F489228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1058 | 424 | 2116 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300025898|Ga0207692_10314733|Ga0207692_103147332 |
| Length | 173 |
| Sequence | MFRNIHTDPASEKPMQTVRLIVNGNAVGATADPETPLLDILRNHLGLMGTKFGCGLEQCGCCMVLVDGKPEKSCGKPLSTVAGREIVTIEGLGTPDRPHPLQRAFIDEQAGQCGYCLPGILITAKALLDRNPSPSRSEIAAALDDNICRCGSHIRILRAVERAARLLRDGAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 136 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 157 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 158 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 236 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 237 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 247 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 259 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 265 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 276 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 277 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 287 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 288 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 289 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 290 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 291 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 292 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 293 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 366 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 367 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 368 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 371 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 372 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 373 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 374 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 375 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 412 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 414 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 420 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 423 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 424 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.54 |
| Nodule | 0 |
| Rhizoplane | 6.05 |
| Rhizosphere | 88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207692_10314733 | 3300025898 | Bacteria | 956 |
| 2 | ARcpr5oldR_c001102 | 3300000041 | Bacteria | 2819 |
| 3 | ARSoilYngRDRAFT_c01134 | 3300000042 | Bacteria | 1655 |
| 4 | ARSoilOldRDRAFT_c000194 | 3300000044 | Bacteria | 9800 |
| 5 | ARCol0yngRDRAFT_1000833 | 3300000652 | Bacteria | 2820 |
| 6 | JGI24032J14994_101065 | 3300001430 | Bacteria | 1263 |
| 7 | JGI24746J21847_1000495 | 3300001977 | Bacteria | 5901 |
| 8 | JGI24747J21853_1001963 | 3300001978 | Bacteria | 1615 |
| 9 | JGI24739J22299_10001299 | 3300001989 | Bacteria | 9376 |
| 10 | JGI24750J21931_1000493 | 3300002070 | Bacteria | 6203 |
| 11 | JGI24748J21848_1004930 | 3300002074 | Bacteria | 1539 |
| 12 | JGI24738J21930_10000506 | 3300002075 | Bacteria | 11097 |
| 13 | JGI24749J21850_1001158 | 3300002076 | Bacteria | 3747 |
| 14 | JGI24744J21845_10027423 | 3300002077 | Bacteria | 1100 |
| 15 | JGI24034J26672_10008361 | 3300002239 | Bacteria | 1512 |
| 16 | JGI24742J22300_10003727 | 3300002244 | Bacteria | 2475 |
| 17 | JGI24751J29686_10039380 | 3300002459 | Bacteria | 978 |
| 18 | JGI26145J50221_1006328 | 3300003371 | Bacteria | 990 |
| 19 | Ga0065712_10072710 | 3300005290 | Bacteria | 4646 |
| 20 | Ga0065712_10244275 | 3300005290 | Bacteria | 976 |
| 21 | Ga0065715_10004320 | 3300005293 | Bacteria | 6202 |
| 22 | Ga0065715_10037744 | 3300005293 | Bacteria | 1373 |
| 23 | Ga0070658_10009108 | 3300005327 | Bacteria | 7981 |
| 24 | Ga0070676_10016795 | 3300005328 | Bacteria | 4046 |
| 25 | Ga0070676_11079621 | 3300005328 | Bacteria | 606 |
| 26 | Ga0070683_100003556 | 3300005329 | Bacteria | 12682 |
| 27 | Ga0070683_100148983 | 3300005329 | Bacteria | 2218 |
| 28 | Ga0070683_100399368 | 3300005329 | Bacteria | 1311 |
| 29 | Ga0070690_100017989 | 3300005330 | Bacteria | 4261 |
| 30 | Ga0070690_100176509 | 3300005330 | Bacteria | 1474 |
| 31 | Ga0070690_100245782 | 3300005330 | Bacteria | 1264 |
| 32 | Ga0070690_100291265 | 3300005330 | Bacteria | 1168 |
| 33 | Ga0070690_100522901 | 3300005330 | Bacteria | 891 |
| 34 | Ga0070670_100008291 | 3300005331 | Bacteria | 8849 |
| 35 | Ga0070670_100374034 | 3300005331 | Unclassified | 1254 |
| 36 | Ga0070670_100592443 | 3300005331 | Unclassified | 991 |
| 37 | Ga0070670_100861511 | 3300005331 | Bacteria | 820 |
| 38 | Ga0070677_10004318 | 3300005333 | Bacteria | 4629 |
| 39 | Ga0068869_100001645 | 3300005334 | Bacteria | 13324 |
| 40 | Ga0068869_100083099 | 3300005334 | Bacteria | 2394 |
| 41 | Ga0068869_100359195 | 3300005334 | Bacteria | 1189 |
| 42 | Ga0070666_10021722 | 3300005335 | Bacteria | 4160 |
| 43 | Ga0070666_10259398 | 3300005335 | Bacteria | 1232 |
| 44 | Ga0070666_10964258 | 3300005335 | Bacteria | 632 |
| 45 | Ga0070680_100001406 | 3300005336 | Bacteria | 17386 |
| 46 | Ga0070680_100007032 | 3300005336 | Bacteria | 8577 |
| 47 | Ga0070680_100102341 | 3300005336 | Bacteria | 2379 |
| 48 | Ga0070680_100233386 | 3300005336 | Bacteria | 1554 |
| 49 | Ga0070680_100593317 | 3300005336 | Bacteria | 951 |
| 50 | Ga0070682_100013294 | 3300005337 | Bacteria | 4733 |
| 51 | Ga0070682_100021362 | 3300005337 | Bacteria | 3818 |
| 52 | Ga0070682_100116347 | 3300005337 | Bacteria | 1789 |
| 53 | Ga0068868_100008818 | 3300005338 | Bacteria | 7225 |
| 54 | Ga0068868_100308577 | 3300005338 | Bacteria | 1345 |
| 55 | Ga0070660_100005193 | 3300005339 | Bacteria | 8999 |
| 56 | Ga0070660_100375820 | 3300005339 | Bacteria | 1173 |
| 57 | Ga0070660_100724508 | 3300005339 | Bacteria | 834 |
| 58 | Ga0070689_100008604 | 3300005340 | Bacteria | 7195 |
| 59 | Ga0070689_100075116 | 3300005340 | Plasmid | 2645 |
| 60 | Ga0070689_100153068 | 3300005340 | Bacteria | 1861 |
| 61 | Ga0070689_100460351 | 3300005340 | Bacteria | 1084 |
| 62 | Ga0070689_100558865 | 3300005340 | Bacteria | 987 |
| 63 | Ga0070691_10003570 | 3300005341 | Bacteria | 7017 |
| 64 | Ga0070691_10069685 | 3300005341 | Bacteria | 1705 |
| 65 | Ga0070687_100000814 | 3300005343 | Bacteria | 10390 |
| 66 | Ga0070687_100068757 | 3300005343 | Bacteria | 1894 |
| 67 | Ga0070661_100025170 | 3300005344 | Bacteria | 4275 |
| 68 | Ga0070661_100396884 | 3300005344 | Bacteria | 1090 |
| 69 | Ga0070661_100999666 | 3300005344 | Bacteria | 694 |
| 70 | Ga0070692_10033441 | 3300005345 | Bacteria | 2590 |
| 71 | Ga0070668_100000327 | 3300005347 | Bacteria | 31302 |
| 72 | Ga0070668_100090356 | 3300005347 | Bacteria | 2413 |
| 73 | Ga0070668_100805716 | 3300005347 | Bacteria | 835 |
| 74 | Ga0070669_100004627 | 3300005353 | Bacteria | 9929 |
| 75 | Ga0070669_100059577 | 3300005353 | Bacteria | 2803 |
| 76 | Ga0070675_100000633 | 3300005354 | Bacteria | 24266 |
| 77 | Ga0070675_100159505 | 3300005354 | Bacteria | 1939 |
| 78 | Ga0070671_100000738 | 3300005355 | Bacteria | 23424 |
| 79 | Ga0070671_100047745 | 3300005355 | Bacteria | 3559 |
| 80 | Ga0070671_100609623 | 3300005355 | Bacteria | 944 |
| 81 | Ga0070674_100000211 | 3300005356 | Bacteria | 28048 |
| 82 | Ga0070674_100093560 | 3300005356 | Bacteria | 2175 |
| 83 | Ga0070674_100455324 | 3300005356 | Bacteria | 1057 |
| 84 | Ga0070674_100542380 | 3300005356 | Bacteria | 975 |
| 85 | Ga0070673_100000736 | 3300005364 | Bacteria | 18131 |
| 86 | Ga0070673_100027886 | 3300005364 | Bacteria | 4192 |
| 87 | Ga0070673_100073956 | 3300005364 | Bacteria | 2744 |
| 88 | Ga0070673_101177616 | 3300005364 | Bacteria | 717 |
| 89 | Ga0070688_100012623 | 3300005365 | Bacteria | 4737 |
| 90 | Ga0070688_100050586 | 3300005365 | Bacteria | 2589 |
| 91 | Ga0070688_100091180 | 3300005365 | Bacteria | 1991 |
| 92 | Ga0070688_100368035 | 3300005365 | Unclassified | 1057 |
| 93 | Ga0070659_100000508 | 3300005366 | Bacteria | 28548 |
| 94 | Ga0070659_100229903 | 3300005366 | Bacteria | 1533 |
| 95 | Ga0070667_100006728 | 3300005367 | Bacteria | 9548 |
| 96 | Ga0070667_101514449 | 3300005367 | Bacteria | 630 |
| 97 | Ga0070703_10003437 | 3300005406 | Bacteria | 4516 |
| 98 | Ga0070703_10076684 | 3300005406 | Bacteria | 1129 |
| 99 | Ga0070709_10014167 | 3300005434 | Bacteria | 4504 |
| 100 | Ga0070709_10051924 | 3300005434 | Bacteria | 2574 |
| 101 | Ga0070714_100035933 | 3300005435 | Bacteria | 4153 |
| 102 | Ga0070714_100094771 | 3300005435 | Bacteria | 2620 |
| 103 | Ga0070714_100226224 | 3300005435 | Bacteria | 1722 |
| 104 | Ga0070713_100013021 | 3300005436 | Bacteria | 6125 |
| 105 | Ga0070713_100100376 | 3300005436 | Bacteria | 2505 |
| 106 | Ga0070713_100158839 | 3300005436 | Bacteria | 2016 |
| 107 | Ga0070713_100287315 | 3300005436 | Bacteria | 1510 |
| 108 | Ga0070713_100880141 | 3300005436 | Bacteria | 861 |
| 109 | Ga0070713_101100363 | 3300005436 | Bacteria | 768 |
| 110 | Ga0070713_101254063 | 3300005436 | Bacteria | 718 |
| 111 | Ga0070710_10003802 | 3300005437 | Bacteria | 7138 |
| 112 | Ga0070710_10021231 | 3300005437 | Bacteria | 3380 |
| 113 | Ga0070710_10666680 | 3300005437 | Bacteria | 731 |
| 114 | Ga0070701_10001645 | 3300005438 | Bacteria | 8355 |
| 115 | Ga0070701_11142013 | 3300005438 | Bacteria | 550 |
| 116 | Ga0070711_100333180 | 3300005439 | Bacteria | 1215 |
| 117 | Ga0070711_100733695 | 3300005439 | Bacteria | 834 |
| 118 | Ga0070705_100342912 | 3300005440 | Bacteria | 1086 |
| 119 | Ga0070700_100002387 | 3300005441 | Bacteria | 9573 |
| 120 | Ga0070700_100179619 | 3300005441 | Bacteria | 1472 |
| 121 | Ga0070700_100203976 | 3300005441 | Bacteria | 1391 |
| 122 | Ga0070700_100252850 | 3300005441 | Bacteria | 1265 |
| 123 | Ga0070694_100002705 | 3300005444 | Bacteria | 10512 |
| 124 | Ga0070694_100022727 | 3300005444 | Bacteria | 4022 |
| 125 | Ga0070708_100174330 | 3300005445 | Bacteria | 2009 |
| 126 | Ga0070708_101915286 | 3300005445 | Bacteria | 549 |
| 127 | Ga0070663_100000815 | 3300005455 | Bacteria | 16913 |
| 128 | Ga0070663_100055426 | 3300005455 | Bacteria | 2837 |
| 129 | Ga0070663_100514866 | 3300005455 | Bacteria | 995 |
| 130 | Ga0070663_100901845 | 3300005455 | Bacteria | 764 |
| 131 | Ga0070678_100055998 | 3300005456 | Bacteria | 2881 |
| 132 | Ga0070678_100123520 | 3300005456 | Bacteria | 2045 |
| 133 | Ga0070662_100009625 | 3300005457 | Bacteria | 6322 |
| 134 | Ga0070662_100137798 | 3300005457 | Bacteria | 1888 |
| 135 | Ga0070681_10015221 | 3300005458 | Bacteria | 7652 |
| 136 | Ga0070681_10037495 | 3300005458 | Bacteria | 4863 |
| 137 | Ga0070681_10038319 | 3300005458 | Bacteria | 4806 |
| 138 | Ga0070681_10138771 | 3300005458 | Bacteria | 2361 |
| 139 | Ga0070681_10145327 | 3300005458 | Bacteria | 2301 |
| 140 | Ga0070681_10648698 | 3300005458 | Bacteria | 970 |
| 141 | Ga0068867_100000652 | 3300005459 | Bacteria | 22983 |
| 142 | Ga0070685_10003090 | 3300005466 | Bacteria | 8466 |
| 143 | Ga0070685_10004123 | 3300005466 | Bacteria | 7333 |
| 144 | Ga0070685_10105700 | 3300005466 | Bacteria | 1726 |
| 145 | Ga0070706_100070387 | 3300005467 | Bacteria | 3235 |
| 146 | Ga0070706_100101892 | 3300005467 | Bacteria | 2668 |
| 147 | Ga0070706_101420975 | 3300005467 | Unclassified | 635 |
| 148 | Ga0070707_100706268 | 3300005468 | Bacteria | 971 |
| 149 | Ga0070698_100027073 | 3300005471 | Bacteria | 5962 |
| 150 | Ga0070698_100536019 | 3300005471 | Bacteria | 1109 |
| 151 | Ga0070699_100040041 | 3300005518 | Bacteria | 4058 |
| 152 | Ga0070699_100671763 | 3300005518 | Bacteria | 946 |
| 153 | Ga0070699_101053391 | 3300005518 | Bacteria | 746 |
| 154 | Ga0070679_100021378 | 3300005530 | Bacteria | 6316 |
| 155 | Ga0070679_100031573 | 3300005530 | Bacteria | 5234 |
| 156 | Ga0070679_100134342 | 3300005530 | Bacteria | 2455 |
| 157 | Ga0070679_100180329 | 3300005530 | Bacteria | 2084 |
| 158 | Ga0070679_100725618 | 3300005530 | Bacteria | 936 |
| 159 | Ga0070684_100009390 | 3300005535 | Bacteria | 7701 |
| 160 | Ga0070684_100121428 | 3300005535 | Bacteria | 2350 |
| 161 | Ga0070684_100553272 | 3300005535 | Bacteria | 1068 |
| 162 | Ga0070684_101171120 | 3300005535 | Bacteria | 723 |
| 163 | Ga0070697_100132293 | 3300005536 | Bacteria | 2093 |
| 164 | Ga0070697_100206403 | 3300005536 | Bacteria | 1671 |
| 165 | Ga0070697_100411036 | 3300005536 | Bacteria | 1175 |
| 166 | Ga0070697_100782223 | 3300005536 | Bacteria | 844 |
| 167 | Ga0068853_100033052 | 3300005539 | Bacteria | 4386 |
| 168 | Ga0070672_100010446 | 3300005543 | Bacteria | 6442 |
| 169 | Ga0070672_100159788 | 3300005543 | Bacteria | 1869 |
| 170 | Ga0070672_100284181 | 3300005543 | Bacteria | 1400 |
| 171 | Ga0070686_100005337 | 3300005544 | Bacteria | 7109 |
| 172 | Ga0070686_100019247 | 3300005544 | Bacteria | 4020 |
| 173 | Ga0070686_100207680 | 3300005544 | Bacteria | 1408 |
| 174 | Ga0070686_101699220 | 3300005544 | Bacteria | 536 |
| 175 | Ga0070695_100000791 | 3300005545 | Bacteria | 17042 |
| 176 | Ga0070695_100254442 | 3300005545 | Bacteria | 1280 |
| 177 | Ga0070696_100031267 | 3300005546 | Bacteria | 3647 |
| 178 | Ga0070696_100097449 | 3300005546 | Bacteria | 2103 |
| 179 | Ga0070696_100183889 | 3300005546 | Bacteria | 1552 |
| 180 | Ga0070696_100434966 | 3300005546 | Bacteria | 1033 |
| 181 | Ga0070696_100586564 | 3300005546 | Bacteria | 897 |
| 182 | Ga0070693_100010016 | 3300005547 | Bacteria | 4730 |
| 183 | Ga0070665_100073390 | 3300005548 | Bacteria | 3428 |
| 184 | Ga0070665_100375699 | 3300005548 | Bacteria | 1428 |
| 185 | Ga0070665_101826270 | 3300005548 | Bacteria | 614 |
| 186 | Ga0070704_100026728 | 3300005549 | Bacteria | 3820 |
| 187 | Ga0068855_100041815 | 3300005563 | Bacteria | 5431 |
| 188 | Ga0068855_100051893 | 3300005563 | Bacteria | 4830 |
| 189 | Ga0068855_101104328 | 3300005563 | Bacteria | 829 |
| 190 | Ga0070664_100002092 | 3300005564 | Bacteria | 15953 |
| 191 | Ga0070664_100055051 | 3300005564 | Bacteria | 3376 |
| 192 | Ga0070664_100090607 | 3300005564 | Bacteria | 2647 |
| 193 | Ga0070664_100213516 | 3300005564 | Bacteria | 1725 |
| 194 | Ga0070664_100290706 | 3300005564 | Unclassified | 1475 |
| 195 | Ga0070664_101384584 | 3300005564 | Bacteria | 665 |
| 196 | Ga0068857_100014842 | 3300005577 | Bacteria | 6794 |
| 197 | Ga0068857_100120910 | 3300005577 | Bacteria | 2358 |
| 198 | Ga0068854_100013287 | 3300005578 | Bacteria | 5399 |
| 199 | Ga0068856_100012787 | 3300005614 | Bacteria | 8125 |
| 200 | Ga0068856_100297558 | 3300005614 | Bacteria | 1631 |
| 201 | Ga0070702_100000664 | 3300005615 | Bacteria | 12852 |
| 202 | Ga0070702_100717620 | 3300005615 | Bacteria | 764 |
| 203 | Ga0068852_100088794 | 3300005616 | Bacteria | 2761 |
| 204 | Ga0068852_100685592 | 3300005616 | Bacteria | 1034 |
| 205 | Ga0068859_100021689 | 3300005617 | Bacteria | 6445 |
| 206 | Ga0068859_100062548 | 3300005617 | Bacteria | 3752 |
| 207 | Ga0068859_100078290 | 3300005617 | Bacteria | 3346 |
| 208 | Ga0068864_100029489 | 3300005618 | Bacteria | 4648 |
| 209 | Ga0068866_10013065 | 3300005718 | Bacteria | 3632 |
| 210 | Ga0068866_10132425 | 3300005718 | Bacteria | 1420 |
| 211 | Ga0068861_100086909 | 3300005719 | Bacteria | 2459 |
| 212 | Ga0068861_100254322 | 3300005719 | Bacteria | 1500 |
| 213 | Ga0068851_10655512 | 3300005834 | Bacteria | 643 |
| 214 | Ga0068870_10001203 | 3300005840 | Bacteria | 10389 |
| 215 | Ga0068870_10247364 | 3300005840 | Bacteria | 1104 |
| 216 | Ga0068870_10512045 | 3300005840 | Bacteria | 802 |
| 217 | Ga0068863_100001709 | 3300005841 | Bacteria | 21721 |
| 218 | Ga0068863_100173074 | 3300005841 | Bacteria | 2071 |
| 219 | Ga0068863_100340115 | 3300005841 | Bacteria | 1460 |
| 220 | Ga0068863_100399671 | 3300005841 | Bacteria | 1344 |
| 221 | Ga0068858_100006236 | 3300005842 | Bacteria | 11620 |
| 222 | Ga0068858_100393571 | 3300005842 | Bacteria | 1331 |
| 223 | Ga0068860_100002355 | 3300005843 | Bacteria | 19851 |
| 224 | Ga0068860_100193378 | 3300005843 | Bacteria | 1969 |
| 225 | Ga0068860_100221258 | 3300005843 | Bacteria | 1838 |
| 226 | Ga0068860_100710994 | 3300005843 | Bacteria | 1015 |
| 227 | Ga0068860_101196928 | 3300005843 | Bacteria | 780 |
| 228 | Ga0068862_100020174 | 3300005844 | Bacteria | 5566 |
| 229 | Ga0068862_100118494 | 3300005844 | Bacteria | 2331 |
| 230 | Ga0068862_100262668 | 3300005844 | Unclassified | 1576 |
| 231 | Ga0081455_10000237 | 3300005937 | Bacteria | 71335 |
| 232 | Ga0081455_10059737 | 3300005937 | Bacteria | 3217 |
| 233 | Ga0081455_10074285 | 3300005937 | Bacteria | 2808 |
| 234 | Ga0081455_10224245 | 3300005937 | Bacteria | 1391 |
| 235 | Ga0081455_10609741 | 3300005937 | Unclassified | 710 |
| 236 | Ga0081540_1034662 | 3300005983 | Bacteria | 2717 |
| 237 | Ga0081540_1060320 | 3300005983 | Bacteria | 1815 |
| 238 | Ga0070717_10002340 | 3300006028 | Bacteria | 13346 |
| 239 | Ga0075363_100187569 | 3300006048 | Bacteria | 1179 |
| 240 | Ga0075363_100207777 | 3300006048 | Bacteria | 1120 |
| 241 | Ga0075364_10234635 | 3300006051 | Bacteria | 1246 |
| 242 | Ga0075364_10269301 | 3300006051 | Unclassified | 1158 |
| 243 | Ga0075364_10319679 | 3300006051 | Bacteria | 1057 |
| 244 | Ga0075432_10111959 | 3300006058 | Bacteria | 1018 |
| 245 | Ga0070715_10007901 | 3300006163 | Bacteria | 3681 |
| 246 | Ga0070715_10026837 | 3300006163 | Bacteria | 2295 |
| 247 | Ga0070716_100010298 | 3300006173 | Bacteria | 4683 |
| 248 | Ga0070712_100013539 | 3300006175 | Bacteria | 5214 |
| 249 | Ga0070712_100084087 | 3300006175 | Bacteria | 2312 |
| 250 | Ga0070712_100182201 | 3300006175 | Bacteria | 1637 |
| 251 | Ga0070712_100190528 | 3300006175 | Bacteria | 1604 |
| 252 | Ga0070712_100256783 | 3300006175 | Bacteria | 1399 |
| 253 | Ga0070712_100304224 | 3300006175 | Bacteria | 1291 |
| 254 | Ga0070712_101268567 | 3300006175 | Unclassified | 642 |
| 255 | Ga0075362_10045900 | 3300006177 | Bacteria | 1942 |
| 256 | Ga0075362_10054677 | 3300006177 | Bacteria | 1795 |
| 257 | Ga0075362_10188292 | 3300006177 | Bacteria | 1002 |
| 258 | Ga0075362_10213391 | 3300006177 | Bacteria | 942 |
| 259 | Ga0075362_10661996 | 3300006177 | Bacteria | 543 |
| 260 | Ga0075367_10009109 | 3300006178 | Bacteria | 5172 |
| 261 | Ga0075367_10040927 | 3300006178 | Bacteria | 2707 |
| 262 | Ga0075367_10103405 | 3300006178 | Bacteria | 1743 |
| 263 | Ga0075367_10217034 | 3300006178 | Bacteria | 1196 |
| 264 | Ga0075369_10012698 | 3300006186 | Bacteria | 3328 |
| 265 | Ga0075369_10302836 | 3300006186 | Bacteria | 746 |
| 266 | Ga0075366_10001526 | 3300006195 | Bacteria | 11574 |
| 267 | Ga0075366_10028964 | 3300006195 | Bacteria | 3251 |
| 268 | Ga0097621_100013205 | 3300006237 | Bacteria | 6145 |
| 269 | Ga0097621_100016048 | 3300006237 | Bacteria | 5651 |
| 270 | Ga0075370_10008507 | 3300006353 | Bacteria | 5285 |
| 271 | Ga0075370_10181435 | 3300006353 | Bacteria | 1239 |
| 272 | Ga0075370_10194030 | 3300006353 | Bacteria | 1197 |
| 273 | Ga0068871_100002813 | 3300006358 | Bacteria | 11905 |
| 274 | Ga0068871_100012582 | 3300006358 | Bacteria | 6248 |
| 275 | Ga0068871_100137152 | 3300006358 | Bacteria | 2078 |
| 276 | Ga0075428_100009659 | 3300006844 | Bacteria | 10713 |
| 277 | Ga0075428_101128255 | 3300006844 | Bacteria | 828 |
| 278 | Ga0075430_100003548 | 3300006846 | Bacteria | 13061 |
| 279 | Ga0075431_100007309 | 3300006847 | Bacteria | 11001 |
| 280 | Ga0075433_10000385 | 3300006852 | Bacteria | 27972 |
| 281 | Ga0075433_10017361 | 3300006852 | Bacteria | 5960 |
| 282 | Ga0075433_10240532 | 3300006852 | Bacteria | 1607 |
| 283 | Ga0075434_100001834 | 3300006871 | Bacteria | 18340 |
| 284 | Ga0075434_100002777 | 3300006871 | Bacteria | 15489 |
| 285 | Ga0075434_100034528 | 3300006871 | Bacteria | 4994 |
| 286 | Ga0075434_100057623 | 3300006871 | Bacteria | 3861 |
| 287 | Ga0075434_100109859 | 3300006871 | Bacteria | 2768 |
| 288 | Ga0075434_100213441 | 3300006871 | Bacteria | 1950 |
| 289 | Ga0075429_100006121 | 3300006880 | Bacteria | 10398 |
| 290 | Ga0068865_100008168 | 3300006881 | Bacteria | 6461 |
| 291 | Ga0068865_100218330 | 3300006881 | Bacteria | 1489 |
| 292 | Ga0097620_100021689 | 3300006931 | Bacteria | 6445 |
| 293 | Ga0097620_100062547 | 3300006931 | Bacteria | 3752 |
| 294 | Ga0097620_100078296 | 3300006931 | Bacteria | 3346 |
| 295 | Ga0075435_100000959 | 3300007076 | Bacteria | 18214 |
| 296 | Ga0075435_100004768 | 3300007076 | Bacteria | 9364 |
| 297 | Ga0075435_100007344 | 3300007076 | Bacteria | 7848 |
| 298 | Ga0075435_100210323 | 3300007076 | Bacteria | 1650 |
| 299 | Ga0075435_100423390 | 3300007076 | Bacteria | 1147 |
| 300 | Ga0075435_100483204 | 3300007076 | Bacteria | 1070 |
| 301 | Ga0075435_100491439 | 3300007076 | Bacteria | 1061 |
| 302 | Ga0105251_10322103 | 3300009011 | Bacteria | 703 |
| 303 | Ga0105240_10008002 | 3300009093 | Bacteria | 15226 |
| 304 | Ga0105240_11325890 | 3300009093 | Bacteria | 758 |
| 305 | Ga0111539_10000500 | 3300009094 | Bacteria | 49951 |
| 306 | Ga0111539_10010854 | 3300009094 | Bacteria | 11464 |
| 307 | Ga0111539_10173769 | 3300009094 | Bacteria | 2517 |
| 308 | Ga0111539_10385074 | 3300009094 | Bacteria | 1633 |
| 309 | Ga0111539_11236135 | 3300009094 | Bacteria | 867 |
| 310 | Ga0111539_11759069 | 3300009094 | Bacteria | 719 |
| 311 | Ga0105245_10000661 | 3300009098 | Bacteria | 31194 |
| 312 | Ga0105245_10062727 | 3300009098 | Bacteria | 3354 |
| 313 | Ga0105245_10497294 | 3300009098 | Bacteria | 1235 |
| 314 | Ga0105245_10716382 | 3300009098 | Bacteria | 1035 |
| 315 | Ga0105245_11042158 | 3300009098 | Bacteria | 863 |
| 316 | Ga0105247_10000960 | 3300009101 | Bacteria | 21746 |
| 317 | Ga0105247_10027599 | 3300009101 | Bacteria | 3432 |
| 318 | Ga0105247_10311421 | 3300009101 | Bacteria | 1095 |
| 319 | Ga0105243_10002561 | 3300009148 | Bacteria | 15197 |
| 320 | Ga0105243_10118527 | 3300009148 | Bacteria | 2227 |
| 321 | Ga0105243_10136574 | 3300009148 | Bacteria | 2087 |
| 322 | Ga0105241_10105908 | 3300009174 | Bacteria | 2244 |
| 323 | Ga0105241_10369774 | 3300009174 | Bacteria | 1250 |
| 324 | Ga0105241_11352070 | 3300009174 | Bacteria | 680 |
| 325 | Ga0105242_10013459 | 3300009176 | Bacteria | 6325 |
| 326 | Ga0105242_10037115 | 3300009176 | Bacteria | 3913 |
| 327 | Ga0105242_10710096 | 3300009176 | Bacteria | 985 |
| 328 | Ga0105248_10036093 | 3300009177 | Bacteria | 5529 |
| 329 | Ga0105248_10187343 | 3300009177 | Bacteria | 2332 |
| 330 | Ga0105248_10228909 | 3300009177 | Bacteria | 2092 |
| 331 | Ga0105248_10464935 | 3300009177 | Bacteria | 1426 |
| 332 | Ga0105237_10011302 | 3300009545 | Bacteria | 9447 |
| 333 | Ga0105237_10265850 | 3300009545 | Bacteria | 1718 |
| 334 | Ga0105237_10327390 | 3300009545 | Bacteria | 1536 |
| 335 | Ga0105237_10425962 | 3300009545 | Bacteria | 1333 |
| 336 | Ga0105238_10123801 | 3300009551 | Bacteria | 2565 |
| 337 | Ga0105238_10266242 | 3300009551 | Bacteria | 1694 |
| 338 | Ga0105249_10008921 | 3300009553 | Bacteria | 8758 |
| 339 | Ga0105249_10555698 | 3300009553 | Bacteria | 1199 |
| 340 | Ga0105249_10708010 | 3300009553 | Bacteria | 1067 |
| 341 | Ga0105249_11298857 | 3300009553 | Bacteria | 799 |
| 342 | Ga0105239_10310631 | 3300010375 | Bacteria | 1777 |
| 343 | Ga0105239_10449830 | 3300010375 | Bacteria | 1461 |
| 344 | Ga0105239_11548480 | 3300010375 | Bacteria | 766 |
| 345 | Ga0105246_10046608 | 3300011119 | Bacteria | 2957 |
| 346 | Ga0105246_10172577 | 3300011119 | Bacteria | 1657 |
| 347 | Ga0105246_10287104 | 3300011119 | Bacteria | 1323 |
| 348 | Ga0105246_11197563 | 3300011119 | Unclassified | 699 |
| 349 | Ga0157341_1000435 | 3300012494 | Bacteria | 2087 |
| 350 | Ga0157347_1005285 | 3300012502 | Bacteria | 1229 |
| 351 | Ga0157373_10058492 | 3300013100 | Bacteria | 2733 |
| 352 | Ga0157373_10488312 | 3300013100 | Bacteria | 889 |
| 353 | Ga0157371_10180062 | 3300013102 | Bacteria | 1512 |
| 354 | Ga0157371_10839991 | 3300013102 | Bacteria | 694 |
| 355 | Ga0157370_10321322 | 3300013104 | Bacteria | 1428 |
| 356 | Ga0157370_10362813 | 3300013104 | Bacteria | 1335 |
| 357 | Ga0157369_10615146 | 3300013105 | Bacteria | 1121 |
| 358 | Ga0157369_11921429 | 3300013105 | Bacteria | 601 |
| 359 | Ga0157374_10015572 | 3300013296 | Bacteria | 6673 |
| 360 | Ga0157374_10519597 | 3300013296 | Bacteria | 1196 |
| 361 | Ga0157374_10705971 | 3300013296 | Bacteria | 1022 |
| 362 | Ga0157374_11830467 | 3300013296 | Bacteria | 632 |
| 363 | Ga0157378_10001521 | 3300013297 | Bacteria | 20986 |
| 364 | Ga0157378_10438660 | 3300013297 | Bacteria | 1294 |
| 365 | Ga0163162_10000819 | 3300013306 | Bacteria | 28876 |
| 366 | Ga0163162_10124602 | 3300013306 | Bacteria | 2682 |
| 367 | Ga0163162_11071185 | 3300013306 | Bacteria | 913 |
| 368 | Ga0163162_11078127 | 3300013306 | Bacteria | 910 |
| 369 | Ga0163162_11402507 | 3300013306 | Bacteria | 795 |
| 370 | Ga0163162_11853756 | 3300013306 | Bacteria | 690 |
| 371 | Ga0157372_10041275 | 3300013307 | Bacteria | 5101 |
| 372 | Ga0157372_10908693 | 3300013307 | Bacteria | 1021 |
| 373 | Ga0157375_10001004 | 3300013308 | Bacteria | 24381 |
| 374 | Ga0157375_10014815 | 3300013308 | Bacteria | 6966 |
| 375 | Ga0157375_10146665 | 3300013308 | Bacteria | 2491 |
| 376 | Ga0157375_11086474 | 3300013308 | Bacteria | 936 |
| 377 | Ga0163163_10005260 | 3300014325 | Bacteria | 11163 |
| 378 | Ga0163163_10021832 | 3300014325 | Bacteria | 6048 |
| 379 | Ga0163163_10658449 | 3300014325 | Bacteria | 1111 |
| 380 | Ga0163163_11133673 | 3300014325 | Bacteria | 845 |
| 381 | Ga0163163_12627158 | 3300014325 | Bacteria | 561 |
| 382 | Ga0157380_10091002 | 3300014326 | Bacteria | 2518 |
| 383 | Ga0157380_10165767 | 3300014326 | Bacteria | 1925 |
| 384 | Ga0182008_10056120 | 3300014497 | Bacteria | 1947 |
| 385 | Ga0157377_10007323 | 3300014745 | Bacteria | 5322 |
| 386 | Ga0157377_10488028 | 3300014745 | Bacteria | 858 |
| 387 | Ga0157379_10002682 | 3300014968 | Bacteria | 14992 |
| 388 | Ga0157379_10187055 | 3300014968 | Bacteria | 1872 |
| 389 | Ga0157379_10276786 | 3300014968 | Bacteria | 1527 |
| 390 | Ga0157379_10507658 | 3300014968 | Bacteria | 1118 |
| 391 | Ga0157376_10024522 | 3300014969 | Bacteria | 4738 |
| 392 | Ga0157376_10953220 | 3300014969 | Bacteria | 879 |
| 393 | Ga0157376_11251859 | 3300014969 | Bacteria | 771 |
| 394 | Ga0157376_12170386 | 3300014969 | Bacteria | 594 |
| 395 | Ga0163161_10008318 | 3300017792 | Bacteria | 7184 |
| 396 | Ga0213873_10066014 | 3300021358 | Unclassified | 989 |
| 397 | Ga0213872_10159566 | 3300021361 | Bacteria | 982 |
| 398 | Ga0213876_10297480 | 3300021384 | Bacteria | 858 |
| 399 | Ga0213875_10001665 | 3300021388 | Bacteria | 13999 |
| 400 | Ga0213871_10008671 | 3300021441 | Bacteria | 2253 |
| 401 | Ga0213871_10130151 | 3300021441 | Bacteria | 755 |
| 402 | Ga0207666_1000061 | 3300025271 | Bacteria | 19549 |
| 403 | Ga0207666_1016554 | 3300025271 | Bacteria | 1058 |
| 404 | Ga0207673_1000454 | 3300025290 | Bacteria | 4249 |
| 405 | Ga0207697_10000191 | 3300025315 | Bacteria | 32215 |
| 406 | Ga0207697_10046818 | 3300025315 | Bacteria | 1782 |
| 407 | Ga0207653_10048753 | 3300025885 | Bacteria | 1404 |
| 408 | Ga0207682_10000035 | 3300025893 | Bacteria | 56611 |
| 409 | Ga0207692_10096324 | 3300025898 | Bacteria | 1615 |
| 410 | Ga0207642_10003201 | 3300025899 | Bacteria | 5132 |
| 411 | Ga0207642_10019378 | 3300025899 | Bacteria | 2633 |
| 412 | Ga0207710_10003954 | 3300025900 | Bacteria | 6534 |
| 413 | Ga0207710_10010216 | 3300025900 | Bacteria | 3949 |
| 414 | Ga0207710_10219407 | 3300025900 | Bacteria | 944 |
| 415 | Ga0207688_10000164 | 3300025901 | Bacteria | 28882 |
| 416 | Ga0207688_10024078 | 3300025901 | Bacteria | 3338 |
| 417 | Ga0207680_10216671 | 3300025903 | Bacteria | 1311 |
| 418 | Ga0207680_10234817 | 3300025903 | Bacteria | 1261 |
| 419 | Ga0207680_10719553 | 3300025903 | Bacteria | 715 |
| 420 | Ga0207647_10033968 | 3300025904 | Bacteria | 3260 |
| 421 | Ga0207647_10249969 | 3300025904 | Bacteria | 1017 |
| 422 | Ga0207685_10048532 | 3300025905 | Bacteria | 1627 |
| 423 | Ga0207699_10060174 | 3300025906 | Bacteria | 2279 |
| 424 | Ga0207699_10065027 | 3300025906 | Bacteria | 2209 |
| 425 | Ga0207699_10176427 | 3300025906 | Bacteria | 1433 |
| 426 | Ga0207699_10507162 | 3300025906 | Bacteria | 871 |
| 427 | Ga0207645_10000675 | 3300025907 | Bacteria | 28236 |
| 428 | Ga0207645_10157162 | 3300025907 | Bacteria | 1486 |
| 429 | Ga0207643_10005662 | 3300025908 | Bacteria | 6683 |
| 430 | Ga0207707_10019277 | 3300025912 | Bacteria | 5953 |
| 431 | Ga0207707_10040135 | 3300025912 | Bacteria | 4089 |
| 432 | Ga0207707_10147737 | 3300025912 | Bacteria | 2055 |
| 433 | Ga0207707_10252491 | 3300025912 | Bacteria | 1532 |
| 434 | Ga0207707_10605503 | 3300025912 | Bacteria | 927 |
| 435 | Ga0207695_10026400 | 3300025913 | Bacteria | 6481 |
| 436 | Ga0207695_10250667 | 3300025913 | Bacteria | 1670 |
| 437 | Ga0207671_10082459 | 3300025914 | Bacteria | 2413 |
| 438 | Ga0207671_10133759 | 3300025914 | Bacteria | 1905 |
| 439 | Ga0207671_10169236 | 3300025914 | Bacteria | 1696 |
| 440 | Ga0207693_10013190 | 3300025915 | Bacteria | 6667 |
| 441 | Ga0207693_10045743 | 3300025915 | Bacteria | 3438 |
| 442 | Ga0207693_10243681 | 3300025915 | Bacteria | 1411 |
| 443 | Ga0207693_10272105 | 3300025915 | Bacteria | 1327 |
| 444 | Ga0207693_10385077 | 3300025915 | Bacteria | 1097 |
| 445 | Ga0207663_10102785 | 3300025916 | Bacteria | 1923 |
| 446 | Ga0207663_11181604 | 3300025916 | Bacteria | 616 |
| 447 | Ga0207660_10000388 | 3300025917 | Bacteria | 28927 |
| 448 | Ga0207660_10013525 | 3300025917 | Bacteria | 5349 |
| 449 | Ga0207660_10154326 | 3300025917 | Bacteria | 1766 |
| 450 | Ga0207660_10726319 | 3300025917 | Bacteria | 810 |
| 451 | Ga0207662_10001201 | 3300025918 | Bacteria | 12363 |
| 452 | Ga0207662_10063281 | 3300025918 | Bacteria | 2224 |
| 453 | Ga0207662_10084226 | 3300025918 | Bacteria | 1945 |
| 454 | Ga0207657_10018763 | 3300025919 | Bacteria | 6589 |
| 455 | Ga0207649_10024805 | 3300025920 | Bacteria | 3489 |
| 456 | Ga0207649_10278080 | 3300025920 | Bacteria | 1216 |
| 457 | Ga0207652_10011032 | 3300025921 | Bacteria | 7283 |
| 458 | Ga0207652_10288977 | 3300025921 | Bacteria | 1479 |
| 459 | Ga0207646_10539340 | 3300025922 | Bacteria | 1049 |
| 460 | Ga0207646_10820278 | 3300025922 | Bacteria | 828 |
| 461 | Ga0207681_10004176 | 3300025923 | Bacteria | 8943 |
| 462 | Ga0207681_10393563 | 3300025923 | Bacteria | 1118 |
| 463 | Ga0207694_10042945 | 3300025924 | Bacteria | 3489 |
| 464 | Ga0207694_10184269 | 3300025924 | Bacteria | 1694 |
| 465 | Ga0207650_10031895 | 3300025925 | Bacteria | 3809 |
| 466 | Ga0207650_10220507 | 3300025925 | Bacteria | 1526 |
| 467 | Ga0207650_10604562 | 3300025925 | Unclassified | 922 |
| 468 | Ga0207659_10004854 | 3300025926 | Bacteria | 8148 |
| 469 | Ga0207659_10061627 | 3300025926 | Bacteria | 2704 |
| 470 | Ga0207659_10450720 | 3300025926 | Unclassified | 1084 |
| 471 | Ga0207687_10001487 | 3300025927 | Bacteria | 16057 |
| 472 | Ga0207687_10029797 | 3300025927 | Bacteria | 3673 |
| 473 | Ga0207687_10113573 | 3300025927 | Bacteria | 2015 |
| 474 | Ga0207687_10482412 | 3300025927 | Bacteria | 1032 |
| 475 | Ga0207700_10001623 | 3300025928 | Bacteria | 12780 |
| 476 | Ga0207700_10131703 | 3300025928 | Bacteria | 2042 |
| 477 | Ga0207700_10579583 | 3300025928 | Bacteria | 998 |
| 478 | Ga0207664_10058259 | 3300025929 | Bacteria | 3072 |
| 479 | Ga0207664_10129499 | 3300025929 | Bacteria | 2123 |
| 480 | Ga0207664_10168751 | 3300025929 | Bacteria | 1871 |
| 481 | Ga0207664_10336295 | 3300025929 | Bacteria | 1334 |
| 482 | Ga0207644_10052064 | 3300025931 | Bacteria | 2941 |
| 483 | Ga0207644_10159352 | 3300025931 | Bacteria | 1753 |
| 484 | Ga0207644_10354181 | 3300025931 | Bacteria | 1192 |
| 485 | Ga0207690_10001328 | 3300025932 | Bacteria | 15550 |
| 486 | Ga0207690_10111781 | 3300025932 | Bacteria | 1969 |
| 487 | Ga0207706_10002409 | 3300025933 | Bacteria | 18241 |
| 488 | Ga0207706_10050021 | 3300025933 | Bacteria | 3693 |
| 489 | Ga0207706_10055598 | 3300025933 | Bacteria | 3490 |
| 490 | Ga0207706_10134040 | 3300025933 | Bacteria | 2179 |
| 491 | Ga0207686_10030378 | 3300025934 | Bacteria | 3198 |
| 492 | Ga0207686_10100453 | 3300025934 | Bacteria | 1930 |
| 493 | Ga0207686_10568768 | 3300025934 | Bacteria | 888 |
| 494 | Ga0207686_10805058 | 3300025934 | Bacteria | 753 |
| 495 | Ga0207709_10000374 | 3300025935 | Bacteria | 45115 |
| 496 | Ga0207709_10182583 | 3300025935 | Bacteria | 1483 |
| 497 | Ga0207709_10886064 | 3300025935 | Bacteria | 725 |
| 498 | Ga0207670_10036530 | 3300025936 | Bacteria | 3195 |
| 499 | Ga0207670_10629806 | 3300025936 | Bacteria | 883 |
| 500 | Ga0207669_10000353 | 3300025937 | Bacteria | 20899 |
| 501 | Ga0207669_10204313 | 3300025937 | Bacteria | 1437 |
| 502 | Ga0207669_10307711 | 3300025937 | Bacteria | 1207 |
| 503 | Ga0207669_10478930 | 3300025937 | Bacteria | 992 |
| 504 | Ga0207704_10000265 | 3300025938 | Bacteria | 25185 |
| 505 | Ga0207704_11014579 | 3300025938 | Bacteria | 702 |
| 506 | Ga0207665_10002010 | 3300025939 | Bacteria | 13687 |
| 507 | Ga0207665_10142203 | 3300025939 | Bacteria | 1712 |
| 508 | Ga0207665_10202137 | 3300025939 | Bacteria | 1448 |
| 509 | Ga0207665_10832618 | 3300025939 | Bacteria | 730 |
| 510 | Ga0207691_10000869 | 3300025940 | Bacteria | 30055 |
| 511 | Ga0207691_10334961 | 3300025940 | Bacteria | 1296 |
| 512 | Ga0207711_10004421 | 3300025941 | Bacteria | 11984 |
| 513 | Ga0207711_10013109 | 3300025941 | Bacteria | 6885 |
| 514 | Ga0207711_10175543 | 3300025941 | Bacteria | 1946 |
| 515 | Ga0207711_10282518 | 3300025941 | Bacteria | 1529 |
| 516 | Ga0207689_10001240 | 3300025942 | Bacteria | 24594 |
| 517 | Ga0207689_10018642 | 3300025942 | Bacteria | 5854 |
| 518 | Ga0207689_10358454 | 3300025942 | Bacteria | 1213 |
| 519 | Ga0207661_10000371 | 3300025944 | Bacteria | 28821 |
| 520 | Ga0207661_10542235 | 3300025944 | Bacteria | 1065 |
| 521 | Ga0207661_11162703 | 3300025944 | Bacteria | 710 |
| 522 | Ga0207679_10000224 | 3300025945 | Bacteria | 44681 |
| 523 | Ga0207679_10063595 | 3300025945 | Bacteria | 2755 |
| 524 | Ga0207679_10144794 | 3300025945 | Bacteria | 1926 |
| 525 | Ga0207679_10209532 | 3300025945 | Bacteria | 1633 |
| 526 | Ga0207679_10319841 | 3300025945 | Bacteria | 1343 |
| 527 | Ga0207679_10394987 | 3300025945 | Bacteria | 1215 |
| 528 | Ga0207667_10135074 | 3300025949 | Bacteria | 2540 |
| 529 | Ga0207667_10720143 | 3300025949 | Bacteria | 999 |
| 530 | Ga0207651_10037760 | 3300025960 | Bacteria | 3166 |
| 531 | Ga0207651_10190011 | 3300025960 | Bacteria | 1637 |
| 532 | Ga0207651_10406676 | 3300025960 | Bacteria | 1159 |
| 533 | Ga0207712_10006600 | 3300025961 | Bacteria | 7321 |
| 534 | Ga0207712_10351230 | 3300025961 | Bacteria | 1226 |
| 535 | Ga0207712_10461261 | 3300025961 | Bacteria | 1079 |
| 536 | Ga0207668_10000284 | 3300025972 | Bacteria | 33391 |
| 537 | Ga0207668_10105223 | 3300025972 | Bacteria | 2106 |
| 538 | Ga0207668_10326304 | 3300025972 | Bacteria | 1275 |
| 539 | Ga0207640_10015972 | 3300025981 | Bacteria | 4357 |
| 540 | Ga0207640_10641800 | 3300025981 | Bacteria | 904 |
| 541 | Ga0207658_10019082 | 3300025986 | Bacteria | 4742 |
| 542 | Ga0207658_10139426 | 3300025986 | Bacteria | 1960 |
| 543 | Ga0207658_10390396 | 3300025986 | Bacteria | 1221 |
| 544 | Ga0207677_10009705 | 3300026023 | Bacteria | 5422 |
| 545 | Ga0207677_10093800 | 3300026023 | Bacteria | 2189 |
| 546 | Ga0207703_10054919 | 3300026035 | Bacteria | 3240 |
| 547 | Ga0207703_10200249 | 3300026035 | Bacteria | 1774 |
| 548 | Ga0207703_10350763 | 3300026035 | Bacteria | 1358 |
| 549 | Ga0207703_10912943 | 3300026035 | Bacteria | 841 |
| 550 | Ga0207639_10006844 | 3300026041 | Bacteria | 7766 |
| 551 | Ga0207678_10000756 | 3300026067 | Bacteria | 29533 |
| 552 | Ga0207678_10020551 | 3300026067 | Bacteria | 5788 |
| 553 | Ga0207678_10052160 | 3300026067 | Bacteria | 3530 |
| 554 | Ga0207678_10224650 | 3300026067 | Bacteria | 1608 |
| 555 | Ga0207708_10004433 | 3300026075 | Bacteria | 10349 |
| 556 | Ga0207708_10089651 | 3300026075 | Bacteria | 2370 |
| 557 | Ga0207708_10183468 | 3300026075 | Bacteria | 1662 |
| 558 | Ga0207708_10346390 | 3300026075 | Bacteria | 1218 |
| 559 | Ga0207702_10016673 | 3300026078 | Bacteria | 6082 |
| 560 | Ga0207702_10264619 | 3300026078 | Bacteria | 1620 |
| 561 | Ga0207702_10320136 | 3300026078 | Bacteria | 1477 |
| 562 | Ga0207641_10003398 | 3300026088 | Bacteria | 14113 |
| 563 | Ga0207641_10209626 | 3300026088 | Bacteria | 1801 |
| 564 | Ga0207641_10515522 | 3300026088 | Bacteria | 1163 |
| 565 | Ga0207641_10584214 | 3300026088 | Bacteria | 1092 |
| 566 | Ga0207641_10688036 | 3300026088 | Bacteria | 1006 |
| 567 | Ga0207648_10000616 | 3300026089 | Bacteria | 39912 |
| 568 | Ga0207648_10240751 | 3300026089 | Bacteria | 1611 |
| 569 | Ga0207676_10000347 | 3300026095 | Bacteria | 39680 |
| 570 | Ga0207676_11147327 | 3300026095 | Bacteria | 769 |
| 571 | Ga0207674_10002264 | 3300026116 | Bacteria | 24389 |
| 572 | Ga0207674_10190125 | 3300026116 | Bacteria | 2003 |
| 573 | Ga0207674_10308982 | 3300026116 | Bacteria | 1530 |
| 574 | Ga0207674_10385273 | 3300026116 | Bacteria | 1355 |
| 575 | Ga0207675_100010802 | 3300026118 | Bacteria | 8557 |
| 576 | Ga0207675_100057594 | 3300026118 | Unclassified | 3626 |
| 577 | Ga0207675_100278562 | 3300026118 | Bacteria | 1625 |
| 578 | Ga0207675_102103102 | 3300026118 | Bacteria | 581 |
| 579 | Ga0207683_10000635 | 3300026121 | Bacteria | 32087 |
| 580 | Ga0207683_10143722 | 3300026121 | Bacteria | 2150 |
| 581 | Ga0207683_10147053 | 3300026121 | Bacteria | 2126 |
| 582 | Ga0207698_10062738 | 3300026142 | Bacteria | 2904 |
| 583 | Ga0209973_1007087 | 3300027252 | Bacteria | 1243 |
| 584 | Ga0209984_1006992 | 3300027424 | Bacteria | 1395 |
| 585 | Ga0209999_1021106 | 3300027543 | Bacteria | 1195 |
| 586 | Ga0210002_1003619 | 3300027617 | Bacteria | 2286 |
| 587 | Ga0209998_10001047 | 3300027717 | Bacteria | 6940 |
| 588 | Ga0209813_10305639 | 3300027866 | Bacteria | 619 |
| 589 | Ga0209974_10004485 | 3300027876 | Bacteria | 4970 |
| 590 | Ga0207428_10000256 | 3300027907 | Bacteria | 72918 |
| 591 | Ga0207428_10000338 | 3300027907 | Bacteria | 60937 |
| 592 | Ga0207428_10086092 | 3300027907 | Bacteria | 2446 |
| 593 | Ga0268266_10115706 | 3300028379 | Bacteria | 2381 |
| 594 | Ga0268266_10926649 | 3300028379 | Bacteria | 843 |
| 595 | Ga0268265_10022010 | 3300028380 | Bacteria | 4474 |
| 596 | Ga0268265_10158326 | 3300028380 | Bacteria | 1920 |
| 597 | Ga0268265_10206704 | 3300028380 | Bacteria | 1707 |
| 598 | Ga0268265_10351582 | 3300028380 | Bacteria | 1346 |
| 599 | Ga0268264_10127826 | 3300028381 | Bacteria | 2248 |
| 600 | Ga0268264_10238998 | 3300028381 | Bacteria | 1681 |
| 601 | Ga0268264_10267874 | 3300028381 | Bacteria | 1595 |
| 602 | Ga0265334_10003956 | 3300028573 | Bacteria | 6668 |
| 603 | Ga0265325_10000707 | 3300031241 | Bacteria | 24193 |
| 604 | Ga0265325_10136421 | 3300031241 | Bacteria | 1170 |
| 605 | Ga0265340_10049816 | 3300031247 | Bacteria | 2033 |
| 606 | Ga0265339_10052866 | 3300031249 | Bacteria | 2211 |
| 607 | Ga0265339_10448872 | 3300031249 | Bacteria | 599 |
| 608 | Ga0265316_10302651 | 3300031344 | Bacteria | 1164 |
| 609 | Ga0265313_10060075 | 3300031595 | Bacteria | 1784 |
| 610 | Ga0265314_10006447 | 3300031711 | Bacteria | 10386 |
| 611 | Ga0373930_0001155 | 3300034816 | Bacteria | 3854 |
| 612 | Ga0373930_0007245 | 3300034816 | Bacteria | 1903 |
| 613 | Ga0373948_0002036 | 3300034817 | Bacteria | 2921 |
| 614 | Ga0373950_0006879 | 3300034818 | Bacteria | 1749 |
| 615 | Ga0373950_0012812 | 3300034818 | Bacteria | 1390 |
| 616 | Ga0373958_0007782 | 3300034819 | Bacteria | 1717 |
| 617 | Ga0373958_0015528 | 3300034819 | Bacteria | 1347 |
| 618 | Ga0373959_0004547 | 3300034820 | Bacteria | 2240 |
| 619 | Ga0373959_0012790 | 3300034820 | Bacteria | 1504 |
| 620 | Ga0373938_0007697 | 3300034957 | Bacteria | 1902 |
| 621 | Ga0373926_0034118 | 3300035083 | Bacteria | 1800 |
| 622 | Ga0373926_0037711 | 3300035083 | Bacteria | 1719 |
| 623 | Ga0373928_0007593 | 3300035084 | Bacteria | 2094 |
| 624 | Ga0373928_0011502 | 3300035084 | Bacteria | 1752 |
| 625 | Ga0373928_0012597 | 3300035084 | Bacteria | 1689 |
| 626 | Ga0373929_0005768 | 3300035085 | Bacteria | 2235 |
| 627 | Ga0373929_0005974 | 3300035085 | Bacteria | 2198 |
| 628 | Ga0373934_0008041 | 3300035086 | Bacteria | 3925 |
| 629 | Ga0373934_0044942 | 3300035086 | Unclassified | 1746 |
| 630 | Ga0373934_0056385 | 3300035086 | Bacteria | 1563 |
| 631 | Ga0373934_0178166 | 3300035086 | Unclassified | 873 |
| 632 | Ga0373940_0015995 | 3300035088 | Bacteria | 1853 |
| 633 | Ga0373940_0016579 | 3300035088 | Bacteria | 1826 |
| 634 | Ga0373940_0209165 | 3300035088 | Bacteria | 644 |
| 635 | Ga0373944_0002044 | 3300035089 | Bacteria | 5116 |
| 636 | Ga0373944_0060803 | 3300035089 | Bacteria | 1212 |
| 637 | Ga0373951_0002018 | 3300035091 | Bacteria | 5203 |
| 638 | Ga0373951_0006340 | 3300035091 | Bacteria | 2703 |
| 639 | Ga0373952_0001998 | 3300035092 | Bacteria | 3686 |
| 640 | Ga0373923_0018427 | 3300035111 | Bacteria | 2687 |
| 641 | Ga0373923_0036530 | 3300035111 | Bacteria | 2005 |
| 642 | Ga0373923_0045038 | 3300035111 | Bacteria | 1831 |
| 643 | Ga0373923_0103951 | 3300035111 | Bacteria | 1255 |
| 644 | Ga0373932_0003036 | 3300035112 | Bacteria | 4106 |
| 645 | Ga0373932_0006656 | 3300035112 | Bacteria | 2737 |
| 646 | Ga0373932_0011254 | 3300035112 | Bacteria | 2182 |
| 647 | Ga0373936_0006174 | 3300035113 | Bacteria | 4516 |
| 648 | Ga0373936_0087237 | 3300035113 | Bacteria | 1305 |
| 649 | Ga0373936_0178310 | 3300035113 | Bacteria | 931 |
| 650 | Ga0373939_0000902 | 3300035114 | Bacteria | 7384 |
| 651 | Ga0373939_0007588 | 3300035114 | Bacteria | 2636 |
| 652 | Ga0373939_0239198 | 3300035114 | Bacteria | 702 |
| 653 | Ga0373941_0003262 | 3300035115 | Bacteria | 3659 |
| 654 | Ga0373941_0009030 | 3300035115 | Bacteria | 2498 |
| 655 | Ga0373941_0028147 | 3300035115 | Bacteria | 1647 |
| 656 | Ga0373941_0141682 | 3300035115 | Bacteria | 875 |
| 657 | Ga0373945_0056159 | 3300035116 | Bacteria | 1459 |
| 658 | Ga0373945_0096156 | 3300035116 | Bacteria | 1153 |
| 659 | Ga0373953_0010155 | 3300035117 | Bacteria | 3264 |
| 660 | Ga0373953_0066542 | 3300035117 | Bacteria | 1481 |
| 661 | Ga0373954_0015168 | 3300035118 | Bacteria | 3442 |
| 662 | Ga0373954_0037050 | 3300035118 | Bacteria | 2266 |
| 663 | Ga0373954_0037323 | 3300035118 | Bacteria | 2258 |
| 664 | Ga0373954_0037660 | 3300035118 | Bacteria | 2248 |
| 665 | Ga0373956_0005035 | 3300035119 | Bacteria | 5295 |
| 666 | Ga0373956_0036696 | 3300035119 | Bacteria | 2164 |
| 667 | Ga0373956_0076730 | 3300035119 | Bacteria | 1529 |
| 668 | Ga0373956_0483191 | 3300035119 | Bacteria | 591 |
| 669 | Ga0373957_0003814 | 3300035120 | Bacteria | 4518 |
| 670 | Ga0373957_0009661 | 3300035120 | Bacteria | 3162 |
| 671 | Ga0373957_0017846 | 3300035120 | Unclassified | 2478 |
| 672 | Ga0373957_0036433 | 3300035120 | Bacteria | 1833 |
| 673 | Ga0373960_0003326 | 3300035121 | Bacteria | 3638 |
| 674 | Ga0373960_0008439 | 3300035121 | Bacteria | 2468 |
| 675 | Ga0373960_0081624 | 3300035121 | Bacteria | 1019 |
| 676 | Ga0373943_0005971 | 3300035170 | Bacteria | 5464 |
| 677 | Ga0373943_0119066 | 3300035170 | Bacteria | 1401 |
| 678 | Ga0373946_0004752 | 3300035171 | Bacteria | 4884 |
| 679 | Ga0373946_0006500 | 3300035171 | Bacteria | 4239 |
| 680 | Ga0373946_0453148 | 3300035171 | Bacteria | 653 |
| 681 | Ga0373955_0005173 | 3300035172 | Bacteria | 5837 |
| 682 | Ga0373955_0007863 | 3300035172 | Bacteria | 4919 |
| 683 | Ga0373955_0517190 | 3300035172 | Bacteria | 729 |
| 684 | Ga0373942_0005209 | 3300035207 | Bacteria | 3012 |
| 685 | Ga0373942_0044827 | 3300035207 | Bacteria | 1219 |
| 686 | Ga0373961_0005123 | 3300035241 | Bacteria | 3152 |
| 687 | Ga0373961_0015491 | 3300035241 | Bacteria | 1950 |
| 688 | Ga0373962_0001573 | 3300035242 | Bacteria | 5412 |
| 689 | Ga0373962_0002923 | 3300035242 | Bacteria | 4098 |
| 690 | Ga0373962_0039205 | 3300035242 | Bacteria | 1328 |
| 691 | Ga0373962_0093379 | 3300035242 | Bacteria | 930 |
| 692 | Ga0373924_0120206 | 3300035410 | Unclassified | 1139 |
| 693 | Ga0373924_0125633 | 3300035410 | Bacteria | 1115 |
| 694 | Ga0373924_0127675 | 3300035410 | Bacteria | 1106 |
| 695 | Ga0373931_0000456 | 3300035691 | Bacteria | 16713 |
| 696 | Ga0373931_0001189 | 3300035691 | Bacteria | 11121 |
| 697 | Ga0373931_0118820 | 3300035691 | Bacteria | 1508 |
| 698 | Ga0373935_0030859 | 3300035692 | Bacteria | 3322 |
| 699 | Ga0373935_0053800 | 3300035692 | Bacteria | 2561 |
| 700 | Ga0373935_0250869 | 3300035692 | Bacteria | 1238 |
| 701 | Ga0373935_0365868 | 3300035692 | Bacteria | 1030 |
| 702 | Ga0373935_0895358 | 3300035692 | Bacteria | 657 |
| 703 | Ga0373927_0175896 | 3300035695 | Bacteria | 1403 |
| 704 | Ga0373927_0602911 | 3300035695 | Bacteria | 726 |
| 705 | Ga0373933_0002021 | 3300035724 | Bacteria | 11686 |
| 706 | Ga0373933_0016901 | 3300035724 | Bacteria | 4088 |
| 707 | Ga0373933_0105401 | 3300035724 | Bacteria | 1753 |
| 708 | Ga0373933_0138364 | 3300035724 | Bacteria | 1536 |
| 709 | Ga0373933_0139654 | 3300035724 | Bacteria | 1529 |
| 710 | Ga0373933_0149708 | 3300035724 | Bacteria | 1477 |
| 711 | Ga0373947_0006649 | 3300035725 | Bacteria | 6710 |
| 712 | Ga0373947_0049439 | 3300035725 | Bacteria | 2525 |
| 713 | Ga0373947_0347027 | 3300035725 | Bacteria | 995 |
| 714 | Ga0373937_0005606 | 3300036401 | Bacteria | 10776 |
| 715 | Ga0373937_0023398 | 3300036401 | Bacteria | 5562 |
| 716 | Ga0373937_0030734 | 3300036401 | Bacteria | 4864 |
| 717 | Ga0373937_0073482 | 3300036401 | Bacteria | 3154 |
| 718 | Ga0373937_0113516 | 3300036401 | Bacteria | 2521 |
| 719 | Ga0373937_0388481 | 3300036401 | Bacteria | 1324 |
| 720 | Ga0373937_0426103 | 3300036401 | Bacteria | 1259 |
| 721 | Ga0373937_0626511 | 3300036401 | Bacteria | 1021 |
| 722 | Ga0373925_0056668 | 3300037068 | Bacteria | 2936 |
| 723 | Ga0373925_0195252 | 3300037068 | Bacteria | 1607 |
| 724 | Ga0373925_0275903 | 3300037068 | Bacteria | 1353 |
| 725 | Ga0395900_0030019 | 3300037418 | Bacteria | 5580 |
| 726 | Ga0395898_0180867 | 3300037466 | Bacteria | 2015 |
| 727 | Ga0436364_0172918 | 3300037853 | Bacteria | 18712 |
| 728 | Ga0436364_0468701 | 3300037853 | Bacteria | 1275 |
| 729 | Ga0436364_1358998 | 3300037853 | Bacteria | 4177 |
| 730 | Ga0395901_0182002 | 3300038443 | Bacteria | 2204 |
| 731 | Ga0395901_0192454 | 3300038443 | Bacteria | 2139 |
| 732 | Ga0242420_023320 | 3300038996 | Bacteria | 1117 |
| 733 | Ga0436365_0186088 | 3300039437 | Bacteria | 757 |
| 734 | Ga0436365_0421649 | 3300039437 | Bacteria | 723 |
| 735 | Ga0436365_1250625 | 3300039437 | Unclassified | 950 |
| 736 | Ga0436365_1269348 | 3300039437 | Bacteria | 964 |
| 737 | Ga0436365_1327329 | 3300039437 | Bacteria | 1085 |
| 738 | Ga0436365_1848984 | 3300039437 | Bacteria | 1045 |
| 739 | Ga0436360_0296707 | 3300039438 | Bacteria | 4126 |
| 740 | Ga0436360_0342520 | 3300039438 | Bacteria | 1194 |
| 741 | Ga0436360_0697918 | 3300039438 | Bacteria | 2248 |
| 742 | Ga0436360_1048989 | 3300039438 | Unclassified | 1478 |
| 743 | Ga0436361_1180233 | 3300039447 | Bacteria | 1152 |
| 744 | Ga0436363_1365906 | 3300039450 | Unclassified | 1402 |
| 745 | Ga0436363_1699543 | 3300039450 | Unclassified | 750 |
| 746 | Ga0436362_0594923 | 3300039453 | Bacteria | 2496 |
| 747 | Ga0436362_0895477 | 3300039453 | Bacteria | 1876 |
| 748 | Ga0436362_0985321 | 3300039453 | Bacteria | 3046 |
| 749 | Ga0436362_1038513 | 3300039453 | Bacteria | 1553 |
| 750 | Ga0436362_1145440 | 3300039453 | Bacteria | 761 |
| 751 | Ga0439453_0036440 | 3300041408 | Bacteria | 951 |
| 752 | Ga0439448_0018354 | 3300042005 | Bacteria | 2143 |
| 753 | Ga0439460_0021984 | 3300042461 | Bacteria | 1747 |
| 754 | Ga0466963_0500664 | 3300044694 | Bacteria | 858 |
| 755 | Ga0453684_0159277 | 3300044712 | Bacteria | 2672 |
| 756 | Ga0466957_0438866 | 3300044842 | Bacteria | 898 |
| 757 | Ga0451576_0468538 | 3300045051 | Bacteria | 1323 |
| 758 | Ga0466967_0066717 | 3300045976 | Bacteria | 3207 |
| 759 | Ga0495592_0014180 | 3300046454 | Bacteria | 6056 |
| 760 | Ga0495592_0014723 | 3300046454 | Bacteria | 5939 |
| 761 | Ga0495592_0034688 | 3300046454 | Bacteria | 3802 |
| 762 | Ga0495592_0364409 | 3300046454 | Bacteria | 923 |
| 763 | Ga0495592_0684464 | 3300046454 | Unclassified | 618 |
| 764 | Ga0495603_0031400 | 3300046455 | Bacteria | 3197 |
| 765 | Ga0495603_0070882 | 3300046455 | Bacteria | 2048 |
| 766 | Ga0495603_0071470 | 3300046455 | Bacteria | 2039 |
| 767 | Ga0495629_0001083 | 3300046459 | Bacteria | 21626 |
| 768 | Ga0495629_0039078 | 3300046459 | Bacteria | 3340 |
| 769 | Ga0495638_0333984 | 3300046460 | Bacteria | 805 |
| 770 | Ga0495641_0010963 | 3300046461 | Bacteria | 5204 |
| 771 | Ga0495641_0071353 | 3300046461 | Bacteria | 1559 |
| 772 | Ga0495641_0112010 | 3300046461 | Bacteria | 1217 |
| 773 | Ga0495651_0078923 | 3300046462 | Bacteria | 2489 |
| 774 | Ga0495651_0188928 | 3300046462 | Bacteria | 1451 |
| 775 | Ga0495651_0194694 | 3300046462 | Bacteria | 1423 |
| 776 | Ga0495653_0035586 | 3300046463 | Bacteria | 3928 |
| 777 | Ga0495653_0052046 | 3300046463 | Bacteria | 3140 |
| 778 | Ga0495653_0055919 | 3300046463 | Bacteria | 3010 |
| 779 | Ga0495653_0727090 | 3300046463 | Unclassified | 601 |
| 780 | Ga0495580_0052480 | 3300046472 | Bacteria | 2879 |
| 781 | Ga0495580_0068596 | 3300046472 | Bacteria | 2479 |
| 782 | Ga0495582_0008478 | 3300046473 | Bacteria | 5671 |
| 783 | Ga0495582_0048374 | 3300046473 | Bacteria | 2341 |
| 784 | Ga0495639_0012788 | 3300046475 | Bacteria | 3621 |
| 785 | Ga0495639_0037629 | 3300046475 | Bacteria | 2169 |
| 786 | Ga0495662_0017471 | 3300046476 | Bacteria | 3471 |
| 787 | Ga0495664_0008862 | 3300046477 | Bacteria | 5621 |
| 788 | Ga0495664_0141932 | 3300046477 | Bacteria | 1456 |
| 789 | Ga0495664_0323053 | 3300046477 | Bacteria | 930 |
| 790 | Ga0495584_0497292 | 3300046491 | Unclassified | 621 |
| 791 | Ga0495585_0017542 | 3300046492 | Bacteria | 4135 |
| 792 | Ga0495594_0028091 | 3300046499 | Bacteria | 3034 |
| 793 | Ga0495594_0070962 | 3300046499 | Bacteria | 1936 |
| 794 | Ga0495607_0038290 | 3300046501 | Bacteria | 2873 |
| 795 | Ga0495583_0289549 | 3300046506 | Bacteria | 652 |
| 796 | Ga0495608_0025074 | 3300046511 | Bacteria | 4072 |
| 797 | Ga0495608_0115130 | 3300046511 | Bacteria | 1726 |
| 798 | Ga0495608_0151331 | 3300046511 | Bacteria | 1478 |
| 799 | Ga0495608_0430839 | 3300046511 | Bacteria | 804 |
| 800 | Ga0495616_0272769 | 3300046513 | Unclassified | 721 |
| 801 | Ga0495618_0006625 | 3300046514 | Bacteria | 7020 |
| 802 | Ga0495618_0046556 | 3300046514 | Bacteria | 2737 |
| 803 | Ga0495628_0123271 | 3300046516 | Bacteria | 1986 |
| 804 | Ga0495628_0192253 | 3300046516 | Bacteria | 1540 |
| 805 | Ga0495630_0016770 | 3300046517 | Bacteria | 5359 |
| 806 | Ga0495630_0066890 | 3300046517 | Bacteria | 2701 |
| 807 | Ga0495644_0007689 | 3300046523 | Bacteria | 4156 |
| 808 | Ga0495666_0020697 | 3300046526 | Bacteria | 3257 |
| 809 | Ga0495652_0083034 | 3300046529 | Bacteria | 2638 |
| 810 | Ga0495652_0156496 | 3300046529 | Bacteria | 1774 |
| 811 | Ga0495652_0229539 | 3300046529 | Bacteria | 1389 |
| 812 | Ga0495665_0016353 | 3300046531 | Bacteria | 3998 |
| 813 | Ga0495640_0060069 | 3300046533 | Bacteria | 2586 |
| 814 | Ga0495640_0083163 | 3300046533 | Bacteria | 2124 |
| 815 | Ga0495640_0407473 | 3300046533 | Bacteria | 834 |
| 816 | Ga0495586_0062944 | 3300046535 | Bacteria | 2020 |
| 817 | Ga0495586_0121495 | 3300046535 | Bacteria | 1459 |
| 818 | Ga0495587_0032403 | 3300046536 | Bacteria | 3160 |
| 819 | Ga0495587_0041143 | 3300046536 | Bacteria | 2758 |
| 820 | Ga0495587_0051587 | 3300046536 | Bacteria | 2431 |
| 821 | Ga0495598_0023053 | 3300046537 | Bacteria | 1672 |
| 822 | Ga0495645_0047821 | 3300046543 | Bacteria | 3116 |
| 823 | Ga0495645_0106395 | 3300046543 | Bacteria | 1989 |
| 824 | Ga0495622_0018549 | 3300046557 | Bacteria | 3241 |
| 825 | Ga0495667_0017147 | 3300046559 | Bacteria | 4891 |
| 826 | Ga0495667_0024353 | 3300046559 | Bacteria | 4076 |
| 827 | Ga0495667_0031146 | 3300046559 | Bacteria | 3581 |
| 828 | Ga0495667_0036511 | 3300046559 | Bacteria | 3280 |
| 829 | Ga0495667_0042796 | 3300046559 | Bacteria | 3003 |
| 830 | Ga0495634_0043965 | 3300046642 | Bacteria | 3026 |
| 831 | Ga0495634_0054684 | 3300046642 | Bacteria | 2670 |
| 832 | Ga0495611_0129987 | 3300046648 | Bacteria | 1174 |
| 833 | Ga0495635_0090219 | 3300046663 | Bacteria | 2096 |
| 834 | Ga0495635_0262941 | 3300046663 | Bacteria | 1162 |
| 835 | Ga0495659_0010862 | 3300046664 | Bacteria | 2931 |
| 836 | Ga0495657_0004474 | 3300046675 | Bacteria | 11174 |
| 837 | Ga0495657_0097325 | 3300046675 | Bacteria | 1879 |
| 838 | Ga0495657_0199419 | 3300046675 | Bacteria | 1220 |
| 839 | Ga0495599_0072874 | 3300046678 | Bacteria | 2143 |
| 840 | Ga0495599_0102840 | 3300046678 | Bacteria | 1780 |
| 841 | Ga0495599_0215668 | 3300046678 | Bacteria | 1175 |
| 842 | Ga0495623_0037694 | 3300046679 | Bacteria | 3092 |
| 843 | Ga0495646_0035965 | 3300046680 | Bacteria | 3069 |
| 844 | Ga0495646_0136543 | 3300046680 | Bacteria | 1375 |
| 845 | Ga0495647_0007965 | 3300046681 | Bacteria | 3561 |
| 846 | Ga0495647_0009359 | 3300046681 | Bacteria | 3317 |
| 847 | Ga0495647_0190726 | 3300046681 | Bacteria | 895 |
| 848 | Ga0495658_0000657 | 3300046683 | Bacteria | 18752 |
| 849 | Ga0495658_0041696 | 3300046683 | Bacteria | 2559 |
| 850 | Ga0495658_0049728 | 3300046683 | Bacteria | 2368 |
| 851 | Ga0495658_0063602 | 3300046683 | Bacteria | 2123 |
| 852 | Ga0495669_0298046 | 3300046684 | Bacteria | 777 |
| 853 | Ga0495613_0027530 | 3300046689 | Bacteria | 4230 |
| 854 | Ga0495613_0056832 | 3300046689 | Bacteria | 2873 |
| 855 | Ga0495624_0010273 | 3300046690 | Bacteria | 6451 |
| 856 | Ga0495670_0005981 | 3300046691 | Bacteria | 5959 |
| 857 | Ga0495671_0251470 | 3300046692 | Bacteria | 853 |
| 858 | Ga0495600_0036766 | 3300046809 | Bacteria | 3182 |
| 859 | Ga0495600_0070247 | 3300046809 | Bacteria | 2288 |
| 860 | Ga0495600_0075100 | 3300046809 | Bacteria | 2207 |
| 861 | Ga0495581_0024119 | 3300047315 | Bacteria | 3524 |
| 862 | Ga0495581_0038908 | 3300047315 | Bacteria | 2753 |
| 863 | Ga0495604_0023975 | 3300047317 | Bacteria | 4870 |
| 864 | Ga0495604_0032475 | 3300047317 | Bacteria | 4136 |
| 865 | Ga0495604_0129670 | 3300047317 | Bacteria | 1814 |
| 866 | Ga0495604_0336133 | 3300047317 | Bacteria | 1006 |
| 867 | Ga0495604_0524695 | 3300047317 | Bacteria | 766 |
| 868 | Ga0495674_0048828 | 3300047319 | Bacteria | 3742 |
| 869 | Ga0495674_0328938 | 3300047319 | Bacteria | 1243 |
| 870 | Ga0495676_0151527 | 3300047321 | Bacteria | 1649 |
| 871 | Ga0495676_0187399 | 3300047321 | Bacteria | 1445 |
| 872 | Ga0495680_0011464 | 3300047322 | Bacteria | 7847 |
| 873 | Ga0495680_0015033 | 3300047322 | Bacteria | 6685 |
| 874 | Ga0495680_0027040 | 3300047322 | Bacteria | 4720 |
| 875 | Ga0495680_0133289 | 3300047322 | Bacteria | 1823 |
| 876 | Ga0495680_0328229 | 3300047322 | Bacteria | 1069 |
| 877 | Ga0495675_0125936 | 3300047444 | Bacteria | 1594 |
| 878 | Ga0495675_0231718 | 3300047444 | Bacteria | 1114 |
| 879 | Ga0495677_0160348 | 3300047445 | Bacteria | 868 |
| 880 | Ga0495677_0203376 | 3300047445 | Bacteria | 770 |
| 881 | Ga0495679_085464 | 3300047446 | Bacteria | 891 |
| 882 | Ga0495681_0182685 | 3300047470 | Bacteria | 861 |
| 883 | Ga0495684_0064317 | 3300047471 | Bacteria | 2787 |
| 884 | Ga0495684_0107787 | 3300047471 | Bacteria | 2104 |
| 885 | Ga0495684_0127401 | 3300047471 | Bacteria | 1915 |
| 886 | Ga0495684_0515967 | 3300047471 | Bacteria | 819 |
| 887 | Ga0495686_0002628 | 3300047472 | Bacteria | 16632 |
| 888 | Ga0495593_0015003 | 3300047673 | Bacteria | 4400 |
| 889 | Ga0495593_0047421 | 3300047673 | Bacteria | 2285 |
| 890 | Ga0495593_0083154 | 3300047673 | Bacteria | 1654 |
| 891 | Ga0495602_0067594 | 3300048088 | Bacteria | 3074 |
| 892 | Ga0495602_0075417 | 3300048088 | Bacteria | 2862 |
| 893 | Ga0495602_0118134 | 3300048088 | Bacteria | 2139 |
| 894 | Ga0495602_0458491 | 3300048088 | Bacteria | 898 |
| 895 | Ga0496100_0043390 | 3300048903 | Bacteria | 2875 |
| 896 | Ga0496100_0093381 | 3300048903 | Bacteria | 2058 |
| 897 | Ga0496100_0723402 | 3300048903 | Bacteria | 777 |
| 898 | Ga0496101_0039951 | 3300048904 | Bacteria | 3340 |
| 899 | Ga0496101_0790244 | 3300048904 | Bacteria | 748 |
| 900 | Ga0496102_0120761 | 3300048905 | Bacteria | 2447 |
| 901 | Ga0496102_0146137 | 3300048905 | Bacteria | 2219 |
| 902 | Ga0496102_0203808 | 3300048905 | Bacteria | 1864 |
| 903 | Ga0496102_0263614 | 3300048905 | Bacteria | 1624 |
| 904 | Ga0496102_0345265 | 3300048905 | Bacteria | 1401 |
| 905 | Ga0496102_1108427 | 3300048905 | Bacteria | 711 |
| 906 | Ga0496103_0032545 | 3300048906 | Bacteria | 3182 |
| 907 | Ga0496103_0134740 | 3300048906 | Bacteria | 1578 |
| 908 | Ga0496104_0001026 | 3300048907 | Bacteria | 23907 |
| 909 | Ga0496104_0084764 | 3300048907 | Bacteria | 3024 |
| 910 | Ga0496104_0161480 | 3300048907 | Bacteria | 2149 |
| 911 | Ga0496104_0410381 | 3300048907 | Bacteria | 1267 |
| 912 | Ga0496105_0048461 | 3300048908 | Bacteria | 3506 |
| 913 | Ga0496105_0063288 | 3300048908 | Bacteria | 3052 |
| 914 | Ga0496105_0114002 | 3300048908 | Bacteria | 2229 |
| 915 | Ga0496105_0273257 | 3300048908 | Bacteria | 1364 |
| 916 | Ga0496105_0588876 | 3300048908 | Bacteria | 864 |
| 917 | Ga0496106_0077045 | 3300048909 | Bacteria | 2556 |
| 918 | Ga0496106_0147132 | 3300048909 | Bacteria | 1856 |
| 919 | Ga0496106_0179245 | 3300048909 | Bacteria | 1681 |
| 920 | Ga0496106_0777419 | 3300048909 | Bacteria | 760 |
| 921 | Ga0496106_1481587 | 3300048909 | Bacteria | 522 |
| 922 | Ga0496107_0010208 | 3300048910 | Bacteria | 6515 |
| 923 | Ga0496107_0012830 | 3300048910 | Bacteria | 5856 |
| 924 | Ga0496107_0079757 | 3300048910 | Bacteria | 2386 |
| 925 | Ga0496108_0038783 | 3300048911 | Bacteria | 3969 |
| 926 | Ga0496108_0051869 | 3300048911 | Bacteria | 3436 |
| 927 | Ga0496108_0108553 | 3300048911 | Bacteria | 2371 |
| 928 | Ga0496108_0110196 | 3300048911 | Bacteria | 2353 |
| 929 | Ga0496109_0000211 | 3300048912 | Bacteria | 57066 |
| 930 | Ga0496109_0005410 | 3300048912 | Bacteria | 10678 |
| 931 | Ga0496109_0210473 | 3300048912 | Bacteria | 1829 |
| 932 | Ga0496109_0247786 | 3300048912 | Bacteria | 1677 |
| 933 | Ga0496109_0339553 | 3300048912 | Bacteria | 1418 |
| 934 | Ga0496110_0029267 | 3300048913 | Bacteria | 4739 |
| 935 | Ga0496110_0112176 | 3300048913 | Bacteria | 2451 |
| 936 | Ga0496110_0170330 | 3300048913 | Bacteria | 1975 |
| 937 | Ga0496110_0197748 | 3300048913 | Bacteria | 1826 |
| 938 | Ga0496110_1148489 | 3300048913 | Bacteria | 685 |
| 939 | Ga0496111_0057100 | 3300048914 | Bacteria | 2825 |
| 940 | Ga0496111_0127848 | 3300048914 | Bacteria | 1879 |
| 941 | Ga0496112_0018318 | 3300048915 | Bacteria | 6592 |
| 942 | Ga0496112_0029842 | 3300048915 | Bacteria | 5275 |
| 943 | Ga0496112_0171079 | 3300048915 | Bacteria | 2137 |
| 944 | Ga0496113_0070215 | 3300048916 | Bacteria | 2662 |
| 945 | Ga0496113_0086591 | 3300048916 | Bacteria | 2407 |
| 946 | Ga0496113_0158489 | 3300048916 | Bacteria | 1788 |
| 947 | Ga0496113_0222427 | 3300048916 | Bacteria | 1504 |
| 948 | Ga0496113_0240647 | 3300048916 | Bacteria | 1444 |
| 949 | Ga0496113_0267699 | 3300048916 | Bacteria | 1365 |
| 950 | Ga0496114_0012331 | 3300048917 | Bacteria | 6840 |
| 951 | Ga0496114_0250164 | 3300048917 | Bacteria | 1559 |
| 952 | Ga0496114_1213138 | 3300048917 | Bacteria | 641 |
| 953 | Ga0496115_0020154 | 3300048918 | Bacteria | 5140 |
| 954 | Ga0496115_0134879 | 3300048918 | Bacteria | 2035 |
| 955 | Ga0496115_0166033 | 3300048918 | Bacteria | 1825 |
| 956 | Ga0496115_0288086 | 3300048918 | Bacteria | 1347 |
| 957 | Ga0496115_0489547 | 3300048918 | Bacteria | 989 |
| 958 | Ga0496115_0601490 | 3300048918 | Bacteria | 874 |
| 959 | Ga0501038_0540985 | 3300049574 | Bacteria | 887 |
| 960 | Ga0501042_0912024 | 3300049578 | Bacteria | 640 |
| 961 | Ga0501067_0461755 | 3300049583 | Bacteria | 709 |
| 962 | Ga0501071_0547108 | 3300049587 | Bacteria | 889 |
| 963 | Ga0501071_0992080 | 3300049587 | Bacteria | 649 |
| 964 | Ga0501072_0763662 | 3300049588 | Bacteria | 758 |
| 965 | Ga0501073_0136552 | 3300049589 | Bacteria | 1700 |
| 966 | Ga0501075_0863376 | 3300049591 | Bacteria | 688 |
| 967 | Ga0501076_0493485 | 3300049592 | Bacteria | 1009 |
| 968 | Ga0501077_0060241 | 3300049593 | Bacteria | 2409 |
| 969 | Ga0501077_0226068 | 3300049593 | Bacteria | 1190 |
| 970 | Ga0501079_0315950 | 3300049741 | Bacteria | 1223 |
| 971 | Ga0501079_0325269 | 3300049741 | Bacteria | 1204 |
| 972 | Ga0501081_0220178 | 3300049743 | Bacteria | 1380 |
| 973 | Ga0501081_0307836 | 3300049743 | Bacteria | 1163 |
| 974 | Ga0501044_0916031 | 3300049823 | Unclassified | 751 |
| 975 | Ga0501044_1015906 | 3300049823 | Bacteria | 701 |
| 976 | Ga0501045_0542706 | 3300049824 | Bacteria | 863 |
| 977 | nmdc:mga03683_22960_c1 | 3300050489 | Bacteria | 2424 |
| 978 | nmdc:mga03683_299330_c1 | 3300050489 | Bacteria | 754 |
| 979 | nmdc:mga03683_8800_c1 | 3300050489 | Bacteria | 3563 |
| 980 | nmdc:mga03n38_20921_c1 | 3300050490 | Bacteria | 2625 |
| 981 | nmdc:mga03n38_216203_c1 | 3300050490 | Bacteria | 998 |
| 982 | nmdc:mga00v17_461330_c1 | 3300050491 | Bacteria | 824 |
| 983 | nmdc:mga0yw44_891729_c1 | 3300050492 | Bacteria | 603 |
| 984 | nmdc:mga0k408_15938_c1 | 3300050493 | Bacteria | 2480 |
| 985 | nmdc:mga0k408_3337_c2 | 3300050493 | Bacteria | 7320 |
| 986 | nmdc:mga06z11_50594_c1 | 3300050494 | Bacteria | 2124 |
| 987 | nmdc:mga06z11_62736_c1 | 3300050494 | Bacteria | 1942 |
| 988 | nmdc:mga04h51_6758_c1 | 3300050495 | Bacteria | 2994 |
| 989 | nmdc:mga07m45_223270_c1 | 3300050496 | Bacteria | 1096 |
| 990 | nmdc:mga07m45_49013_c1 | 3300050496 | Bacteria | 2376 |
| 991 | nmdc:mga05p37_12232_c1 | 3300050507 | Bacteria | 10248 |
| 992 | nmdc:mga05p37_88924_c1 | 3300050507 | Bacteria | 3807 |
| 993 | nmdc:mga09592_2014_c1 | 3300050508 | Bacteria | 16388 |
| 994 | nmdc:mga0qj67_853_c1 | 3300050509 | Bacteria | 20926 |
| 995 | nmdc:mga06r32_2147_c1 | 3300050510 | Bacteria | 17624 |
| 996 | nmdc:mga08y16_115404_c1 | 3300050511 | Bacteria | 2796 |
| 997 | nmdc:mga08y16_2382_c1 | 3300050511 | Bacteria | 19292 |
| 998 | nmdc:mga08y16_34723_c1 | 3300050511 | Bacteria | 5299 |
| 999 | nmdc:mga0n895_108615_c1 | 3300050512 | Bacteria | 2789 |
| 1000 | nmdc:mga0n895_171_c1 | 3300050512 | Bacteria | 40104 |
| 1001 | nmdc:mga0n895_198042_c1 | 3300050512 | Bacteria | 2040 |
| 1002 | nmdc:mga0n895_605_c1 | 3300050512 | Bacteria | 24828 |
| 1003 | nmdc:mga0n895_60719_c1 | 3300050512 | Bacteria | 3731 |
| 1004 | nmdc:mga0n895_616853_c1 | 3300050512 | Bacteria | 1086 |
| 1005 | nmdc:mga0n895_6888_c1 | 3300050512 | Bacteria | 9709 |
| 1006 | nmdc:mga0rr50_227_c1 | 3300050513 | Bacteria | 30396 |
| 1007 | nmdc:mga0rr50_372592_c1 | 3300050513 | Bacteria | 1203 |
| 1008 | nmdc:mga0rr50_410553_c1 | 3300050513 | Bacteria | 1145 |
| 1009 | nmdc:mga0rr50_92072_c1 | 3300050513 | Bacteria | 2363 |
| 1010 | nmdc:mga08x19_279968_c1 | 3300050514 | Bacteria | 1155 |
| 1011 | nmdc:mga08x19_295907_c1 | 3300050514 | Bacteria | 1124 |
| 1012 | nmdc:mga0a205_6279_c1 | 3300050515 | Bacteria | 10728 |
| 1013 | nmdc:mga0a205_650646_c1 | 3300050515 | Bacteria | 905 |
| 1014 | Ga0495601_0002332 | 3300053077 | Bacteria | 10741 |
| 1015 | Ga0495601_0042033 | 3300053077 | Bacteria | 2866 |
| 1016 | Ga0495601_0050228 | 3300053077 | Bacteria | 2630 |
| 1017 | Ga0495601_0061603 | 3300053077 | Bacteria | 2381 |
| 1018 | Ga0495601_0068681 | 3300053077 | Bacteria | 2259 |
| 1019 | Ga0495601_0071170 | 3300053077 | Bacteria | 2221 |
| 1020 | Ga0495601_0257013 | 3300053077 | Bacteria | 1140 |
| 1021 | Ga0495612_0002302 | 3300053078 | Bacteria | 7865 |
| 1022 | Ga0495612_0008576 | 3300053078 | Bacteria | 4145 |
| 1023 | Ga0495612_0023184 | 3300053078 | Bacteria | 2489 |
| 1024 | Ga0495612_0025709 | 3300053078 | Bacteria | 2364 |
| 1025 | Ga0495612_0087164 | 3300053078 | Bacteria | 1317 |
| 1026 | Ga0495612_0126728 | 3300053078 | Bacteria | 1101 |
| 1027 | Ga0495595_0008233 | 3300053084 | Bacteria | 4281 |
| 1028 | Ga0495595_0010670 | 3300053084 | Bacteria | 3824 |
| 1029 | Ga0495595_0018944 | 3300053084 | Bacteria | 2980 |
| 1030 | Ga0495595_0023442 | 3300053084 | Bacteria | 2717 |
| 1031 | Ga0495595_0118497 | 3300053084 | Bacteria | 1288 |
| 1032 | Ga0495595_0120075 | 3300053084 | Unclassified | 1280 |
| 1033 | Ga0495595_0276122 | 3300053084 | Bacteria | 843 |
| 1034 | Ga0495595_0354363 | 3300053084 | Bacteria | 741 |
| 1035 | Ga0495619_0000105 | 3300053085 | Bacteria | 62599 |
| 1036 | Ga0495619_0000826 | 3300053085 | Bacteria | 20303 |
| 1037 | Ga0495619_0007484 | 3300053085 | Bacteria | 6916 |
| 1038 | Ga0495619_0012732 | 3300053085 | Bacteria | 5293 |
| 1039 | Ga0495619_0052120 | 3300053085 | Bacteria | 2704 |
| 1040 | Ga0495619_0108886 | 3300053085 | Bacteria | 1891 |
| 1041 | Ga0495619_0164419 | 3300053085 | Bacteria | 1533 |
| 1042 | Ga0500578_0288828 | 3300053086 | Bacteria | 976 |
| 1043 | Ga0500643_015685 | 3300053087 | Bacteria | 2589 |
| 1044 | Ga0500644_0002887 | 3300053088 | Bacteria | 4267 |
| 1045 | Ga0500651_0012416 | 3300053093 | Bacteria | 5165 |
| 1046 | Ga0500566_0068402 | 3300053094 | Bacteria | 1997 |
| 1047 | Ga0500566_0204223 | 3300053094 | Unclassified | 995 |
| 1048 | Ga0500641_0000586 | 3300053096 | Bacteria | 13113 |
| 1049 | Ga0500650_0019903 | 3300053098 | Bacteria | 2937 |
| 1050 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 1051 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1052 | Ga0500616_0003550 | 3300053153 | Bacteria | 11819 |
| 1053 | Ga0500645_000563 | 3300053730 | Bacteria | 24381 |
| 1054 | Ga0501084_0068279 | 3300054114 | Bacteria | 2976 |
| 1055 | Ga0501082_0116497 | 3300060353 | Bacteria | 2314 |
| 1056 | Ga0530510_0146007 | 3300061734 | Bacteria | 1745 |
| 1057 | 2643774441 | 2643221551 | Bacteria | 3750538 |
| 1058 | 2643792886 | 2643221555 | Bacteria | 3749717 |
| 1059 | Ga0207692_10314733 | |||
| 1060 | ARcpr5oldR_c001102 | |||
| 1061 | ARSoilYngRDRAFT_c01134 | |||
| 1062 | ARSoilOldRDRAFT_c000194 | |||
| 1063 | ARCol0yngRDRAFT_1000833 | |||
| 1064 | JGI24032J14994_101065 | |||
| 1065 | JGI24746J21847_1000495 | |||
| 1066 | JGI24747J21853_1001963 | |||
| 1067 | JGI24739J22299_10001299 | |||
| 1068 | JGI24750J21931_1000493 | |||
| 1069 | JGI24748J21848_1004930 | |||
| 1070 | JGI24738J21930_10000506 | |||
| 1071 | JGI24749J21850_1001158 | |||
| 1072 | JGI24744J21845_10027423 | |||
| 1073 | JGI24034J26672_10008361 | |||
| 1074 | JGI24742J22300_10003727 | |||
| 1075 | JGI24751J29686_10039380 | |||
| 1076 | JGI26145J50221_1006328 | |||
| 1077 | Ga0065712_10072710 | |||
| 1078 | Ga0065712_10244275 | |||
| 1079 | Ga0065715_10004320 | |||
| 1080 | Ga0065715_10037744 | |||
| 1081 | Ga0070658_10009108 | |||
| 1082 | Ga0070676_10016795 | |||
| 1083 | Ga0070676_11079621 | |||
| 1084 | Ga0070683_100003556 | |||
| 1085 | Ga0070683_100148983 | |||
| 1086 | Ga0070683_100399368 | |||
| 1087 | Ga0070690_100017989 | |||
| 1088 | Ga0070690_100176509 | |||
| 1089 | Ga0070690_100245782 | |||
| 1090 | Ga0070690_100291265 | |||
| 1091 | Ga0070690_100522901 | |||
| 1092 | Ga0070670_100008291 | |||
| 1093 | Ga0070670_100374034 | |||
| 1094 | Ga0070670_100592443 | |||
| 1095 | Ga0070670_100861511 | |||
| 1096 | Ga0070677_10004318 | |||
| 1097 | Ga0068869_100001645 | |||
| 1098 | Ga0068869_100083099 | |||
| 1099 | Ga0068869_100359195 | |||
| 1100 | Ga0070666_10021722 | |||
| 1101 | Ga0070666_10259398 | |||
| 1102 | Ga0070666_10964258 | |||
| 1103 | Ga0070680_100001406 | |||
| 1104 | Ga0070680_100007032 | |||
| 1105 | Ga0070680_100102341 | |||
| 1106 | Ga0070680_100233386 | |||
| 1107 | Ga0070680_100593317 | |||
| 1108 | Ga0070682_100013294 | |||
| 1109 | Ga0070682_100021362 | |||
| 1110 | Ga0070682_100116347 | |||
| 1111 | Ga0068868_100008818 | |||
| 1112 | Ga0068868_100308577 | |||
| 1113 | Ga0070660_100005193 | |||
| 1114 | Ga0070660_100375820 | |||
| 1115 | Ga0070660_100724508 | |||
| 1116 | Ga0070689_100008604 | |||
| 1117 | Ga0070689_100075116 | |||
| 1118 | Ga0070689_100153068 | |||
| 1119 | Ga0070689_100460351 | |||
| 1120 | Ga0070689_100558865 | |||
| 1121 | Ga0070691_10003570 | |||
| 1122 | Ga0070691_10069685 | |||
| 1123 | Ga0070687_100000814 | |||
| 1124 | Ga0070687_100068757 | |||
| 1125 | Ga0070661_100025170 | |||
| 1126 | Ga0070661_100396884 | |||
| 1127 | Ga0070661_100999666 | |||
| 1128 | Ga0070692_10033441 | |||
| 1129 | Ga0070668_100000327 | |||
| 1130 | Ga0070668_100090356 | |||
| 1131 | Ga0070668_100805716 | |||
| 1132 | Ga0070669_100004627 | |||
| 1133 | Ga0070669_100059577 | |||
| 1134 | Ga0070675_100000633 | |||
| 1135 | Ga0070675_100159505 | |||
| 1136 | Ga0070671_100000738 | |||
| 1137 | Ga0070671_100047745 | |||
| 1138 | Ga0070671_100609623 | |||
| 1139 | Ga0070674_100000211 | |||
| 1140 | Ga0070674_100093560 | |||
| 1141 | Ga0070674_100455324 | |||
| 1142 | Ga0070674_100542380 | |||
| 1143 | Ga0070673_100000736 | |||
| 1144 | Ga0070673_100027886 | |||
| 1145 | Ga0070673_100073956 | |||
| 1146 | Ga0070673_101177616 | |||
| 1147 | Ga0070688_100012623 | |||
| 1148 | Ga0070688_100050586 | |||
| 1149 | Ga0070688_100091180 | |||
| 1150 | Ga0070688_100368035 | |||
| 1151 | Ga0070659_100000508 | |||
| 1152 | Ga0070659_100229903 | |||
| 1153 | Ga0070667_100006728 | |||
| 1154 | Ga0070667_101514449 | |||
| 1155 | Ga0070703_10003437 | |||
| 1156 | Ga0070703_10076684 | |||
| 1157 | Ga0070709_10014167 | |||
| 1158 | Ga0070709_10051924 | |||
| 1159 | Ga0070714_100035933 | |||
| 1160 | Ga0070714_100094771 | |||
| 1161 | Ga0070714_100226224 | |||
| 1162 | Ga0070713_100013021 | |||
| 1163 | Ga0070713_100100376 | |||
| 1164 | Ga0070713_100158839 | |||
| 1165 | Ga0070713_100287315 | |||
| 1166 | Ga0070713_100880141 | |||
| 1167 | Ga0070713_101100363 | |||
| 1168 | Ga0070713_101254063 | |||
| 1169 | Ga0070710_10003802 | |||
| 1170 | Ga0070710_10021231 | |||
| 1171 | Ga0070710_10666680 | |||
| 1172 | Ga0070701_10001645 | |||
| 1173 | Ga0070701_11142013 | |||
| 1174 | Ga0070711_100333180 | |||
| 1175 | Ga0070711_100733695 | |||
| 1176 | Ga0070705_100342912 | |||
| 1177 | Ga0070700_100002387 | |||
| 1178 | Ga0070700_100179619 | |||
| 1179 | Ga0070700_100203976 | |||
| 1180 | Ga0070700_100252850 | |||
| 1181 | Ga0070694_100002705 | |||
| 1182 | Ga0070694_100022727 | |||
| 1183 | Ga0070708_100174330 | |||
| 1184 | Ga0070708_101915286 | |||
| 1185 | Ga0070663_100000815 | |||
| 1186 | Ga0070663_100055426 | |||
| 1187 | Ga0070663_100514866 | |||
| 1188 | Ga0070663_100901845 | |||
| 1189 | Ga0070678_100055998 | |||
| 1190 | Ga0070678_100123520 | |||
| 1191 | Ga0070662_100009625 | |||
| 1192 | Ga0070662_100137798 | |||
| 1193 | Ga0070681_10015221 | |||
| 1194 | Ga0070681_10037495 | |||
| 1195 | Ga0070681_10038319 | |||
| 1196 | Ga0070681_10138771 | |||
| 1197 | Ga0070681_10145327 | |||
| 1198 | Ga0070681_10648698 | |||
| 1199 | Ga0068867_100000652 | |||
| 1200 | Ga0070685_10003090 | |||
| 1201 | Ga0070685_10004123 | |||
| 1202 | Ga0070685_10105700 | |||
| 1203 | Ga0070706_100070387 | |||
| 1204 | Ga0070706_100101892 | |||
| 1205 | Ga0070706_101420975 | |||
| 1206 | Ga0070707_100706268 | |||
| 1207 | Ga0070698_100027073 | |||
| 1208 | Ga0070698_100536019 | |||
| 1209 | Ga0070699_100040041 | |||
| 1210 | Ga0070699_100671763 | |||
| 1211 | Ga0070699_101053391 | |||
| 1212 | Ga0070679_100021378 | |||
| 1213 | Ga0070679_100031573 | |||
| 1214 | Ga0070679_100134342 | |||
| 1215 | Ga0070679_100180329 | |||
| 1216 | Ga0070679_100725618 | |||
| 1217 | Ga0070684_100009390 | |||
| 1218 | Ga0070684_100121428 | |||
| 1219 | Ga0070684_100553272 | |||
| 1220 | Ga0070684_101171120 | |||
| 1221 | Ga0070697_100132293 | |||
| 1222 | Ga0070697_100206403 | |||
| 1223 | Ga0070697_100411036 | |||
| 1224 | Ga0070697_100782223 | |||
| 1225 | Ga0068853_100033052 | |||
| 1226 | Ga0070672_100010446 | |||
| 1227 | Ga0070672_100159788 | |||
| 1228 | Ga0070672_100284181 | |||
| 1229 | Ga0070686_100005337 | |||
| 1230 | Ga0070686_100019247 | |||
| 1231 | Ga0070686_100207680 | |||
| 1232 | Ga0070686_101699220 | |||
| 1233 | Ga0070695_100000791 | |||
| 1234 | Ga0070695_100254442 | |||
| 1235 | Ga0070696_100031267 | |||
| 1236 | Ga0070696_100097449 | |||
| 1237 | Ga0070696_100183889 | |||
| 1238 | Ga0070696_100434966 | |||
| 1239 | Ga0070696_100586564 | |||
| 1240 | Ga0070693_100010016 | |||
| 1241 | Ga0070665_100073390 | |||
| 1242 | Ga0070665_100375699 | |||
| 1243 | Ga0070665_101826270 | |||
| 1244 | Ga0070704_100026728 | |||
| 1245 | Ga0068855_100041815 | |||
| 1246 | Ga0068855_100051893 | |||
| 1247 | Ga0068855_101104328 | |||
| 1248 | Ga0070664_100002092 | |||
| 1249 | Ga0070664_100055051 | |||
| 1250 | Ga0070664_100090607 | |||
| 1251 | Ga0070664_100213516 | |||
| 1252 | Ga0070664_100290706 | |||
| 1253 | Ga0070664_101384584 | |||
| 1254 | Ga0068857_100014842 | |||
| 1255 | Ga0068857_100120910 | |||
| 1256 | Ga0068854_100013287 | |||
| 1257 | Ga0068856_100012787 | |||
| 1258 | Ga0068856_100297558 | |||
| 1259 | Ga0070702_100000664 | |||
| 1260 | Ga0070702_100717620 | |||
| 1261 | Ga0068852_100088794 | |||
| 1262 | Ga0068852_100685592 | |||
| 1263 | Ga0068859_100021689 | |||
| 1264 | Ga0068859_100062548 | |||
| 1265 | Ga0068859_100078290 | |||
| 1266 | Ga0068864_100029489 | |||
| 1267 | Ga0068866_10013065 | |||
| 1268 | Ga0068866_10132425 | |||
| 1269 | Ga0068861_100086909 | |||
| 1270 | Ga0068861_100254322 | |||
| 1271 | Ga0068851_10655512 | |||
| 1272 | Ga0068870_10001203 | |||
| 1273 | Ga0068870_10247364 | |||
| 1274 | Ga0068870_10512045 | |||
| 1275 | Ga0068863_100001709 | |||
| 1276 | Ga0068863_100173074 | |||
| 1277 | Ga0068863_100340115 | |||
| 1278 | Ga0068863_100399671 | |||
| 1279 | Ga0068858_100006236 | |||
| 1280 | Ga0068858_100393571 | |||
| 1281 | Ga0068860_100002355 | |||
| 1282 | Ga0068860_100193378 | |||
| 1283 | Ga0068860_100221258 | |||
| 1284 | Ga0068860_100710994 | |||
| 1285 | Ga0068860_101196928 | |||
| 1286 | Ga0068862_100020174 | |||
| 1287 | Ga0068862_100118494 | |||
| 1288 | Ga0068862_100262668 | |||
| 1289 | Ga0081455_10000237 | |||
| 1290 | Ga0081455_10059737 | |||
| 1291 | Ga0081455_10074285 | |||
| 1292 | Ga0081455_10224245 | |||
| 1293 | Ga0081455_10609741 | |||
| 1294 | Ga0081540_1034662 | |||
| 1295 | Ga0081540_1060320 | |||
| 1296 | Ga0070717_10002340 | |||
| 1297 | Ga0075363_100187569 | |||
| 1298 | Ga0075363_100207777 | |||
| 1299 | Ga0075364_10234635 | |||
| 1300 | Ga0075364_10269301 | |||
| 1301 | Ga0075364_10319679 | |||
| 1302 | Ga0075432_10111959 | |||
| 1303 | Ga0070715_10007901 | |||
| 1304 | Ga0070715_10026837 | |||
| 1305 | Ga0070716_100010298 | |||
| 1306 | Ga0070712_100013539 | |||
| 1307 | Ga0070712_100084087 | |||
| 1308 | Ga0070712_100182201 | |||
| 1309 | Ga0070712_100190528 | |||
| 1310 | Ga0070712_100256783 | |||
| 1311 | Ga0070712_100304224 | |||
| 1312 | Ga0070712_101268567 | |||
| 1313 | Ga0075362_10045900 | |||
| 1314 | Ga0075362_10054677 | |||
| 1315 | Ga0075362_10188292 | |||
| 1316 | Ga0075362_10213391 | |||
| 1317 | Ga0075362_10661996 | |||
| 1318 | Ga0075367_10009109 | |||
| 1319 | Ga0075367_10040927 | |||
| 1320 | Ga0075367_10103405 | |||
| 1321 | Ga0075367_10217034 | |||
| 1322 | Ga0075369_10012698 | |||
| 1323 | Ga0075369_10302836 | |||
| 1324 | Ga0075366_10001526 | |||
| 1325 | Ga0075366_10028964 | |||
| 1326 | Ga0097621_100013205 | |||
| 1327 | Ga0097621_100016048 | |||
| 1328 | Ga0075370_10008507 | |||
| 1329 | Ga0075370_10181435 | |||
| 1330 | Ga0075370_10194030 | |||
| 1331 | Ga0068871_100002813 | |||
| 1332 | Ga0068871_100012582 | |||
| 1333 | Ga0068871_100137152 | |||
| 1334 | Ga0075428_100009659 | |||
| 1335 | Ga0075428_101128255 | |||
| 1336 | Ga0075430_100003548 | |||
| 1337 | Ga0075431_100007309 | |||
| 1338 | Ga0075433_10000385 | |||
| 1339 | Ga0075433_10017361 | |||
| 1340 | Ga0075433_10240532 | |||
| 1341 | Ga0075434_100001834 | |||
| 1342 | Ga0075434_100002777 | |||
| 1343 | Ga0075434_100034528 | |||
| 1344 | Ga0075434_100057623 | |||
| 1345 | Ga0075434_100109859 | |||
| 1346 | Ga0075434_100213441 | |||
| 1347 | Ga0075429_100006121 | |||
| 1348 | Ga0068865_100008168 | |||
| 1349 | Ga0068865_100218330 | |||
| 1350 | Ga0097620_100021689 | |||
| 1351 | Ga0097620_100062547 | |||
| 1352 | Ga0097620_100078296 | |||
| 1353 | Ga0075435_100000959 | |||
| 1354 | Ga0075435_100004768 | |||
| 1355 | Ga0075435_100007344 | |||
| 1356 | Ga0075435_100210323 | |||
| 1357 | Ga0075435_100423390 | |||
| 1358 | Ga0075435_100483204 | |||
| 1359 | Ga0075435_100491439 | |||
| 1360 | Ga0105251_10322103 | |||
| 1361 | Ga0105240_10008002 | |||
| 1362 | Ga0105240_11325890 | |||
| 1363 | Ga0111539_10000500 | |||
| 1364 | Ga0111539_10010854 | |||
| 1365 | Ga0111539_10173769 | |||
| 1366 | Ga0111539_10385074 | |||
| 1367 | Ga0111539_11236135 | |||
| 1368 | Ga0111539_11759069 | |||
| 1369 | Ga0105245_10000661 | |||
| 1370 | Ga0105245_10062727 | |||
| 1371 | Ga0105245_10497294 | |||
| 1372 | Ga0105245_10716382 | |||
| 1373 | Ga0105245_11042158 | |||
| 1374 | Ga0105247_10000960 | |||
| 1375 | Ga0105247_10027599 | |||
| 1376 | Ga0105247_10311421 | |||
| 1377 | Ga0105243_10002561 | |||
| 1378 | Ga0105243_10118527 | |||
| 1379 | Ga0105243_10136574 | |||
| 1380 | Ga0105241_10105908 | |||
| 1381 | Ga0105241_10369774 | |||
| 1382 | Ga0105241_11352070 | |||
| 1383 | Ga0105242_10013459 | |||
| 1384 | Ga0105242_10037115 | |||
| 1385 | Ga0105242_10710096 | |||
| 1386 | Ga0105248_10036093 | |||
| 1387 | Ga0105248_10187343 | |||
| 1388 | Ga0105248_10228909 | |||
| 1389 | Ga0105248_10464935 | |||
| 1390 | Ga0105237_10011302 | |||
| 1391 | Ga0105237_10265850 | |||
| 1392 | Ga0105237_10327390 | |||
| 1393 | Ga0105237_10425962 | |||
| 1394 | Ga0105238_10123801 | |||
| 1395 | Ga0105238_10266242 | |||
| 1396 | Ga0105249_10008921 | |||
| 1397 | Ga0105249_10555698 | |||
| 1398 | Ga0105249_10708010 | |||
| 1399 | Ga0105249_11298857 | |||
| 1400 | Ga0105239_10310631 | |||
| 1401 | Ga0105239_10449830 | |||
| 1402 | Ga0105239_11548480 | |||
| 1403 | Ga0105246_10046608 | |||
| 1404 | Ga0105246_10172577 | |||
| 1405 | Ga0105246_10287104 | |||
| 1406 | Ga0105246_11197563 | |||
| 1407 | Ga0157341_1000435 | |||
| 1408 | Ga0157347_1005285 | |||
| 1409 | Ga0157373_10058492 | |||
| 1410 | Ga0157373_10488312 | |||
| 1411 | Ga0157371_10180062 | |||
| 1412 | Ga0157371_10839991 | |||
| 1413 | Ga0157370_10321322 | |||
| 1414 | Ga0157370_10362813 | |||
| 1415 | Ga0157369_10615146 | |||
| 1416 | Ga0157369_11921429 | |||
| 1417 | Ga0157374_10015572 | |||
| 1418 | Ga0157374_10519597 | |||
| 1419 | Ga0157374_10705971 | |||
| 1420 | Ga0157374_11830467 | |||
| 1421 | Ga0157378_10001521 | |||
| 1422 | Ga0157378_10438660 | |||
| 1423 | Ga0163162_10000819 | |||
| 1424 | Ga0163162_10124602 | |||
| 1425 | Ga0163162_11071185 | |||
| 1426 | Ga0163162_11078127 | |||
| 1427 | Ga0163162_11402507 | |||
| 1428 | Ga0163162_11853756 | |||
| 1429 | Ga0157372_10041275 | |||
| 1430 | Ga0157372_10908693 | |||
| 1431 | Ga0157375_10001004 | |||
| 1432 | Ga0157375_10014815 | |||
| 1433 | Ga0157375_10146665 | |||
| 1434 | Ga0157375_11086474 | |||
| 1435 | Ga0163163_10005260 | |||
| 1436 | Ga0163163_10021832 | |||
| 1437 | Ga0163163_10658449 | |||
| 1438 | Ga0163163_11133673 | |||
| 1439 | Ga0163163_12627158 | |||
| 1440 | Ga0157380_10091002 | |||
| 1441 | Ga0157380_10165767 | |||
| 1442 | Ga0182008_10056120 | |||
| 1443 | Ga0157377_10007323 | |||
| 1444 | Ga0157377_10488028 | |||
| 1445 | Ga0157379_10002682 | |||
| 1446 | Ga0157379_10187055 | |||
| 1447 | Ga0157379_10276786 | |||
| 1448 | Ga0157379_10507658 | |||
| 1449 | Ga0157376_10024522 | |||
| 1450 | Ga0157376_10953220 | |||
| 1451 | Ga0157376_11251859 | |||
| 1452 | Ga0157376_12170386 | |||
| 1453 | Ga0163161_10008318 | |||
| 1454 | Ga0213873_10066014 | |||
| 1455 | Ga0213872_10159566 | |||
| 1456 | Ga0213876_10297480 | |||
| 1457 | Ga0213875_10001665 | |||
| 1458 | Ga0213871_10008671 | |||
| 1459 | Ga0213871_10130151 | |||
| 1460 | Ga0207666_1000061 | |||
| 1461 | Ga0207666_1016554 | |||
| 1462 | Ga0207673_1000454 | |||
| 1463 | Ga0207697_10000191 | |||
| 1464 | Ga0207697_10046818 | |||
| 1465 | Ga0207653_10048753 | |||
| 1466 | Ga0207682_10000035 | |||
| 1467 | Ga0207692_10096324 | |||
| 1468 | Ga0207642_10003201 | |||
| 1469 | Ga0207642_10019378 | |||
| 1470 | Ga0207710_10003954 | |||
| 1471 | Ga0207710_10010216 | |||
| 1472 | Ga0207710_10219407 | |||
| 1473 | Ga0207688_10000164 | |||
| 1474 | Ga0207688_10024078 | |||
| 1475 | Ga0207680_10216671 | |||
| 1476 | Ga0207680_10234817 | |||
| 1477 | Ga0207680_10719553 | |||
| 1478 | Ga0207647_10033968 | |||
| 1479 | Ga0207647_10249969 | |||
| 1480 | Ga0207685_10048532 | |||
| 1481 | Ga0207699_10060174 | |||
| 1482 | Ga0207699_10065027 | |||
| 1483 | Ga0207699_10176427 | |||
| 1484 | Ga0207699_10507162 | |||
| 1485 | Ga0207645_10000675 | |||
| 1486 | Ga0207645_10157162 | |||
| 1487 | Ga0207643_10005662 | |||
| 1488 | Ga0207707_10019277 | |||
| 1489 | Ga0207707_10040135 | |||
| 1490 | Ga0207707_10147737 | |||
| 1491 | Ga0207707_10252491 | |||
| 1492 | Ga0207707_10605503 | |||
| 1493 | Ga0207695_10026400 | |||
| 1494 | Ga0207695_10250667 | |||
| 1495 | Ga0207671_10082459 | |||
| 1496 | Ga0207671_10133759 | |||
| 1497 | Ga0207671_10169236 | |||
| 1498 | Ga0207693_10013190 | |||
| 1499 | Ga0207693_10045743 | |||
| 1500 | Ga0207693_10243681 | |||
| 1501 | Ga0207693_10272105 | |||
| 1502 | Ga0207693_10385077 | |||
| 1503 | Ga0207663_10102785 | |||
| 1504 | Ga0207663_11181604 | |||
| 1505 | Ga0207660_10000388 | |||
| 1506 | Ga0207660_10013525 | |||
| 1507 | Ga0207660_10154326 | |||
| 1508 | Ga0207660_10726319 | |||
| 1509 | Ga0207662_10001201 | |||
| 1510 | Ga0207662_10063281 | |||
| 1511 | Ga0207662_10084226 | |||
| 1512 | Ga0207657_10018763 | |||
| 1513 | Ga0207649_10024805 | |||
| 1514 | Ga0207649_10278080 | |||
| 1515 | Ga0207652_10011032 | |||
| 1516 | Ga0207652_10288977 | |||
| 1517 | Ga0207646_10539340 | |||
| 1518 | Ga0207646_10820278 | |||
| 1519 | Ga0207681_10004176 | |||
| 1520 | Ga0207681_10393563 | |||
| 1521 | Ga0207694_10042945 | |||
| 1522 | Ga0207694_10184269 | |||
| 1523 | Ga0207650_10031895 | |||
| 1524 | Ga0207650_10220507 | |||
| 1525 | Ga0207650_10604562 | |||
| 1526 | Ga0207659_10004854 | |||
| 1527 | Ga0207659_10061627 | |||
| 1528 | Ga0207659_10450720 | |||
| 1529 | Ga0207687_10001487 | |||
| 1530 | Ga0207687_10029797 | |||
| 1531 | Ga0207687_10113573 | |||
| 1532 | Ga0207687_10482412 | |||
| 1533 | Ga0207700_10001623 | |||
| 1534 | Ga0207700_10131703 | |||
| 1535 | Ga0207700_10579583 | |||
| 1536 | Ga0207664_10058259 | |||
| 1537 | Ga0207664_10129499 | |||
| 1538 | Ga0207664_10168751 | |||
| 1539 | Ga0207664_10336295 | |||
| 1540 | Ga0207644_10052064 | |||
| 1541 | Ga0207644_10159352 | |||
| 1542 | Ga0207644_10354181 | |||
| 1543 | Ga0207690_10001328 | |||
| 1544 | Ga0207690_10111781 | |||
| 1545 | Ga0207706_10002409 | |||
| 1546 | Ga0207706_10050021 | |||
| 1547 | Ga0207706_10055598 | |||
| 1548 | Ga0207706_10134040 | |||
| 1549 | Ga0207686_10030378 | |||
| 1550 | Ga0207686_10100453 | |||
| 1551 | Ga0207686_10568768 | |||
| 1552 | Ga0207686_10805058 | |||
| 1553 | Ga0207709_10000374 | |||
| 1554 | Ga0207709_10182583 | |||
| 1555 | Ga0207709_10886064 | |||
| 1556 | Ga0207670_10036530 | |||
| 1557 | Ga0207670_10629806 | |||
| 1558 | Ga0207669_10000353 | |||
| 1559 | Ga0207669_10204313 | |||
| 1560 | Ga0207669_10307711 | |||
| 1561 | Ga0207669_10478930 | |||
| 1562 | Ga0207704_10000265 | |||
| 1563 | Ga0207704_11014579 | |||
| 1564 | Ga0207665_10002010 | |||
| 1565 | Ga0207665_10142203 | |||
| 1566 | Ga0207665_10202137 | |||
| 1567 | Ga0207665_10832618 | |||
| 1568 | Ga0207691_10000869 | |||
| 1569 | Ga0207691_10334961 | |||
| 1570 | Ga0207711_10004421 | |||
| 1571 | Ga0207711_10013109 | |||
| 1572 | Ga0207711_10175543 | |||
| 1573 | Ga0207711_10282518 | |||
| 1574 | Ga0207689_10001240 | |||
| 1575 | Ga0207689_10018642 | |||
| 1576 | Ga0207689_10358454 | |||
| 1577 | Ga0207661_10000371 | |||
| 1578 | Ga0207661_10542235 | |||
| 1579 | Ga0207661_11162703 | |||
| 1580 | Ga0207679_10000224 | |||
| 1581 | Ga0207679_10063595 | |||
| 1582 | Ga0207679_10144794 | |||
| 1583 | Ga0207679_10209532 | |||
| 1584 | Ga0207679_10319841 | |||
| 1585 | Ga0207679_10394987 | |||
| 1586 | Ga0207667_10135074 | |||
| 1587 | Ga0207667_10720143 | |||
| 1588 | Ga0207651_10037760 | |||
| 1589 | Ga0207651_10190011 | |||
| 1590 | Ga0207651_10406676 | |||
| 1591 | Ga0207712_10006600 | |||
| 1592 | Ga0207712_10351230 | |||
| 1593 | Ga0207712_10461261 | |||
| 1594 | Ga0207668_10000284 | |||
| 1595 | Ga0207668_10105223 | |||
| 1596 | Ga0207668_10326304 | |||
| 1597 | Ga0207640_10015972 | |||
| 1598 | Ga0207640_10641800 | |||
| 1599 | Ga0207658_10019082 | |||
| 1600 | Ga0207658_10139426 | |||
| 1601 | Ga0207658_10390396 | |||
| 1602 | Ga0207677_10009705 | |||
| 1603 | Ga0207677_10093800 | |||
| 1604 | Ga0207703_10054919 | |||
| 1605 | Ga0207703_10200249 | |||
| 1606 | Ga0207703_10350763 | |||
| 1607 | Ga0207703_10912943 | |||
| 1608 | Ga0207639_10006844 | |||
| 1609 | Ga0207678_10000756 | |||
| 1610 | Ga0207678_10020551 | |||
| 1611 | Ga0207678_10052160 | |||
| 1612 | Ga0207678_10224650 | |||
| 1613 | Ga0207708_10004433 | |||
| 1614 | Ga0207708_10089651 | |||
| 1615 | Ga0207708_10183468 | |||
| 1616 | Ga0207708_10346390 | |||
| 1617 | Ga0207702_10016673 | |||
| 1618 | Ga0207702_10264619 | |||
| 1619 | Ga0207702_10320136 | |||
| 1620 | Ga0207641_10003398 | |||
| 1621 | Ga0207641_10209626 | |||
| 1622 | Ga0207641_10515522 | |||
| 1623 | Ga0207641_10584214 | |||
| 1624 | Ga0207641_10688036 | |||
| 1625 | Ga0207648_10000616 | |||
| 1626 | Ga0207648_10240751 | |||
| 1627 | Ga0207676_10000347 | |||
| 1628 | Ga0207676_11147327 | |||
| 1629 | Ga0207674_10002264 | |||
| 1630 | Ga0207674_10190125 | |||
| 1631 | Ga0207674_10308982 | |||
| 1632 | Ga0207674_10385273 | |||
| 1633 | Ga0207675_100010802 | |||
| 1634 | Ga0207675_100057594 | |||
| 1635 | Ga0207675_100278562 | |||
| 1636 | Ga0207675_102103102 | |||
| 1637 | Ga0207683_10000635 | |||
| 1638 | Ga0207683_10143722 | |||
| 1639 | Ga0207683_10147053 | |||
| 1640 | Ga0207698_10062738 | |||
| 1641 | Ga0209973_1007087 | |||
| 1642 | Ga0209984_1006992 | |||
| 1643 | Ga0209999_1021106 | |||
| 1644 | Ga0210002_1003619 | |||
| 1645 | Ga0209998_10001047 | |||
| 1646 | Ga0209813_10305639 | |||
| 1647 | Ga0209974_10004485 | |||
| 1648 | Ga0207428_10000256 | |||
| 1649 | Ga0207428_10000338 | |||
| 1650 | Ga0207428_10086092 | |||
| 1651 | Ga0268266_10115706 | |||
| 1652 | Ga0268266_10926649 | |||
| 1653 | Ga0268265_10022010 | |||
| 1654 | Ga0268265_10158326 | |||
| 1655 | Ga0268265_10206704 | |||
| 1656 | Ga0268265_10351582 | |||
| 1657 | Ga0268264_10127826 | |||
| 1658 | Ga0268264_10238998 | |||
| 1659 | Ga0268264_10267874 | |||
| 1660 | Ga0265334_10003956 | |||
| 1661 | Ga0265325_10000707 | |||
| 1662 | Ga0265325_10136421 | |||
| 1663 | Ga0265340_10049816 | |||
| 1664 | Ga0265339_10052866 | |||
| 1665 | Ga0265339_10448872 | |||
| 1666 | Ga0265316_10302651 | |||
| 1667 | Ga0265313_10060075 | |||
| 1668 | Ga0265314_10006447 | |||
| 1669 | Ga0373930_0001155 | |||
| 1670 | Ga0373930_0007245 | |||
| 1671 | Ga0373948_0002036 | |||
| 1672 | Ga0373950_0006879 | |||
| 1673 | Ga0373950_0012812 | |||
| 1674 | Ga0373958_0007782 | |||
| 1675 | Ga0373958_0015528 | |||
| 1676 | Ga0373959_0004547 | |||
| 1677 | Ga0373959_0012790 | |||
| 1678 | Ga0373938_0007697 | |||
| 1679 | Ga0373926_0034118 | |||
| 1680 | Ga0373926_0037711 | |||
| 1681 | Ga0373928_0007593 | |||
| 1682 | Ga0373928_0011502 | |||
| 1683 | Ga0373928_0012597 | |||
| 1684 | Ga0373929_0005768 | |||
| 1685 | Ga0373929_0005974 | |||
| 1686 | Ga0373934_0008041 | |||
| 1687 | Ga0373934_0044942 | |||
| 1688 | Ga0373934_0056385 | |||
| 1689 | Ga0373934_0178166 | |||
| 1690 | Ga0373940_0015995 | |||
| 1691 | Ga0373940_0016579 | |||
| 1692 | Ga0373940_0209165 | |||
| 1693 | Ga0373944_0002044 | |||
| 1694 | Ga0373944_0060803 | |||
| 1695 | Ga0373951_0002018 | |||
| 1696 | Ga0373951_0006340 | |||
| 1697 | Ga0373952_0001998 | |||
| 1698 | Ga0373923_0018427 | |||
| 1699 | Ga0373923_0036530 | |||
| 1700 | Ga0373923_0045038 | |||
| 1701 | Ga0373923_0103951 | |||
| 1702 | Ga0373932_0003036 | |||
| 1703 | Ga0373932_0006656 | |||
| 1704 | Ga0373932_0011254 | |||
| 1705 | Ga0373936_0006174 | |||
| 1706 | Ga0373936_0087237 | |||
| 1707 | Ga0373936_0178310 | |||
| 1708 | Ga0373939_0000902 | |||
| 1709 | Ga0373939_0007588 | |||
| 1710 | Ga0373939_0239198 | |||
| 1711 | Ga0373941_0003262 | |||
| 1712 | Ga0373941_0009030 | |||
| 1713 | Ga0373941_0028147 | |||
| 1714 | Ga0373941_0141682 | |||
| 1715 | Ga0373945_0056159 | |||
| 1716 | Ga0373945_0096156 | |||
| 1717 | Ga0373953_0010155 | |||
| 1718 | Ga0373953_0066542 | |||
| 1719 | Ga0373954_0015168 | |||
| 1720 | Ga0373954_0037050 | |||
| 1721 | Ga0373954_0037323 | |||
| 1722 | Ga0373954_0037660 | |||
| 1723 | Ga0373956_0005035 | |||
| 1724 | Ga0373956_0036696 | |||
| 1725 | Ga0373956_0076730 | |||
| 1726 | Ga0373956_0483191 | |||
| 1727 | Ga0373957_0003814 | |||
| 1728 | Ga0373957_0009661 | |||
| 1729 | Ga0373957_0017846 | |||
| 1730 | Ga0373957_0036433 | |||
| 1731 | Ga0373960_0003326 | |||
| 1732 | Ga0373960_0008439 | |||
| 1733 | Ga0373960_0081624 | |||
| 1734 | Ga0373943_0005971 | |||
| 1735 | Ga0373943_0119066 | |||
| 1736 | Ga0373946_0004752 | |||
| 1737 | Ga0373946_0006500 | |||
| 1738 | Ga0373946_0453148 | |||
| 1739 | Ga0373955_0005173 | |||
| 1740 | Ga0373955_0007863 | |||
| 1741 | Ga0373955_0517190 | |||
| 1742 | Ga0373942_0005209 | |||
| 1743 | Ga0373942_0044827 | |||
| 1744 | Ga0373961_0005123 | |||
| 1745 | Ga0373961_0015491 | |||
| 1746 | Ga0373962_0001573 | |||
| 1747 | Ga0373962_0002923 | |||
| 1748 | Ga0373962_0039205 | |||
| 1749 | Ga0373962_0093379 | |||
| 1750 | Ga0373924_0120206 | |||
| 1751 | Ga0373924_0125633 | |||
| 1752 | Ga0373924_0127675 | |||
| 1753 | Ga0373931_0000456 | |||
| 1754 | Ga0373931_0001189 | |||
| 1755 | Ga0373931_0118820 | |||
| 1756 | Ga0373935_0030859 | |||
| 1757 | Ga0373935_0053800 | |||
| 1758 | Ga0373935_0250869 | |||
| 1759 | Ga0373935_0365868 | |||
| 1760 | Ga0373935_0895358 | |||
| 1761 | Ga0373927_0175896 | |||
| 1762 | Ga0373927_0602911 | |||
| 1763 | Ga0373933_0002021 | |||
| 1764 | Ga0373933_0016901 | |||
| 1765 | Ga0373933_0105401 | |||
| 1766 | Ga0373933_0138364 | |||
| 1767 | Ga0373933_0139654 | |||
| 1768 | Ga0373933_0149708 | |||
| 1769 | Ga0373947_0006649 | |||
| 1770 | Ga0373947_0049439 | |||
| 1771 | Ga0373947_0347027 | |||
| 1772 | Ga0373937_0005606 | |||
| 1773 | Ga0373937_0023398 | |||
| 1774 | Ga0373937_0030734 | |||
| 1775 | Ga0373937_0073482 | |||
| 1776 | Ga0373937_0113516 | |||
| 1777 | Ga0373937_0388481 | |||
| 1778 | Ga0373937_0426103 | |||
| 1779 | Ga0373937_0626511 | |||
| 1780 | Ga0373925_0056668 | |||
| 1781 | Ga0373925_0195252 | |||
| 1782 | Ga0373925_0275903 | |||
| 1783 | Ga0395900_0030019 | |||
| 1784 | Ga0395898_0180867 | |||
| 1785 | Ga0436364_0172918 | |||
| 1786 | Ga0436364_0468701 | |||
| 1787 | Ga0436364_1358998 | |||
| 1788 | Ga0395901_0182002 | |||
| 1789 | Ga0395901_0192454 | |||
| 1790 | Ga0242420_023320 | |||
| 1791 | Ga0436365_0186088 | |||
| 1792 | Ga0436365_0421649 | |||
| 1793 | Ga0436365_1250625 | |||
| 1794 | Ga0436365_1269348 | |||
| 1795 | Ga0436365_1327329 | |||
| 1796 | Ga0436365_1848984 | |||
| 1797 | Ga0436360_0296707 | |||
| 1798 | Ga0436360_0342520 | |||
| 1799 | Ga0436360_0697918 | |||
| 1800 | Ga0436360_1048989 | |||
| 1801 | Ga0436361_1180233 | |||
| 1802 | Ga0436363_1365906 | |||
| 1803 | Ga0436363_1699543 | |||
| 1804 | Ga0436362_0594923 | |||
| 1805 | Ga0436362_0895477 | |||
| 1806 | Ga0436362_0985321 | |||
| 1807 | Ga0436362_1038513 | |||
| 1808 | Ga0436362_1145440 | |||
| 1809 | Ga0439453_0036440 | |||
| 1810 | Ga0439448_0018354 | |||
| 1811 | Ga0439460_0021984 | |||
| 1812 | Ga0466963_0500664 | |||
| 1813 | Ga0453684_0159277 | |||
| 1814 | Ga0466957_0438866 | |||
| 1815 | Ga0451576_0468538 | |||
| 1816 | Ga0466967_0066717 | |||
| 1817 | Ga0495592_0014180 | |||
| 1818 | Ga0495592_0014723 | |||
| 1819 | Ga0495592_0034688 | |||
| 1820 | Ga0495592_0364409 | |||
| 1821 | Ga0495592_0684464 | |||
| 1822 | Ga0495603_0031400 | |||
| 1823 | Ga0495603_0070882 | |||
| 1824 | Ga0495603_0071470 | |||
| 1825 | Ga0495629_0001083 | |||
| 1826 | Ga0495629_0039078 | |||
| 1827 | Ga0495638_0333984 | |||
| 1828 | Ga0495641_0010963 | |||
| 1829 | Ga0495641_0071353 | |||
| 1830 | Ga0495641_0112010 | |||
| 1831 | Ga0495651_0078923 | |||
| 1832 | Ga0495651_0188928 | |||
| 1833 | Ga0495651_0194694 | |||
| 1834 | Ga0495653_0035586 | |||
| 1835 | Ga0495653_0052046 | |||
| 1836 | Ga0495653_0055919 | |||
| 1837 | Ga0495653_0727090 | |||
| 1838 | Ga0495580_0052480 | |||
| 1839 | Ga0495580_0068596 | |||
| 1840 | Ga0495582_0008478 | |||
| 1841 | Ga0495582_0048374 | |||
| 1842 | Ga0495639_0012788 | |||
| 1843 | Ga0495639_0037629 | |||
| 1844 | Ga0495662_0017471 | |||
| 1845 | Ga0495664_0008862 | |||
| 1846 | Ga0495664_0141932 | |||
| 1847 | Ga0495664_0323053 | |||
| 1848 | Ga0495584_0497292 | |||
| 1849 | Ga0495585_0017542 | |||
| 1850 | Ga0495594_0028091 | |||
| 1851 | Ga0495594_0070962 | |||
| 1852 | Ga0495607_0038290 | |||
| 1853 | Ga0495583_0289549 | |||
| 1854 | Ga0495608_0025074 | |||
| 1855 | Ga0495608_0115130 | |||
| 1856 | Ga0495608_0151331 | |||
| 1857 | Ga0495608_0430839 | |||
| 1858 | Ga0495616_0272769 | |||
| 1859 | Ga0495618_0006625 | |||
| 1860 | Ga0495618_0046556 | |||
| 1861 | Ga0495628_0123271 | |||
| 1862 | Ga0495628_0192253 | |||
| 1863 | Ga0495630_0016770 | |||
| 1864 | Ga0495630_0066890 | |||
| 1865 | Ga0495644_0007689 | |||
| 1866 | Ga0495666_0020697 | |||
| 1867 | Ga0495652_0083034 | |||
| 1868 | Ga0495652_0156496 | |||
| 1869 | Ga0495652_0229539 | |||
| 1870 | Ga0495665_0016353 | |||
| 1871 | Ga0495640_0060069 | |||
| 1872 | Ga0495640_0083163 | |||
| 1873 | Ga0495640_0407473 | |||
| 1874 | Ga0495586_0062944 | |||
| 1875 | Ga0495586_0121495 | |||
| 1876 | Ga0495587_0032403 | |||
| 1877 | Ga0495587_0041143 | |||
| 1878 | Ga0495587_0051587 | |||
| 1879 | Ga0495598_0023053 | |||
| 1880 | Ga0495645_0047821 | |||
| 1881 | Ga0495645_0106395 | |||
| 1882 | Ga0495622_0018549 | |||
| 1883 | Ga0495667_0017147 | |||
| 1884 | Ga0495667_0024353 | |||
| 1885 | Ga0495667_0031146 | |||
| 1886 | Ga0495667_0036511 | |||
| 1887 | Ga0495667_0042796 | |||
| 1888 | Ga0495634_0043965 | |||
| 1889 | Ga0495634_0054684 | |||
| 1890 | Ga0495611_0129987 | |||
| 1891 | Ga0495635_0090219 | |||
| 1892 | Ga0495635_0262941 | |||
| 1893 | Ga0495659_0010862 | |||
| 1894 | Ga0495657_0004474 | |||
| 1895 | Ga0495657_0097325 | |||
| 1896 | Ga0495657_0199419 | |||
| 1897 | Ga0495599_0072874 | |||
| 1898 | Ga0495599_0102840 | |||
| 1899 | Ga0495599_0215668 | |||
| 1900 | Ga0495623_0037694 | |||
| 1901 | Ga0495646_0035965 | |||
| 1902 | Ga0495646_0136543 | |||
| 1903 | Ga0495647_0007965 | |||
| 1904 | Ga0495647_0009359 | |||
| 1905 | Ga0495647_0190726 | |||
| 1906 | Ga0495658_0000657 | |||
| 1907 | Ga0495658_0041696 | |||
| 1908 | Ga0495658_0049728 | |||
| 1909 | Ga0495658_0063602 | |||
| 1910 | Ga0495669_0298046 | |||
| 1911 | Ga0495613_0027530 | |||
| 1912 | Ga0495613_0056832 | |||
| 1913 | Ga0495624_0010273 | |||
| 1914 | Ga0495670_0005981 | |||
| 1915 | Ga0495671_0251470 | |||
| 1916 | Ga0495600_0036766 | |||
| 1917 | Ga0495600_0070247 | |||
| 1918 | Ga0495600_0075100 | |||
| 1919 | Ga0495581_0024119 | |||
| 1920 | Ga0495581_0038908 | |||
| 1921 | Ga0495604_0023975 | |||
| 1922 | Ga0495604_0032475 | |||
| 1923 | Ga0495604_0129670 | |||
| 1924 | Ga0495604_0336133 | |||
| 1925 | Ga0495604_0524695 | |||
| 1926 | Ga0495674_0048828 | |||
| 1927 | Ga0495674_0328938 | |||
| 1928 | Ga0495676_0151527 | |||
| 1929 | Ga0495676_0187399 | |||
| 1930 | Ga0495680_0011464 | |||
| 1931 | Ga0495680_0015033 | |||
| 1932 | Ga0495680_0027040 | |||
| 1933 | Ga0495680_0133289 | |||
| 1934 | Ga0495680_0328229 | |||
| 1935 | Ga0495675_0125936 | |||
| 1936 | Ga0495675_0231718 | |||
| 1937 | Ga0495677_0160348 | |||
| 1938 | Ga0495677_0203376 | |||
| 1939 | Ga0495679_085464 | |||
| 1940 | Ga0495681_0182685 | |||
| 1941 | Ga0495684_0064317 | |||
| 1942 | Ga0495684_0107787 | |||
| 1943 | Ga0495684_0127401 | |||
| 1944 | Ga0495684_0515967 | |||
| 1945 | Ga0495686_0002628 | |||
| 1946 | Ga0495593_0015003 | |||
| 1947 | Ga0495593_0047421 | |||
| 1948 | Ga0495593_0083154 | |||
| 1949 | Ga0495602_0067594 | |||
| 1950 | Ga0495602_0075417 | |||
| 1951 | Ga0495602_0118134 | |||
| 1952 | Ga0495602_0458491 | |||
| 1953 | Ga0496100_0043390 | |||
| 1954 | Ga0496100_0093381 | |||
| 1955 | Ga0496100_0723402 | |||
| 1956 | Ga0496101_0039951 | |||
| 1957 | Ga0496101_0790244 | |||
| 1958 | Ga0496102_0120761 | |||
| 1959 | Ga0496102_0146137 | |||
| 1960 | Ga0496102_0203808 | |||
| 1961 | Ga0496102_0263614 | |||
| 1962 | Ga0496102_0345265 | |||
| 1963 | Ga0496102_1108427 | |||
| 1964 | Ga0496103_0032545 | |||
| 1965 | Ga0496103_0134740 | |||
| 1966 | Ga0496104_0001026 | |||
| 1967 | Ga0496104_0084764 | |||
| 1968 | Ga0496104_0161480 | |||
| 1969 | Ga0496104_0410381 | |||
| 1970 | Ga0496105_0048461 | |||
| 1971 | Ga0496105_0063288 | |||
| 1972 | Ga0496105_0114002 | |||
| 1973 | Ga0496105_0273257 | |||
| 1974 | Ga0496105_0588876 | |||
| 1975 | Ga0496106_0077045 | |||
| 1976 | Ga0496106_0147132 | |||
| 1977 | Ga0496106_0179245 | |||
| 1978 | Ga0496106_0777419 | |||
| 1979 | Ga0496106_1481587 | |||
| 1980 | Ga0496107_0010208 | |||
| 1981 | Ga0496107_0012830 | |||
| 1982 | Ga0496107_0079757 | |||
| 1983 | Ga0496108_0038783 | |||
| 1984 | Ga0496108_0051869 | |||
| 1985 | Ga0496108_0108553 | |||
| 1986 | Ga0496108_0110196 | |||
| 1987 | Ga0496109_0000211 | |||
| 1988 | Ga0496109_0005410 | |||
| 1989 | Ga0496109_0210473 | |||
| 1990 | Ga0496109_0247786 | |||
| 1991 | Ga0496109_0339553 | |||
| 1992 | Ga0496110_0029267 | |||
| 1993 | Ga0496110_0112176 | |||
| 1994 | Ga0496110_0170330 | |||
| 1995 | Ga0496110_0197748 | |||
| 1996 | Ga0496110_1148489 | |||
| 1997 | Ga0496111_0057100 | |||
| 1998 | Ga0496111_0127848 | |||
| 1999 | Ga0496112_0018318 | |||
| 2000 | Ga0496112_0029842 | |||
| 2001 | Ga0496112_0171079 | |||
| 2002 | Ga0496113_0070215 | |||
| 2003 | Ga0496113_0086591 | |||
| 2004 | Ga0496113_0158489 | |||
| 2005 | Ga0496113_0222427 | |||
| 2006 | Ga0496113_0240647 | |||
| 2007 | Ga0496113_0267699 | |||
| 2008 | Ga0496114_0012331 | |||
| 2009 | Ga0496114_0250164 | |||
| 2010 | Ga0496114_1213138 | |||
| 2011 | Ga0496115_0020154 | |||
| 2012 | Ga0496115_0134879 | |||
| 2013 | Ga0496115_0166033 | |||
| 2014 | Ga0496115_0288086 | |||
| 2015 | Ga0496115_0489547 | |||
| 2016 | Ga0496115_0601490 | |||
| 2017 | Ga0501038_0540985 | |||
| 2018 | Ga0501042_0912024 | |||
| 2019 | Ga0501067_0461755 | |||
| 2020 | Ga0501071_0547108 | |||
| 2021 | Ga0501071_0992080 | |||
| 2022 | Ga0501072_0763662 | |||
| 2023 | Ga0501073_0136552 | |||
| 2024 | Ga0501075_0863376 | |||
| 2025 | Ga0501076_0493485 | |||
| 2026 | Ga0501077_0060241 | |||
| 2027 | Ga0501077_0226068 | |||
| 2028 | Ga0501079_0315950 | |||
| 2029 | Ga0501079_0325269 | |||
| 2030 | Ga0501081_0220178 | |||
| 2031 | Ga0501081_0307836 | |||
| 2032 | Ga0501044_0916031 | |||
| 2033 | Ga0501044_1015906 | |||
| 2034 | Ga0501045_0542706 | |||
| 2035 | nmdc:mga03683_22960_c1 | |||
| 2036 | nmdc:mga03683_299330_c1 | |||
| 2037 | nmdc:mga03683_8800_c1 | |||
| 2038 | nmdc:mga03n38_20921_c1 | |||
| 2039 | nmdc:mga03n38_216203_c1 | |||
| 2040 | nmdc:mga00v17_461330_c1 | |||
| 2041 | nmdc:mga0yw44_891729_c1 | |||
| 2042 | nmdc:mga0k408_15938_c1 | |||
| 2043 | nmdc:mga0k408_3337_c2 | |||
| 2044 | nmdc:mga06z11_50594_c1 | |||
| 2045 | nmdc:mga06z11_62736_c1 | |||
| 2046 | nmdc:mga04h51_6758_c1 | |||
| 2047 | nmdc:mga07m45_223270_c1 | |||
| 2048 | nmdc:mga07m45_49013_c1 | |||
| 2049 | nmdc:mga05p37_12232_c1 | |||
| 2050 | nmdc:mga05p37_88924_c1 | |||
| 2051 | nmdc:mga09592_2014_c1 | |||
| 2052 | nmdc:mga0qj67_853_c1 | |||
| 2053 | nmdc:mga06r32_2147_c1 | |||
| 2054 | nmdc:mga08y16_115404_c1 | |||
| 2055 | nmdc:mga08y16_2382_c1 | |||
| 2056 | nmdc:mga08y16_34723_c1 | |||
| 2057 | nmdc:mga0n895_108615_c1 | |||
| 2058 | nmdc:mga0n895_171_c1 | |||
| 2059 | nmdc:mga0n895_198042_c1 | |||
| 2060 | nmdc:mga0n895_605_c1 | |||
| 2061 | nmdc:mga0n895_60719_c1 | |||
| 2062 | nmdc:mga0n895_616853_c1 | |||
| 2063 | nmdc:mga0n895_6888_c1 | |||
| 2064 | nmdc:mga0rr50_227_c1 | |||
| 2065 | nmdc:mga0rr50_372592_c1 | |||
| 2066 | nmdc:mga0rr50_410553_c1 | |||
| 2067 | nmdc:mga0rr50_92072_c1 | |||
| 2068 | nmdc:mga08x19_279968_c1 | |||
| 2069 | nmdc:mga08x19_295907_c1 | |||
| 2070 | nmdc:mga0a205_6279_c1 | |||
| 2071 | nmdc:mga0a205_650646_c1 | |||
| 2072 | Ga0495601_0002332 | |||
| 2073 | Ga0495601_0042033 | |||
| 2074 | Ga0495601_0050228 | |||
| 2075 | Ga0495601_0061603 | |||
| 2076 | Ga0495601_0068681 | |||
| 2077 | Ga0495601_0071170 | |||
| 2078 | Ga0495601_0257013 | |||
| 2079 | Ga0495612_0002302 | |||
| 2080 | Ga0495612_0008576 | |||
| 2081 | Ga0495612_0023184 | |||
| 2082 | Ga0495612_0025709 | |||
| 2083 | Ga0495612_0087164 | |||
| 2084 | Ga0495612_0126728 | |||
| 2085 | Ga0495595_0008233 | |||
| 2086 | Ga0495595_0010670 | |||
| 2087 | Ga0495595_0018944 | |||
| 2088 | Ga0495595_0023442 | |||
| 2089 | Ga0495595_0118497 | |||
| 2090 | Ga0495595_0120075 | |||
| 2091 | Ga0495595_0276122 | |||
| 2092 | Ga0495595_0354363 | |||
| 2093 | Ga0495619_0000105 | |||
| 2094 | Ga0495619_0000826 | |||
| 2095 | Ga0495619_0007484 | |||
| 2096 | Ga0495619_0012732 | |||
| 2097 | Ga0495619_0052120 | |||
| 2098 | Ga0495619_0108886 | |||
| 2099 | Ga0495619_0164419 | |||
| 2100 | Ga0500578_0288828 | |||
| 2101 | Ga0500643_015685 | |||
| 2102 | Ga0500644_0002887 | |||
| 2103 | Ga0500651_0012416 | |||
| 2104 | Ga0500566_0068402 | |||
| 2105 | Ga0500566_0204223 | |||
| 2106 | Ga0500641_0000586 | |||
| 2107 | Ga0500650_0019903 | |||
| 2108 | Ga0500595_000016 | |||
| 2109 | Ga0500616_0000006 | |||
| 2110 | Ga0500616_0003550 | |||
| 2111 | Ga0500645_000563 | |||
| 2112 | Ga0501084_0068279 | |||
| 2113 | Ga0501082_0116497 | |||
| 2114 | Ga0530510_0146007 | |||
| 2115 | 2643774441 | |||
| 2116 | 2643792886 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9472 | 3 | 157 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9458 | 1 | 155 |
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.9422 | 2 | 154 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.9381 | 3 | 158 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9316 | 3 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9548 | 80 | 155 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9491 | 80 | 155 | 1.10.150.120 |
| 1alo002 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9478 | 76 | 158 | 1.10.150.120 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9452 | 1 | 78 | 3.10.20.30 |
| 3hrdH01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.939 | 2 | 78 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q0RCB4-F1-model_v4 | deleted | 0.9696 | 3 | 156 |
|
| AF-A0A0Q4GS30-F1-model_v4 | (2Fe-2S)-binding protein | 0.9693 | 3 | 156 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A4V1DDK5-F1-model_v4 | (2Fe-2S)-binding protein | 0.9682 | 1 | 156 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7X3G2F7-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9679 | 5 | 153 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A4R5Q8V3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9678 | 5 | 155 |
GO:0016491
GO:0046872 GO:0051537 |