F489228

General Info

Members Datasets Scaffolds Average Seq Length
1058 424 2116 160

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10314733|Ga0207692_103147332
Length 173
Sequence MFRNIHTDPASEKPMQTVRLIVNGNAVGATADPETPLLDILRNHLGLMGTKFGCGLEQCGCCMVLVDGKPEKSCGKPLSTVAGREIVTIEGLGTPDRPHPLQRAFIDEQAGQCGYCLPGILITAKALLDRNPSPSRSEIAAALDDNICRCGSHIRILRAVERAARLLRDGAAR

Samples

Sample ID Description Type Environment
1 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
136 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
157 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
158 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
236 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
244 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
257 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
259 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
260 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
261 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
262 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
263 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
264 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
265 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
270 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
291 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
292 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
326 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
327 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
339 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
345 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
354 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
355 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
372 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
383 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
384 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
391 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
392 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
401 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
402 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
403 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
404 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
412 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
423 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
424 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.54
Nodule 0
Rhizoplane 6.05
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207692_10314733 3300025898 Bacteria 956
2 ARcpr5oldR_c001102 3300000041 Bacteria 2819
3 ARSoilYngRDRAFT_c01134 3300000042 Bacteria 1655
4 ARSoilOldRDRAFT_c000194 3300000044 Bacteria 9800
5 ARCol0yngRDRAFT_1000833 3300000652 Bacteria 2820
6 JGI24032J14994_101065 3300001430 Bacteria 1263
7 JGI24746J21847_1000495 3300001977 Bacteria 5901
8 JGI24747J21853_1001963 3300001978 Bacteria 1615
9 JGI24739J22299_10001299 3300001989 Bacteria 9376
10 JGI24750J21931_1000493 3300002070 Bacteria 6203
11 JGI24748J21848_1004930 3300002074 Bacteria 1539
12 JGI24738J21930_10000506 3300002075 Bacteria 11097
13 JGI24749J21850_1001158 3300002076 Bacteria 3747
14 JGI24744J21845_10027423 3300002077 Bacteria 1100
15 JGI24034J26672_10008361 3300002239 Bacteria 1512
16 JGI24742J22300_10003727 3300002244 Bacteria 2475
17 JGI24751J29686_10039380 3300002459 Bacteria 978
18 JGI26145J50221_1006328 3300003371 Bacteria 990
19 Ga0065712_10072710 3300005290 Bacteria 4646
20 Ga0065712_10244275 3300005290 Bacteria 976
21 Ga0065715_10004320 3300005293 Bacteria 6202
22 Ga0065715_10037744 3300005293 Bacteria 1373
23 Ga0070658_10009108 3300005327 Bacteria 7981
24 Ga0070676_10016795 3300005328 Bacteria 4046
25 Ga0070676_11079621 3300005328 Bacteria 606
26 Ga0070683_100003556 3300005329 Bacteria 12682
27 Ga0070683_100148983 3300005329 Bacteria 2218
28 Ga0070683_100399368 3300005329 Bacteria 1311
29 Ga0070690_100017989 3300005330 Bacteria 4261
30 Ga0070690_100176509 3300005330 Bacteria 1474
31 Ga0070690_100245782 3300005330 Bacteria 1264
32 Ga0070690_100291265 3300005330 Bacteria 1168
33 Ga0070690_100522901 3300005330 Bacteria 891
34 Ga0070670_100008291 3300005331 Bacteria 8849
35 Ga0070670_100374034 3300005331 Unclassified 1254
36 Ga0070670_100592443 3300005331 Unclassified 991
37 Ga0070670_100861511 3300005331 Bacteria 820
38 Ga0070677_10004318 3300005333 Bacteria 4629
39 Ga0068869_100001645 3300005334 Bacteria 13324
40 Ga0068869_100083099 3300005334 Bacteria 2394
41 Ga0068869_100359195 3300005334 Bacteria 1189
42 Ga0070666_10021722 3300005335 Bacteria 4160
43 Ga0070666_10259398 3300005335 Bacteria 1232
44 Ga0070666_10964258 3300005335 Bacteria 632
45 Ga0070680_100001406 3300005336 Bacteria 17386
46 Ga0070680_100007032 3300005336 Bacteria 8577
47 Ga0070680_100102341 3300005336 Bacteria 2379
48 Ga0070680_100233386 3300005336 Bacteria 1554
49 Ga0070680_100593317 3300005336 Bacteria 951
50 Ga0070682_100013294 3300005337 Bacteria 4733
51 Ga0070682_100021362 3300005337 Bacteria 3818
52 Ga0070682_100116347 3300005337 Bacteria 1789
53 Ga0068868_100008818 3300005338 Bacteria 7225
54 Ga0068868_100308577 3300005338 Bacteria 1345
55 Ga0070660_100005193 3300005339 Bacteria 8999
56 Ga0070660_100375820 3300005339 Bacteria 1173
57 Ga0070660_100724508 3300005339 Bacteria 834
58 Ga0070689_100008604 3300005340 Bacteria 7195
59 Ga0070689_100075116 3300005340 Plasmid 2645
60 Ga0070689_100153068 3300005340 Bacteria 1861
61 Ga0070689_100460351 3300005340 Bacteria 1084
62 Ga0070689_100558865 3300005340 Bacteria 987
63 Ga0070691_10003570 3300005341 Bacteria 7017
64 Ga0070691_10069685 3300005341 Bacteria 1705
65 Ga0070687_100000814 3300005343 Bacteria 10390
66 Ga0070687_100068757 3300005343 Bacteria 1894
67 Ga0070661_100025170 3300005344 Bacteria 4275
68 Ga0070661_100396884 3300005344 Bacteria 1090
69 Ga0070661_100999666 3300005344 Bacteria 694
70 Ga0070692_10033441 3300005345 Bacteria 2590
71 Ga0070668_100000327 3300005347 Bacteria 31302
72 Ga0070668_100090356 3300005347 Bacteria 2413
73 Ga0070668_100805716 3300005347 Bacteria 835
74 Ga0070669_100004627 3300005353 Bacteria 9929
75 Ga0070669_100059577 3300005353 Bacteria 2803
76 Ga0070675_100000633 3300005354 Bacteria 24266
77 Ga0070675_100159505 3300005354 Bacteria 1939
78 Ga0070671_100000738 3300005355 Bacteria 23424
79 Ga0070671_100047745 3300005355 Bacteria 3559
80 Ga0070671_100609623 3300005355 Bacteria 944
81 Ga0070674_100000211 3300005356 Bacteria 28048
82 Ga0070674_100093560 3300005356 Bacteria 2175
83 Ga0070674_100455324 3300005356 Bacteria 1057
84 Ga0070674_100542380 3300005356 Bacteria 975
85 Ga0070673_100000736 3300005364 Bacteria 18131
86 Ga0070673_100027886 3300005364 Bacteria 4192
87 Ga0070673_100073956 3300005364 Bacteria 2744
88 Ga0070673_101177616 3300005364 Bacteria 717
89 Ga0070688_100012623 3300005365 Bacteria 4737
90 Ga0070688_100050586 3300005365 Bacteria 2589
91 Ga0070688_100091180 3300005365 Bacteria 1991
92 Ga0070688_100368035 3300005365 Unclassified 1057
93 Ga0070659_100000508 3300005366 Bacteria 28548
94 Ga0070659_100229903 3300005366 Bacteria 1533
95 Ga0070667_100006728 3300005367 Bacteria 9548
96 Ga0070667_101514449 3300005367 Bacteria 630
97 Ga0070703_10003437 3300005406 Bacteria 4516
98 Ga0070703_10076684 3300005406 Bacteria 1129
99 Ga0070709_10014167 3300005434 Bacteria 4504
100 Ga0070709_10051924 3300005434 Bacteria 2574
101 Ga0070714_100035933 3300005435 Bacteria 4153
102 Ga0070714_100094771 3300005435 Bacteria 2620
103 Ga0070714_100226224 3300005435 Bacteria 1722
104 Ga0070713_100013021 3300005436 Bacteria 6125
105 Ga0070713_100100376 3300005436 Bacteria 2505
106 Ga0070713_100158839 3300005436 Bacteria 2016
107 Ga0070713_100287315 3300005436 Bacteria 1510
108 Ga0070713_100880141 3300005436 Bacteria 861
109 Ga0070713_101100363 3300005436 Bacteria 768
110 Ga0070713_101254063 3300005436 Bacteria 718
111 Ga0070710_10003802 3300005437 Bacteria 7138
112 Ga0070710_10021231 3300005437 Bacteria 3380
113 Ga0070710_10666680 3300005437 Bacteria 731
114 Ga0070701_10001645 3300005438 Bacteria 8355
115 Ga0070701_11142013 3300005438 Bacteria 550
116 Ga0070711_100333180 3300005439 Bacteria 1215
117 Ga0070711_100733695 3300005439 Bacteria 834
118 Ga0070705_100342912 3300005440 Bacteria 1086
119 Ga0070700_100002387 3300005441 Bacteria 9573
120 Ga0070700_100179619 3300005441 Bacteria 1472
121 Ga0070700_100203976 3300005441 Bacteria 1391
122 Ga0070700_100252850 3300005441 Bacteria 1265
123 Ga0070694_100002705 3300005444 Bacteria 10512
124 Ga0070694_100022727 3300005444 Bacteria 4022
125 Ga0070708_100174330 3300005445 Bacteria 2009
126 Ga0070708_101915286 3300005445 Bacteria 549
127 Ga0070663_100000815 3300005455 Bacteria 16913
128 Ga0070663_100055426 3300005455 Bacteria 2837
129 Ga0070663_100514866 3300005455 Bacteria 995
130 Ga0070663_100901845 3300005455 Bacteria 764
131 Ga0070678_100055998 3300005456 Bacteria 2881
132 Ga0070678_100123520 3300005456 Bacteria 2045
133 Ga0070662_100009625 3300005457 Bacteria 6322
134 Ga0070662_100137798 3300005457 Bacteria 1888
135 Ga0070681_10015221 3300005458 Bacteria 7652
136 Ga0070681_10037495 3300005458 Bacteria 4863
137 Ga0070681_10038319 3300005458 Bacteria 4806
138 Ga0070681_10138771 3300005458 Bacteria 2361
139 Ga0070681_10145327 3300005458 Bacteria 2301
140 Ga0070681_10648698 3300005458 Bacteria 970
141 Ga0068867_100000652 3300005459 Bacteria 22983
142 Ga0070685_10003090 3300005466 Bacteria 8466
143 Ga0070685_10004123 3300005466 Bacteria 7333
144 Ga0070685_10105700 3300005466 Bacteria 1726
145 Ga0070706_100070387 3300005467 Bacteria 3235
146 Ga0070706_100101892 3300005467 Bacteria 2668
147 Ga0070706_101420975 3300005467 Unclassified 635
148 Ga0070707_100706268 3300005468 Bacteria 971
149 Ga0070698_100027073 3300005471 Bacteria 5962
150 Ga0070698_100536019 3300005471 Bacteria 1109
151 Ga0070699_100040041 3300005518 Bacteria 4058
152 Ga0070699_100671763 3300005518 Bacteria 946
153 Ga0070699_101053391 3300005518 Bacteria 746
154 Ga0070679_100021378 3300005530 Bacteria 6316
155 Ga0070679_100031573 3300005530 Bacteria 5234
156 Ga0070679_100134342 3300005530 Bacteria 2455
157 Ga0070679_100180329 3300005530 Bacteria 2084
158 Ga0070679_100725618 3300005530 Bacteria 936
159 Ga0070684_100009390 3300005535 Bacteria 7701
160 Ga0070684_100121428 3300005535 Bacteria 2350
161 Ga0070684_100553272 3300005535 Bacteria 1068
162 Ga0070684_101171120 3300005535 Bacteria 723
163 Ga0070697_100132293 3300005536 Bacteria 2093
164 Ga0070697_100206403 3300005536 Bacteria 1671
165 Ga0070697_100411036 3300005536 Bacteria 1175
166 Ga0070697_100782223 3300005536 Bacteria 844
167 Ga0068853_100033052 3300005539 Bacteria 4386
168 Ga0070672_100010446 3300005543 Bacteria 6442
169 Ga0070672_100159788 3300005543 Bacteria 1869
170 Ga0070672_100284181 3300005543 Bacteria 1400
171 Ga0070686_100005337 3300005544 Bacteria 7109
172 Ga0070686_100019247 3300005544 Bacteria 4020
173 Ga0070686_100207680 3300005544 Bacteria 1408
174 Ga0070686_101699220 3300005544 Bacteria 536
175 Ga0070695_100000791 3300005545 Bacteria 17042
176 Ga0070695_100254442 3300005545 Bacteria 1280
177 Ga0070696_100031267 3300005546 Bacteria 3647
178 Ga0070696_100097449 3300005546 Bacteria 2103
179 Ga0070696_100183889 3300005546 Bacteria 1552
180 Ga0070696_100434966 3300005546 Bacteria 1033
181 Ga0070696_100586564 3300005546 Bacteria 897
182 Ga0070693_100010016 3300005547 Bacteria 4730
183 Ga0070665_100073390 3300005548 Bacteria 3428
184 Ga0070665_100375699 3300005548 Bacteria 1428
185 Ga0070665_101826270 3300005548 Bacteria 614
186 Ga0070704_100026728 3300005549 Bacteria 3820
187 Ga0068855_100041815 3300005563 Bacteria 5431
188 Ga0068855_100051893 3300005563 Bacteria 4830
189 Ga0068855_101104328 3300005563 Bacteria 829
190 Ga0070664_100002092 3300005564 Bacteria 15953
191 Ga0070664_100055051 3300005564 Bacteria 3376
192 Ga0070664_100090607 3300005564 Bacteria 2647
193 Ga0070664_100213516 3300005564 Bacteria 1725
194 Ga0070664_100290706 3300005564 Unclassified 1475
195 Ga0070664_101384584 3300005564 Bacteria 665
196 Ga0068857_100014842 3300005577 Bacteria 6794
197 Ga0068857_100120910 3300005577 Bacteria 2358
198 Ga0068854_100013287 3300005578 Bacteria 5399
199 Ga0068856_100012787 3300005614 Bacteria 8125
200 Ga0068856_100297558 3300005614 Bacteria 1631
201 Ga0070702_100000664 3300005615 Bacteria 12852
202 Ga0070702_100717620 3300005615 Bacteria 764
203 Ga0068852_100088794 3300005616 Bacteria 2761
204 Ga0068852_100685592 3300005616 Bacteria 1034
205 Ga0068859_100021689 3300005617 Bacteria 6445
206 Ga0068859_100062548 3300005617 Bacteria 3752
207 Ga0068859_100078290 3300005617 Bacteria 3346
208 Ga0068864_100029489 3300005618 Bacteria 4648
209 Ga0068866_10013065 3300005718 Bacteria 3632
210 Ga0068866_10132425 3300005718 Bacteria 1420
211 Ga0068861_100086909 3300005719 Bacteria 2459
212 Ga0068861_100254322 3300005719 Bacteria 1500
213 Ga0068851_10655512 3300005834 Bacteria 643
214 Ga0068870_10001203 3300005840 Bacteria 10389
215 Ga0068870_10247364 3300005840 Bacteria 1104
216 Ga0068870_10512045 3300005840 Bacteria 802
217 Ga0068863_100001709 3300005841 Bacteria 21721
218 Ga0068863_100173074 3300005841 Bacteria 2071
219 Ga0068863_100340115 3300005841 Bacteria 1460
220 Ga0068863_100399671 3300005841 Bacteria 1344
221 Ga0068858_100006236 3300005842 Bacteria 11620
222 Ga0068858_100393571 3300005842 Bacteria 1331
223 Ga0068860_100002355 3300005843 Bacteria 19851
224 Ga0068860_100193378 3300005843 Bacteria 1969
225 Ga0068860_100221258 3300005843 Bacteria 1838
226 Ga0068860_100710994 3300005843 Bacteria 1015
227 Ga0068860_101196928 3300005843 Bacteria 780
228 Ga0068862_100020174 3300005844 Bacteria 5566
229 Ga0068862_100118494 3300005844 Bacteria 2331
230 Ga0068862_100262668 3300005844 Unclassified 1576
231 Ga0081455_10000237 3300005937 Bacteria 71335
232 Ga0081455_10059737 3300005937 Bacteria 3217
233 Ga0081455_10074285 3300005937 Bacteria 2808
234 Ga0081455_10224245 3300005937 Bacteria 1391
235 Ga0081455_10609741 3300005937 Unclassified 710
236 Ga0081540_1034662 3300005983 Bacteria 2717
237 Ga0081540_1060320 3300005983 Bacteria 1815
238 Ga0070717_10002340 3300006028 Bacteria 13346
239 Ga0075363_100187569 3300006048 Bacteria 1179
240 Ga0075363_100207777 3300006048 Bacteria 1120
241 Ga0075364_10234635 3300006051 Bacteria 1246
242 Ga0075364_10269301 3300006051 Unclassified 1158
243 Ga0075364_10319679 3300006051 Bacteria 1057
244 Ga0075432_10111959 3300006058 Bacteria 1018
245 Ga0070715_10007901 3300006163 Bacteria 3681
246 Ga0070715_10026837 3300006163 Bacteria 2295
247 Ga0070716_100010298 3300006173 Bacteria 4683
248 Ga0070712_100013539 3300006175 Bacteria 5214
249 Ga0070712_100084087 3300006175 Bacteria 2312
250 Ga0070712_100182201 3300006175 Bacteria 1637
251 Ga0070712_100190528 3300006175 Bacteria 1604
252 Ga0070712_100256783 3300006175 Bacteria 1399
253 Ga0070712_100304224 3300006175 Bacteria 1291
254 Ga0070712_101268567 3300006175 Unclassified 642
255 Ga0075362_10045900 3300006177 Bacteria 1942
256 Ga0075362_10054677 3300006177 Bacteria 1795
257 Ga0075362_10188292 3300006177 Bacteria 1002
258 Ga0075362_10213391 3300006177 Bacteria 942
259 Ga0075362_10661996 3300006177 Bacteria 543
260 Ga0075367_10009109 3300006178 Bacteria 5172
261 Ga0075367_10040927 3300006178 Bacteria 2707
262 Ga0075367_10103405 3300006178 Bacteria 1743
263 Ga0075367_10217034 3300006178 Bacteria 1196
264 Ga0075369_10012698 3300006186 Bacteria 3328
265 Ga0075369_10302836 3300006186 Bacteria 746
266 Ga0075366_10001526 3300006195 Bacteria 11574
267 Ga0075366_10028964 3300006195 Bacteria 3251
268 Ga0097621_100013205 3300006237 Bacteria 6145
269 Ga0097621_100016048 3300006237 Bacteria 5651
270 Ga0075370_10008507 3300006353 Bacteria 5285
271 Ga0075370_10181435 3300006353 Bacteria 1239
272 Ga0075370_10194030 3300006353 Bacteria 1197
273 Ga0068871_100002813 3300006358 Bacteria 11905
274 Ga0068871_100012582 3300006358 Bacteria 6248
275 Ga0068871_100137152 3300006358 Bacteria 2078
276 Ga0075428_100009659 3300006844 Bacteria 10713
277 Ga0075428_101128255 3300006844 Bacteria 828
278 Ga0075430_100003548 3300006846 Bacteria 13061
279 Ga0075431_100007309 3300006847 Bacteria 11001
280 Ga0075433_10000385 3300006852 Bacteria 27972
281 Ga0075433_10017361 3300006852 Bacteria 5960
282 Ga0075433_10240532 3300006852 Bacteria 1607
283 Ga0075434_100001834 3300006871 Bacteria 18340
284 Ga0075434_100002777 3300006871 Bacteria 15489
285 Ga0075434_100034528 3300006871 Bacteria 4994
286 Ga0075434_100057623 3300006871 Bacteria 3861
287 Ga0075434_100109859 3300006871 Bacteria 2768
288 Ga0075434_100213441 3300006871 Bacteria 1950
289 Ga0075429_100006121 3300006880 Bacteria 10398
290 Ga0068865_100008168 3300006881 Bacteria 6461
291 Ga0068865_100218330 3300006881 Bacteria 1489
292 Ga0097620_100021689 3300006931 Bacteria 6445
293 Ga0097620_100062547 3300006931 Bacteria 3752
294 Ga0097620_100078296 3300006931 Bacteria 3346
295 Ga0075435_100000959 3300007076 Bacteria 18214
296 Ga0075435_100004768 3300007076 Bacteria 9364
297 Ga0075435_100007344 3300007076 Bacteria 7848
298 Ga0075435_100210323 3300007076 Bacteria 1650
299 Ga0075435_100423390 3300007076 Bacteria 1147
300 Ga0075435_100483204 3300007076 Bacteria 1070
301 Ga0075435_100491439 3300007076 Bacteria 1061
302 Ga0105251_10322103 3300009011 Bacteria 703
303 Ga0105240_10008002 3300009093 Bacteria 15226
304 Ga0105240_11325890 3300009093 Bacteria 758
305 Ga0111539_10000500 3300009094 Bacteria 49951
306 Ga0111539_10010854 3300009094 Bacteria 11464
307 Ga0111539_10173769 3300009094 Bacteria 2517
308 Ga0111539_10385074 3300009094 Bacteria 1633
309 Ga0111539_11236135 3300009094 Bacteria 867
310 Ga0111539_11759069 3300009094 Bacteria 719
311 Ga0105245_10000661 3300009098 Bacteria 31194
312 Ga0105245_10062727 3300009098 Bacteria 3354
313 Ga0105245_10497294 3300009098 Bacteria 1235
314 Ga0105245_10716382 3300009098 Bacteria 1035
315 Ga0105245_11042158 3300009098 Bacteria 863
316 Ga0105247_10000960 3300009101 Bacteria 21746
317 Ga0105247_10027599 3300009101 Bacteria 3432
318 Ga0105247_10311421 3300009101 Bacteria 1095
319 Ga0105243_10002561 3300009148 Bacteria 15197
320 Ga0105243_10118527 3300009148 Bacteria 2227
321 Ga0105243_10136574 3300009148 Bacteria 2087
322 Ga0105241_10105908 3300009174 Bacteria 2244
323 Ga0105241_10369774 3300009174 Bacteria 1250
324 Ga0105241_11352070 3300009174 Bacteria 680
325 Ga0105242_10013459 3300009176 Bacteria 6325
326 Ga0105242_10037115 3300009176 Bacteria 3913
327 Ga0105242_10710096 3300009176 Bacteria 985
328 Ga0105248_10036093 3300009177 Bacteria 5529
329 Ga0105248_10187343 3300009177 Bacteria 2332
330 Ga0105248_10228909 3300009177 Bacteria 2092
331 Ga0105248_10464935 3300009177 Bacteria 1426
332 Ga0105237_10011302 3300009545 Bacteria 9447
333 Ga0105237_10265850 3300009545 Bacteria 1718
334 Ga0105237_10327390 3300009545 Bacteria 1536
335 Ga0105237_10425962 3300009545 Bacteria 1333
336 Ga0105238_10123801 3300009551 Bacteria 2565
337 Ga0105238_10266242 3300009551 Bacteria 1694
338 Ga0105249_10008921 3300009553 Bacteria 8758
339 Ga0105249_10555698 3300009553 Bacteria 1199
340 Ga0105249_10708010 3300009553 Bacteria 1067
341 Ga0105249_11298857 3300009553 Bacteria 799
342 Ga0105239_10310631 3300010375 Bacteria 1777
343 Ga0105239_10449830 3300010375 Bacteria 1461
344 Ga0105239_11548480 3300010375 Bacteria 766
345 Ga0105246_10046608 3300011119 Bacteria 2957
346 Ga0105246_10172577 3300011119 Bacteria 1657
347 Ga0105246_10287104 3300011119 Bacteria 1323
348 Ga0105246_11197563 3300011119 Unclassified 699
349 Ga0157341_1000435 3300012494 Bacteria 2087
350 Ga0157347_1005285 3300012502 Bacteria 1229
351 Ga0157373_10058492 3300013100 Bacteria 2733
352 Ga0157373_10488312 3300013100 Bacteria 889
353 Ga0157371_10180062 3300013102 Bacteria 1512
354 Ga0157371_10839991 3300013102 Bacteria 694
355 Ga0157370_10321322 3300013104 Bacteria 1428
356 Ga0157370_10362813 3300013104 Bacteria 1335
357 Ga0157369_10615146 3300013105 Bacteria 1121
358 Ga0157369_11921429 3300013105 Bacteria 601
359 Ga0157374_10015572 3300013296 Bacteria 6673
360 Ga0157374_10519597 3300013296 Bacteria 1196
361 Ga0157374_10705971 3300013296 Bacteria 1022
362 Ga0157374_11830467 3300013296 Bacteria 632
363 Ga0157378_10001521 3300013297 Bacteria 20986
364 Ga0157378_10438660 3300013297 Bacteria 1294
365 Ga0163162_10000819 3300013306 Bacteria 28876
366 Ga0163162_10124602 3300013306 Bacteria 2682
367 Ga0163162_11071185 3300013306 Bacteria 913
368 Ga0163162_11078127 3300013306 Bacteria 910
369 Ga0163162_11402507 3300013306 Bacteria 795
370 Ga0163162_11853756 3300013306 Bacteria 690
371 Ga0157372_10041275 3300013307 Bacteria 5101
372 Ga0157372_10908693 3300013307 Bacteria 1021
373 Ga0157375_10001004 3300013308 Bacteria 24381
374 Ga0157375_10014815 3300013308 Bacteria 6966
375 Ga0157375_10146665 3300013308 Bacteria 2491
376 Ga0157375_11086474 3300013308 Bacteria 936
377 Ga0163163_10005260 3300014325 Bacteria 11163
378 Ga0163163_10021832 3300014325 Bacteria 6048
379 Ga0163163_10658449 3300014325 Bacteria 1111
380 Ga0163163_11133673 3300014325 Bacteria 845
381 Ga0163163_12627158 3300014325 Bacteria 561
382 Ga0157380_10091002 3300014326 Bacteria 2518
383 Ga0157380_10165767 3300014326 Bacteria 1925
384 Ga0182008_10056120 3300014497 Bacteria 1947
385 Ga0157377_10007323 3300014745 Bacteria 5322
386 Ga0157377_10488028 3300014745 Bacteria 858
387 Ga0157379_10002682 3300014968 Bacteria 14992
388 Ga0157379_10187055 3300014968 Bacteria 1872
389 Ga0157379_10276786 3300014968 Bacteria 1527
390 Ga0157379_10507658 3300014968 Bacteria 1118
391 Ga0157376_10024522 3300014969 Bacteria 4738
392 Ga0157376_10953220 3300014969 Bacteria 879
393 Ga0157376_11251859 3300014969 Bacteria 771
394 Ga0157376_12170386 3300014969 Bacteria 594
395 Ga0163161_10008318 3300017792 Bacteria 7184
396 Ga0213873_10066014 3300021358 Unclassified 989
397 Ga0213872_10159566 3300021361 Bacteria 982
398 Ga0213876_10297480 3300021384 Bacteria 858
399 Ga0213875_10001665 3300021388 Bacteria 13999
400 Ga0213871_10008671 3300021441 Bacteria 2253
401 Ga0213871_10130151 3300021441 Bacteria 755
402 Ga0207666_1000061 3300025271 Bacteria 19549
403 Ga0207666_1016554 3300025271 Bacteria 1058
404 Ga0207673_1000454 3300025290 Bacteria 4249
405 Ga0207697_10000191 3300025315 Bacteria 32215
406 Ga0207697_10046818 3300025315 Bacteria 1782
407 Ga0207653_10048753 3300025885 Bacteria 1404
408 Ga0207682_10000035 3300025893 Bacteria 56611
409 Ga0207692_10096324 3300025898 Bacteria 1615
410 Ga0207642_10003201 3300025899 Bacteria 5132
411 Ga0207642_10019378 3300025899 Bacteria 2633
412 Ga0207710_10003954 3300025900 Bacteria 6534
413 Ga0207710_10010216 3300025900 Bacteria 3949
414 Ga0207710_10219407 3300025900 Bacteria 944
415 Ga0207688_10000164 3300025901 Bacteria 28882
416 Ga0207688_10024078 3300025901 Bacteria 3338
417 Ga0207680_10216671 3300025903 Bacteria 1311
418 Ga0207680_10234817 3300025903 Bacteria 1261
419 Ga0207680_10719553 3300025903 Bacteria 715
420 Ga0207647_10033968 3300025904 Bacteria 3260
421 Ga0207647_10249969 3300025904 Bacteria 1017
422 Ga0207685_10048532 3300025905 Bacteria 1627
423 Ga0207699_10060174 3300025906 Bacteria 2279
424 Ga0207699_10065027 3300025906 Bacteria 2209
425 Ga0207699_10176427 3300025906 Bacteria 1433
426 Ga0207699_10507162 3300025906 Bacteria 871
427 Ga0207645_10000675 3300025907 Bacteria 28236
428 Ga0207645_10157162 3300025907 Bacteria 1486
429 Ga0207643_10005662 3300025908 Bacteria 6683
430 Ga0207707_10019277 3300025912 Bacteria 5953
431 Ga0207707_10040135 3300025912 Bacteria 4089
432 Ga0207707_10147737 3300025912 Bacteria 2055
433 Ga0207707_10252491 3300025912 Bacteria 1532
434 Ga0207707_10605503 3300025912 Bacteria 927
435 Ga0207695_10026400 3300025913 Bacteria 6481
436 Ga0207695_10250667 3300025913 Bacteria 1670
437 Ga0207671_10082459 3300025914 Bacteria 2413
438 Ga0207671_10133759 3300025914 Bacteria 1905
439 Ga0207671_10169236 3300025914 Bacteria 1696
440 Ga0207693_10013190 3300025915 Bacteria 6667
441 Ga0207693_10045743 3300025915 Bacteria 3438
442 Ga0207693_10243681 3300025915 Bacteria 1411
443 Ga0207693_10272105 3300025915 Bacteria 1327
444 Ga0207693_10385077 3300025915 Bacteria 1097
445 Ga0207663_10102785 3300025916 Bacteria 1923
446 Ga0207663_11181604 3300025916 Bacteria 616
447 Ga0207660_10000388 3300025917 Bacteria 28927
448 Ga0207660_10013525 3300025917 Bacteria 5349
449 Ga0207660_10154326 3300025917 Bacteria 1766
450 Ga0207660_10726319 3300025917 Bacteria 810
451 Ga0207662_10001201 3300025918 Bacteria 12363
452 Ga0207662_10063281 3300025918 Bacteria 2224
453 Ga0207662_10084226 3300025918 Bacteria 1945
454 Ga0207657_10018763 3300025919 Bacteria 6589
455 Ga0207649_10024805 3300025920 Bacteria 3489
456 Ga0207649_10278080 3300025920 Bacteria 1216
457 Ga0207652_10011032 3300025921 Bacteria 7283
458 Ga0207652_10288977 3300025921 Bacteria 1479
459 Ga0207646_10539340 3300025922 Bacteria 1049
460 Ga0207646_10820278 3300025922 Bacteria 828
461 Ga0207681_10004176 3300025923 Bacteria 8943
462 Ga0207681_10393563 3300025923 Bacteria 1118
463 Ga0207694_10042945 3300025924 Bacteria 3489
464 Ga0207694_10184269 3300025924 Bacteria 1694
465 Ga0207650_10031895 3300025925 Bacteria 3809
466 Ga0207650_10220507 3300025925 Bacteria 1526
467 Ga0207650_10604562 3300025925 Unclassified 922
468 Ga0207659_10004854 3300025926 Bacteria 8148
469 Ga0207659_10061627 3300025926 Bacteria 2704
470 Ga0207659_10450720 3300025926 Unclassified 1084
471 Ga0207687_10001487 3300025927 Bacteria 16057
472 Ga0207687_10029797 3300025927 Bacteria 3673
473 Ga0207687_10113573 3300025927 Bacteria 2015
474 Ga0207687_10482412 3300025927 Bacteria 1032
475 Ga0207700_10001623 3300025928 Bacteria 12780
476 Ga0207700_10131703 3300025928 Bacteria 2042
477 Ga0207700_10579583 3300025928 Bacteria 998
478 Ga0207664_10058259 3300025929 Bacteria 3072
479 Ga0207664_10129499 3300025929 Bacteria 2123
480 Ga0207664_10168751 3300025929 Bacteria 1871
481 Ga0207664_10336295 3300025929 Bacteria 1334
482 Ga0207644_10052064 3300025931 Bacteria 2941
483 Ga0207644_10159352 3300025931 Bacteria 1753
484 Ga0207644_10354181 3300025931 Bacteria 1192
485 Ga0207690_10001328 3300025932 Bacteria 15550
486 Ga0207690_10111781 3300025932 Bacteria 1969
487 Ga0207706_10002409 3300025933 Bacteria 18241
488 Ga0207706_10050021 3300025933 Bacteria 3693
489 Ga0207706_10055598 3300025933 Bacteria 3490
490 Ga0207706_10134040 3300025933 Bacteria 2179
491 Ga0207686_10030378 3300025934 Bacteria 3198
492 Ga0207686_10100453 3300025934 Bacteria 1930
493 Ga0207686_10568768 3300025934 Bacteria 888
494 Ga0207686_10805058 3300025934 Bacteria 753
495 Ga0207709_10000374 3300025935 Bacteria 45115
496 Ga0207709_10182583 3300025935 Bacteria 1483
497 Ga0207709_10886064 3300025935 Bacteria 725
498 Ga0207670_10036530 3300025936 Bacteria 3195
499 Ga0207670_10629806 3300025936 Bacteria 883
500 Ga0207669_10000353 3300025937 Bacteria 20899
501 Ga0207669_10204313 3300025937 Bacteria 1437
502 Ga0207669_10307711 3300025937 Bacteria 1207
503 Ga0207669_10478930 3300025937 Bacteria 992
504 Ga0207704_10000265 3300025938 Bacteria 25185
505 Ga0207704_11014579 3300025938 Bacteria 702
506 Ga0207665_10002010 3300025939 Bacteria 13687
507 Ga0207665_10142203 3300025939 Bacteria 1712
508 Ga0207665_10202137 3300025939 Bacteria 1448
509 Ga0207665_10832618 3300025939 Bacteria 730
510 Ga0207691_10000869 3300025940 Bacteria 30055
511 Ga0207691_10334961 3300025940 Bacteria 1296
512 Ga0207711_10004421 3300025941 Bacteria 11984
513 Ga0207711_10013109 3300025941 Bacteria 6885
514 Ga0207711_10175543 3300025941 Bacteria 1946
515 Ga0207711_10282518 3300025941 Bacteria 1529
516 Ga0207689_10001240 3300025942 Bacteria 24594
517 Ga0207689_10018642 3300025942 Bacteria 5854
518 Ga0207689_10358454 3300025942 Bacteria 1213
519 Ga0207661_10000371 3300025944 Bacteria 28821
520 Ga0207661_10542235 3300025944 Bacteria 1065
521 Ga0207661_11162703 3300025944 Bacteria 710
522 Ga0207679_10000224 3300025945 Bacteria 44681
523 Ga0207679_10063595 3300025945 Bacteria 2755
524 Ga0207679_10144794 3300025945 Bacteria 1926
525 Ga0207679_10209532 3300025945 Bacteria 1633
526 Ga0207679_10319841 3300025945 Bacteria 1343
527 Ga0207679_10394987 3300025945 Bacteria 1215
528 Ga0207667_10135074 3300025949 Bacteria 2540
529 Ga0207667_10720143 3300025949 Bacteria 999
530 Ga0207651_10037760 3300025960 Bacteria 3166
531 Ga0207651_10190011 3300025960 Bacteria 1637
532 Ga0207651_10406676 3300025960 Bacteria 1159
533 Ga0207712_10006600 3300025961 Bacteria 7321
534 Ga0207712_10351230 3300025961 Bacteria 1226
535 Ga0207712_10461261 3300025961 Bacteria 1079
536 Ga0207668_10000284 3300025972 Bacteria 33391
537 Ga0207668_10105223 3300025972 Bacteria 2106
538 Ga0207668_10326304 3300025972 Bacteria 1275
539 Ga0207640_10015972 3300025981 Bacteria 4357
540 Ga0207640_10641800 3300025981 Bacteria 904
541 Ga0207658_10019082 3300025986 Bacteria 4742
542 Ga0207658_10139426 3300025986 Bacteria 1960
543 Ga0207658_10390396 3300025986 Bacteria 1221
544 Ga0207677_10009705 3300026023 Bacteria 5422
545 Ga0207677_10093800 3300026023 Bacteria 2189
546 Ga0207703_10054919 3300026035 Bacteria 3240
547 Ga0207703_10200249 3300026035 Bacteria 1774
548 Ga0207703_10350763 3300026035 Bacteria 1358
549 Ga0207703_10912943 3300026035 Bacteria 841
550 Ga0207639_10006844 3300026041 Bacteria 7766
551 Ga0207678_10000756 3300026067 Bacteria 29533
552 Ga0207678_10020551 3300026067 Bacteria 5788
553 Ga0207678_10052160 3300026067 Bacteria 3530
554 Ga0207678_10224650 3300026067 Bacteria 1608
555 Ga0207708_10004433 3300026075 Bacteria 10349
556 Ga0207708_10089651 3300026075 Bacteria 2370
557 Ga0207708_10183468 3300026075 Bacteria 1662
558 Ga0207708_10346390 3300026075 Bacteria 1218
559 Ga0207702_10016673 3300026078 Bacteria 6082
560 Ga0207702_10264619 3300026078 Bacteria 1620
561 Ga0207702_10320136 3300026078 Bacteria 1477
562 Ga0207641_10003398 3300026088 Bacteria 14113
563 Ga0207641_10209626 3300026088 Bacteria 1801
564 Ga0207641_10515522 3300026088 Bacteria 1163
565 Ga0207641_10584214 3300026088 Bacteria 1092
566 Ga0207641_10688036 3300026088 Bacteria 1006
567 Ga0207648_10000616 3300026089 Bacteria 39912
568 Ga0207648_10240751 3300026089 Bacteria 1611
569 Ga0207676_10000347 3300026095 Bacteria 39680
570 Ga0207676_11147327 3300026095 Bacteria 769
571 Ga0207674_10002264 3300026116 Bacteria 24389
572 Ga0207674_10190125 3300026116 Bacteria 2003
573 Ga0207674_10308982 3300026116 Bacteria 1530
574 Ga0207674_10385273 3300026116 Bacteria 1355
575 Ga0207675_100010802 3300026118 Bacteria 8557
576 Ga0207675_100057594 3300026118 Unclassified 3626
577 Ga0207675_100278562 3300026118 Bacteria 1625
578 Ga0207675_102103102 3300026118 Bacteria 581
579 Ga0207683_10000635 3300026121 Bacteria 32087
580 Ga0207683_10143722 3300026121 Bacteria 2150
581 Ga0207683_10147053 3300026121 Bacteria 2126
582 Ga0207698_10062738 3300026142 Bacteria 2904
583 Ga0209973_1007087 3300027252 Bacteria 1243
584 Ga0209984_1006992 3300027424 Bacteria 1395
585 Ga0209999_1021106 3300027543 Bacteria 1195
586 Ga0210002_1003619 3300027617 Bacteria 2286
587 Ga0209998_10001047 3300027717 Bacteria 6940
588 Ga0209813_10305639 3300027866 Bacteria 619
589 Ga0209974_10004485 3300027876 Bacteria 4970
590 Ga0207428_10000256 3300027907 Bacteria 72918
591 Ga0207428_10000338 3300027907 Bacteria 60937
592 Ga0207428_10086092 3300027907 Bacteria 2446
593 Ga0268266_10115706 3300028379 Bacteria 2381
594 Ga0268266_10926649 3300028379 Bacteria 843
595 Ga0268265_10022010 3300028380 Bacteria 4474
596 Ga0268265_10158326 3300028380 Bacteria 1920
597 Ga0268265_10206704 3300028380 Bacteria 1707
598 Ga0268265_10351582 3300028380 Bacteria 1346
599 Ga0268264_10127826 3300028381 Bacteria 2248
600 Ga0268264_10238998 3300028381 Bacteria 1681
601 Ga0268264_10267874 3300028381 Bacteria 1595
602 Ga0265334_10003956 3300028573 Bacteria 6668
603 Ga0265325_10000707 3300031241 Bacteria 24193
604 Ga0265325_10136421 3300031241 Bacteria 1170
605 Ga0265340_10049816 3300031247 Bacteria 2033
606 Ga0265339_10052866 3300031249 Bacteria 2211
607 Ga0265339_10448872 3300031249 Bacteria 599
608 Ga0265316_10302651 3300031344 Bacteria 1164
609 Ga0265313_10060075 3300031595 Bacteria 1784
610 Ga0265314_10006447 3300031711 Bacteria 10386
611 Ga0373930_0001155 3300034816 Bacteria 3854
612 Ga0373930_0007245 3300034816 Bacteria 1903
613 Ga0373948_0002036 3300034817 Bacteria 2921
614 Ga0373950_0006879 3300034818 Bacteria 1749
615 Ga0373950_0012812 3300034818 Bacteria 1390
616 Ga0373958_0007782 3300034819 Bacteria 1717
617 Ga0373958_0015528 3300034819 Bacteria 1347
618 Ga0373959_0004547 3300034820 Bacteria 2240
619 Ga0373959_0012790 3300034820 Bacteria 1504
620 Ga0373938_0007697 3300034957 Bacteria 1902
621 Ga0373926_0034118 3300035083 Bacteria 1800
622 Ga0373926_0037711 3300035083 Bacteria 1719
623 Ga0373928_0007593 3300035084 Bacteria 2094
624 Ga0373928_0011502 3300035084 Bacteria 1752
625 Ga0373928_0012597 3300035084 Bacteria 1689
626 Ga0373929_0005768 3300035085 Bacteria 2235
627 Ga0373929_0005974 3300035085 Bacteria 2198
628 Ga0373934_0008041 3300035086 Bacteria 3925
629 Ga0373934_0044942 3300035086 Unclassified 1746
630 Ga0373934_0056385 3300035086 Bacteria 1563
631 Ga0373934_0178166 3300035086 Unclassified 873
632 Ga0373940_0015995 3300035088 Bacteria 1853
633 Ga0373940_0016579 3300035088 Bacteria 1826
634 Ga0373940_0209165 3300035088 Bacteria 644
635 Ga0373944_0002044 3300035089 Bacteria 5116
636 Ga0373944_0060803 3300035089 Bacteria 1212
637 Ga0373951_0002018 3300035091 Bacteria 5203
638 Ga0373951_0006340 3300035091 Bacteria 2703
639 Ga0373952_0001998 3300035092 Bacteria 3686
640 Ga0373923_0018427 3300035111 Bacteria 2687
641 Ga0373923_0036530 3300035111 Bacteria 2005
642 Ga0373923_0045038 3300035111 Bacteria 1831
643 Ga0373923_0103951 3300035111 Bacteria 1255
644 Ga0373932_0003036 3300035112 Bacteria 4106
645 Ga0373932_0006656 3300035112 Bacteria 2737
646 Ga0373932_0011254 3300035112 Bacteria 2182
647 Ga0373936_0006174 3300035113 Bacteria 4516
648 Ga0373936_0087237 3300035113 Bacteria 1305
649 Ga0373936_0178310 3300035113 Bacteria 931
650 Ga0373939_0000902 3300035114 Bacteria 7384
651 Ga0373939_0007588 3300035114 Bacteria 2636
652 Ga0373939_0239198 3300035114 Bacteria 702
653 Ga0373941_0003262 3300035115 Bacteria 3659
654 Ga0373941_0009030 3300035115 Bacteria 2498
655 Ga0373941_0028147 3300035115 Bacteria 1647
656 Ga0373941_0141682 3300035115 Bacteria 875
657 Ga0373945_0056159 3300035116 Bacteria 1459
658 Ga0373945_0096156 3300035116 Bacteria 1153
659 Ga0373953_0010155 3300035117 Bacteria 3264
660 Ga0373953_0066542 3300035117 Bacteria 1481
661 Ga0373954_0015168 3300035118 Bacteria 3442
662 Ga0373954_0037050 3300035118 Bacteria 2266
663 Ga0373954_0037323 3300035118 Bacteria 2258
664 Ga0373954_0037660 3300035118 Bacteria 2248
665 Ga0373956_0005035 3300035119 Bacteria 5295
666 Ga0373956_0036696 3300035119 Bacteria 2164
667 Ga0373956_0076730 3300035119 Bacteria 1529
668 Ga0373956_0483191 3300035119 Bacteria 591
669 Ga0373957_0003814 3300035120 Bacteria 4518
670 Ga0373957_0009661 3300035120 Bacteria 3162
671 Ga0373957_0017846 3300035120 Unclassified 2478
672 Ga0373957_0036433 3300035120 Bacteria 1833
673 Ga0373960_0003326 3300035121 Bacteria 3638
674 Ga0373960_0008439 3300035121 Bacteria 2468
675 Ga0373960_0081624 3300035121 Bacteria 1019
676 Ga0373943_0005971 3300035170 Bacteria 5464
677 Ga0373943_0119066 3300035170 Bacteria 1401
678 Ga0373946_0004752 3300035171 Bacteria 4884
679 Ga0373946_0006500 3300035171 Bacteria 4239
680 Ga0373946_0453148 3300035171 Bacteria 653
681 Ga0373955_0005173 3300035172 Bacteria 5837
682 Ga0373955_0007863 3300035172 Bacteria 4919
683 Ga0373955_0517190 3300035172 Bacteria 729
684 Ga0373942_0005209 3300035207 Bacteria 3012
685 Ga0373942_0044827 3300035207 Bacteria 1219
686 Ga0373961_0005123 3300035241 Bacteria 3152
687 Ga0373961_0015491 3300035241 Bacteria 1950
688 Ga0373962_0001573 3300035242 Bacteria 5412
689 Ga0373962_0002923 3300035242 Bacteria 4098
690 Ga0373962_0039205 3300035242 Bacteria 1328
691 Ga0373962_0093379 3300035242 Bacteria 930
692 Ga0373924_0120206 3300035410 Unclassified 1139
693 Ga0373924_0125633 3300035410 Bacteria 1115
694 Ga0373924_0127675 3300035410 Bacteria 1106
695 Ga0373931_0000456 3300035691 Bacteria 16713
696 Ga0373931_0001189 3300035691 Bacteria 11121
697 Ga0373931_0118820 3300035691 Bacteria 1508
698 Ga0373935_0030859 3300035692 Bacteria 3322
699 Ga0373935_0053800 3300035692 Bacteria 2561
700 Ga0373935_0250869 3300035692 Bacteria 1238
701 Ga0373935_0365868 3300035692 Bacteria 1030
702 Ga0373935_0895358 3300035692 Bacteria 657
703 Ga0373927_0175896 3300035695 Bacteria 1403
704 Ga0373927_0602911 3300035695 Bacteria 726
705 Ga0373933_0002021 3300035724 Bacteria 11686
706 Ga0373933_0016901 3300035724 Bacteria 4088
707 Ga0373933_0105401 3300035724 Bacteria 1753
708 Ga0373933_0138364 3300035724 Bacteria 1536
709 Ga0373933_0139654 3300035724 Bacteria 1529
710 Ga0373933_0149708 3300035724 Bacteria 1477
711 Ga0373947_0006649 3300035725 Bacteria 6710
712 Ga0373947_0049439 3300035725 Bacteria 2525
713 Ga0373947_0347027 3300035725 Bacteria 995
714 Ga0373937_0005606 3300036401 Bacteria 10776
715 Ga0373937_0023398 3300036401 Bacteria 5562
716 Ga0373937_0030734 3300036401 Bacteria 4864
717 Ga0373937_0073482 3300036401 Bacteria 3154
718 Ga0373937_0113516 3300036401 Bacteria 2521
719 Ga0373937_0388481 3300036401 Bacteria 1324
720 Ga0373937_0426103 3300036401 Bacteria 1259
721 Ga0373937_0626511 3300036401 Bacteria 1021
722 Ga0373925_0056668 3300037068 Bacteria 2936
723 Ga0373925_0195252 3300037068 Bacteria 1607
724 Ga0373925_0275903 3300037068 Bacteria 1353
725 Ga0395900_0030019 3300037418 Bacteria 5580
726 Ga0395898_0180867 3300037466 Bacteria 2015
727 Ga0436364_0172918 3300037853 Bacteria 18712
728 Ga0436364_0468701 3300037853 Bacteria 1275
729 Ga0436364_1358998 3300037853 Bacteria 4177
730 Ga0395901_0182002 3300038443 Bacteria 2204
731 Ga0395901_0192454 3300038443 Bacteria 2139
732 Ga0242420_023320 3300038996 Bacteria 1117
733 Ga0436365_0186088 3300039437 Bacteria 757
734 Ga0436365_0421649 3300039437 Bacteria 723
735 Ga0436365_1250625 3300039437 Unclassified 950
736 Ga0436365_1269348 3300039437 Bacteria 964
737 Ga0436365_1327329 3300039437 Bacteria 1085
738 Ga0436365_1848984 3300039437 Bacteria 1045
739 Ga0436360_0296707 3300039438 Bacteria 4126
740 Ga0436360_0342520 3300039438 Bacteria 1194
741 Ga0436360_0697918 3300039438 Bacteria 2248
742 Ga0436360_1048989 3300039438 Unclassified 1478
743 Ga0436361_1180233 3300039447 Bacteria 1152
744 Ga0436363_1365906 3300039450 Unclassified 1402
745 Ga0436363_1699543 3300039450 Unclassified 750
746 Ga0436362_0594923 3300039453 Bacteria 2496
747 Ga0436362_0895477 3300039453 Bacteria 1876
748 Ga0436362_0985321 3300039453 Bacteria 3046
749 Ga0436362_1038513 3300039453 Bacteria 1553
750 Ga0436362_1145440 3300039453 Bacteria 761
751 Ga0439453_0036440 3300041408 Bacteria 951
752 Ga0439448_0018354 3300042005 Bacteria 2143
753 Ga0439460_0021984 3300042461 Bacteria 1747
754 Ga0466963_0500664 3300044694 Bacteria 858
755 Ga0453684_0159277 3300044712 Bacteria 2672
756 Ga0466957_0438866 3300044842 Bacteria 898
757 Ga0451576_0468538 3300045051 Bacteria 1323
758 Ga0466967_0066717 3300045976 Bacteria 3207
759 Ga0495592_0014180 3300046454 Bacteria 6056
760 Ga0495592_0014723 3300046454 Bacteria 5939
761 Ga0495592_0034688 3300046454 Bacteria 3802
762 Ga0495592_0364409 3300046454 Bacteria 923
763 Ga0495592_0684464 3300046454 Unclassified 618
764 Ga0495603_0031400 3300046455 Bacteria 3197
765 Ga0495603_0070882 3300046455 Bacteria 2048
766 Ga0495603_0071470 3300046455 Bacteria 2039
767 Ga0495629_0001083 3300046459 Bacteria 21626
768 Ga0495629_0039078 3300046459 Bacteria 3340
769 Ga0495638_0333984 3300046460 Bacteria 805
770 Ga0495641_0010963 3300046461 Bacteria 5204
771 Ga0495641_0071353 3300046461 Bacteria 1559
772 Ga0495641_0112010 3300046461 Bacteria 1217
773 Ga0495651_0078923 3300046462 Bacteria 2489
774 Ga0495651_0188928 3300046462 Bacteria 1451
775 Ga0495651_0194694 3300046462 Bacteria 1423
776 Ga0495653_0035586 3300046463 Bacteria 3928
777 Ga0495653_0052046 3300046463 Bacteria 3140
778 Ga0495653_0055919 3300046463 Bacteria 3010
779 Ga0495653_0727090 3300046463 Unclassified 601
780 Ga0495580_0052480 3300046472 Bacteria 2879
781 Ga0495580_0068596 3300046472 Bacteria 2479
782 Ga0495582_0008478 3300046473 Bacteria 5671
783 Ga0495582_0048374 3300046473 Bacteria 2341
784 Ga0495639_0012788 3300046475 Bacteria 3621
785 Ga0495639_0037629 3300046475 Bacteria 2169
786 Ga0495662_0017471 3300046476 Bacteria 3471
787 Ga0495664_0008862 3300046477 Bacteria 5621
788 Ga0495664_0141932 3300046477 Bacteria 1456
789 Ga0495664_0323053 3300046477 Bacteria 930
790 Ga0495584_0497292 3300046491 Unclassified 621
791 Ga0495585_0017542 3300046492 Bacteria 4135
792 Ga0495594_0028091 3300046499 Bacteria 3034
793 Ga0495594_0070962 3300046499 Bacteria 1936
794 Ga0495607_0038290 3300046501 Bacteria 2873
795 Ga0495583_0289549 3300046506 Bacteria 652
796 Ga0495608_0025074 3300046511 Bacteria 4072
797 Ga0495608_0115130 3300046511 Bacteria 1726
798 Ga0495608_0151331 3300046511 Bacteria 1478
799 Ga0495608_0430839 3300046511 Bacteria 804
800 Ga0495616_0272769 3300046513 Unclassified 721
801 Ga0495618_0006625 3300046514 Bacteria 7020
802 Ga0495618_0046556 3300046514 Bacteria 2737
803 Ga0495628_0123271 3300046516 Bacteria 1986
804 Ga0495628_0192253 3300046516 Bacteria 1540
805 Ga0495630_0016770 3300046517 Bacteria 5359
806 Ga0495630_0066890 3300046517 Bacteria 2701
807 Ga0495644_0007689 3300046523 Bacteria 4156
808 Ga0495666_0020697 3300046526 Bacteria 3257
809 Ga0495652_0083034 3300046529 Bacteria 2638
810 Ga0495652_0156496 3300046529 Bacteria 1774
811 Ga0495652_0229539 3300046529 Bacteria 1389
812 Ga0495665_0016353 3300046531 Bacteria 3998
813 Ga0495640_0060069 3300046533 Bacteria 2586
814 Ga0495640_0083163 3300046533 Bacteria 2124
815 Ga0495640_0407473 3300046533 Bacteria 834
816 Ga0495586_0062944 3300046535 Bacteria 2020
817 Ga0495586_0121495 3300046535 Bacteria 1459
818 Ga0495587_0032403 3300046536 Bacteria 3160
819 Ga0495587_0041143 3300046536 Bacteria 2758
820 Ga0495587_0051587 3300046536 Bacteria 2431
821 Ga0495598_0023053 3300046537 Bacteria 1672
822 Ga0495645_0047821 3300046543 Bacteria 3116
823 Ga0495645_0106395 3300046543 Bacteria 1989
824 Ga0495622_0018549 3300046557 Bacteria 3241
825 Ga0495667_0017147 3300046559 Bacteria 4891
826 Ga0495667_0024353 3300046559 Bacteria 4076
827 Ga0495667_0031146 3300046559 Bacteria 3581
828 Ga0495667_0036511 3300046559 Bacteria 3280
829 Ga0495667_0042796 3300046559 Bacteria 3003
830 Ga0495634_0043965 3300046642 Bacteria 3026
831 Ga0495634_0054684 3300046642 Bacteria 2670
832 Ga0495611_0129987 3300046648 Bacteria 1174
833 Ga0495635_0090219 3300046663 Bacteria 2096
834 Ga0495635_0262941 3300046663 Bacteria 1162
835 Ga0495659_0010862 3300046664 Bacteria 2931
836 Ga0495657_0004474 3300046675 Bacteria 11174
837 Ga0495657_0097325 3300046675 Bacteria 1879
838 Ga0495657_0199419 3300046675 Bacteria 1220
839 Ga0495599_0072874 3300046678 Bacteria 2143
840 Ga0495599_0102840 3300046678 Bacteria 1780
841 Ga0495599_0215668 3300046678 Bacteria 1175
842 Ga0495623_0037694 3300046679 Bacteria 3092
843 Ga0495646_0035965 3300046680 Bacteria 3069
844 Ga0495646_0136543 3300046680 Bacteria 1375
845 Ga0495647_0007965 3300046681 Bacteria 3561
846 Ga0495647_0009359 3300046681 Bacteria 3317
847 Ga0495647_0190726 3300046681 Bacteria 895
848 Ga0495658_0000657 3300046683 Bacteria 18752
849 Ga0495658_0041696 3300046683 Bacteria 2559
850 Ga0495658_0049728 3300046683 Bacteria 2368
851 Ga0495658_0063602 3300046683 Bacteria 2123
852 Ga0495669_0298046 3300046684 Bacteria 777
853 Ga0495613_0027530 3300046689 Bacteria 4230
854 Ga0495613_0056832 3300046689 Bacteria 2873
855 Ga0495624_0010273 3300046690 Bacteria 6451
856 Ga0495670_0005981 3300046691 Bacteria 5959
857 Ga0495671_0251470 3300046692 Bacteria 853
858 Ga0495600_0036766 3300046809 Bacteria 3182
859 Ga0495600_0070247 3300046809 Bacteria 2288
860 Ga0495600_0075100 3300046809 Bacteria 2207
861 Ga0495581_0024119 3300047315 Bacteria 3524
862 Ga0495581_0038908 3300047315 Bacteria 2753
863 Ga0495604_0023975 3300047317 Bacteria 4870
864 Ga0495604_0032475 3300047317 Bacteria 4136
865 Ga0495604_0129670 3300047317 Bacteria 1814
866 Ga0495604_0336133 3300047317 Bacteria 1006
867 Ga0495604_0524695 3300047317 Bacteria 766
868 Ga0495674_0048828 3300047319 Bacteria 3742
869 Ga0495674_0328938 3300047319 Bacteria 1243
870 Ga0495676_0151527 3300047321 Bacteria 1649
871 Ga0495676_0187399 3300047321 Bacteria 1445
872 Ga0495680_0011464 3300047322 Bacteria 7847
873 Ga0495680_0015033 3300047322 Bacteria 6685
874 Ga0495680_0027040 3300047322 Bacteria 4720
875 Ga0495680_0133289 3300047322 Bacteria 1823
876 Ga0495680_0328229 3300047322 Bacteria 1069
877 Ga0495675_0125936 3300047444 Bacteria 1594
878 Ga0495675_0231718 3300047444 Bacteria 1114
879 Ga0495677_0160348 3300047445 Bacteria 868
880 Ga0495677_0203376 3300047445 Bacteria 770
881 Ga0495679_085464 3300047446 Bacteria 891
882 Ga0495681_0182685 3300047470 Bacteria 861
883 Ga0495684_0064317 3300047471 Bacteria 2787
884 Ga0495684_0107787 3300047471 Bacteria 2104
885 Ga0495684_0127401 3300047471 Bacteria 1915
886 Ga0495684_0515967 3300047471 Bacteria 819
887 Ga0495686_0002628 3300047472 Bacteria 16632
888 Ga0495593_0015003 3300047673 Bacteria 4400
889 Ga0495593_0047421 3300047673 Bacteria 2285
890 Ga0495593_0083154 3300047673 Bacteria 1654
891 Ga0495602_0067594 3300048088 Bacteria 3074
892 Ga0495602_0075417 3300048088 Bacteria 2862
893 Ga0495602_0118134 3300048088 Bacteria 2139
894 Ga0495602_0458491 3300048088 Bacteria 898
895 Ga0496100_0043390 3300048903 Bacteria 2875
896 Ga0496100_0093381 3300048903 Bacteria 2058
897 Ga0496100_0723402 3300048903 Bacteria 777
898 Ga0496101_0039951 3300048904 Bacteria 3340
899 Ga0496101_0790244 3300048904 Bacteria 748
900 Ga0496102_0120761 3300048905 Bacteria 2447
901 Ga0496102_0146137 3300048905 Bacteria 2219
902 Ga0496102_0203808 3300048905 Bacteria 1864
903 Ga0496102_0263614 3300048905 Bacteria 1624
904 Ga0496102_0345265 3300048905 Bacteria 1401
905 Ga0496102_1108427 3300048905 Bacteria 711
906 Ga0496103_0032545 3300048906 Bacteria 3182
907 Ga0496103_0134740 3300048906 Bacteria 1578
908 Ga0496104_0001026 3300048907 Bacteria 23907
909 Ga0496104_0084764 3300048907 Bacteria 3024
910 Ga0496104_0161480 3300048907 Bacteria 2149
911 Ga0496104_0410381 3300048907 Bacteria 1267
912 Ga0496105_0048461 3300048908 Bacteria 3506
913 Ga0496105_0063288 3300048908 Bacteria 3052
914 Ga0496105_0114002 3300048908 Bacteria 2229
915 Ga0496105_0273257 3300048908 Bacteria 1364
916 Ga0496105_0588876 3300048908 Bacteria 864
917 Ga0496106_0077045 3300048909 Bacteria 2556
918 Ga0496106_0147132 3300048909 Bacteria 1856
919 Ga0496106_0179245 3300048909 Bacteria 1681
920 Ga0496106_0777419 3300048909 Bacteria 760
921 Ga0496106_1481587 3300048909 Bacteria 522
922 Ga0496107_0010208 3300048910 Bacteria 6515
923 Ga0496107_0012830 3300048910 Bacteria 5856
924 Ga0496107_0079757 3300048910 Bacteria 2386
925 Ga0496108_0038783 3300048911 Bacteria 3969
926 Ga0496108_0051869 3300048911 Bacteria 3436
927 Ga0496108_0108553 3300048911 Bacteria 2371
928 Ga0496108_0110196 3300048911 Bacteria 2353
929 Ga0496109_0000211 3300048912 Bacteria 57066
930 Ga0496109_0005410 3300048912 Bacteria 10678
931 Ga0496109_0210473 3300048912 Bacteria 1829
932 Ga0496109_0247786 3300048912 Bacteria 1677
933 Ga0496109_0339553 3300048912 Bacteria 1418
934 Ga0496110_0029267 3300048913 Bacteria 4739
935 Ga0496110_0112176 3300048913 Bacteria 2451
936 Ga0496110_0170330 3300048913 Bacteria 1975
937 Ga0496110_0197748 3300048913 Bacteria 1826
938 Ga0496110_1148489 3300048913 Bacteria 685
939 Ga0496111_0057100 3300048914 Bacteria 2825
940 Ga0496111_0127848 3300048914 Bacteria 1879
941 Ga0496112_0018318 3300048915 Bacteria 6592
942 Ga0496112_0029842 3300048915 Bacteria 5275
943 Ga0496112_0171079 3300048915 Bacteria 2137
944 Ga0496113_0070215 3300048916 Bacteria 2662
945 Ga0496113_0086591 3300048916 Bacteria 2407
946 Ga0496113_0158489 3300048916 Bacteria 1788
947 Ga0496113_0222427 3300048916 Bacteria 1504
948 Ga0496113_0240647 3300048916 Bacteria 1444
949 Ga0496113_0267699 3300048916 Bacteria 1365
950 Ga0496114_0012331 3300048917 Bacteria 6840
951 Ga0496114_0250164 3300048917 Bacteria 1559
952 Ga0496114_1213138 3300048917 Bacteria 641
953 Ga0496115_0020154 3300048918 Bacteria 5140
954 Ga0496115_0134879 3300048918 Bacteria 2035
955 Ga0496115_0166033 3300048918 Bacteria 1825
956 Ga0496115_0288086 3300048918 Bacteria 1347
957 Ga0496115_0489547 3300048918 Bacteria 989
958 Ga0496115_0601490 3300048918 Bacteria 874
959 Ga0501038_0540985 3300049574 Bacteria 887
960 Ga0501042_0912024 3300049578 Bacteria 640
961 Ga0501067_0461755 3300049583 Bacteria 709
962 Ga0501071_0547108 3300049587 Bacteria 889
963 Ga0501071_0992080 3300049587 Bacteria 649
964 Ga0501072_0763662 3300049588 Bacteria 758
965 Ga0501073_0136552 3300049589 Bacteria 1700
966 Ga0501075_0863376 3300049591 Bacteria 688
967 Ga0501076_0493485 3300049592 Bacteria 1009
968 Ga0501077_0060241 3300049593 Bacteria 2409
969 Ga0501077_0226068 3300049593 Bacteria 1190
970 Ga0501079_0315950 3300049741 Bacteria 1223
971 Ga0501079_0325269 3300049741 Bacteria 1204
972 Ga0501081_0220178 3300049743 Bacteria 1380
973 Ga0501081_0307836 3300049743 Bacteria 1163
974 Ga0501044_0916031 3300049823 Unclassified 751
975 Ga0501044_1015906 3300049823 Bacteria 701
976 Ga0501045_0542706 3300049824 Bacteria 863
977 nmdc:mga03683_22960_c1 3300050489 Bacteria 2424
978 nmdc:mga03683_299330_c1 3300050489 Bacteria 754
979 nmdc:mga03683_8800_c1 3300050489 Bacteria 3563
980 nmdc:mga03n38_20921_c1 3300050490 Bacteria 2625
981 nmdc:mga03n38_216203_c1 3300050490 Bacteria 998
982 nmdc:mga00v17_461330_c1 3300050491 Bacteria 824
983 nmdc:mga0yw44_891729_c1 3300050492 Bacteria 603
984 nmdc:mga0k408_15938_c1 3300050493 Bacteria 2480
985 nmdc:mga0k408_3337_c2 3300050493 Bacteria 7320
986 nmdc:mga06z11_50594_c1 3300050494 Bacteria 2124
987 nmdc:mga06z11_62736_c1 3300050494 Bacteria 1942
988 nmdc:mga04h51_6758_c1 3300050495 Bacteria 2994
989 nmdc:mga07m45_223270_c1 3300050496 Bacteria 1096
990 nmdc:mga07m45_49013_c1 3300050496 Bacteria 2376
991 nmdc:mga05p37_12232_c1 3300050507 Bacteria 10248
992 nmdc:mga05p37_88924_c1 3300050507 Bacteria 3807
993 nmdc:mga09592_2014_c1 3300050508 Bacteria 16388
994 nmdc:mga0qj67_853_c1 3300050509 Bacteria 20926
995 nmdc:mga06r32_2147_c1 3300050510 Bacteria 17624
996 nmdc:mga08y16_115404_c1 3300050511 Bacteria 2796
997 nmdc:mga08y16_2382_c1 3300050511 Bacteria 19292
998 nmdc:mga08y16_34723_c1 3300050511 Bacteria 5299
999 nmdc:mga0n895_108615_c1 3300050512 Bacteria 2789
1000 nmdc:mga0n895_171_c1 3300050512 Bacteria 40104
1001 nmdc:mga0n895_198042_c1 3300050512 Bacteria 2040
1002 nmdc:mga0n895_605_c1 3300050512 Bacteria 24828
1003 nmdc:mga0n895_60719_c1 3300050512 Bacteria 3731
1004 nmdc:mga0n895_616853_c1 3300050512 Bacteria 1086
1005 nmdc:mga0n895_6888_c1 3300050512 Bacteria 9709
1006 nmdc:mga0rr50_227_c1 3300050513 Bacteria 30396
1007 nmdc:mga0rr50_372592_c1 3300050513 Bacteria 1203
1008 nmdc:mga0rr50_410553_c1 3300050513 Bacteria 1145
1009 nmdc:mga0rr50_92072_c1 3300050513 Bacteria 2363
1010 nmdc:mga08x19_279968_c1 3300050514 Bacteria 1155
1011 nmdc:mga08x19_295907_c1 3300050514 Bacteria 1124
1012 nmdc:mga0a205_6279_c1 3300050515 Bacteria 10728
1013 nmdc:mga0a205_650646_c1 3300050515 Bacteria 905
1014 Ga0495601_0002332 3300053077 Bacteria 10741
1015 Ga0495601_0042033 3300053077 Bacteria 2866
1016 Ga0495601_0050228 3300053077 Bacteria 2630
1017 Ga0495601_0061603 3300053077 Bacteria 2381
1018 Ga0495601_0068681 3300053077 Bacteria 2259
1019 Ga0495601_0071170 3300053077 Bacteria 2221
1020 Ga0495601_0257013 3300053077 Bacteria 1140
1021 Ga0495612_0002302 3300053078 Bacteria 7865
1022 Ga0495612_0008576 3300053078 Bacteria 4145
1023 Ga0495612_0023184 3300053078 Bacteria 2489
1024 Ga0495612_0025709 3300053078 Bacteria 2364
1025 Ga0495612_0087164 3300053078 Bacteria 1317
1026 Ga0495612_0126728 3300053078 Bacteria 1101
1027 Ga0495595_0008233 3300053084 Bacteria 4281
1028 Ga0495595_0010670 3300053084 Bacteria 3824
1029 Ga0495595_0018944 3300053084 Bacteria 2980
1030 Ga0495595_0023442 3300053084 Bacteria 2717
1031 Ga0495595_0118497 3300053084 Bacteria 1288
1032 Ga0495595_0120075 3300053084 Unclassified 1280
1033 Ga0495595_0276122 3300053084 Bacteria 843
1034 Ga0495595_0354363 3300053084 Bacteria 741
1035 Ga0495619_0000105 3300053085 Bacteria 62599
1036 Ga0495619_0000826 3300053085 Bacteria 20303
1037 Ga0495619_0007484 3300053085 Bacteria 6916
1038 Ga0495619_0012732 3300053085 Bacteria 5293
1039 Ga0495619_0052120 3300053085 Bacteria 2704
1040 Ga0495619_0108886 3300053085 Bacteria 1891
1041 Ga0495619_0164419 3300053085 Bacteria 1533
1042 Ga0500578_0288828 3300053086 Bacteria 976
1043 Ga0500643_015685 3300053087 Bacteria 2589
1044 Ga0500644_0002887 3300053088 Bacteria 4267
1045 Ga0500651_0012416 3300053093 Bacteria 5165
1046 Ga0500566_0068402 3300053094 Bacteria 1997
1047 Ga0500566_0204223 3300053094 Unclassified 995
1048 Ga0500641_0000586 3300053096 Bacteria 13113
1049 Ga0500650_0019903 3300053098 Bacteria 2937
1050 Ga0500595_000016 3300053119 Bacteria 211397
1051 Ga0500616_0000006 3300053153 Bacteria 944738
1052 Ga0500616_0003550 3300053153 Bacteria 11819
1053 Ga0500645_000563 3300053730 Bacteria 24381
1054 Ga0501084_0068279 3300054114 Bacteria 2976
1055 Ga0501082_0116497 3300060353 Bacteria 2314
1056 Ga0530510_0146007 3300061734 Bacteria 1745
1057 2643774441 2643221551 Bacteria 3750538
1058 2643792886 2643221555 Bacteria 3749717
1059 Ga0207692_10314733
1060 ARcpr5oldR_c001102
1061 ARSoilYngRDRAFT_c01134
1062 ARSoilOldRDRAFT_c000194
1063 ARCol0yngRDRAFT_1000833
1064 JGI24032J14994_101065
1065 JGI24746J21847_1000495
1066 JGI24747J21853_1001963
1067 JGI24739J22299_10001299
1068 JGI24750J21931_1000493
1069 JGI24748J21848_1004930
1070 JGI24738J21930_10000506
1071 JGI24749J21850_1001158
1072 JGI24744J21845_10027423
1073 JGI24034J26672_10008361
1074 JGI24742J22300_10003727
1075 JGI24751J29686_10039380
1076 JGI26145J50221_1006328
1077 Ga0065712_10072710
1078 Ga0065712_10244275
1079 Ga0065715_10004320
1080 Ga0065715_10037744
1081 Ga0070658_10009108
1082 Ga0070676_10016795
1083 Ga0070676_11079621
1084 Ga0070683_100003556
1085 Ga0070683_100148983
1086 Ga0070683_100399368
1087 Ga0070690_100017989
1088 Ga0070690_100176509
1089 Ga0070690_100245782
1090 Ga0070690_100291265
1091 Ga0070690_100522901
1092 Ga0070670_100008291
1093 Ga0070670_100374034
1094 Ga0070670_100592443
1095 Ga0070670_100861511
1096 Ga0070677_10004318
1097 Ga0068869_100001645
1098 Ga0068869_100083099
1099 Ga0068869_100359195
1100 Ga0070666_10021722
1101 Ga0070666_10259398
1102 Ga0070666_10964258
1103 Ga0070680_100001406
1104 Ga0070680_100007032
1105 Ga0070680_100102341
1106 Ga0070680_100233386
1107 Ga0070680_100593317
1108 Ga0070682_100013294
1109 Ga0070682_100021362
1110 Ga0070682_100116347
1111 Ga0068868_100008818
1112 Ga0068868_100308577
1113 Ga0070660_100005193
1114 Ga0070660_100375820
1115 Ga0070660_100724508
1116 Ga0070689_100008604
1117 Ga0070689_100075116
1118 Ga0070689_100153068
1119 Ga0070689_100460351
1120 Ga0070689_100558865
1121 Ga0070691_10003570
1122 Ga0070691_10069685
1123 Ga0070687_100000814
1124 Ga0070687_100068757
1125 Ga0070661_100025170
1126 Ga0070661_100396884
1127 Ga0070661_100999666
1128 Ga0070692_10033441
1129 Ga0070668_100000327
1130 Ga0070668_100090356
1131 Ga0070668_100805716
1132 Ga0070669_100004627
1133 Ga0070669_100059577
1134 Ga0070675_100000633
1135 Ga0070675_100159505
1136 Ga0070671_100000738
1137 Ga0070671_100047745
1138 Ga0070671_100609623
1139 Ga0070674_100000211
1140 Ga0070674_100093560
1141 Ga0070674_100455324
1142 Ga0070674_100542380
1143 Ga0070673_100000736
1144 Ga0070673_100027886
1145 Ga0070673_100073956
1146 Ga0070673_101177616
1147 Ga0070688_100012623
1148 Ga0070688_100050586
1149 Ga0070688_100091180
1150 Ga0070688_100368035
1151 Ga0070659_100000508
1152 Ga0070659_100229903
1153 Ga0070667_100006728
1154 Ga0070667_101514449
1155 Ga0070703_10003437
1156 Ga0070703_10076684
1157 Ga0070709_10014167
1158 Ga0070709_10051924
1159 Ga0070714_100035933
1160 Ga0070714_100094771
1161 Ga0070714_100226224
1162 Ga0070713_100013021
1163 Ga0070713_100100376
1164 Ga0070713_100158839
1165 Ga0070713_100287315
1166 Ga0070713_100880141
1167 Ga0070713_101100363
1168 Ga0070713_101254063
1169 Ga0070710_10003802
1170 Ga0070710_10021231
1171 Ga0070710_10666680
1172 Ga0070701_10001645
1173 Ga0070701_11142013
1174 Ga0070711_100333180
1175 Ga0070711_100733695
1176 Ga0070705_100342912
1177 Ga0070700_100002387
1178 Ga0070700_100179619
1179 Ga0070700_100203976
1180 Ga0070700_100252850
1181 Ga0070694_100002705
1182 Ga0070694_100022727
1183 Ga0070708_100174330
1184 Ga0070708_101915286
1185 Ga0070663_100000815
1186 Ga0070663_100055426
1187 Ga0070663_100514866
1188 Ga0070663_100901845
1189 Ga0070678_100055998
1190 Ga0070678_100123520
1191 Ga0070662_100009625
1192 Ga0070662_100137798
1193 Ga0070681_10015221
1194 Ga0070681_10037495
1195 Ga0070681_10038319
1196 Ga0070681_10138771
1197 Ga0070681_10145327
1198 Ga0070681_10648698
1199 Ga0068867_100000652
1200 Ga0070685_10003090
1201 Ga0070685_10004123
1202 Ga0070685_10105700
1203 Ga0070706_100070387
1204 Ga0070706_100101892
1205 Ga0070706_101420975
1206 Ga0070707_100706268
1207 Ga0070698_100027073
1208 Ga0070698_100536019
1209 Ga0070699_100040041
1210 Ga0070699_100671763
1211 Ga0070699_101053391
1212 Ga0070679_100021378
1213 Ga0070679_100031573
1214 Ga0070679_100134342
1215 Ga0070679_100180329
1216 Ga0070679_100725618
1217 Ga0070684_100009390
1218 Ga0070684_100121428
1219 Ga0070684_100553272
1220 Ga0070684_101171120
1221 Ga0070697_100132293
1222 Ga0070697_100206403
1223 Ga0070697_100411036
1224 Ga0070697_100782223
1225 Ga0068853_100033052
1226 Ga0070672_100010446
1227 Ga0070672_100159788
1228 Ga0070672_100284181
1229 Ga0070686_100005337
1230 Ga0070686_100019247
1231 Ga0070686_100207680
1232 Ga0070686_101699220
1233 Ga0070695_100000791
1234 Ga0070695_100254442
1235 Ga0070696_100031267
1236 Ga0070696_100097449
1237 Ga0070696_100183889
1238 Ga0070696_100434966
1239 Ga0070696_100586564
1240 Ga0070693_100010016
1241 Ga0070665_100073390
1242 Ga0070665_100375699
1243 Ga0070665_101826270
1244 Ga0070704_100026728
1245 Ga0068855_100041815
1246 Ga0068855_100051893
1247 Ga0068855_101104328
1248 Ga0070664_100002092
1249 Ga0070664_100055051
1250 Ga0070664_100090607
1251 Ga0070664_100213516
1252 Ga0070664_100290706
1253 Ga0070664_101384584
1254 Ga0068857_100014842
1255 Ga0068857_100120910
1256 Ga0068854_100013287
1257 Ga0068856_100012787
1258 Ga0068856_100297558
1259 Ga0070702_100000664
1260 Ga0070702_100717620
1261 Ga0068852_100088794
1262 Ga0068852_100685592
1263 Ga0068859_100021689
1264 Ga0068859_100062548
1265 Ga0068859_100078290
1266 Ga0068864_100029489
1267 Ga0068866_10013065
1268 Ga0068866_10132425
1269 Ga0068861_100086909
1270 Ga0068861_100254322
1271 Ga0068851_10655512
1272 Ga0068870_10001203
1273 Ga0068870_10247364
1274 Ga0068870_10512045
1275 Ga0068863_100001709
1276 Ga0068863_100173074
1277 Ga0068863_100340115
1278 Ga0068863_100399671
1279 Ga0068858_100006236
1280 Ga0068858_100393571
1281 Ga0068860_100002355
1282 Ga0068860_100193378
1283 Ga0068860_100221258
1284 Ga0068860_100710994
1285 Ga0068860_101196928
1286 Ga0068862_100020174
1287 Ga0068862_100118494
1288 Ga0068862_100262668
1289 Ga0081455_10000237
1290 Ga0081455_10059737
1291 Ga0081455_10074285
1292 Ga0081455_10224245
1293 Ga0081455_10609741
1294 Ga0081540_1034662
1295 Ga0081540_1060320
1296 Ga0070717_10002340
1297 Ga0075363_100187569
1298 Ga0075363_100207777
1299 Ga0075364_10234635
1300 Ga0075364_10269301
1301 Ga0075364_10319679
1302 Ga0075432_10111959
1303 Ga0070715_10007901
1304 Ga0070715_10026837
1305 Ga0070716_100010298
1306 Ga0070712_100013539
1307 Ga0070712_100084087
1308 Ga0070712_100182201
1309 Ga0070712_100190528
1310 Ga0070712_100256783
1311 Ga0070712_100304224
1312 Ga0070712_101268567
1313 Ga0075362_10045900
1314 Ga0075362_10054677
1315 Ga0075362_10188292
1316 Ga0075362_10213391
1317 Ga0075362_10661996
1318 Ga0075367_10009109
1319 Ga0075367_10040927
1320 Ga0075367_10103405
1321 Ga0075367_10217034
1322 Ga0075369_10012698
1323 Ga0075369_10302836
1324 Ga0075366_10001526
1325 Ga0075366_10028964
1326 Ga0097621_100013205
1327 Ga0097621_100016048
1328 Ga0075370_10008507
1329 Ga0075370_10181435
1330 Ga0075370_10194030
1331 Ga0068871_100002813
1332 Ga0068871_100012582
1333 Ga0068871_100137152
1334 Ga0075428_100009659
1335 Ga0075428_101128255
1336 Ga0075430_100003548
1337 Ga0075431_100007309
1338 Ga0075433_10000385
1339 Ga0075433_10017361
1340 Ga0075433_10240532
1341 Ga0075434_100001834
1342 Ga0075434_100002777
1343 Ga0075434_100034528
1344 Ga0075434_100057623
1345 Ga0075434_100109859
1346 Ga0075434_100213441
1347 Ga0075429_100006121
1348 Ga0068865_100008168
1349 Ga0068865_100218330
1350 Ga0097620_100021689
1351 Ga0097620_100062547
1352 Ga0097620_100078296
1353 Ga0075435_100000959
1354 Ga0075435_100004768
1355 Ga0075435_100007344
1356 Ga0075435_100210323
1357 Ga0075435_100423390
1358 Ga0075435_100483204
1359 Ga0075435_100491439
1360 Ga0105251_10322103
1361 Ga0105240_10008002
1362 Ga0105240_11325890
1363 Ga0111539_10000500
1364 Ga0111539_10010854
1365 Ga0111539_10173769
1366 Ga0111539_10385074
1367 Ga0111539_11236135
1368 Ga0111539_11759069
1369 Ga0105245_10000661
1370 Ga0105245_10062727
1371 Ga0105245_10497294
1372 Ga0105245_10716382
1373 Ga0105245_11042158
1374 Ga0105247_10000960
1375 Ga0105247_10027599
1376 Ga0105247_10311421
1377 Ga0105243_10002561
1378 Ga0105243_10118527
1379 Ga0105243_10136574
1380 Ga0105241_10105908
1381 Ga0105241_10369774
1382 Ga0105241_11352070
1383 Ga0105242_10013459
1384 Ga0105242_10037115
1385 Ga0105242_10710096
1386 Ga0105248_10036093
1387 Ga0105248_10187343
1388 Ga0105248_10228909
1389 Ga0105248_10464935
1390 Ga0105237_10011302
1391 Ga0105237_10265850
1392 Ga0105237_10327390
1393 Ga0105237_10425962
1394 Ga0105238_10123801
1395 Ga0105238_10266242
1396 Ga0105249_10008921
1397 Ga0105249_10555698
1398 Ga0105249_10708010
1399 Ga0105249_11298857
1400 Ga0105239_10310631
1401 Ga0105239_10449830
1402 Ga0105239_11548480
1403 Ga0105246_10046608
1404 Ga0105246_10172577
1405 Ga0105246_10287104
1406 Ga0105246_11197563
1407 Ga0157341_1000435
1408 Ga0157347_1005285
1409 Ga0157373_10058492
1410 Ga0157373_10488312
1411 Ga0157371_10180062
1412 Ga0157371_10839991
1413 Ga0157370_10321322
1414 Ga0157370_10362813
1415 Ga0157369_10615146
1416 Ga0157369_11921429
1417 Ga0157374_10015572
1418 Ga0157374_10519597
1419 Ga0157374_10705971
1420 Ga0157374_11830467
1421 Ga0157378_10001521
1422 Ga0157378_10438660
1423 Ga0163162_10000819
1424 Ga0163162_10124602
1425 Ga0163162_11071185
1426 Ga0163162_11078127
1427 Ga0163162_11402507
1428 Ga0163162_11853756
1429 Ga0157372_10041275
1430 Ga0157372_10908693
1431 Ga0157375_10001004
1432 Ga0157375_10014815
1433 Ga0157375_10146665
1434 Ga0157375_11086474
1435 Ga0163163_10005260
1436 Ga0163163_10021832
1437 Ga0163163_10658449
1438 Ga0163163_11133673
1439 Ga0163163_12627158
1440 Ga0157380_10091002
1441 Ga0157380_10165767
1442 Ga0182008_10056120
1443 Ga0157377_10007323
1444 Ga0157377_10488028
1445 Ga0157379_10002682
1446 Ga0157379_10187055
1447 Ga0157379_10276786
1448 Ga0157379_10507658
1449 Ga0157376_10024522
1450 Ga0157376_10953220
1451 Ga0157376_11251859
1452 Ga0157376_12170386
1453 Ga0163161_10008318
1454 Ga0213873_10066014
1455 Ga0213872_10159566
1456 Ga0213876_10297480
1457 Ga0213875_10001665
1458 Ga0213871_10008671
1459 Ga0213871_10130151
1460 Ga0207666_1000061
1461 Ga0207666_1016554
1462 Ga0207673_1000454
1463 Ga0207697_10000191
1464 Ga0207697_10046818
1465 Ga0207653_10048753
1466 Ga0207682_10000035
1467 Ga0207692_10096324
1468 Ga0207642_10003201
1469 Ga0207642_10019378
1470 Ga0207710_10003954
1471 Ga0207710_10010216
1472 Ga0207710_10219407
1473 Ga0207688_10000164
1474 Ga0207688_10024078
1475 Ga0207680_10216671
1476 Ga0207680_10234817
1477 Ga0207680_10719553
1478 Ga0207647_10033968
1479 Ga0207647_10249969
1480 Ga0207685_10048532
1481 Ga0207699_10060174
1482 Ga0207699_10065027
1483 Ga0207699_10176427
1484 Ga0207699_10507162
1485 Ga0207645_10000675
1486 Ga0207645_10157162
1487 Ga0207643_10005662
1488 Ga0207707_10019277
1489 Ga0207707_10040135
1490 Ga0207707_10147737
1491 Ga0207707_10252491
1492 Ga0207707_10605503
1493 Ga0207695_10026400
1494 Ga0207695_10250667
1495 Ga0207671_10082459
1496 Ga0207671_10133759
1497 Ga0207671_10169236
1498 Ga0207693_10013190
1499 Ga0207693_10045743
1500 Ga0207693_10243681
1501 Ga0207693_10272105
1502 Ga0207693_10385077
1503 Ga0207663_10102785
1504 Ga0207663_11181604
1505 Ga0207660_10000388
1506 Ga0207660_10013525
1507 Ga0207660_10154326
1508 Ga0207660_10726319
1509 Ga0207662_10001201
1510 Ga0207662_10063281
1511 Ga0207662_10084226
1512 Ga0207657_10018763
1513 Ga0207649_10024805
1514 Ga0207649_10278080
1515 Ga0207652_10011032
1516 Ga0207652_10288977
1517 Ga0207646_10539340
1518 Ga0207646_10820278
1519 Ga0207681_10004176
1520 Ga0207681_10393563
1521 Ga0207694_10042945
1522 Ga0207694_10184269
1523 Ga0207650_10031895
1524 Ga0207650_10220507
1525 Ga0207650_10604562
1526 Ga0207659_10004854
1527 Ga0207659_10061627
1528 Ga0207659_10450720
1529 Ga0207687_10001487
1530 Ga0207687_10029797
1531 Ga0207687_10113573
1532 Ga0207687_10482412
1533 Ga0207700_10001623
1534 Ga0207700_10131703
1535 Ga0207700_10579583
1536 Ga0207664_10058259
1537 Ga0207664_10129499
1538 Ga0207664_10168751
1539 Ga0207664_10336295
1540 Ga0207644_10052064
1541 Ga0207644_10159352
1542 Ga0207644_10354181
1543 Ga0207690_10001328
1544 Ga0207690_10111781
1545 Ga0207706_10002409
1546 Ga0207706_10050021
1547 Ga0207706_10055598
1548 Ga0207706_10134040
1549 Ga0207686_10030378
1550 Ga0207686_10100453
1551 Ga0207686_10568768
1552 Ga0207686_10805058
1553 Ga0207709_10000374
1554 Ga0207709_10182583
1555 Ga0207709_10886064
1556 Ga0207670_10036530
1557 Ga0207670_10629806
1558 Ga0207669_10000353
1559 Ga0207669_10204313
1560 Ga0207669_10307711
1561 Ga0207669_10478930
1562 Ga0207704_10000265
1563 Ga0207704_11014579
1564 Ga0207665_10002010
1565 Ga0207665_10142203
1566 Ga0207665_10202137
1567 Ga0207665_10832618
1568 Ga0207691_10000869
1569 Ga0207691_10334961
1570 Ga0207711_10004421
1571 Ga0207711_10013109
1572 Ga0207711_10175543
1573 Ga0207711_10282518
1574 Ga0207689_10001240
1575 Ga0207689_10018642
1576 Ga0207689_10358454
1577 Ga0207661_10000371
1578 Ga0207661_10542235
1579 Ga0207661_11162703
1580 Ga0207679_10000224
1581 Ga0207679_10063595
1582 Ga0207679_10144794
1583 Ga0207679_10209532
1584 Ga0207679_10319841
1585 Ga0207679_10394987
1586 Ga0207667_10135074
1587 Ga0207667_10720143
1588 Ga0207651_10037760
1589 Ga0207651_10190011
1590 Ga0207651_10406676
1591 Ga0207712_10006600
1592 Ga0207712_10351230
1593 Ga0207712_10461261
1594 Ga0207668_10000284
1595 Ga0207668_10105223
1596 Ga0207668_10326304
1597 Ga0207640_10015972
1598 Ga0207640_10641800
1599 Ga0207658_10019082
1600 Ga0207658_10139426
1601 Ga0207658_10390396
1602 Ga0207677_10009705
1603 Ga0207677_10093800
1604 Ga0207703_10054919
1605 Ga0207703_10200249
1606 Ga0207703_10350763
1607 Ga0207703_10912943
1608 Ga0207639_10006844
1609 Ga0207678_10000756
1610 Ga0207678_10020551
1611 Ga0207678_10052160
1612 Ga0207678_10224650
1613 Ga0207708_10004433
1614 Ga0207708_10089651
1615 Ga0207708_10183468
1616 Ga0207708_10346390
1617 Ga0207702_10016673
1618 Ga0207702_10264619
1619 Ga0207702_10320136
1620 Ga0207641_10003398
1621 Ga0207641_10209626
1622 Ga0207641_10515522
1623 Ga0207641_10584214
1624 Ga0207641_10688036
1625 Ga0207648_10000616
1626 Ga0207648_10240751
1627 Ga0207676_10000347
1628 Ga0207676_11147327
1629 Ga0207674_10002264
1630 Ga0207674_10190125
1631 Ga0207674_10308982
1632 Ga0207674_10385273
1633 Ga0207675_100010802
1634 Ga0207675_100057594
1635 Ga0207675_100278562
1636 Ga0207675_102103102
1637 Ga0207683_10000635
1638 Ga0207683_10143722
1639 Ga0207683_10147053
1640 Ga0207698_10062738
1641 Ga0209973_1007087
1642 Ga0209984_1006992
1643 Ga0209999_1021106
1644 Ga0210002_1003619
1645 Ga0209998_10001047
1646 Ga0209813_10305639
1647 Ga0209974_10004485
1648 Ga0207428_10000256
1649 Ga0207428_10000338
1650 Ga0207428_10086092
1651 Ga0268266_10115706
1652 Ga0268266_10926649
1653 Ga0268265_10022010
1654 Ga0268265_10158326
1655 Ga0268265_10206704
1656 Ga0268265_10351582
1657 Ga0268264_10127826
1658 Ga0268264_10238998
1659 Ga0268264_10267874
1660 Ga0265334_10003956
1661 Ga0265325_10000707
1662 Ga0265325_10136421
1663 Ga0265340_10049816
1664 Ga0265339_10052866
1665 Ga0265339_10448872
1666 Ga0265316_10302651
1667 Ga0265313_10060075
1668 Ga0265314_10006447
1669 Ga0373930_0001155
1670 Ga0373930_0007245
1671 Ga0373948_0002036
1672 Ga0373950_0006879
1673 Ga0373950_0012812
1674 Ga0373958_0007782
1675 Ga0373958_0015528
1676 Ga0373959_0004547
1677 Ga0373959_0012790
1678 Ga0373938_0007697
1679 Ga0373926_0034118
1680 Ga0373926_0037711
1681 Ga0373928_0007593
1682 Ga0373928_0011502
1683 Ga0373928_0012597
1684 Ga0373929_0005768
1685 Ga0373929_0005974
1686 Ga0373934_0008041
1687 Ga0373934_0044942
1688 Ga0373934_0056385
1689 Ga0373934_0178166
1690 Ga0373940_0015995
1691 Ga0373940_0016579
1692 Ga0373940_0209165
1693 Ga0373944_0002044
1694 Ga0373944_0060803
1695 Ga0373951_0002018
1696 Ga0373951_0006340
1697 Ga0373952_0001998
1698 Ga0373923_0018427
1699 Ga0373923_0036530
1700 Ga0373923_0045038
1701 Ga0373923_0103951
1702 Ga0373932_0003036
1703 Ga0373932_0006656
1704 Ga0373932_0011254
1705 Ga0373936_0006174
1706 Ga0373936_0087237
1707 Ga0373936_0178310
1708 Ga0373939_0000902
1709 Ga0373939_0007588
1710 Ga0373939_0239198
1711 Ga0373941_0003262
1712 Ga0373941_0009030
1713 Ga0373941_0028147
1714 Ga0373941_0141682
1715 Ga0373945_0056159
1716 Ga0373945_0096156
1717 Ga0373953_0010155
1718 Ga0373953_0066542
1719 Ga0373954_0015168
1720 Ga0373954_0037050
1721 Ga0373954_0037323
1722 Ga0373954_0037660
1723 Ga0373956_0005035
1724 Ga0373956_0036696
1725 Ga0373956_0076730
1726 Ga0373956_0483191
1727 Ga0373957_0003814
1728 Ga0373957_0009661
1729 Ga0373957_0017846
1730 Ga0373957_0036433
1731 Ga0373960_0003326
1732 Ga0373960_0008439
1733 Ga0373960_0081624
1734 Ga0373943_0005971
1735 Ga0373943_0119066
1736 Ga0373946_0004752
1737 Ga0373946_0006500
1738 Ga0373946_0453148
1739 Ga0373955_0005173
1740 Ga0373955_0007863
1741 Ga0373955_0517190
1742 Ga0373942_0005209
1743 Ga0373942_0044827
1744 Ga0373961_0005123
1745 Ga0373961_0015491
1746 Ga0373962_0001573
1747 Ga0373962_0002923
1748 Ga0373962_0039205
1749 Ga0373962_0093379
1750 Ga0373924_0120206
1751 Ga0373924_0125633
1752 Ga0373924_0127675
1753 Ga0373931_0000456
1754 Ga0373931_0001189
1755 Ga0373931_0118820
1756 Ga0373935_0030859
1757 Ga0373935_0053800
1758 Ga0373935_0250869
1759 Ga0373935_0365868
1760 Ga0373935_0895358
1761 Ga0373927_0175896
1762 Ga0373927_0602911
1763 Ga0373933_0002021
1764 Ga0373933_0016901
1765 Ga0373933_0105401
1766 Ga0373933_0138364
1767 Ga0373933_0139654
1768 Ga0373933_0149708
1769 Ga0373947_0006649
1770 Ga0373947_0049439
1771 Ga0373947_0347027
1772 Ga0373937_0005606
1773 Ga0373937_0023398
1774 Ga0373937_0030734
1775 Ga0373937_0073482
1776 Ga0373937_0113516
1777 Ga0373937_0388481
1778 Ga0373937_0426103
1779 Ga0373937_0626511
1780 Ga0373925_0056668
1781 Ga0373925_0195252
1782 Ga0373925_0275903
1783 Ga0395900_0030019
1784 Ga0395898_0180867
1785 Ga0436364_0172918
1786 Ga0436364_0468701
1787 Ga0436364_1358998
1788 Ga0395901_0182002
1789 Ga0395901_0192454
1790 Ga0242420_023320
1791 Ga0436365_0186088
1792 Ga0436365_0421649
1793 Ga0436365_1250625
1794 Ga0436365_1269348
1795 Ga0436365_1327329
1796 Ga0436365_1848984
1797 Ga0436360_0296707
1798 Ga0436360_0342520
1799 Ga0436360_0697918
1800 Ga0436360_1048989
1801 Ga0436361_1180233
1802 Ga0436363_1365906
1803 Ga0436363_1699543
1804 Ga0436362_0594923
1805 Ga0436362_0895477
1806 Ga0436362_0985321
1807 Ga0436362_1038513
1808 Ga0436362_1145440
1809 Ga0439453_0036440
1810 Ga0439448_0018354
1811 Ga0439460_0021984
1812 Ga0466963_0500664
1813 Ga0453684_0159277
1814 Ga0466957_0438866
1815 Ga0451576_0468538
1816 Ga0466967_0066717
1817 Ga0495592_0014180
1818 Ga0495592_0014723
1819 Ga0495592_0034688
1820 Ga0495592_0364409
1821 Ga0495592_0684464
1822 Ga0495603_0031400
1823 Ga0495603_0070882
1824 Ga0495603_0071470
1825 Ga0495629_0001083
1826 Ga0495629_0039078
1827 Ga0495638_0333984
1828 Ga0495641_0010963
1829 Ga0495641_0071353
1830 Ga0495641_0112010
1831 Ga0495651_0078923
1832 Ga0495651_0188928
1833 Ga0495651_0194694
1834 Ga0495653_0035586
1835 Ga0495653_0052046
1836 Ga0495653_0055919
1837 Ga0495653_0727090
1838 Ga0495580_0052480
1839 Ga0495580_0068596
1840 Ga0495582_0008478
1841 Ga0495582_0048374
1842 Ga0495639_0012788
1843 Ga0495639_0037629
1844 Ga0495662_0017471
1845 Ga0495664_0008862
1846 Ga0495664_0141932
1847 Ga0495664_0323053
1848 Ga0495584_0497292
1849 Ga0495585_0017542
1850 Ga0495594_0028091
1851 Ga0495594_0070962
1852 Ga0495607_0038290
1853 Ga0495583_0289549
1854 Ga0495608_0025074
1855 Ga0495608_0115130
1856 Ga0495608_0151331
1857 Ga0495608_0430839
1858 Ga0495616_0272769
1859 Ga0495618_0006625
1860 Ga0495618_0046556
1861 Ga0495628_0123271
1862 Ga0495628_0192253
1863 Ga0495630_0016770
1864 Ga0495630_0066890
1865 Ga0495644_0007689
1866 Ga0495666_0020697
1867 Ga0495652_0083034
1868 Ga0495652_0156496
1869 Ga0495652_0229539
1870 Ga0495665_0016353
1871 Ga0495640_0060069
1872 Ga0495640_0083163
1873 Ga0495640_0407473
1874 Ga0495586_0062944
1875 Ga0495586_0121495
1876 Ga0495587_0032403
1877 Ga0495587_0041143
1878 Ga0495587_0051587
1879 Ga0495598_0023053
1880 Ga0495645_0047821
1881 Ga0495645_0106395
1882 Ga0495622_0018549
1883 Ga0495667_0017147
1884 Ga0495667_0024353
1885 Ga0495667_0031146
1886 Ga0495667_0036511
1887 Ga0495667_0042796
1888 Ga0495634_0043965
1889 Ga0495634_0054684
1890 Ga0495611_0129987
1891 Ga0495635_0090219
1892 Ga0495635_0262941
1893 Ga0495659_0010862
1894 Ga0495657_0004474
1895 Ga0495657_0097325
1896 Ga0495657_0199419
1897 Ga0495599_0072874
1898 Ga0495599_0102840
1899 Ga0495599_0215668
1900 Ga0495623_0037694
1901 Ga0495646_0035965
1902 Ga0495646_0136543
1903 Ga0495647_0007965
1904 Ga0495647_0009359
1905 Ga0495647_0190726
1906 Ga0495658_0000657
1907 Ga0495658_0041696
1908 Ga0495658_0049728
1909 Ga0495658_0063602
1910 Ga0495669_0298046
1911 Ga0495613_0027530
1912 Ga0495613_0056832
1913 Ga0495624_0010273
1914 Ga0495670_0005981
1915 Ga0495671_0251470
1916 Ga0495600_0036766
1917 Ga0495600_0070247
1918 Ga0495600_0075100
1919 Ga0495581_0024119
1920 Ga0495581_0038908
1921 Ga0495604_0023975
1922 Ga0495604_0032475
1923 Ga0495604_0129670
1924 Ga0495604_0336133
1925 Ga0495604_0524695
1926 Ga0495674_0048828
1927 Ga0495674_0328938
1928 Ga0495676_0151527
1929 Ga0495676_0187399
1930 Ga0495680_0011464
1931 Ga0495680_0015033
1932 Ga0495680_0027040
1933 Ga0495680_0133289
1934 Ga0495680_0328229
1935 Ga0495675_0125936
1936 Ga0495675_0231718
1937 Ga0495677_0160348
1938 Ga0495677_0203376
1939 Ga0495679_085464
1940 Ga0495681_0182685
1941 Ga0495684_0064317
1942 Ga0495684_0107787
1943 Ga0495684_0127401
1944 Ga0495684_0515967
1945 Ga0495686_0002628
1946 Ga0495593_0015003
1947 Ga0495593_0047421
1948 Ga0495593_0083154
1949 Ga0495602_0067594
1950 Ga0495602_0075417
1951 Ga0495602_0118134
1952 Ga0495602_0458491
1953 Ga0496100_0043390
1954 Ga0496100_0093381
1955 Ga0496100_0723402
1956 Ga0496101_0039951
1957 Ga0496101_0790244
1958 Ga0496102_0120761
1959 Ga0496102_0146137
1960 Ga0496102_0203808
1961 Ga0496102_0263614
1962 Ga0496102_0345265
1963 Ga0496102_1108427
1964 Ga0496103_0032545
1965 Ga0496103_0134740
1966 Ga0496104_0001026
1967 Ga0496104_0084764
1968 Ga0496104_0161480
1969 Ga0496104_0410381
1970 Ga0496105_0048461
1971 Ga0496105_0063288
1972 Ga0496105_0114002
1973 Ga0496105_0273257
1974 Ga0496105_0588876
1975 Ga0496106_0077045
1976 Ga0496106_0147132
1977 Ga0496106_0179245
1978 Ga0496106_0777419
1979 Ga0496106_1481587
1980 Ga0496107_0010208
1981 Ga0496107_0012830
1982 Ga0496107_0079757
1983 Ga0496108_0038783
1984 Ga0496108_0051869
1985 Ga0496108_0108553
1986 Ga0496108_0110196
1987 Ga0496109_0000211
1988 Ga0496109_0005410
1989 Ga0496109_0210473
1990 Ga0496109_0247786
1991 Ga0496109_0339553
1992 Ga0496110_0029267
1993 Ga0496110_0112176
1994 Ga0496110_0170330
1995 Ga0496110_0197748
1996 Ga0496110_1148489
1997 Ga0496111_0057100
1998 Ga0496111_0127848
1999 Ga0496112_0018318
2000 Ga0496112_0029842
2001 Ga0496112_0171079
2002 Ga0496113_0070215
2003 Ga0496113_0086591
2004 Ga0496113_0158489
2005 Ga0496113_0222427
2006 Ga0496113_0240647
2007 Ga0496113_0267699
2008 Ga0496114_0012331
2009 Ga0496114_0250164
2010 Ga0496114_1213138
2011 Ga0496115_0020154
2012 Ga0496115_0134879
2013 Ga0496115_0166033
2014 Ga0496115_0288086
2015 Ga0496115_0489547
2016 Ga0496115_0601490
2017 Ga0501038_0540985
2018 Ga0501042_0912024
2019 Ga0501067_0461755
2020 Ga0501071_0547108
2021 Ga0501071_0992080
2022 Ga0501072_0763662
2023 Ga0501073_0136552
2024 Ga0501075_0863376
2025 Ga0501076_0493485
2026 Ga0501077_0060241
2027 Ga0501077_0226068
2028 Ga0501079_0315950
2029 Ga0501079_0325269
2030 Ga0501081_0220178
2031 Ga0501081_0307836
2032 Ga0501044_0916031
2033 Ga0501044_1015906
2034 Ga0501045_0542706
2035 nmdc:mga03683_22960_c1
2036 nmdc:mga03683_299330_c1
2037 nmdc:mga03683_8800_c1
2038 nmdc:mga03n38_20921_c1
2039 nmdc:mga03n38_216203_c1
2040 nmdc:mga00v17_461330_c1
2041 nmdc:mga0yw44_891729_c1
2042 nmdc:mga0k408_15938_c1
2043 nmdc:mga0k408_3337_c2
2044 nmdc:mga06z11_50594_c1
2045 nmdc:mga06z11_62736_c1
2046 nmdc:mga04h51_6758_c1
2047 nmdc:mga07m45_223270_c1
2048 nmdc:mga07m45_49013_c1
2049 nmdc:mga05p37_12232_c1
2050 nmdc:mga05p37_88924_c1
2051 nmdc:mga09592_2014_c1
2052 nmdc:mga0qj67_853_c1
2053 nmdc:mga06r32_2147_c1
2054 nmdc:mga08y16_115404_c1
2055 nmdc:mga08y16_2382_c1
2056 nmdc:mga08y16_34723_c1
2057 nmdc:mga0n895_108615_c1
2058 nmdc:mga0n895_171_c1
2059 nmdc:mga0n895_198042_c1
2060 nmdc:mga0n895_605_c1
2061 nmdc:mga0n895_60719_c1
2062 nmdc:mga0n895_616853_c1
2063 nmdc:mga0n895_6888_c1
2064 nmdc:mga0rr50_227_c1
2065 nmdc:mga0rr50_372592_c1
2066 nmdc:mga0rr50_410553_c1
2067 nmdc:mga0rr50_92072_c1
2068 nmdc:mga08x19_279968_c1
2069 nmdc:mga08x19_295907_c1
2070 nmdc:mga0a205_6279_c1
2071 nmdc:mga0a205_650646_c1
2072 Ga0495601_0002332
2073 Ga0495601_0042033
2074 Ga0495601_0050228
2075 Ga0495601_0061603
2076 Ga0495601_0068681
2077 Ga0495601_0071170
2078 Ga0495601_0257013
2079 Ga0495612_0002302
2080 Ga0495612_0008576
2081 Ga0495612_0023184
2082 Ga0495612_0025709
2083 Ga0495612_0087164
2084 Ga0495612_0126728
2085 Ga0495595_0008233
2086 Ga0495595_0010670
2087 Ga0495595_0018944
2088 Ga0495595_0023442
2089 Ga0495595_0118497
2090 Ga0495595_0120075
2091 Ga0495595_0276122
2092 Ga0495595_0354363
2093 Ga0495619_0000105
2094 Ga0495619_0000826
2095 Ga0495619_0007484
2096 Ga0495619_0012732
2097 Ga0495619_0052120
2098 Ga0495619_0108886
2099 Ga0495619_0164419
2100 Ga0500578_0288828
2101 Ga0500643_015685
2102 Ga0500644_0002887
2103 Ga0500651_0012416
2104 Ga0500566_0068402
2105 Ga0500566_0204223
2106 Ga0500641_0000586
2107 Ga0500650_0019903
2108 Ga0500595_000016
2109 Ga0500616_0000006
2110 Ga0500616_0003550
2111 Ga0500645_000563
2112 Ga0501084_0068279
2113 Ga0501082_0116497
2114 Ga0530510_0146007
2115 2643774441
2116 2643792886

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

88

161

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

20

86

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9472 3 157
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9458 1 155
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9422 2 154
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9381 3 158
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9316 3 156
ID Description Score Start End Superfamily
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9548 80 155 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9491 80 155 1.10.150.120
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9478 76 158 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9452 1 78 3.10.20.30
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.939 2 78 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A4Q0RCB4-F1-model_v4 deleted 0.9696 3 156
AF-A0A0Q4GS30-F1-model_v4 (2Fe-2S)-binding protein 0.9693 3 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A4V1DDK5-F1-model_v4 (2Fe-2S)-binding protein 0.9682 1 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X3G2F7-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9679 5 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A4R5Q8V3-F1-model_v4 (2Fe-2S)-binding protein 0.9678 5 155 GO:0016491
GO:0046872
GO:0051537

Map