ga0207677_10096242
1631 Ga0207703_10039720
1632 Ga0207703_10117183
1633 Ga0207678_10077130
1634 Ga0207678_10516119
1635 Ga0207678_10851361
1636 Ga0207678_11040186
1637 Ga0207708_10026855
1638 Ga0207708_10035413
1639 Ga0207708_10060464
1640 Ga0207708_10063996
1641 Ga0207708_10412034
1642 Ga0207708_11003099
1643 Ga0207702_10024939
1644 Ga0207702_10039177
1645 Ga0207702_10735214
1646 Ga0207641_10013055
1647 Ga0207641_10016365
1648 Ga0207641_10016663
1649 Ga0207641_10042754
1650 Ga0207641_10527283
1651 Ga0207648_10003093
1652 Ga0207648_10054704
1653 Ga0207648_10138782
1654 Ga0207648_10218035
1655 Ga0207648_10246016
1656 Ga0207676_10000881
1657 Ga0207676_10023698
1658 Ga0207676_10043399
1659 Ga0207676_10075913
1660 Ga0207676_10146877
1661 Ga0207676_10259134
1662 Ga0207676_10585833
1663 Ga0207676_10743179
1664 Ga0207674_10057329
1665 Ga0207674_10400681
1666 Ga0207675_100013285
1667 Ga0207675_100017706
1668 Ga0207675_100039464
1669 Ga0207675_100047554
1670 Ga0207675_100135806
1671 Ga0207675_100213364
1672 Ga0207675_100861745
1673 Ga0207683_10001982
1674 Ga0207683_10029975
1675 Ga0207683_10060121
1676 Ga0207683_10150402
1677 Ga0207683_10156372
1678 Ga0207683_10186772
1679 Ga0207683_10219559
1680 Ga0207683_10294142
1681 Ga0207683_10304561
1682 Ga0207683_10469585
1683 Ga0209588_1001197
1684 Ga0209588_1062266
1685 Ga0209971_1042278
1686 Ga0209813_10021546
1687 Ga0207428_10010695
1688 Ga0207428_10015486
1689 Ga0207428_10086811
1690 Ga0207428_10091287
1691 Ga0207428_10121070
1692 Ga0207428_10127367
1693 Ga0207428_10494480
1694 Ga0268266_10120852
1695 Ga0268266_10498621
1696 Ga0268266_10851542
1697 Ga0268266_10929321
1698 Ga0268265_10027299
1699 Ga0268265_10063693
1700 Ga0268265_10144242
1701 Ga0268265_10340100
1702 Ga0268265_10673305
1703 Ga0268265_11019859
1704 Ga0268265_11034458
1705 Ga0268264_10024489
1706 Ga0268264_10029081
1707 Ga0268264_10468847
1708 Ga0307511_10000753
1709 Ga0265320_10132298
1710 Ga0307513_10007242
1711 Ga0307408_100079340
1712 Ga0307408_100905245
1713 Ga0316575_10062868
1714 Ga0265314_10002259
1715 Ga0307516_10438510
1716 Ga0307405_10014597
1717 Ga0307405_10015195
1718 Ga0307405_10035416
1719 Ga0307413_10006412
1720 Ga0307413_10160631
1721 Ga0307518_10249959
1722 Ga0307410_10109505
1723 Ga0307410_10142863
1724 Ga0307410_10477230
1725 Ga0307407_10025679
1726 Ga0307407_10091770
1727 Ga0307412_10011434
1728 Ga0307412_10394406
1729 Ga0307409_100326842
1730 Ga0307409_100571376
1731 Ga0307416_100017210
1732 Ga0307416_100030947
1733 Ga0307414_10026496
1734 Ga0307414_10529761
1735 Ga0307411_10048678
1736 Ga0307411_10123136
1737 Ga0307415_100049190
1738 Ga0307415_100051773
1739 Ga0307507_10036513
1740 Ga0373938_0008859
1741 Ga0373952_0021108
1742 Ga0373939_0054799
1743 Ga0373955_0072642
1744 Ga0316574_0196335
1745 Ga0373931_0026585
1746 Ga0373933_0264667
1747 Ga0373937_0211861
1748 Ga0373937_0387602
1749 Ga0373937_0443544
1750 Ga0373925_0043043
1751 Ga0373925_0229822
1752 Ga0395898_0077282
1753 Ga0436364_1036432
1754 Ga0395901_0233293
1755 Ga0395901_0540294
1756 Ga0436365_0897074
1757 Ga0439461_0074718
1758 Ga0451800_0886097
1759 Ga0451833_0106998
1760 Ga0451833_0113201
1761 Ga0451835_0659563
1762 Ga0451837_1544089
1763 Ga0451841_1451426
1764 Ga0451845_0982859
1765 Ga0451847_0527546
1766 Ga0451849_0684911
1767 Ga0451853_0301670
1768 Ga0451853_0751866
1769 Ga0451853_0912580
1770 Ga0451853_1156423
1771 Ga0439441_001360
1772 Ga0439441_021743
1773 Ga0439455_0025760
1774 Ga0450894_025984
1775 Ga0450903_000057
1776 Ga0450905_015167
1777 Ga0439458_0000582
1778 Ga0439458_0087065
1779 Ga0439458_0097807
1780 Ga0439435_0175842
1781 Ga0451577_0217584
1782 Ga0439440_0047346
1783 Ga0466963_0044773
1784 Ga0466963_0193507
1785 Ga0466963_0255863
1786 Ga0466963_0359694
1787 Ga0466957_0029088
1788 Ga0466957_0166653
1789 Ga0451576_0036785
1790 Ga0451576_0122617
1791 Ga0451576_0212864
1792 Ga0451576_0425588
1793 Ga0451576_0573630
1794 Ga0466958_0094533
1795 Ga0466967_0000816
1796 Ga0466967_0025195
1797 Ga0466967_0144481
1798 Ga0466967_0546623
1799 Ga0466967_0656997
1800 Ga0495603_0099165
1801 Ga0495590_0003033
1802 Ga0495591_001035
1803 Ga0495629_0001977
1804 Ga0495629_0015038
1805 Ga0495638_0028495
1806 Ga0495638_0065401
1807 Ga0495641_0160117
1808 Ga0495651_0005248
1809 Ga0495651_0268289
1810 Ga0495651_0601545
1811 Ga0495653_0069531
1812 Ga0495653_0160337
1813 Ga0495650_0091868
1814 Ga0495580_0037031
1815 Ga0495582_0090462
1816 Ga0495582_0309051
1817 Ga0495605_0000934
1818 Ga0495605_0010293
1819 Ga0495664_0008090
1820 Ga0495585_0011450
1821 Ga0495596_0005499
1822 Ga0495596_0115288
1823 Ga0495607_0036690
1824 Ga0495583_0084127
1825 Ga0495606_0100852
1826 Ga0495608_0047546
1827 Ga0495618_0027141
1828 Ga0495618_0233666
1829 Ga0495620_0073462
1830 Ga0495628_0111598
1831 Ga0495630_0068242
1832 Ga0495643_0215155
1833 Ga0495644_0090261
1834 Ga0495648_0110409
1835 Ga0495663_0031396
1836 Ga0495666_0027494
1837 Ga0495642_0066665
1838 Ga0495642_0074851
1839 Ga0495652_0166497
1840 Ga0495652_0369207
1841 Ga0495665_0002074
1842 Ga0495665_0178497
1843 Ga0495640_0005656
1844 Ga0495586_0047806
1845 Ga0495586_0166608
1846 Ga0495598_0008709
1847 Ga0495621_0012727
1848 Ga0495597_0003168
1849 Ga0495667_0108041
1850 Ga0495656_0054209
1851 Ga0495611_0149401
1852 Ga0495625_0416655
1853 Ga0495625_0460319
1854 Ga0495635_0041581
1855 Ga0495661_0085354
1856 Ga0495588_0223461
1857 Ga0495588_0346391
1858 Ga0495599_0225155
1859 Ga0495623_0003527
1860 Ga0495646_0048950
1861 Ga0495647_0053054
1862 Ga0495647_0064337
1863 Ga0495658_0024122
1864 Ga0495658_0026743
1865 Ga0495658_0208941
1866 Ga0495669_0000700
1867 Ga0495669_0000910
1868 Ga0495613_0070806
1869 Ga0495613_0640866
1870 Ga0495624_0318665
1871 Ga0495670_0008683
1872 Ga0495671_0034390
1873 Ga0495649_0086290
1874 Ga0495589_0007026
1875 Ga0495589_0029041
1876 Ga0495589_0037586
1877 Ga0495600_0002767
1878 Ga0495581_0137766
1879 Ga0495636_0024130
1880 Ga0495674_0032323
1881 Ga0495674_0071538
1882 Ga0495674_0274251
1883 Ga0495674_0598746
1884 Ga0495676_0004511
1885 Ga0495676_0029551
1886 Ga0495680_0494148
1887 Ga0495683_0003800
1888 Ga0495683_0008921
1889 Ga0495675_0000565
1890 Ga0495675_0282685
1891 Ga0495677_0232995
1892 Ga0495679_004891
1893 Ga0495679_041605
1894 Ga0495685_050243
1895 Ga0495673_0005324
1896 Ga0495684_0076879
1897 Ga0495593_0004290
1898 Ga0495614_0010984
1899 Ga0495614_0029926
1900 Ga0495626_0151335
1901 Ga0496100_0004806
1902 Ga0496100_0019087
1903 Ga0496100_0019193
1904 Ga0496100_0049972
1905 Ga0496100_0261046
1906 Ga0496101_0002482
1907 Ga0496101_0021889
1908 Ga0496101_0123812
1909 Ga0496101_0155205
1910 Ga0496101_0309097
1911 Ga0496101_0425349
1912 Ga0496102_0008128
1913 Ga0496102_0013990
1914 Ga0496102_0054604
1915 Ga0496102_0140040
1916 Ga0496102_0190365
1917 Ga0496102_0676745
1918 Ga0496102_0771723
1919 Ga0496103_0005096
1920 Ga0496103_0009801
1921 Ga0496103_0180849
1922 Ga0496104_0000254
1923 Ga0496104_0109985
1924 Ga0496104_0116676
1925 Ga0496104_0237288
1926 Ga0496104_0492963
1927 Ga0496105_0000055
1928 Ga0496105_0057708
1929 Ga0496105_0131065
1930 Ga0496105_0173723
1931 Ga0496105_0191675
1932 Ga0496105_0309968
1933 Ga0496106_0016808
1934 Ga0496106_0030254
1935 Ga0496106_0588380
1936 Ga0496107_0072351
1937 Ga0496108_0004970
1938 Ga0496108_0193806
1939 Ga0496108_0477731
1940 Ga0496108_0571444
1941 Ga0496109_0001932
1942 Ga0496109_0032387
1943 Ga0496109_0058727
1944 Ga0496109_0131121
1945 Ga0496109_0147363
1946 Ga0496109_0235468
1947 Ga0496109_0299021
1948 Ga0496109_0306005
1949 Ga0496109_0341261
1950 Ga0496110_0001472
1951 Ga0496110_0039557
1952 Ga0496110_0041197
1953 Ga0496110_0359531
1954 Ga0496110_0433090
1955 Ga0496111_0000582
1956 Ga0496111_0008397
1957 Ga0496111_0014348
1958 Ga0496111_0194248
1959 Ga0496112_0003831
1960 Ga0496112_0017806
1961 Ga0496112_0050753
1962 Ga0496112_0173777
1963 Ga0496113_0003115
1964 Ga0496113_0163173
1965 Ga0496113_0241533
1966 Ga0496114_0000256
1967 Ga0496114_0002392
1968 Ga0496114_0010753
1969 Ga0496114_0023237
1970 Ga0496115_0014234
1971 Ga0496115_0057171
1972 Ga0496115_0239039
1973 Ga0496116_0017931
1974 Ga0496117_0043335
1975 Ga0496118_0043853
1976 Ga0496119_0034893
1977 Ga0496121_0288112
1978 Ga0496122_0006936
1979 Ga0496122_0021302
1980 Ga0496123_0036840
1981 Ga0496123_0063746
1982 Ga0496124_0007274
1983 Ga0496125_0149213
1984 Ga0495678_120675
1985 Ga0495678_155781
1986 Ga0495682_0019468
1987 Ga0501036_0071471
1988 Ga0501036_0516667
1989 Ga0501038_0929688
1990 Ga0501039_0015411
1991 Ga0501040_0232926
1992 Ga0501041_0041077
1993 Ga0501041_0087947
1994 Ga0501042_0216076
1995 Ga0501042_0262230
1996 Ga0501042_0282845
1997 Ga0501043_0594918
1998 Ga0501046_0061065
1999 Ga0501046_0095129
2000 Ga0501046_0646507
2001 Ga0501068_0456634
2002 Ga0501068_0660744
2003 Ga0501070_0384482
2004 Ga0501071_0114502
2005 Ga0501072_0043951
2006 Ga0501072_0104955
2007 Ga0501072_0340127
2008 Ga0501072_0479312
2009 Ga0501073_0112136
2010 Ga0501074_0116165
2011 Ga0501075_0044302
2012 Ga0501075_0048868
2013 Ga0501075_0156544
2014 Ga0501077_0132464
2015 Ga0501079_0045574
2016 Ga0501079_0161403
2017 Ga0501080_0092730
2018 Ga0501080_0901047
2019 Ga0501081_0168045
2020 Ga0501081_0230254
2021 Ga0501081_0234212
2022 Ga0501081_0419559
2023 Ga0501081_0475767
2024 Ga0501045_0002197
2025 Ga0501045_0251204
2026 nmdc:mga0yw44_132265_c1
2027 nmdc:mga0k408_135494_c1
2028 nmdc:mga06z11_280989_c1
2029 nmdc:mga06z11_577633_c1
2030 nmdc:mga06z11_679_c1
2031 nmdc:mga04h51_20907_c1
2032 nmdc:mga07m45_254691_c1
2033 nmdc:mga05p37_1561296_c1
2034 nmdc:mga05p37_19865_c1
2035 nmdc:mga05p37_244386_c1
2036 nmdc:mga05p37_31350_c1
2037 nmdc:mga05p37_501778_c1
2038 nmdc:mga05p37_77_c1
2039 nmdc:mga05p37_931815_c1
2040 nmdc:mga09592_13099_c1
2041 nmdc:mga09592_15462_c1
2042 nmdc:mga09592_184713_c1
2043 nmdc:mga09592_355_c1
2044 nmdc:mga09592_71811_c1
2045 nmdc:mga0qj67_1010_c1
2046 nmdc:mga0qj67_24922_c1
2047 nmdc:mga0qj67_278487_c1
2048 nmdc:mga0qj67_6148_c1
2049 nmdc:mga06r32_11689_c1
2050 nmdc:mga06r32_13206_c1
2051 nmdc:mga06r32_19481_c1
2052 nmdc:mga06r32_3055_c1
2053 nmdc:mga06r32_34053_c1
2054 nmdc:mga06r32_479995_c1
2055 nmdc:mga06r32_48368_c1
2056 nmdc:mga06r32_7651_c1
2057 nmdc:mga08y16_1023228_c1
2058 nmdc:mga08y16_11017_c1
2059 nmdc:mga08y16_136746_c1
2060 nmdc:mga08y16_1998_c1
2061 nmdc:mga08y16_23677_c1
2062 nmdc:mga08y16_28383_c1
2063 nmdc:mga08y16_337277_c1
2064 nmdc:mga08y16_34274_c1
2065 nmdc:mga08y16_465022_c1
2066 nmdc:mga08y16_5088_c1
2067 nmdc:mga08y16_529794_c1
2068 nmdc:mga08y16_534504_c1
2069 nmdc:mga0n895_221418_c1
2070 nmdc:mga0n895_2763_c1
2071 nmdc:mga0n895_314639_c1
2072 nmdc:mga0n895_323329_c1
2073 nmdc:mga0n895_38591_c1
2074 nmdc:mga0n895_670615_c1
2075 nmdc:mga0rr50_223001_c1
2076 nmdc:mga0rr50_419358_c1
2077 nmdc:mga0rr50_43386_c1
2078 nmdc:mga08x19_424945_c1
2079 nmdc:mga0a205_1255_c1
2080 nmdc:mga0a205_139416_c1
2081 nmdc:mga0a205_172419_c1
2082 nmdc:mga0a205_282111_c1
2083 nmdc:mga0a205_38623_c2
2084 nmdc:mga0sz30_10569_c2
2085 Ga0495595_0447612
2086 Ga0500646_0002708
2087 Ga0500583_0143396
2088 Ga0500641_0013330
2089 Ga0500555_015156
2090 Ga0500655_018992
2091 Ga0500568_0036062
2092 Ga0500577_0041098
2093 Ga0500588_0022165
2094 Ga0500604_0001071
2095 Ga0500616_0112259
2096 Ga0500616_0222851
2097 Ga0500622_0262428
2098 Ga0501084_0051953
2099 Ga0501082_0424376
2100 Ga0530510_0002185
2101 2515683618
2102 2559426437
2103 2585318149
2104 2644267346
2105 2753266154
2106 2786673840
2107 2792841141
2108 2862385991
2109 2877676336
2110 2895517722
2111 2902685056
2112 2904485921
2113 2919532694
2114 2954700888
2115 2954706458
2116 8008559133

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

19

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jmv-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol 0.9491 1 199
7jmr-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis 0.9477 1 199
7jmv-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol 0.9445 1 199
7jmr-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis 0.9431 1 199
7kd9-assembly2.cif.gz_C crystal structure of gallic acid decarboxylase from arxula adeninivorans 0.9201 1 199
ID Description Score Start End Superfamily
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8743 1 127 3.10.450.50
5stdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8423 5 133 3.10.450.50
1idpA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8275 5 133 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8198 1 127 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.819 6 139 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2P7B700-F1-model_v4 SnoaL-like domain-containing protein 0.996 1 199
AF-A0A1Y0BLM0-F1-model_v4 J507 0.996 2 197
AF-A0A7W6U417-F1-model_v4 deleted 0.9959 5 162
AF-A0A523U914-F1-model_v4 Nuclear transport factor 2 family protein 0.9954 5 196
AF-A0A1H6NW08-F1-model_v4 deleted 0.9951 1 199

Map