F489233

General Info

Members Datasets Scaffolds Average Seq Length
1058 672 2116 128

Family's Representative Sequence

Representative Sequence 3300042006|Ga0439432_094448|Ga0439432_094448_425_862
Length 145
Sequence MKRRILTPVWKENEPMGFAVMSMTGTAAARVKAIVENSGPDAKGIRVGIKKGGCAGMEYTIELVSEPNAKDDLIERDGAKVWVEPSAVLYLLGTEMDFETTTLRSGFTFTNPNQTSACGCGESVELKPADLAALAAQRQSEPAHS

Samples

Sample ID Description Type Environment
1 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
85 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
89 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
90 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
91 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
92 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
108 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
195 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
196 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
197 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
198 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
199 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
281 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
320 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
321 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
322 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
323 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
327 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
331 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
332 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
333 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
334 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
338 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
339 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
340 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
341 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
342 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
364 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
365 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
366 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
367 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
368 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
369 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
370 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
371 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
372 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
373 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
374 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
375 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
376 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
377 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
378 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
379 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
380 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
381 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
382 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
383 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
384 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
385 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
386 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
387 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
388 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
389 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
390 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
391 2519899620 Rhizobium sp. Pop5 Isolate Nodule
392 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
393 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
394 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
395 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
396 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
397 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
398 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
399 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
400 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
401 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
402 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
403 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
404 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
405 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
406 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
407 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
408 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
409 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
410 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
411 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
412 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
413 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
414 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
415 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
416 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
417 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
418 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
419 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
420 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
421 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
422 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
423 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
424 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
425 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
426 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
427 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
428 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
429 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
430 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
431 2643221558 Rhizobium sp. Root149 Isolate Unclassified
432 2643221568 Rhizobium sp. Root564 Isolate Unclassified
433 2643221582 Rhizobium sp. Root651 Isolate Unclassified
434 2643221599 Rhizobium sp. Root708 Isolate Unclassified
435 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
436 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
437 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
438 2643221693 Rhizobium sp. Root491 Isolate Unclassified
439 2643221719 Rhizobium sp. Root274 Isolate Unclassified
440 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
441 2718217882 Rhizobium sp. N741 Isolate Nodule
442 2718217927 Rhizobium sp. N324 Isolate Nodule
443 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
444 2718218009 Rhizobium sp. N561 Isolate Nodule
445 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
446 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
447 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
448 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
449 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
450 2718218363 Rhizobium sp. N113 Isolate Nodule
451 2718218365 Rhizobium sp. N731 Isolate Nodule
452 2718218366 Rhizobium sp. N621 Isolate Nodule
453 2718218423 Rhizobium sp. N941 Isolate Nodule
454 2721755514 Rhizobium sp. N6212 Isolate Nodule
455 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
456 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
457 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
458 2721755809 Rhizobium sp. N541 Isolate Nodule
459 2721755810 Rhizobium sp. N871 Isolate Nodule
460 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
461 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
462 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
463 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
464 2728369365 Rhizobium sp. N1341 Isolate Nodule
465 2728369397 Rhizobium sp. N1314 Isolate Nodule
466 2738541293 Rhizobium sp. GV031 Isolate Unclassified
467 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
468 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
469 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
470 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
471 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
472 2791355256 Rhizobium sp. M10 Isolate Nodule
473 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
474 2791355260 Rhizobium sp. L9 Isolate Nodule
475 2791355261 Rhizobium sp. J15 Isolate Nodule
476 2791355262 Rhizobium sp. M1 Isolate Nodule
477 2791355263 Rhizobium chutanense C5 Isolate Nodule
478 2791355264 Rhizobium sp. S9 Isolate Nodule
479 2791355265 Rhizobium sp. H4 Isolate Nodule
480 2791355266 Rhizobium sp. L43 Isolate Nodule
481 2791355267 Rhizobium sp. L18 Isolate Nodule
482 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
483 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
484 2802429633 Rhizobium anhuiense J3 Isolate Nodule
485 2802429634 Rhizobium anhuiense S10 Isolate Nodule
486 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
487 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
488 2802429637 Rhizobium anhuiense C15 Isolate Nodule
489 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
490 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
491 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
492 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
493 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
494 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
495 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
496 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
497 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
498 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
499 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
500 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
501 2838048938 Rhizobium pisi 27/80 Isolate Nodule
502 2838061910 Rhizobium phaseoli L15 Isolate Nodule
503 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
504 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
505 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
506 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
507 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
508 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
509 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
510 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
511 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
512 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
513 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
514 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
515 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
516 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
517 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
518 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
519 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
520 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
521 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
522 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
523 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
524 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
525 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
526 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
527 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
528 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
529 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
530 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
531 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
532 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
533 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
534 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
535 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
536 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
537 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
538 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
539 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
540 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
541 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
542 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
543 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
544 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
545 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
546 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
547 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
548 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
549 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
550 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
551 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
552 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
553 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
554 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
555 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
556 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
557 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
558 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
559 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
560 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
561 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
562 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
563 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
564 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
565 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
566 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
567 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
568 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
569 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
570 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
571 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
572 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
573 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
574 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
575 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
576 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
577 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
578 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
579 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
580 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
581 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
582 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
583 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
584 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
585 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
586 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
587 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
588 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
589 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
590 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
591 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
592 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
593 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
594 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
595 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
596 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
597 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
598 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
599 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
600 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
601 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
602 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
603 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
604 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
605 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
606 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
607 2933599457 Rhizobium phaseoli M3 Isolate Nodule
608 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
609 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
610 2936381700 Rhizobium chutanense C16 Isolate Unclassified
611 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
612 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
613 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
614 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
615 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
616 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
617 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
618 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
619 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
620 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
621 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
622 2996887358 Rhizobium sp. R711 Isolate Nodule
623 2996893221 Rhizobium sp. R635 Isolate Nodule
624 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
625 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
626 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
627 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
628 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
629 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
630 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
631 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
632 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
633 8005258706 Rhizobium sp. R693 Isolate Nodule
634 8005275841 Rhizobium sp. N4311 Isolate Nodule
635 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
636 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
637 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
638 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
639 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
640 8005321885 Rhizobium sp. R72 Isolate Nodule
641 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
642 8005382845 Rhizobium sp. R634 Isolate Nodule
643 8005395548 Rhizobium sp. R339 Isolate Nodule
644 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
645 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
646 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
647 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
648 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
649 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
650 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
651 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
652 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
653 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
654 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
655 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
656 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
657 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
658 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
659 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
660 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
661 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
662 8018176218 Rhizobium sp. N122 Isolate Nodule
663 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
664 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
665 8024501048 Rhizobium sp. H4 Isolate Nodule
666 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
667 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
668 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
669 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
670 8056382006 Rhizobium croatiense 13T Isolate Nodule
671 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
672 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.11
Metatranscriptomes 3.69
Isolates 29.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 24.01
Nodule 19.75
Rhizoplane 3.69
Rhizosphere 31.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439432_094448 3300042006 Bacteria 898
2 JGI24740J21852_10000493 3300001979 Bacteria 16930
3 JGI25155J39150_1000215 3300002704 Bacteria 23334
4 JGI25156J39149_1000491 3300002705 Bacteria 23712
5 JGI25162J39368_1002390 3300002737 Bacteria 7381
6 JGI25162J39368_1002612 3300002737 Bacteria 6743
7 JGI25154J39366_1000407 3300002738 Bacteria 23364
8 JGI25158J39367_1000050 3300002739 Bacteria 27257
9 JGI25158J39367_1000062 3300002739 Bacteria 24133
10 JGI25157J39369_1000515 3300002741 Bacteria 23712
11 JGI25152J39213_1000882 3300002773 Bacteria 14768
12 JGI25152J39213_1001368 3300002773 Bacteria 10639
13 JGI25152J39213_1004354 3300002773 Bacteria 4485
14 JGI25152J39213_1005142 3300002773 Bacteria 3919
15 JGI25152J39213_1010012 3300002773 Bacteria 2202
16 JGI25152J39213_1010021 3300002773 Bacteria 2199
17 JGI25152J39213_1010514 3300002773 Bacteria 2111
18 JGI25150J39212_1000070 3300002774 Bacteria 61799
19 JGI25159J45721_1000220 3300002987 Bacteria 26975
20 JGI25159J45721_1000293 3300002987 Bacteria 23430
21 JGI25151J46595_10000208 3300003187 Bacteria 71857
22 JGI25151J46595_10002724 3300003187 Bacteria 10310
23 JGI25151J46595_10003717 3300003187 Bacteria 8292
24 JGI25151J46595_10061494 3300003187 Bacteria 1194
25 JGI25151J46595_10102587 3300003187 Bacteria 767
26 JGI25151J46595_10125013 3300003187 Bacteria 649
27 JGI25165J46597_1002236 3300003214 Bacteria 6742
28 JGI25165J46597_1013291 3300003214 Bacteria 1135
29 JGI25165J46597_1045737 3300003214 Bacteria 561
30 JGI25153J46596_10005239 3300003215 Bacteria 6822
31 JGI25153J46596_10007174 3300003215 Bacteria 5525
32 JGI25153J46596_10012399 3300003215 Bacteria 3679
33 JGI25153J46596_10017134 3300003215 Bacteria 2868
34 JGI25153J46596_10024079 3300003215 Bacteria 2202
35 JGI25153J46596_10024110 3300003215 Bacteria 2199
36 Ga0006777J48905_1071315 3300003308 Bacteria 519
37 rootH1_10007619 3300003316 Bacteria 2172
38 rootL2_10144815 3300003322 Bacteria 2132
39 rootH1_10173941 3300003323 Bacteria 2359
40 JGI25160J50197_1000010 3300003354 Bacteria 279365
41 JGI25160J50197_1001320 3300003354 Bacteria 12521
42 JGI25160J50197_1009199 3300003354 Bacteria 3686
43 JGI25161J50226_1000006 3300003374 Bacteria 279563
44 JGI25161J50226_1000055 3300003374 Bacteria 104131
45 JGI25161J50226_1003482 3300003374 Bacteria 3583
46 Ga0006562J51391_1011003 3300003578 Bacteria 594
47 Ga0006562J51391_1015089 3300003578 Bacteria 1077
48 Ga0006780_1034804 3300003735 Bacteria 517
49 Ga0055539_1010828 3300003752 Bacteria 1128
50 Ga0055526_1004543 3300003771 Bacteria 8297
51 Ga0055526_1005021 3300003771 Bacteria 7738
52 Ga0055526_1018953 3300003771 Bacteria 2533
53 Ga0055526_1030878 3300003771 Bacteria 1552
54 Ga0055524_1006400 3300003775 Bacteria 5109
55 Ga0055524_1006486 3300003775 Bacteria 5071
56 Ga0055524_1010891 3300003775 Bacteria 3591
57 Ga0055524_1014571 3300003775 Bacteria 2908
58 Ga0055524_1014808 3300003775 Bacteria 2873
59 Ga0055524_1090124 3300003775 Bacteria 534
60 Ga0055536_1001994 3300003781 Bacteria 11712
61 Ga0055528_1000222 3300003790 Bacteria 47898
62 Ga0055528_1001131 3300003790 Bacteria 17456
63 Ga0055528_1003737 3300003790 Bacteria 7510
64 Ga0055528_1006581 3300003790 Bacteria 5257
65 Ga0055528_1007309 3300003790 Bacteria 4901
66 Ga0055528_1015876 3300003790 Bacteria 2694
67 Ga0055530_10012055 3300003791 Bacteria 3044
68 Ga0055540_1002477 3300003792 Bacteria 9704
69 Ga0055540_1002600 3300003792 Bacteria 9399
70 Ga0055540_1004537 3300003792 Bacteria 6195
71 Ga0055540_1018459 3300003792 Bacteria 1911
72 Ga0055531_10002361 3300003794 Bacteria 12693
73 Ga0058692_1012421 3300003856 Bacteria 2016
74 Ga0058692_1017684 3300003856 Bacteria 1559
75 Ga0055543_1000014 3300004625 Bacteria 177906
76 Ga0055543_1000032 3300004625 Bacteria 130218
77 Ga0055543_1001284 3300004625 Bacteria 10327
78 Ga0058859_11735091 3300004798 Bacteria 580
79 Ga0065165_1000251 3300005262 Bacteria 93020
80 Ga0065165_1007728 3300005262 Bacteria 5204
81 Ga0065165_1008141 3300005262 Bacteria 4985
82 Ga0065165_1009371 3300005262 Bacteria 4402
83 Ga0065165_1010277 3300005262 Bacteria 4068
84 Ga0065716_1006144 3300005277 Bacteria 827
85 Ga0070658_11628835 3300005327 Bacteria 559
86 Ga0070676_11288229 3300005328 Bacteria 558
87 Ga0070670_102235645 3300005331 Bacteria 504
88 Ga0070666_10277318 3300005335 Bacteria 1191
89 Ga0070680_100479679 3300005336 Bacteria 1063
90 Ga0070691_10444225 3300005341 Bacteria 739
91 Ga0070668_100056375 3300005347 Bacteria 3035
92 Ga0070668_101135544 3300005347 Bacteria 706
93 Ga0070668_101265686 3300005347 Bacteria 670
94 Ga0070669_100516076 3300005353 Bacteria 993
95 Ga0070671_100015004 3300005355 Bacteria 6257
96 Ga0070659_100708508 3300005366 Bacteria 871
97 Ga0070667_100719536 3300005367 Bacteria 924
98 Ga0070700_100078363 3300005441 Bacteria 2127
99 Ga0070663_100185984 3300005455 Bacteria 1614
100 Ga0070663_100327877 3300005455 Bacteria 1233
101 Ga0070663_100892988 3300005455 Bacteria 767
102 Ga0070681_10384584 3300005458 Bacteria 1314
103 Ga0070665_100017458 3300005548 Bacteria 7205
104 Ga0070665_100144234 3300005548 Bacteria 2385
105 Ga0070665_101987164 3300005548 Bacteria 587
106 Ga0068854_101363251 3300005578 Bacteria 640
107 Ga0068856_100090914 3300005614 Bacteria 3037
108 Ga0068860_100011367 3300005843 Bacteria 8773
109 Ga0068862_100466932 3300005844 Bacteria 1192
110 Ga0068862_101762160 3300005844 Bacteria 628
111 Ga0081538_10100234 3300005981 Bacteria 1461
112 Ga0075365_10000756 3300006038 Bacteria 13118
113 Ga0075368_10006544 3300006042 Bacteria 4076
114 Ga0075368_10083887 3300006042 Bacteria 1298
115 Ga0075368_10207400 3300006042 Bacteria 830
116 Ga0075363_100034113 3300006048 Bacteria 2655
117 Ga0075363_100085198 3300006048 Bacteria 1733
118 Ga0075364_10000588 3300006051 Bacteria 18752
119 Ga0075364_10038531 3300006051 Bacteria 3096
120 Ga0075364_10364891 3300006051 Bacteria 985
121 Ga0075364_10763204 3300006051 Bacteria 659
122 Ga0075432_10177480 3300006058 Bacteria 832
123 Ga0070715_10946374 3300006163 Bacteria 533
124 Ga0070712_100567161 3300006175 Bacteria 958
125 Ga0075362_10001370 3300006177 Bacteria 7725
126 Ga0075362_10021646 3300006177 Bacteria 2701
127 Ga0075362_10058822 3300006177 Bacteria 1734
128 Ga0075367_10000829 3300006178 Bacteria 12260
129 Ga0075367_10002190 3300006178 Bacteria 8807
130 Ga0075367_10036160 3300006178 Bacteria 2862
131 Ga0075367_10067009 3300006178 Bacteria 2152
132 Ga0075369_10005950 3300006186 Bacteria 4590
133 Ga0075369_10007017 3300006186 Bacteria 4279
134 Ga0075369_10012601 3300006186 Bacteria 3340
135 Ga0075369_10017769 3300006186 Bacteria 2889
136 Ga0075369_10237727 3300006186 Bacteria 845
137 Ga0075366_10261609 3300006195 Bacteria 1056
138 Ga0075370_10007341 3300006353 Bacteria 5611
139 Ga0075370_10010671 3300006353 Bacteria 4813
140 Ga0075370_10880672 3300006353 Bacteria 547
141 Ga0075430_100173733 3300006846 Bacteria 1793
142 Ga0075431_100205127 3300006847 Bacteria 2016
143 Ga0075431_100356459 3300006847 Bacteria 1470
144 Ga0068865_102081222 3300006881 Bacteria 516
145 Ga0099826_10000117 3300006948 Bacteria 36698
146 Ga0099826_10033503 3300006948 Bacteria 3685
147 Ga0105251_10207618 3300009011 Bacteria 882
148 Ga0105244_10145660 3300009036 Bacteria 1137
149 Ga0105250_10221710 3300009092 Bacteria 802
150 Ga0105240_10000005 3300009093 Bacteria 702630
151 Ga0111539_10497418 3300009094 Bacteria 1420
152 Ga0105245_10202838 3300009098 Bacteria 1905
153 Ga0105247_10468941 3300009101 Bacteria 911
154 Ga0114129_11374989 3300009147 Bacteria 872
155 Ga0105243_10156938 3300009148 Bacteria 1958
156 Ga0105243_11641641 3300009148 Bacteria 670
157 Ga0105243_11731130 3300009148 Bacteria 655
158 Ga0105248_10012698 3300009177 Bacteria 9296
159 Ga0105248_11663373 3300009177 Bacteria 723
160 Ga0105237_10001882 3300009545 Bacteria 26776
161 Ga0105237_11930570 3300009545 Bacteria 599
162 Ga0105238_10151748 3300009551 Bacteria 2292
163 Ga0123341_1000004 3300009765 Bacteria 153727
164 Ga0123342_1018578 3300009766 Bacteria 5495
165 Ga0123342_1028932 3300009766 Bacteria 2933
166 Ga0105239_10002014 3300010375 Bacteria 26368
167 Ga0105239_10297106 3300010375 Bacteria 1819
168 Ga0105239_11717616 3300010375 Bacteria 727
169 Ga0105246_11690659 3300011119 Bacteria 601
170 Ga0157336_1015709 3300012477 Bacteria 636
171 Ga0157318_1036339 3300012482 Bacteria 509
172 Ga0157314_1020052 3300012500 Bacteria 674
173 Ga0157313_1038229 3300012503 Bacteria 577
174 Ga0157326_1004013 3300012513 Bacteria 1546
175 Ga0157373_10091427 3300013100 Bacteria 2143
176 Ga0157373_10241962 3300013100 Bacteria 1275
177 Ga0157373_10290076 3300013100 Bacteria 1160
178 Ga0157373_11593629 3300013100 Bacteria 500
179 Ga0157371_10000015 3300013102 Bacteria 339838
180 Ga0157371_10037850 3300013102 Bacteria 3452
181 Ga0157371_10376884 3300013102 Bacteria 1036
182 Ga0157370_10000274 3300013104 Bacteria 65400
183 Ga0157370_10003029 3300013104 Bacteria 19939
184 Ga0157370_10752136 3300013104 Bacteria 888
185 Ga0157369_11193503 3300013105 Bacteria 777
186 Ga0157374_10742330 3300013296 Bacteria 996
187 Ga0157378_10882951 3300013297 Bacteria 924
188 Ga0157372_10202277 3300013307 Bacteria 2301
189 Ga0157372_10672482 3300013307 Bacteria 1205
190 Ga0157375_10617180 3300013308 Bacteria 1243
191 Ga0157380_10902198 3300014326 Bacteria 910
192 Ga0182008_10325844 3300014497 Bacteria 809
193 Ga0157379_10618896 3300014968 Bacteria 1012
194 Ga0157376_11439415 3300014969 Bacteria 721
195 Ga0182007_10000711 3300015262 Bacteria 18942
196 Ga0163161_10415253 3300017792 Bacteria 1082
197 Ga0163161_10804756 3300017792 Bacteria 790
198 Ga0206355_1170784 3300020076 Bacteria 803
199 Ga0206351_10714990 3300020077 Bacteria 595
200 Ga0206352_10371491 3300020078 Bacteria 517
201 Ga0224712_10520244 3300022467 Bacteria 576
202 Ga0209435_100045 3300025206 Bacteria 96483
203 Ga0209436_100001 3300025208 Bacteria 304543
204 Ga0209672_104292 3300025228 Bacteria 2682
205 Ga0209437_100047 3300025233 Bacteria 405163
206 Ga0209437_100683 3300025233 Bacteria 18100
207 Ga0207425_1000024 3300025245 Bacteria 328978
208 Ga0207425_1001992 3300025245 Bacteria 7638
209 Ga0207425_1004152 3300025245 Bacteria 4416
210 Ga0207425_1007729 3300025245 Bacteria 2809
211 Ga0207425_1013642 3300025245 Bacteria 1870
212 Ga0207425_1038892 3300025245 Bacteria 913
213 Ga0207425_1056240 3300025245 Bacteria 705
214 Ga0209646_1000154 3300025246 Bacteria 96483
215 Ga0209646_1014143 3300025246 Bacteria 1204
216 Ga0209026_1000177 3300025250 Bacteria 96629
217 Ga0209677_102447 3300025253 Bacteria 6976
218 Ga0209148_1013402 3300025254 Bacteria 1475
219 Ga0209759_1000795 3300025256 Bacteria 25746
220 Ga0209759_1012909 3300025256 Bacteria 2288
221 Ga0209129_1000069 3300025258 Bacteria 212790
222 Ga0209129_1000133 3300025258 Bacteria 126018
223 Ga0209129_1000880 3300025258 Bacteria 18487
224 Ga0209129_1002492 3300025258 Bacteria 8979
225 Ga0209129_1004911 3300025258 Bacteria 4987
226 Ga0209129_1005326 3300025258 Bacteria 4603
227 Ga0209129_1008393 3300025258 Bacteria 2881
228 Ga0209129_1010222 3300025258 Bacteria 2369
229 Ga0209233_1000048 3300025261 Bacteria 453669
230 Ga0209233_1000069 3300025261 Bacteria 367639
231 Ga0209233_1000221 3300025261 Bacteria 104090
232 Ga0209565_1037304 3300025263 Bacteria 920
233 Ga0209455_1017885 3300025272 Bacteria 1471
234 Ga0209673_1000013 3300025273 Bacteria 571633
235 Ga0209673_1000048 3300025273 Bacteria 287976
236 Ga0209673_1002108 3300025273 Bacteria 14922
237 Ga0209673_1003476 3300025273 Bacteria 9255
238 Ga0209673_1004376 3300025273 Bacteria 7608
239 Ga0209673_1026450 3300025273 Bacteria 1905
240 Ga0209673_1040852 3300025273 Bacteria 1323
241 Ga0209130_1000004 3300025284 Bacteria 633436
242 Ga0209130_1000021 3300025284 Bacteria 374278
243 Ga0209130_1013753 3300025284 Bacteria 2061
244 Ga0209130_1030697 3300025284 Bacteria 1108
245 Ga0209675_1093169 3300025291 Bacteria 541
246 Ga0209676_1023289 3300025292 Bacteria 2030
247 Ga0209676_1027846 3300025292 Bacteria 1771
248 Ga0209025_1000050 3300025294 Bacteria 331531
249 Ga0209025_1000572 3300025294 Bacteria 66863
250 Ga0209025_1000787 3300025294 Bacteria 52060
251 Ga0209025_1000803 3300025294 Bacteria 50798
252 Ga0209025_1007047 3300025294 Bacteria 8513
253 Ga0209025_1013063 3300025294 Bacteria 5251
254 Ga0209025_1014129 3300025294 Bacteria 4948
255 Ga0209025_1015082 3300025294 Bacteria 4690
256 Ga0209025_1019159 3300025294 Bacteria 3822
257 Ga0209025_1033243 3300025294 Bacteria 2388
258 Ga0209025_1054224 3300025294 Bacteria 1563
259 Ga0209564_1000375 3300025295 Bacteria 82204
260 Ga0209564_1000570 3300025295 Bacteria 58555
261 Ga0209564_1000631 3300025295 Bacteria 53697
262 Ga0209564_1009645 3300025295 Bacteria 4563
263 Ga0209564_1026738 3300025295 Bacteria 1896
264 Ga0209564_1078010 3300025295 Bacteria 658
265 Ga0209758_1000342 3300025297 Bacteria 86095
266 Ga0209758_1000421 3300025297 Bacteria 71884
267 Ga0209758_1000468 3300025297 Bacteria 66625
268 Ga0209758_1000942 3300025297 Bacteria 39264
269 Ga0209758_1003958 3300025297 Bacteria 12853
270 Ga0209758_1022512 3300025297 Bacteria 2884
271 Ga0209758_1022516 3300025297 Bacteria 2884
272 Ga0209758_1082158 3300025297 Bacteria 971
273 Ga0209050_1004988 3300025298 Bacteria 8635
274 Ga0209050_1005655 3300025298 Bacteria 7740
275 Ga0209256_1002453 3300025299 Bacteria 15124
276 Ga0209256_1005734 3300025299 Bacteria 6963
277 Ga0209256_1007991 3300025299 Bacteria 5029
278 Ga0209256_1009330 3300025299 Bacteria 4324
279 Ga0209256_1012872 3300025299 Bacteria 3152
280 Ga0209256_1024014 3300025299 Bacteria 1804
281 Ga0209256_1037585 3300025299 Bacteria 1260
282 Ga0209256_1055214 3300025299 Bacteria 944
283 Ga0209256_1079533 3300025299 Bacteria 719
284 Ga0207426_1000003 3300025302 Bacteria 1063212
285 Ga0207426_1000010 3300025302 Bacteria 796003
286 Ga0207426_1000039 3300025302 Bacteria 439937
287 Ga0207426_1003019 3300025302 Bacteria 9756
288 Ga0209051_1000445 3300025303 Bacteria 55846
289 Ga0209051_1001553 3300025303 Bacteria 19008
290 Ga0209051_1007905 3300025303 Bacteria 5732
291 Ga0209051_1028176 3300025303 Bacteria 2223
292 Ga0209051_1044776 3300025303 Bacteria 1538
293 Ga0209257_1001375 3300025304 Bacteria 29208
294 Ga0209257_1004317 3300025304 Bacteria 11162
295 Ga0209257_1128584 3300025304 Bacteria 583
296 Ga0207688_10652165 3300025901 Bacteria 665
297 Ga0207680_10446938 3300025903 Bacteria 917
298 Ga0207685_10270111 3300025905 Bacteria 830
299 Ga0207645_10680053 3300025907 Bacteria 699
300 Ga0207695_10000011 3300025913 Bacteria 910221
301 Ga0207671_10000314 3300025914 Bacteria 71414
302 Ga0207671_11177359 3300025914 Bacteria 600
303 Ga0207693_10190086 3300025915 Bacteria 1616
304 Ga0207652_10624676 3300025921 Bacteria 965
305 Ga0207681_10809505 3300025923 Bacteria 783
306 Ga0207694_10332294 3300025924 Bacteria 1256
307 Ga0207650_10371693 3300025925 Bacteria 1179
308 Ga0207644_10149297 3300025931 Bacteria 1807
309 Ga0207709_10167445 3300025935 Bacteria 1539
310 Ga0207709_10327796 3300025935 Bacteria 1148
311 Ga0207669_11092189 3300025937 Bacteria 673
312 Ga0207711_10051970 3300025941 Bacteria 3510
313 Ga0207711_11076542 3300025941 Bacteria 744
314 Ga0207667_11179032 3300025949 Bacteria 746
315 Ga0207640_10076820 3300025981 Bacteria 2268
316 Ga0207640_10899856 3300025981 Bacteria 773
317 Ga0207658_11100088 3300025986 Bacteria 726
318 Ga0207639_10351567 3300026041 Bacteria 1316
319 Ga0207639_11773578 3300026041 Bacteria 578
320 Ga0207708_10377182 3300026075 Bacteria 1169
321 Ga0207702_10018015 3300026078 Bacteria 5845
322 Ga0207702_10623376 3300026078 Bacteria 1059
323 Ga0207674_11471237 3300026116 Bacteria 650
324 Ga0207698_11838853 3300026142 Bacteria 621
325 Ga0209281_1000036 3300027111 Bacteria 369415
326 Ga0209281_1000047 3300027111 Bacteria 326514
327 Ga0209371_1000058 3300027312 Bacteria 237920
328 Ga0209371_1001102 3300027312 Bacteria 20054
329 Ga0209371_1004687 3300027312 Bacteria 5806
330 Ga0209983_1077394 3300027665 Bacteria 744
331 Ga0209282_1005675 3300027666 Bacteria 7688
332 Ga0209282_1043032 3300027666 Bacteria 2659
333 Ga0209813_10005185 3300027866 Bacteria 3151
334 Ga0209813_10075088 3300027866 Bacteria 1107
335 Ga0209813_10215839 3300027866 Bacteria 716
336 Ga0268266_10012142 3300028379 Bacteria 7456
337 Ga0268266_10069211 3300028379 Bacteria 3058
338 Ga0268266_10335561 3300028379 Bacteria 1418
339 Ga0268266_10555960 3300028379 Bacteria 1100
340 Ga0268265_12428906 3300028380 Bacteria 530
341 Ga0268264_10000043 3300028381 Bacteria 371761
342 Ga0307515_10001876 3300028794 Bacteria 46792
343 Ga0307515_10014201 3300028794 Bacteria 14800
344 Ga0307515_10245958 3300028794 Bacteria 1550
345 Ga0268256_1000056 3300030500 Bacteria 231684
346 Ga0268256_1001773 3300030500 Bacteria 12177
347 Ga0268256_1005673 3300030500 Bacteria 4835
348 Ga0316181_1125298 3300030744 Bacteria 4996
349 Ga0307513_10196979 3300031456 Bacteria 1860
350 Ga0307513_10280224 3300031456 Bacteria 1445
351 Ga0307513_10548913 3300031456 Bacteria 868
352 Ga0307408_100259327 3300031548 Bacteria 1438
353 Ga0307408_100359750 3300031548 Bacteria 1238
354 Ga0307516_10426924 3300031730 Bacteria 983
355 Ga0307405_10006169 3300031731 Bacteria 5872
356 Ga0307405_10408406 3300031731 Bacteria 1065
357 Ga0307405_10533313 3300031731 Bacteria 947
358 Ga0307413_10487640 3300031824 Bacteria 987
359 Ga0307406_10019411 3300031901 Bacteria 3989
360 Ga0307412_10016051 3300031911 Bacteria 4451
361 Ga0307412_10547840 3300031911 Bacteria 971
362 Ga0373954_0654168 3300035118 Bacteria 521
363 Ga0373961_0063716 3300035241 Bacteria 1125
364 Ga0373935_0044291 3300035692 Bacteria 2804
365 Ga0373927_0000343 3300035695 Bacteria 36640
366 Ga0373925_0014749 3300037068 Bacteria 5646
367 Ga0395905_0000417 3300037471 Bacteria 59694
368 Ga0395905_0000510 3300037471 Bacteria 53278
369 Ga0395901_0501956 3300038443 Bacteria 1235
370 Ga0436365_0167701 3300039437 Bacteria 1052
371 Ga0439465_0098697 3300041413 Bacteria 1006
372 Ga0451787_171768 3300041441 Bacteria 1224
373 Ga0451793_0417637 3300041452 Bacteria 1076
374 Ga0451797_0850152 3300041453 Bacteria 1338
375 Ga0451800_0211985 3300041459 Bacteria 843
376 Ga0451807_0109277 3300041486 Bacteria 580
377 Ga0451807_1324974 3300041486 Bacteria 857
378 Ga0451835_0475184 3300041492 Bacteria 2443
379 Ga0451839_1012362 3300041496 Bacteria 567
380 Ga0451840_13150 3300041497 Bacteria 1378
381 Ga0451841_1202596 3300041498 Bacteria 2201
382 Ga0451844_03674 3300041500 Bacteria 546
383 Ga0451846_28374 3300041502 Bacteria 2243
384 Ga0451848_08569 3300041504 Bacteria 1191
385 Ga0451850_18058 3300041506 Bacteria 1117
386 Ga0451853_3274431 3300041512 Bacteria 2109
387 Ga0452271_92729 3300041916 Bacteria 1876
388 Ga0439449_0004832 3300042007 Bacteria 5197
389 Ga0439449_0100753 3300042007 Bacteria 1068
390 Ga0466982_0542145 3300044672 Bacteria 591
391 Ga0466963_0058302 3300044694 Bacteria 2574
392 Ga0466964_0118839 3300044706 Bacteria 1189
393 Ga0466971_0150226 3300044719 Bacteria 1087
394 Ga0466970_0036193 3300044765 Bacteria 2614
395 Ga0466970_0749027 3300044765 Bacteria 571
396 Ga0466958_0054106 3300045836 Bacteria 2434
397 Ga0466967_1154027 3300045976 Bacteria 772
398 Ga0495617_073869 3300046452 Bacteria 1120
399 Ga0495638_0048331 3300046460 Bacteria 2663
400 Ga0495638_0283936 3300046460 Bacteria 898
401 Ga0495650_0058946 3300046471 Bacteria 1548
402 Ga0495650_0093122 3300046471 Bacteria 1143
403 Ga0495605_0037945 3300046474 Bacteria 2420
404 Ga0495639_0568203 3300046475 Bacteria 582
405 Ga0495662_0182778 3300046476 Bacteria 1033
406 Ga0495664_0103760 3300046477 Bacteria 1714
407 Ga0495584_0455354 3300046491 Bacteria 651
408 Ga0495585_0029057 3300046492 Bacteria 3150
409 Ga0495585_0263498 3300046492 Bacteria 856
410 Ga0495596_0320417 3300046500 Bacteria 603
411 Ga0495607_0034222 3300046501 Bacteria 3084
412 Ga0495607_0235991 3300046501 Bacteria 887
413 Ga0495583_0027440 3300046506 Bacteria 2810
414 Ga0495583_0047898 3300046506 Bacteria 1963
415 Ga0495606_0018841 3300046507 Bacteria 5161
416 Ga0495606_0029226 3300046507 Bacteria 3875
417 Ga0495606_0126085 3300046507 Bacteria 1526
418 Ga0495606_0143390 3300046507 Bacteria 1409
419 Ga0495606_0314364 3300046507 Bacteria 844
420 Ga0495606_0425710 3300046507 Bacteria 685
421 Ga0495610_0002799 3300046512 Bacteria 14263
422 Ga0495610_0024025 3300046512 Bacteria 3297
423 Ga0495610_0246889 3300046512 Bacteria 709
424 Ga0495616_0276015 3300046513 Bacteria 715
425 Ga0495620_0030263 3300046515 Bacteria 2495
426 Ga0495620_0048016 3300046515 Bacteria 1834
427 Ga0495631_0028888 3300046518 Bacteria 2527
428 Ga0495632_0025395 3300046519 Bacteria 3134
429 Ga0495632_0049563 3300046519 Bacteria 2075
430 Ga0495643_0026643 3300046522 Bacteria 3259
431 Ga0495644_0384914 3300046523 Bacteria 554
432 Ga0495648_0029022 3300046524 Bacteria 3677
433 Ga0495648_0225586 3300046524 Bacteria 921
434 Ga0495654_0003447 3300046530 Bacteria 9678
435 Ga0495654_0181021 3300046530 Bacteria 913
436 Ga0495609_0147674 3300046538 Bacteria 1001
437 Ga0495597_0021952 3300046542 Bacteria 2964
438 Ga0495633_0039287 3300046558 Bacteria 2259
439 Ga0495633_0046888 3300046558 Bacteria 2043
440 Ga0495633_0215281 3300046558 Bacteria 880
441 Ga0495656_0150641 3300046615 Bacteria 1123
442 Ga0495668_0080050 3300046616 Bacteria 1793
443 Ga0495668_0146539 3300046616 Bacteria 1292
444 Ga0495611_0095296 3300046648 Bacteria 1377
445 Ga0495611_0397597 3300046648 Bacteria 630
446 Ga0495625_0079872 3300046660 Bacteria 2279
447 Ga0495625_0204041 3300046660 Bacteria 1303
448 Ga0495625_0631884 3300046660 Bacteria 639
449 Ga0495635_0386798 3300046663 Bacteria 930
450 Ga0495657_0273909 3300046675 Bacteria 1011
451 Ga0495658_0165201 3300046683 Bacteria 1367
452 Ga0495624_0345888 3300046690 Bacteria 894
453 Ga0495670_0287765 3300046691 Bacteria 879
454 Ga0495600_0038572 3300046809 Bacteria 3109
455 Ga0495660_0310840 3300046810 Bacteria 711
456 Ga0495604_0128323 3300047317 Bacteria 1825
457 Ga0495672_0059475 3300047320 Bacteria 2211
458 Ga0495687_077288 3300047443 Bacteria 1315
459 Ga0495687_119074 3300047443 Bacteria 956
460 Ga0495687_187095 3300047443 Bacteria 670
461 Ga0495677_0242670 3300047445 Bacteria 704
462 Ga0495673_0078133 3300047469 Bacteria 1377
463 Ga0495686_0008883 3300047472 Bacteria 7307
464 Ga0495686_0035922 3300047472 Bacteria 3181
465 Ga0495615_0114001 3300048090 Bacteria 776
466 Ga0495626_0069218 3300048091 Bacteria 1590
467 Ga0495626_0170621 3300048091 Bacteria 907
468 Ga0496100_0142389 3300048903 Bacteria 1701
469 Ga0496101_0070666 3300048904 Bacteria 2557
470 Ga0496101_0137302 3300048904 Bacteria 1862
471 Ga0496101_0993593 3300048904 Bacteria 660
472 Ga0496102_0027835 3300048905 Bacteria 5048
473 Ga0496102_0112678 3300048905 Bacteria 2537
474 Ga0496102_1664484 3300048905 Bacteria 556
475 Ga0496103_0015173 3300048906 Bacteria 4580
476 Ga0496103_0065750 3300048906 Bacteria 2262
477 Ga0496104_0031444 3300048907 Bacteria 4936
478 Ga0496104_0532155 3300048907 Bacteria 1086
479 Ga0496105_0029755 3300048908 Bacteria 4471
480 Ga0496105_1211455 3300048908 Bacteria 555
481 Ga0496106_0015087 3300048909 Bacteria 5719
482 Ga0496106_0185807 3300048909 Bacteria 1651
483 Ga0496107_0403196 3300048910 Bacteria 1017
484 Ga0496108_0645419 3300048911 Bacteria 920
485 Ga0496109_0325330 3300048912 Bacteria 1451
486 Ga0496110_0024182 3300048913 Bacteria 5174
487 Ga0496110_0842715 3300048913 Bacteria 822
488 Ga0496110_1606830 3300048913 Bacteria 560
489 Ga0496111_0026685 3300048914 Bacteria 4080
490 Ga0496112_0553383 3300048915 Bacteria 1084
491 Ga0496113_0173809 3300048916 Bacteria 1706
492 Ga0496114_0073568 3300048917 Bacteria 2876
493 Ga0496114_0164122 3300048917 Bacteria 1933
494 Ga0496116_0000061 3300048919 Bacteria 271860
495 Ga0496116_0004401 3300048919 Bacteria 13471
496 Ga0496116_0041972 3300048919 Bacteria 3133
497 Ga0496116_0055113 3300048919 Bacteria 2613
498 Ga0496116_0062085 3300048919 Bacteria 2414
499 Ga0496116_0064173 3300048919 Bacteria 2361
500 Ga0496116_0069160 3300048919 Bacteria 2246
501 Ga0496116_0101931 3300048919 Bacteria 1712
502 Ga0496116_0108716 3300048919 Bacteria 1636
503 Ga0496117_0000002 3300048920 Bacteria 2483758
504 Ga0496117_0000641 3300048920 Bacteria 56335
505 Ga0496117_0006730 3300048920 Bacteria 11478
506 Ga0496117_0006987 3300048920 Bacteria 11187
507 Ga0496117_0021873 3300048920 Bacteria 5154
508 Ga0496117_0056403 3300048920 Bacteria 2736
509 Ga0496117_0061750 3300048920 Bacteria 2573
510 Ga0496117_0211518 3300048920 Bacteria 1087
511 Ga0496117_0234842 3300048920 Bacteria 1011
512 Ga0496117_0296638 3300048920 Bacteria 858
513 Ga0496117_0480762 3300048920 Bacteria 607
514 Ga0496118_0002328 3300048921 Bacteria 25774
515 Ga0496118_0016547 3300048921 Bacteria 6761
516 Ga0496118_0019839 3300048921 Bacteria 5992
517 Ga0496118_0042034 3300048921 Bacteria 3611
518 Ga0496118_0042441 3300048921 Bacteria 3588
519 Ga0496118_0251438 3300048921 Bacteria 1004
520 Ga0496118_0343264 3300048921 Bacteria 799
521 Ga0496119_0007704 3300048922 Bacteria 9634
522 Ga0496119_0027725 3300048922 Bacteria 3884
523 Ga0496119_0047978 3300048922 Bacteria 2652
524 Ga0496119_0057430 3300048922 Bacteria 2351
525 Ga0496119_0087635 3300048922 Bacteria 1776
526 Ga0496119_0093957 3300048922 Bacteria 1698
527 Ga0496119_0169431 3300048922 Bacteria 1154
528 Ga0496119_0585806 3300048922 Bacteria 509
529 Ga0496120_0000951 3300048923 Bacteria 39539
530 Ga0496120_0013700 3300048923 Bacteria 5443
531 Ga0496120_0065222 3300048923 Bacteria 2019
532 Ga0496120_0066629 3300048923 Bacteria 1991
533 Ga0496120_0205188 3300048923 Bacteria 952
534 Ga0496121_0000003 3300048924 Bacteria 1191431
535 Ga0496121_0002428 3300048924 Bacteria 28484
536 Ga0496121_0004370 3300048924 Bacteria 19103
537 Ga0496121_0007053 3300048924 Bacteria 13646
538 Ga0496121_0030273 3300048924 Bacteria 4974
539 Ga0496121_0030540 3300048924 Bacteria 4947
540 Ga0496121_0040901 3300048924 Bacteria 4060
541 Ga0496121_0046259 3300048924 Bacteria 3727
542 Ga0496121_0072004 3300048924 Bacteria 2776
543 Ga0496121_0158703 3300048924 Bacteria 1656
544 Ga0496121_0248902 3300048924 Bacteria 1234
545 Ga0496121_0359104 3300048924 Bacteria 968
546 Ga0496121_0458325 3300048924 Bacteria 820
547 Ga0496122_0000001 3300048925 Bacteria 1827766
548 Ga0496122_0000025 3300048925 Bacteria 362915
549 Ga0496122_0000399 3300048925 Bacteria 92476
550 Ga0496122_0021330 3300048925 Bacteria 5803
551 Ga0496122_0023670 3300048925 Bacteria 5401
552 Ga0496122_0029101 3300048925 Bacteria 4668
553 Ga0496122_0055166 3300048925 Bacteria 2976
554 Ga0496122_0059954 3300048925 Bacteria 2806
555 Ga0496122_0065628 3300048925 Bacteria 2630
556 Ga0496122_0070910 3300048925 Bacteria 2485
557 Ga0496122_0084824 3300048925 Bacteria 2189
558 Ga0496122_0092119 3300048925 Bacteria 2061
559 Ga0496122_0098138 3300048925 Bacteria 1968
560 Ga0496122_0133209 3300048925 Bacteria 1573
561 Ga0496122_0172476 3300048925 Bacteria 1301
562 Ga0496123_0000001 3300048926 Bacteria 1831497
563 Ga0496123_0000032 3300048926 Bacteria 285282
564 Ga0496123_0003753 3300048926 Bacteria 16655
565 Ga0496123_0005051 3300048926 Bacteria 13491
566 Ga0496123_0023077 3300048926 Bacteria 4775
567 Ga0496123_0028615 3300048926 Bacteria 4120
568 Ga0496123_0029510 3300048926 Bacteria 4035
569 Ga0496123_0048891 3300048926 Bacteria 2841
570 Ga0496123_0064479 3300048926 Bacteria 2334
571 Ga0496123_0068749 3300048926 Bacteria 2228
572 Ga0496123_0097691 3300048926 Bacteria 1720
573 Ga0496123_0117681 3300048926 Bacteria 1502
574 Ga0496123_0126523 3300048926 Bacteria 1425
575 Ga0496123_0128170 3300048926 Bacteria 1412
576 Ga0496123_0204942 3300048926 Bacteria 1007
577 Ga0496123_0208749 3300048926 Bacteria 994
578 Ga0496123_0417845 3300048926 Bacteria 605
579 Ga0496124_0001375 3300048927 Bacteria 36436
580 Ga0496124_0004615 3300048927 Bacteria 15952
581 Ga0496124_0004859 3300048927 Bacteria 15455
582 Ga0496124_0008172 3300048927 Bacteria 10978
583 Ga0496124_0009560 3300048927 Bacteria 9963
584 Ga0496124_0010738 3300048927 Bacteria 9233
585 Ga0496124_0018921 3300048927 Bacteria 6430
586 Ga0496124_0019034 3300048927 Bacteria 6407
587 Ga0496124_0023319 3300048927 Bacteria 5651
588 Ga0496124_0031603 3300048927 Bacteria 4685
589 Ga0496124_0043530 3300048927 Bacteria 3860
590 Ga0496124_0064727 3300048927 Bacteria 3051
591 Ga0496124_0076994 3300048927 Bacteria 2752
592 Ga0496124_0108934 3300048927 Bacteria 2233
593 Ga0496124_0134555 3300048927 Bacteria 1959
594 Ga0496124_0143902 3300048927 Bacteria 1878
595 Ga0496124_0259680 3300048927 Bacteria 1279
596 Ga0496124_0478127 3300048927 Bacteria 842
597 Ga0496125_0000155 3300048928 Bacteria 151541
598 Ga0496125_0001650 3300048928 Bacteria 31436
599 Ga0496125_0011951 3300048928 Bacteria 8646
600 Ga0496125_0022579 3300048928 Bacteria 5837
601 Ga0496125_0040552 3300048928 Bacteria 3992
602 Ga0496125_0103805 3300048928 Bacteria 2084
603 Ga0496125_0126493 3300048928 Bacteria 1810
604 Ga0496125_0130507 3300048928 Bacteria 1770
605 Ga0496125_0297465 3300048928 Bacteria 990
606 Ga0496126_0000081 3300048929 Bacteria 218818
607 Ga0496126_0001055 3300048929 Bacteria 46595
608 Ga0496126_0020861 3300048929 Bacteria 6414
609 Ga0496126_0025790 3300048929 Bacteria 5647
610 Ga0496126_0203486 3300048929 Bacteria 1670
611 Ga0496126_0276402 3300048929 Bacteria 1392
612 Ga0496126_0283981 3300048929 Bacteria 1370
613 Ga0496126_0785365 3300048929 Bacteria 732
614 Ga0496126_1225144 3300048929 Bacteria 550
615 Ga0495678_021753 3300049459 Bacteria 2818
616 Ga0495682_0340079 3300049460 Bacteria 529
617 Ga0501032_0230599 3300049569 Bacteria 1204
618 Ga0501033_0006625 3300049570 Bacteria 9057
619 Ga0501033_0365760 3300049570 Bacteria 1009
620 Ga0501034_0324030 3300049571 Bacteria 1473
621 Ga0501034_0558517 3300049571 Bacteria 1053
622 Ga0501034_0745454 3300049571 Bacteria 875
623 Ga0501036_0087090 3300049572 Bacteria 2640
624 Ga0501037_0826255 3300049573 Bacteria 611
625 Ga0501038_0114422 3300049574 Bacteria 2231
626 Ga0501039_0398683 3300049575 Bacteria 1081
627 Ga0501040_0956525 3300049576 Bacteria 621
628 Ga0501043_0097514 3300049579 Bacteria 2311
629 Ga0501046_0252411 3300049580 Bacteria 1298
630 Ga0501047_0157407 3300049581 Bacteria 2145
631 Ga0501072_0272005 3300049588 Bacteria 1348
632 Ga0501072_0743674 3300049588 Bacteria 770
633 Ga0501073_0047442 3300049589 Bacteria 3019
634 Ga0501073_0360341 3300049589 Bacteria 1004
635 Ga0501075_1552763 3300049591 Bacteria 501
636 Ga0501076_0564486 3300049592 Bacteria 939
637 Ga0501076_0761675 3300049592 Bacteria 799
638 Ga0501227_080014 3300049665 Bacteria 856
639 Ga0501080_0618362 3300049742 Bacteria 960
640 Ga0501083_0056452 3300049744 Bacteria 2631
641 Ga0501083_0232129 3300049744 Bacteria 1201
642 Ga0501241_030522 3300049758 Bacteria 1018
643 Ga0501035_0011205 3300049822 Bacteria 8304
644 Ga0501035_0813170 3300049822 Bacteria 746
645 Ga0501044_0227271 3300049823 Bacteria 1815
646 Ga0501044_0798699 3300049823 Bacteria 823
647 nmdc:mga03683_3930_c1 3300050489 Bacteria 4861
648 nmdc:mga03683_40613_c1 3300050489 Bacteria 1909
649 nmdc:mga03683_89964_c1 3300050489 Bacteria 1337
650 nmdc:mga03n38_7216_c1 3300050490 Bacteria 3919
651 nmdc:mga00v17_1054035_c1 3300050491 Bacteria 510
652 nmdc:mga00v17_1316_c1 3300050491 Bacteria 13009
653 nmdc:mga00v17_40_c1 3300050491 Bacteria 80338
654 nmdc:mga00v17_417329_c1 3300050491 Bacteria 872
655 nmdc:mga00v17_645713_c1 3300050491 Bacteria 681
656 nmdc:mga0yw44_39303_c1 3300050492 Bacteria 2805
657 nmdc:mga0yw44_39838_c1 3300050492 Bacteria 2788
658 nmdc:mga0yw44_61756_c1 3300050492 Bacteria 2300
659 nmdc:mga0k408_123477_c1 3300050493 Bacteria 1535
660 nmdc:mga0k408_3552_c1 3300050493 Bacteria 8244
661 nmdc:mga0k408_77389_c1 3300050493 Bacteria 1945
662 nmdc:mga06z11_29591_c1 3300050494 Bacteria 2640
663 nmdc:mga06z11_498651_c1 3300050494 Bacteria 738
664 nmdc:mga04h51_130513_c1 3300050495 Bacteria 945
665 nmdc:mga07m45_334060_c1 3300050496 Bacteria 881
666 nmdc:mga07m45_776269_c1 3300050496 Bacteria 550
667 nmdc:mga07m45_8386_c1 3300050496 Bacteria 5311
668 nmdc:mga05p37_1299293_c1 3300050507 Bacteria 742
669 nmdc:mga0qj67_281133_c1 3300050509 Bacteria 1349
670 nmdc:mga06r32_1711525_c1 3300050510 Bacteria 566
671 nmdc:mga06r32_208537_c1 3300050510 Bacteria 1942
672 nmdc:mga06r32_382246_c1 3300050510 Bacteria 1391
673 nmdc:mga08y16_1256106_c1 3300050511 Bacteria 709
674 nmdc:mga0sz30_18572_c1 3300050516 Bacteria 1647
675 nmdc:mga0sz30_265_c1 3300050516 Bacteria 20071
676 nmdc:mga0sz30_4566_c1 3300050516 Bacteria 1851
677 nmdc:mga0sz30_95762_c1 3300050516 Bacteria 588
678 Ga0500610_0047061 3300053079 Bacteria 2241
679 Ga0500643_024841 3300053087 Bacteria 1896
680 Ga0500643_025791 3300053087 Bacteria 1849
681 Ga0500644_0002689 3300053088 Bacteria 4442
682 Ga0500557_014583 3300053105 Bacteria 2101
683 Ga0500560_059980 3300053107 Bacteria 1238
684 Ga0500569_000941 3300053109 Bacteria 5234
685 Ga0500569_007733 3300053109 Bacteria 2426
686 Ga0500572_033612 3300053111 Bacteria 1448
687 Ga0500594_0012885 3300053118 Bacteria 1979
688 Ga0500607_293124 3300053121 Bacteria 608
689 Ga0500608_017344 3300053122 Bacteria 3270
690 Ga0500608_081168 3300053122 Bacteria 1530
691 Ga0500618_000190 3300053125 Bacteria 50341
692 Ga0500618_000619 3300053125 Bacteria 21597
693 Ga0500618_009408 3300053125 Bacteria 2668
694 Ga0500618_024796 3300053125 Bacteria 1442
695 Ga0500618_034710 3300053125 Bacteria 1173
696 Ga0500642_0209384 3300053130 Bacteria 905
697 Ga0500658_0000262 3300053134 Bacteria 24241
698 Ga0500658_0023929 3300053134 Bacteria 2337
699 Ga0500559_0014361 3300053136 Bacteria 3347
700 Ga0500561_0000314 3300053137 Bacteria 8270
701 Ga0500568_0007314 3300053139 Bacteria 5428
702 Ga0500568_0023435 3300053139 Bacteria 2625
703 Ga0500573_0010605 3300053140 Bacteria 5143
704 Ga0500590_099708 3300053148 Bacteria 1396
705 Ga0500604_0066786 3300053151 Bacteria 1140
706 Ga0500616_0021838 3300053153 Bacteria 3580
707 Ga0500616_0034244 3300053153 Bacteria 2767
708 Ga0500616_0110437 3300053153 Bacteria 1329
709 Ga0500622_0000830 3300053156 Bacteria 26470
710 Ga0500622_0007788 3300053156 Bacteria 6042
711 Ga0500622_0217992 3300053156 Bacteria 857
712 Ga0500624_000222 3300053157 Bacteria 21107
713 Ga0500624_022504 3300053157 Bacteria 1026
714 Ga0500627_0119307 3300053158 Bacteria 1189
715 Ga0500627_0181906 3300053158 Bacteria 946
716 Ga0500627_0260482 3300053158 Bacteria 765
717 Ga0500633_0272638 3300053160 Bacteria 626
718 Ga0500634_0009966 3300053161 Bacteria 4837
719 Ga0500634_0304943 3300053161 Bacteria 629
720 Ga0500636_0000115 3300053177 Bacteria 41660
721 Ga0500636_0002063 3300053177 Bacteria 11088
722 Ga0500565_026180 3300053734 Bacteria 738
723 Ga0501084_0667713 3300054114 Bacteria 877
724 Ga0587084_073933 3300059477 Bacteria 648
725 Ga0587066_063503 3300059490 Bacteria 760
726 Ga0587066_088296 3300059490 Bacteria 684
727 Ga0587073_0100797 3300059492 Bacteria 750
728 Ga0587073_0194053 3300059492 Bacteria 604
729 Ga0587077_073191 3300059493 Bacteria 770
730 Ga0587083_0222556 3300059505 Bacteria 550
731 Ga0587088_020713 3300059508 Bacteria 1093
732 Ga0587088_167536 3300059508 Bacteria 542
733 Ga0587090_000175 3300059510 Bacteria 4472
734 Ga0587091_007538 3300059511 Bacteria 1574
735 Ga0587091_039285 3300059511 Bacteria 926
736 Ga0587094_056360 3300059513 Bacteria 678
737 Ga0587106_041200 3300059605 Bacteria 785
738 Ga0587128_031127 3300059630 Bacteria 884
739 Ga0587067_067651 3300059640 Bacteria 764
740 Ga0587072_044684 3300059643 Bacteria 871
741 Ga0587072_062511 3300059643 Bacteria 770
742 Ga0587075_088827 3300059644 Bacteria 601
743 Ga0587076_094276 3300059645 Bacteria 659
744 Ga0587076_169313 3300059645 Bacteria 543
745 Ga0587102_044756 3300059649 Bacteria 581
746 Ga0587107_029483 3300059652 Bacteria 826
747 Ga0587071_078413 3300060344 Bacteria 732
748 Ga0501082_0926653 3300060353 Bacteria 762
749 Ga0530510_1006086 3300061734 Bacteria 638
750 2509386762 2509276021 Bacteria 7634384
751 2509443167 2509276033 Bacteria 7180565
752 2510133233 2510065019 Bacteria 6903379
753 2510843478 2510461069 Bacteria 5505000
754 2510894599 2510461076 Bacteria 8618824
755 2511135038 2510917022 Bacteria 6504556
756 2511168728 2510917026 Bacteria 7046020
757 2511182346 2510917028 Bacteria 6185411
758 2511200010 2510917030 Bacteria 7460662
759 2513572291 2513237084 Bacteria 7231967
760 2513579647 2513237085 Bacteria 7695351
761 2513594511 2513237088 Bacteria 6927906
762 2513634414 2513237093 Bacteria 7545552
763 2513708812 2513237103 Bacteria 7647401
764 2513864569 2513237138 Bacteria 7368160
765 2513913101 2513237144 Bacteria 7530820
766 2513926320 2513237146 Bacteria 7166346
767 2514021548 2513237162 Bacteria 7468464
768 2515112189 2515075009 Bacteria 7288508
769 2515637258 2515154113 Bacteria 7807172
770 2515639693 2515154114 Bacteria 7848616
771 2515657337 2515154116 Bacteria 7552979
772 2515738658 2515154134 Bacteria 7220242
773 2517035921 2516653077 Bacteria 7555578
774 2517076317 2516653085 Bacteria 7346596
775 2517095073 2517093000 Bacteria 7412387
776 2517406705 2517287029 Bacteria 6905599
777 2520379337 2519899620 Bacteria 6499161
778 2524460354 2524023209 Bacteria 6679728
779 2530645448 2529292951 Bacteria 6916614
780 2535516424 2534681796 Bacteria 7146037
781 2554247982 2554235003 Bacteria 5877155
782 2559295100 2558860242 Bacteria 5568029
783 2561466451 2558860983 Bacteria 4133860
784 2585200090 2582581294 Bacteria 6626667
785 2585224270 2582581298 Bacteria 7315509
786 2585232822 2582581299 Bacteria 6518058
787 2585254679 2582581304 Bacteria 5831370
788 2585270777 2582581307 Bacteria 6597605
789 2585277129 2582581308 Bacteria 7413247
790 2585323862 2582581315 Bacteria 7318924
791 2585331840 2582581316 Bacteria 7774528
792 2585401937 2582581867 Bacteria 7184437
793 2585527560 2585427526 Bacteria 7258840
794 2585534135 2585427527 Bacteria 7273426
795 2585537456 2585427528 Bacteria 6842387
796 2585546391 2585427529 Bacteria 7395659
797 2585552013 2585427530 Bacteria 7383882
798 2585558500 2585427531 Bacteria 6992870
799 2585821722 2585427590 Bacteria 6824633
800 2585835412 2585427593 Bacteria 7141551
801 2585846664 2585427594 Bacteria 6180594
802 2585897867 2585427608 Bacteria 6544331
803 2585904530 2585427609 Bacteria 6667127
804 2585995829 2585427633 Bacteria 6413184
805 2586000392 2585427634 Bacteria 6455027
806 2587980354 2585428125 Bacteria 6662905
807 2599417799 2599185170 Bacteria 7295545
808 2599601412 2599185210 Bacteria 5624189
809 2599721458 2599185236 Bacteria 6875203
810 2600374583 2600254933 Bacteria 4750527
811 2601612038 2600255279 Bacteria 5605316
812 2601749178 2600255308 Bacteria 5611129
813 2616292548 2615840624 Bacteria 6557588
814 2616308506 2615840626 Bacteria 7921970
815 2616557191 2615840698 Bacteria 7319877
816 2617385677 2617270742 Bacteria 6808054
817 2643811785 2643221558 Bacteria 5460675
818 2643854519 2643221568 Bacteria 5187270
819 2643919511 2643221582 Bacteria 5804683
820 2644003696 2643221599 Bacteria 6292121
821 2644192846 2643221634 Bacteria 6705461
822 2644239509 2643221643 Bacteria 5749658
823 2644300257 2643221653 Bacteria 4569637
824 2644520256 2643221693 Bacteria 5513853
825 2644658483 2643221719 Bacteria 4568197
826 2671111790 2667528174 Bacteria 6435400
827 2719181093 2718217882 Bacteria 6556348
828 2719385707 2718217927 Bacteria 6972593
829 2719665526 2718217997 Bacteria 6740740
830 2719731842 2718218009 Bacteria 6478651
831 2720491946 2718218199 Bacteria 6740745
832 2720613213 2718218232 Bacteria 6720332
833 2720620088 2718218233 Bacteria 6662049
834 2720631513 2718218235 Bacteria 6630699
835 2720775241 2718218269 Bacteria 6906114
836 2721147187 2718218363 Bacteria 6524337
837 2721158719 2718218365 Bacteria 6274507
838 2721164105 2718218366 Bacteria 6425255
839 2721399487 2718218423 Bacteria 6438183
840 2722840275 2721755514 Bacteria 6424414
841 2723026858 2721755556 Bacteria 6745503
842 2723560475 2721755684 Bacteria 6859907
843 2723567060 2721755685 Bacteria 6704835
844 2724038300 2721755809 Bacteria 6438790
845 2724044598 2721755810 Bacteria 6479005
846 2724089848 2721755819 Bacteria 6906405
847 2724104325 2721755822 Bacteria 6726041
848 2724110120 2721755823 Bacteria 6752556
849 2730107794 2728369352 Bacteria 6745171
850 2730164330 2728369365 Bacteria 6555560
851 2730298351 2728369397 Bacteria 6274511
852 2738801985 2738541293 Bacteria 7065685
853 2738946138 2738541317 Bacteria 5340176
854 2739036423 2738541333 Bacteria 7106503
855 2766063088 2765235942 Bacteria 7445910
856 2776913615 2775507049 Bacteria 6284736
857 2778173943 2775507266 Bacteria 7392367
858 2793294591 2791355256 Bacteria 6798008
859 2793312163 2791355259 Bacteria 7254731
860 2793322107 2791355260 Bacteria 6598818
861 2793326587 2791355261 Bacteria 6661293
862 2793335813 2791355262 Bacteria 6774204
863 2793341441 2791355263 Bacteria 6872478
864 2793349166 2791355264 Bacteria 6429314
865 2793356710 2791355265 Bacteria 6539969
866 2793361249 2791355266 Bacteria 7116587
867 2793369337 2791355267 Bacteria 7222458
868 2805925627 2802429605 Bacteria 6875453
869 2805933653 2802429606 Bacteria 6346811
870 2806045973 2802429633 Bacteria 7341974
871 2806054353 2802429634 Bacteria 7083200
872 2806060358 2802429635 Bacteria 7650140
873 2806065186 2802429636 Bacteria 7597525
874 2806072453 2802429637 Bacteria 7067217
875 2808985186 2808606387 Bacteria 5697198
876 2819242125 2818991272 Bacteria 4622173
877 2819559618 2818991439 Bacteria 6907412
878 2819612910 2818991448 Bacteria 6772224
879 2819637983 2818991453 Bacteria 7181617
880 2819687243 2818991461 Bacteria 7026071
881 2821127957 2821123053 Bacteria 7836056
882 2838020994 2838016132 Bacteria 6577831
883 2838029023 2838022645 Bacteria 6494267
884 2838030169 2838029111 Bacteria 6603031
885 2838037985 2838035591 Bacteria 7166484
886 2838043345 2838042994 Bacteria 6046894
887 2838052506 2838048938 Bacteria 6044578
888 2838066031 2838061910 Bacteria 6794874
889 2838073505 2838068647 Bacteria 6208656
890 2838667304 2838661181 Bacteria 7385261
891 2838672109 2838668709 Bacteria 6671819
892 2838676046 2838675328 Bacteria 4909118
893 2838682308 2838680041 Bacteria 6545511
894 2838689411 2838686498 Bacteria 7807632
895 2838696879 2838694306 Bacteria 6853137
896 2838704611 2838701080 Bacteria 6669771
897 2838709880 2838707686 Bacteria 6619912
898 2838714928 2838714209 Bacteria 5525906
899 2838721271 2838719591 Bacteria 5523910
900 2838725688 2838724970 Bacteria 4908691
901 2838730744 2838729681 Bacteria 7400765
902 2838738369 2838736955 Bacteria 5760694
903 2838743685 2838742623 Bacteria 7396178
904 2841841262 2841840854 Bacteria 5761912
905 2841848237 2841846520 Bacteria 5345850
906 2841857761 2841851746 Bacteria 7532261
907 2841859218 2841859092 Bacteria 5436171
908 2841864642 2841864319 Bacteria 6742987
909 2842078054 2842077413 Bacteria 6508645
910 2842110583 2842110456 Bacteria 7656360
911 2842119437 2842118031 Bacteria 7033875
912 2842125733 2842124991 Bacteria 5346824
913 2842130941 2842130223 Bacteria 4909145
914 2842141040 2842140634 Bacteria 5759631
915 2842148649 2842146304 Bacteria 5957337
916 2842153889 2842152218 Bacteria 4908957
917 2842157502 2842156927 Bacteria 6894975
918 2842164694 2842163707 Bacteria 6916235
919 2842171172 2842170452 Bacteria 5525737
920 2842177509 2842175837 Bacteria 4908771
921 2842180913 2842180545 Bacteria 6888678
922 2842188037 2842187318 Bacteria 5524014
923 2842194590 2842192696 Bacteria 6147454
924 2842205202 2842198810 Bacteria 6608673
925 2842206117 2842205361 Bacteria 6340321
926 2842212348 2842211629 Bacteria 5523832
927 2842217143 2842217011 Bacteria 7497767
928 2842226033 2842224351 Bacteria 5524473
929 2842231028 2842229732 Bacteria 7475766
930 2842239293 2842237096 Bacteria 6620661
931 2842244864 2842243621 Bacteria 7421798
932 2842254291 2842250916 Bacteria 6579627
933 2842258677 2842257432 Bacteria 7401195
934 2842268193 2842264693 Bacteria 6472963
935 2842273431 2842271015 Bacteria 7807131
936 2842279574 2842278818 Bacteria 6340002
937 2842286215 2842285085 Bacteria 6011953
938 2842291717 2842291075 Bacteria 7076806
939 2842302119 2842298080 Bacteria 6123127
940 2842304208 2842304105 Bacteria 7023636
941 2842313831 2842311132 Bacteria 6616990
942 2842317988 2842317721 Bacteria 6793725
943 2842345921 2842341865 Bacteria 7003929
944 2842357414 2842357229 Bacteria 6485165
945 2842364451 2842363717 Bacteria 6844742
946 2842372874 2842370503 Bacteria 7038661
947 2842378113 2842377471 Bacteria 7140707
948 2842385946 2842384541 Bacteria 7057858
949 2842397582 2842395702 Bacteria 6780583
950 2842403582 2842402390 Bacteria 6681310
951 2842409045 2842409023 Bacteria 6687331
952 2842415699 2842415677 Bacteria 6596907
953 2842427989 2842422224 Bacteria 6239196
954 2842431572 2842428310 Bacteria 6767288
955 2842438468 2842434925 Bacteria 6502746
956 2842445098 2842441272 Bacteria 6769273
957 2842452416 2842447887 Bacteria 6754142
958 2842465944 2842462802 Bacteria 6588055
959 2842473083 2842469257 Bacteria 6752936
960 2842476546 2842475841 Bacteria 6603183
961 2842484911 2842482326 Bacteria 7212537
962 2842489945 2842489311 Bacteria 6620893
963 2842496258 2842495871 Bacteria 6820686
964 2842503697 2842502639 Bacteria 6604161
965 2842515214 2842509118 Bacteria 6850950
966 2842516002 2842515876 Bacteria 5436280
967 2844459248 2844454524 Bacteria 7952546
968 2852389819 2852387548 Bacteria 8025568
969 2854899479 2854896431 Bacteria 5869725
970 2854918301 2854916844 Bacteria 5725939
971 2857518633 2857516855 Bacteria 7787325
972 2857534999 2857531043 Bacteria 6754041
973 2891374402 2891373044 Bacteria 5202277
974 2899793998 2899792073 Bacteria 4926588
975 2899807582 2899803654 Bacteria 5577784
976 2899846395 2899845264 Bacteria 5672268
977 2913311277 2913308742 Bacteria 5350706
978 2919106993 2919100787 Bacteria 7710546
979 2919115018 2919114240 Bacteria 5700270
980 2919168857 2919166419 Bacteria 4952238
981 2919175164 2919171160 Bacteria 6499771
982 2919411763 2919408235 Bacteria 6149349
983 2923557855 2923556063 Bacteria 6793593
984 2926755983 2926754445 Bacteria 5964435
985 2926763080 2926760298 Bacteria 5505990
986 2929140501 2929138655 Bacteria 5810547
987 2933008535 2933006813 Bacteria 4912075
988 2933013352 2933011516 Bacteria 5439334
989 2933021109 2933016740 Bacteria 6355406
990 2933571485 2933570622 Bacteria 7023390
991 2933586611 2933586486 Bacteria 7667493
992 2933596873 2933594066 Bacteria 5594265
993 2933604013 2933599457 Bacteria 5858799
994 2935897265 2935894831 Bacteria 6620579
995 2935904657 2935901341 Bacteria 7341747
996 2936385060 2936381700 Bacteria 7006523
997 2978971544 2978969890 Bacteria 5400756
998 2979094426 2979089926 Bacteria 5670289
999 2979098191 2979095461 Bacteria 5669583
1000 2979103666 2979100975 Bacteria 5423623
1001 2984511770 2984509177 Bacteria 5274802
1002 2984521870 2984518228 Bacteria 5277463
1003 2984541168 2984537506 Bacteria 5277481
1004 2984588689 2984587000 Bacteria 5263363
1005 2984603448 2984601300 Bacteria 5455244
1006 2989353294 2989349275 Bacteria 6349068
1007 2989778596 2989776772 Bacteria 4843317
1008 2996891626 2996887358 Bacteria 5795980
1009 2996898231 2996893221 Bacteria 5823108
1010 3003933597 3003930520 Bacteria 5667563
1011 3005415223 3005409236 Bacteria 7188837
1012 3005420179 3005416602 Bacteria 7064308
1013 3005447434 3005445848 Bacteria 6906074
1014 3005454144 3005452660 Bacteria 5889319
1015 639648453 639633055 Bacteria 7751309
1016 650740303 650716007 Bacteria 5573770
1017 8003571354 8003570095 Bacteria 5747666
1018 8005250907 8005246636 Bacteria 4933972
1019 8005262956 8005258706 Bacteria 6184835
1020 8005280484 8005275841 Bacteria 6929066
1021 8005283102 8005282627 Bacteria 6675747
1022 8005290337 8005289223 Bacteria 6634003
1023 8005302470 8005301065 Bacteria 6614431
1024 8005314448 8005307578 Bacteria 7395396
1025 8005317130 8005314921 Bacteria 7072929
1026 8005326153 8005321885 Bacteria 5795980
1027 8005379114 8005376324 Bacteria 6590079
1028 8005388246 8005382845 Bacteria 6732062
1029 8005397228 8005395548 Bacteria 6806915
1030 8005432051 8005430974 Bacteria 6689030
1031 8005462851 8005460587 Bacteria 7157962
1032 8005485071 8005484373 Bacteria 6297373
1033 8005500250 8005497431 Bacteria 6477605
1034 8005545072 8005542996 Bacteria 7077758
1035 8005557805 8005556819 Bacteria 6908598
1036 8005568978 8005563573 Bacteria 7153261
1037 8005574790 8005570704 Bacteria 6957481
1038 8005621624 8005619151 Bacteria 7030230
1039 8005626445 8005626139 Bacteria 6534237
1040 8005648806 8005645114 Bacteria 6950293
1041 8005659530 8005658619 Bacteria 4500593
1042 8005671666 8005668836 Bacteria 6953162
1043 8005683265 8005682033 Bacteria 6726518
1044 8005694483 8005688590 Bacteria 6610080
1045 8005700110 8005695170 Bacteria 6912330
1046 8018129824 8018127388 Bacteria 7351159
1047 8018166890 8018163183 Bacteria 7277977
1048 8018179923 8018176218 Bacteria 6896178
1049 8023685476 8023680758 Bacteria 7729763
1050 8024492332 8024486573 Bacteria 6540512
1051 8024506678 8024501048 Bacteria 6427847
1052 8046773868 8046767195 Bacteria 7547379
1053 8054462889 8054460903 Bacteria 4872905
1054 8055435090 8055431914 Bacteria 4551896
1055 8056376543 8056375014 Bacteria 7006639
1056 8056388179 8056382006 Bacteria 6408074
1057 8057576756 8057575449 Bacteria 7367519
1058 8057875154 8057874678 Bacteria 7494653
1059 Ga0439432_094448
1060 JGI24740J21852_10000493
1061 JGI25155J39150_1000215
1062 JGI25156J39149_1000491
1063 JGI25162J39368_1002390
1064 JGI25162J39368_1002612
1065 JGI25154J39366_1000407
1066 JGI25158J39367_1000050
1067 JGI25158J39367_1000062
1068 JGI25157J39369_1000515
1069 JGI25152J39213_1000882
1070 JGI25152J39213_1001368
1071 JGI25152J39213_1004354
1072 JGI25152J39213_1005142
1073 JGI25152J39213_1010012
1074 JGI25152J39213_1010021
1075 JGI25152J39213_1010514
1076 JGI25150J39212_1000070
1077 JGI25159J45721_1000220
1078 JGI25159J45721_1000293
1079 JGI25151J46595_10000208
1080 JGI25151J46595_10002724
1081 JGI25151J46595_10003717
1082 JGI25151J46595_10061494
1083 JGI25151J46595_10102587
1084 JGI25151J46595_10125013
1085 JGI25165J46597_1002236
1086 JGI25165J46597_1013291
1087 JGI25165J46597_1045737
1088 JGI25153J46596_10005239
1089 JGI25153J46596_10007174
1090 JGI25153J46596_10012399
1091 JGI25153J46596_10017134
1092 JGI25153J46596_10024079
1093 JGI25153J46596_10024110
1094 Ga0006777J48905_1071315
1095 rootH1_10007619
1096 rootL2_10144815
1097 rootH1_10173941
1098 JGI25160J50197_1000010
1099 JGI25160J50197_1001320
1100 JGI25160J50197_1009199
1101 JGI25161J50226_1000006
1102 JGI25161J50226_1000055
1103 JGI25161J50226_1003482
1104 Ga0006562J51391_1011003
1105 Ga0006562J51391_1015089
1106 Ga0006780_1034804
1107 Ga0055539_1010828
1108 Ga0055526_1004543
1109 Ga0055526_1005021
1110 Ga0055526_1018953
1111 Ga0055526_1030878
1112 Ga0055524_1006400
1113 Ga0055524_1006486
1114 Ga0055524_1010891
1115 Ga0055524_1014571
1116 Ga0055524_1014808
1117 Ga0055524_1090124
1118 Ga0055536_1001994
1119 Ga0055528_1000222
1120 Ga0055528_1001131
1121 Ga0055528_1003737
1122 Ga0055528_1006581
1123 Ga0055528_1007309
1124 Ga0055528_1015876
1125 Ga0055530_10012055
1126 Ga0055540_1002477
1127 Ga0055540_1002600
1128 Ga0055540_1004537
1129 Ga0055540_1018459
1130 Ga0055531_10002361
1131 Ga0058692_1012421
1132 Ga0058692_1017684
1133 Ga0055543_1000014
1134 Ga0055543_1000032
1135 Ga0055543_1001284
1136 Ga0058859_11735091
1137 Ga0065165_1000251
1138 Ga0065165_1007728
1139 Ga0065165_1008141
1140 Ga0065165_1009371
1141 Ga0065165_1010277
1142 Ga0065716_1006144
1143 Ga0070658_11628835
1144 Ga0070676_11288229
1145 Ga0070670_102235645
1146 Ga0070666_10277318
1147 Ga0070680_100479679
1148 Ga0070691_10444225
1149 Ga0070668_100056375
1150 Ga0070668_101135544
1151 Ga0070668_101265686
1152 Ga0070669_100516076
1153 Ga0070671_100015004
1154 Ga0070659_100708508
1155 Ga0070667_100719536
1156 Ga0070700_100078363
1157 Ga0070663_100185984
1158 Ga0070663_100327877
1159 Ga0070663_100892988
1160 Ga0070681_10384584
1161 Ga0070665_100017458
1162 Ga0070665_100144234
1163 Ga0070665_101987164
1164 Ga0068854_101363251
1165 Ga0068856_100090914
1166 Ga0068860_100011367
1167 Ga0068862_100466932
1168 Ga0068862_101762160
1169 Ga0081538_10100234
1170 Ga0075365_10000756
1171 Ga0075368_10006544
1172 Ga0075368_10083887
1173 Ga0075368_10207400
1174 Ga0075363_100034113
1175 Ga0075363_100085198
1176 Ga0075364_10000588
1177 Ga0075364_10038531
1178 Ga0075364_10364891
1179 Ga0075364_10763204
1180 Ga0075432_10177480
1181 Ga0070715_10946374
1182 Ga0070712_100567161
1183 Ga0075362_10001370
1184 Ga0075362_10021646
1185 Ga0075362_10058822
1186 Ga0075367_10000829
1187 Ga0075367_10002190
1188 Ga0075367_10036160
1189 Ga0075367_10067009
1190 Ga0075369_10005950
1191 Ga0075369_10007017
1192 Ga0075369_10012601
1193 Ga0075369_10017769
1194 Ga0075369_10237727
1195 Ga0075366_10261609
1196 Ga0075370_10007341
1197 Ga0075370_10010671
1198 Ga0075370_10880672
1199 Ga0075430_100173733
1200 Ga0075431_100205127
1201 Ga0075431_100356459
1202 Ga0068865_102081222
1203 Ga0099826_10000117
1204 Ga0099826_10033503
1205 Ga0105251_10207618
1206 Ga0105244_10145660
1207 Ga0105250_10221710
1208 Ga0105240_10000005
1209 Ga0111539_10497418
1210 Ga0105245_10202838
1211 Ga0105247_10468941
1212 Ga0114129_11374989
1213 Ga0105243_10156938
1214 Ga0105243_11641641
1215 Ga0105243_11731130
1216 Ga0105248_10012698
1217 Ga0105248_11663373
1218 Ga0105237_10001882
1219 Ga0105237_11930570
1220 Ga0105238_10151748
1221 Ga0123341_1000004
1222 Ga0123342_1018578
1223 Ga0123342_1028932
1224 Ga0105239_10002014
1225 Ga0105239_10297106
1226 Ga0105239_11717616
1227 Ga0105246_11690659
1228 Ga0157336_1015709
1229 Ga0157318_1036339
1230 Ga0157314_1020052
1231 Ga0157313_1038229
1232 Ga0157326_1004013
1233 Ga0157373_10091427
1234 Ga0157373_10241962
1235 Ga0157373_10290076
1236 Ga0157373_11593629
1237 Ga0157371_10000015
1238 Ga0157371_10037850
1239 Ga0157371_10376884
1240 Ga0157370_10000274
1241 Ga0157370_10003029
1242 Ga0157370_10752136
1243 Ga0157369_11193503
1244 Ga0157374_10742330
1245 Ga0157378_10882951
1246 Ga0157372_10202277
1247 Ga0157372_10672482
1248 Ga0157375_10617180
1249 Ga0157380_10902198
1250 Ga0182008_10325844
1251 Ga0157379_10618896
1252 Ga0157376_11439415
1253 Ga0182007_10000711
1254 Ga0163161_10415253
1255 Ga0163161_10804756
1256 Ga0206355_1170784
1257 Ga0206351_10714990
1258 Ga0206352_10371491
1259 Ga0224712_10520244
1260 Ga0209435_100045
1261 Ga0209436_100001
1262 Ga0209672_104292
1263 Ga0209437_100047
1264 Ga0209437_100683
1265 Ga0207425_1000024
1266 Ga0207425_1001992
1267 Ga0207425_1004152
1268 Ga0207425_1007729
1269 Ga0207425_1013642
1270 Ga0207425_1038892
1271 Ga0207425_1056240
1272 Ga0209646_1000154
1273 Ga0209646_1014143
1274 Ga0209026_1000177
1275 Ga0209677_102447
1276 Ga0209148_1013402
1277 Ga0209759_1000795
1278 Ga0209759_1012909
1279 Ga0209129_1000069
1280 Ga0209129_1000133
1281 Ga0209129_1000880
1282 Ga0209129_1002492
1283 Ga0209129_1004911
1284 Ga0209129_1005326
1285 Ga0209129_1008393
1286 Ga0209129_1010222
1287 Ga0209233_1000048
1288 Ga0209233_1000069
1289 Ga0209233_1000221
1290 Ga0209565_1037304
1291 Ga0209455_1017885
1292 Ga0209673_1000013
1293 Ga0209673_1000048
1294 Ga0209673_1002108
1295 Ga0209673_1003476
1296 Ga0209673_1004376
1297 Ga0209673_1026450
1298 Ga0209673_1040852
1299 Ga0209130_1000004
1300 Ga0209130_1000021
1301 Ga0209130_1013753
1302 Ga0209130_1030697
1303 Ga0209675_1093169
1304 Ga0209676_1023289
1305 Ga0209676_1027846
1306 Ga0209025_1000050
1307 Ga0209025_1000572
1308 Ga0209025_1000787
1309 Ga0209025_1000803
1310 Ga0209025_1007047
1311 Ga0209025_1013063
1312 Ga0209025_1014129
1313 Ga0209025_1015082
1314 Ga0209025_1019159
1315 Ga0209025_1033243
1316 Ga0209025_1054224
1317 Ga0209564_1000375
1318 Ga0209564_1000570
1319 Ga0209564_1000631
1320 Ga0209564_1009645
1321 Ga0209564_1026738
1322 Ga0209564_1078010
1323 Ga0209758_1000342
1324 Ga0209758_1000421
1325 Ga0209758_1000468
1326 Ga0209758_1000942
1327 Ga0209758_1003958
1328 Ga0209758_1022512
1329 Ga0209758_1022516
1330 Ga0209758_1082158
1331 Ga0209050_1004988
1332 Ga0209050_1005655
1333 Ga0209256_1002453
1334 Ga0209256_1005734
1335 Ga0209256_1007991
1336 Ga0209256_1009330
1337 Ga0209256_1012872
1338 Ga0209256_1024014
1339 Ga0209256_1037585
1340 Ga0209256_1055214
1341 Ga0209256_1079533
1342 Ga0207426_1000003
1343 Ga0207426_1000010
1344 Ga0207426_1000039
1345 Ga0207426_1003019
1346 Ga0209051_1000445
1347 Ga0209051_1001553
1348 Ga0209051_1007905
1349 Ga0209051_1028176
1350 Ga0209051_1044776
1351 Ga0209257_1001375
1352 Ga0209257_1004317
1353 Ga0209257_1128584
1354 Ga0207688_10652165
1355 Ga0207680_10446938
1356 Ga0207685_10270111
1357 Ga0207645_10680053
1358 Ga0207695_10000011
1359 Ga0207671_10000314
1360 Ga0207671_11177359
1361 Ga0207693_10190086
1362 Ga0207652_10624676
1363 Ga0207681_10809505
1364 Ga0207694_10332294
1365 Ga0207650_10371693
1366 Ga0207644_10149297
1367 Ga0207709_10167445
1368 Ga0207709_10327796
1369 Ga0207669_11092189
1370 Ga0207711_10051970
1371 Ga0207711_11076542
1372 Ga0207667_11179032
1373 Ga0207640_10076820
1374 Ga0207640_10899856
1375 Ga0207658_11100088
1376 Ga0207639_10351567
1377 Ga0207639_11773578
1378 Ga0207708_10377182
1379 Ga0207702_10018015
1380 Ga0207702_10623376
1381 Ga0207674_11471237
1382 Ga0207698_11838853
1383 Ga0209281_1000036
1384 Ga0209281_1000047
1385 Ga0209371_1000058
1386 Ga0209371_1001102
1387 Ga0209371_1004687
1388 Ga0209983_1077394
1389 Ga0209282_1005675
1390 Ga0209282_1043032
1391 Ga0209813_10005185
1392 Ga0209813_10075088
1393 Ga0209813_10215839
1394 Ga0268266_10012142
1395 Ga0268266_10069211
1396 Ga0268266_10335561
1397 Ga0268266_10555960
1398 Ga0268265_12428906
1399 Ga0268264_10000043
1400 Ga0307515_10001876
1401 Ga0307515_10014201
1402 Ga0307515_10245958
1403 Ga0268256_1000056
1404 Ga0268256_1001773
1405 Ga0268256_1005673
1406 Ga0316181_1125298
1407 Ga0307513_10196979
1408 Ga0307513_10280224
1409 Ga0307513_10548913
1410 Ga0307408_100259327
1411 Ga0307408_100359750
1412 Ga0307516_10426924
1413 Ga0307405_10006169
1414 Ga0307405_10408406
1415 Ga0307405_10533313
1416 Ga0307413_10487640
1417 Ga0307406_10019411
1418 Ga0307412_10016051
1419 Ga0307412_10547840
1420 Ga0373954_0654168
1421 Ga0373961_0063716
1422 Ga0373935_0044291
1423 Ga0373927_0000343
1424 Ga0373925_0014749
1425 Ga0395905_0000417
1426 Ga0395905_0000510
1427 Ga0395901_0501956
1428 Ga0436365_0167701
1429 Ga0439465_0098697
1430 Ga0451787_171768
1431 Ga0451793_0417637
1432 Ga0451797_0850152
1433 Ga0451800_0211985
1434 Ga0451807_0109277
1435 Ga0451807_1324974
1436 Ga0451835_0475184
1437 Ga0451839_1012362
1438 Ga0451840_13150
1439 Ga0451841_1202596
1440 Ga0451844_03674
1441 Ga0451846_28374
1442 Ga0451848_08569
1443 Ga0451850_18058
1444 Ga0451853_3274431
1445 Ga0452271_92729
1446 Ga0439449_0004832
1447 Ga0439449_0100753
1448 Ga0466982_0542145
1449 Ga0466963_0058302
1450 Ga0466964_0118839
1451 Ga0466971_0150226
1452 Ga0466970_0036193
1453 Ga0466970_0749027
1454 Ga0466958_0054106
1455 Ga0466967_1154027
1456 Ga0495617_073869
1457 Ga0495638_0048331
1458 Ga0495638_0283936
1459 Ga0495650_0058946
1460 Ga0495650_0093122
1461 Ga0495605_0037945
1462 Ga0495639_0568203
1463 Ga0495662_0182778
1464 Ga0495664_0103760
1465 Ga0495584_0455354
1466 Ga0495585_0029057
1467 Ga0495585_0263498
1468 Ga0495596_0320417
1469 Ga0495607_0034222
1470 Ga0495607_0235991
1471 Ga0495583_0027440
1472 Ga0495583_0047898
1473 Ga0495606_0018841
1474 Ga0495606_0029226
1475 Ga0495606_0126085
1476 Ga0495606_0143390
1477 Ga0495606_0314364
1478 Ga0495606_0425710
1479 Ga0495610_0002799
1480 Ga0495610_0024025
1481 Ga0495610_0246889
1482 Ga0495616_0276015
1483 Ga0495620_0030263
1484 Ga0495620_0048016
1485 Ga0495631_0028888
1486 Ga0495632_0025395
1487 Ga0495632_0049563
1488 Ga0495643_0026643
1489 Ga0495644_0384914
1490 Ga0495648_0029022
1491 Ga0495648_0225586
1492 Ga0495654_0003447
1493 Ga0495654_0181021
1494 Ga0495609_0147674
1495 Ga0495597_0021952
1496 Ga0495633_0039287
1497 Ga0495633_0046888
1498 Ga0495633_0215281
1499 Ga0495656_0150641
1500 Ga0495668_0080050
1501 Ga0495668_0146539
1502 Ga0495611_0095296
1503 Ga0495611_0397597
1504 Ga0495625_0079872
1505 Ga0495625_0204041
1506 Ga0495625_0631884
1507 Ga0495635_0386798
1508 Ga0495657_0273909
1509 Ga0495658_0165201
1510 Ga0495624_0345888
1511 Ga0495670_0287765
1512 Ga0495600_0038572
1513 Ga0495660_0310840
1514 Ga0495604_0128323
1515 Ga0495672_0059475
1516 Ga0495687_077288
1517 Ga0495687_119074
1518 Ga0495687_187095
1519 Ga0495677_0242670
1520 Ga0495673_0078133
1521 Ga0495686_0008883
1522 Ga0495686_0035922
1523 Ga0495615_0114001
1524 Ga0495626_0069218
1525 Ga0495626_0170621
1526 Ga0496100_0142389
1527 Ga0496101_0070666
1528 Ga0496101_0137302
1529 Ga0496101_0993593
1530 Ga0496102_0027835
1531 Ga0496102_0112678
1532 Ga0496102_1664484
1533 Ga0496103_0015173
1534 Ga0496103_0065750
1535 Ga0496104_0031444
1536 Ga0496104_0532155
1537 Ga0496105_0029755
1538 Ga0496105_1211455
1539 Ga0496106_0015087
1540 Ga0496106_0185807
1541 Ga0496107_0403196
1542 Ga0496108_0645419
1543 Ga0496109_0325330
1544 Ga0496110_0024182
1545 Ga0496110_0842715
1546 Ga0496110_1606830
1547 Ga0496111_0026685
1548 Ga0496112_0553383
1549 Ga0496113_0173809
1550 Ga0496114_0073568
1551 Ga0496114_0164122
1552 Ga0496116_0000061
1553 Ga0496116_0004401
1554 Ga0496116_0041972
1555 Ga0496116_0055113
1556 Ga0496116_0062085
1557 Ga0496116_0064173
1558 Ga0496116_0069160
1559 Ga0496116_0101931
1560 Ga0496116_0108716
1561 Ga0496117_0000002
1562 Ga0496117_0000641
1563 Ga0496117_0006730
1564 Ga0496117_0006987
1565 Ga0496117_0021873
1566 Ga0496117_0056403
1567 Ga0496117_0061750
1568 Ga0496117_0211518
1569 Ga0496117_0234842
1570 Ga0496117_0296638
1571 Ga0496117_0480762
1572 Ga0496118_0002328
1573 Ga0496118_0016547
1574 Ga0496118_0019839
1575 Ga0496118_0042034
1576 Ga0496118_0042441
1577 Ga0496118_0251438
1578 Ga0496118_0343264
1579 Ga0496119_0007704
1580 Ga0496119_0027725
1581 Ga0496119_0047978
1582 Ga0496119_0057430
1583 Ga0496119_0087635
1584 Ga0496119_0093957
1585 Ga0496119_0169431
1586 Ga0496119_0585806
1587 Ga0496120_0000951
1588 Ga0496120_0013700
1589 Ga0496120_0065222
1590 Ga0496120_0066629
1591 Ga0496120_0205188
1592 Ga0496121_0000003
1593 Ga0496121_0002428
1594 Ga0496121_0004370
1595 Ga0496121_0007053
1596 Ga0496121_0030273
1597 Ga0496121_0030540
1598 Ga0496121_0040901
1599 Ga0496121_0046259
1600 Ga0496121_0072004
1601 Ga0496121_0158703
1602 Ga0496121_0248902
1603 Ga0496121_0359104
1604 Ga0496121_0458325
1605 Ga0496122_0000001
1606 Ga0496122_0000025
1607 Ga0496122_0000399
1608 Ga0496122_0021330
1609 Ga0496122_0023670
1610 Ga0496122_0029101
1611 Ga0496122_0055166
1612 Ga0496122_0059954
1613 Ga0496122_0065628
1614 Ga0496122_0070910
1615 Ga0496122_0084824
1616 Ga0496122_0092119
1617 Ga0496122_0098138
1618 Ga0496122_0133209
1619 Ga0496122_0172476
1620 Ga0496123_0000001
1621 Ga0496123_0000032
1622 Ga0496123_0003753
1623 Ga0496123_0005051
1624 Ga0496123_0023077
1625 Ga0496123_0028615
1626 Ga0496123_0029510
1627 Ga0496123_0048891
1628 Ga0496123_0064479
1629 Ga0496123_0068749
1630 Ga0496123_0097691
1631 Ga0496123_0117681
1632 Ga0496123_0126523
1633 Ga0496123_0128170
1634 Ga0496123_0204942
1635 Ga0496123_0208749
1636 Ga0496123_0417845
1637 Ga0496124_0001375
1638 Ga0496124_0004615
1639 Ga0496124_0004859
1640 Ga0496124_0008172
1641 Ga0496124_0009560
1642 Ga0496124_0010738
1643 Ga0496124_0018921
1644 Ga0496124_0019034
1645 Ga0496124_0023319
1646 Ga0496124_0031603
1647 Ga0496124_0043530
1648 Ga0496124_0064727
1649 Ga0496124_0076994
1650 Ga0496124_0108934
1651 Ga0496124_0134555
1652 Ga0496124_0143902
1653 Ga0496124_0259680
1654 Ga0496124_0478127
1655 Ga0496125_0000155
1656 Ga0496125_0001650
1657 Ga0496125_0011951
1658 Ga0496125_0022579
1659 Ga0496125_0040552
1660 Ga0496125_0103805
1661 Ga0496125_0126493
1662 Ga0496125_0130507
1663 Ga0496125_0297465
1664 Ga0496126_0000081
1665 Ga0496126_0001055
1666 Ga0496126_0020861
1667 Ga0496126_0025790
1668 Ga0496126_0203486
1669 Ga0496126_0276402
1670 Ga0496126_0283981
1671 Ga0496126_0785365
1672 Ga0496126_1225144
1673 Ga0495678_021753
1674 Ga0495682_0340079
1675 Ga0501032_0230599
1676 Ga0501033_0006625
1677 Ga0501033_0365760
1678 Ga0501034_0324030
1679 Ga0501034_0558517
1680 Ga0501034_0745454
1681 Ga0501036_0087090
1682 Ga0501037_0826255
1683 Ga0501038_0114422
1684 Ga0501039_0398683
1685 Ga0501040_0956525
1686 Ga0501043_0097514
1687 Ga0501046_0252411
1688 Ga0501047_0157407
1689 Ga0501072_0272005
1690 Ga0501072_0743674
1691 Ga0501073_0047442
1692 Ga0501073_0360341
1693 Ga0501075_1552763
1694 Ga0501076_0564486
1695 Ga0501076_0761675
1696 Ga0501227_080014
1697 Ga0501080_0618362
1698 Ga0501083_0056452
1699 Ga0501083_0232129
1700 Ga0501241_030522
1701 Ga0501035_0011205
1702 Ga0501035_0813170
1703 Ga0501044_0227271
1704 Ga0501044_0798699
1705 nmdc:mga03683_3930_c1
1706 nmdc:mga03683_40613_c1
1707 nmdc:mga03683_89964_c1
1708 nmdc:mga03n38_7216_c1
1709 nmdc:mga00v17_1054035_c1
1710 nmdc:mga00v17_1316_c1
1711 nmdc:mga00v17_40_c1
1712 nmdc:mga00v17_417329_c1
1713 nmdc:mga00v17_645713_c1
1714 nmdc:mga0yw44_39303_c1
1715 nmdc:mga0yw44_39838_c1
1716 nmdc:mga0yw44_61756_c1
1717 nmdc:mga0k408_123477_c1
1718 nmdc:mga0k408_3552_c1
1719 nmdc:mga0k408_77389_c1
1720 nmdc:mga06z11_29591_c1
1721 nmdc:mga06z11_498651_c1
1722 nmdc:mga04h51_130513_c1
1723 nmdc:mga07m45_334060_c1
1724 nmdc:mga07m45_776269_c1
1725 nmdc:mga07m45_8386_c1
1726 nmdc:mga05p37_1299293_c1
1727 nmdc:mga0qj67_281133_c1
1728 nmdc:mga06r32_1711525_c1
1729 nmdc:mga06r32_208537_c1
1730 nmdc:mga06r32_382246_c1
1731 nmdc:mga08y16_1256106_c1
1732 nmdc:mga0sz30_18572_c1
1733 nmdc:mga0sz30_265_c1
1734 nmdc:mga0sz30_4566_c1
1735 nmdc:mga0sz30_95762_c1
1736 Ga0500610_0047061
1737 Ga0500643_024841
1738 Ga0500643_025791
1739 Ga0500644_0002689
1740 Ga0500557_014583
1741 Ga0500560_059980
1742 Ga0500569_000941
1743 Ga0500569_007733
1744 Ga0500572_033612
1745 Ga0500594_0012885
1746 Ga0500607_293124
1747 Ga0500608_017344
1748 Ga0500608_081168
1749 Ga0500618_000190
1750 Ga0500618_000619
1751 Ga0500618_009408
1752 Ga0500618_024796
1753 Ga0500618_034710
1754 Ga0500642_0209384
1755 Ga0500658_0000262
1756 Ga0500658_0023929
1757 Ga0500559_0014361
1758 Ga0500561_0000314
1759 Ga0500568_0007314
1760 Ga0500568_0023435
1761 Ga0500573_0010605
1762 Ga0500590_099708
1763 Ga0500604_0066786
1764 Ga0500616_0021838
1765 Ga0500616_0034244
1766 Ga0500616_0110437
1767 Ga0500622_0000830
1768 Ga0500622_0007788
1769 Ga0500622_0217992
1770 Ga0500624_000222
1771 Ga0500624_022504
1772 Ga0500627_0119307
1773 Ga0500627_0181906
1774 Ga0500627_0260482
1775 Ga0500633_0272638
1776 Ga0500634_0009966
1777 Ga0500634_0304943
1778 Ga0500636_0000115
1779 Ga0500636_0002063
1780 Ga0500565_026180
1781 Ga0501084_0667713
1782 Ga0587084_073933
1783 Ga0587066_063503
1784 Ga0587066_088296
1785 Ga0587073_0100797
1786 Ga0587073_0194053
1787 Ga0587077_073191
1788 Ga0587083_0222556
1789 Ga0587088_020713
1790 Ga0587088_167536
1791 Ga0587090_000175
1792 Ga0587091_007538
1793 Ga0587091_039285
1794 Ga0587094_056360
1795 Ga0587106_041200
1796 Ga0587128_031127
1797 Ga0587067_067651
1798 Ga0587072_044684
1799 Ga0587072_062511
1800 Ga0587075_088827
1801 Ga0587076_094276
1802 Ga0587076_169313
1803 Ga0587102_044756
1804 Ga0587107_029483
1805 Ga0587071_078413
1806 Ga0501082_0926653
1807 Ga0530510_1006086
1808 2509386762
1809 2509443167
1810 2510133233
1811 2510843478
1812 2510894599
1813 2511135038
1814 2511168728
1815 2511182346
1816 2511200010
1817 2513572291
1818 2513579647
1819 2513594511
1820 2513634414
1821 2513708812
1822 2513864569
1823 2513913101
1824 2513926320
1825 2514021548
1826 2515112189
1827 2515637258
1828 2515639693
1829 2515657337
1830 2515738658
1831 2517035921
1832 2517076317
1833 2517095073
1834 2517406705
1835 2520379337
1836 2524460354
1837 2530645448
1838 2535516424
1839 2554247982
1840 2559295100
1841 2561466451
1842 2585200090
1843 2585224270
1844 2585232822
1845 2585254679
1846 2585270777
1847 2585277129
1848 2585323862
1849 2585331840
1850 2585401937
1851 2585527560
1852 2585534135
1853 2585537456
1854 2585546391
1855 2585552013
1856 2585558500
1857 2585821722
1858 2585835412
1859 2585846664
1860 2585897867
1861 2585904530
1862 2585995829
1863 2586000392
1864 2587980354
1865 2599417799
1866 2599601412
1867 2599721458
1868 2600374583
1869 2601612038
1870 2601749178
1871 2616292548
1872 2616308506
1873 2616557191
1874 2617385677
1875 2643811785
1876 2643854519
1877 2643919511
1878 2644003696
1879 2644192846
1880 2644239509
1881 2644300257
1882 2644520256
1883 2644658483
1884 2671111790
1885 2719181093
1886 2719385707
1887 2719665526
1888 2719731842
1889 2720491946
1890 2720613213
1891 2720620088
1892 2720631513
1893 2720775241
1894 2721147187
1895 2721158719
1896 2721164105
1897 2721399487
1898 2722840275
1899 2723026858
1900 2723560475
1901 2723567060
1902 2724038300
1903 2724044598
1904 2724089848
1905 2724104325
1906 2724110120
1907 2730107794
1908 2730164330
1909 2730298351
1910 2738801985
1911 2738946138
1912 2739036423
1913 2766063088
1914 2776913615
1915 2778173943
1916 2793294591
1917 2793312163
1918 2793322107
1919 2793326587
1920 2793335813
1921 2793341441
1922 2793349166
1923 2793356710
1924 2793361249
1925 2793369337
1926 2805925627
1927 2805933653
1928 2806045973
1929 2806054353
1930 2806060358
1931 2806065186
1932 2806072453
1933 2808985186
1934 2819242125
1935 2819559618
1936 2819612910
1937 2819637983
1938 2819687243
1939 2821127957
1940 2838020994
1941 2838029023
1942 2838030169
1943 2838037985
1944 2838043345
1945 2838052506
1946 2838066031
1947 2838073505
1948 2838667304
1949 2838672109
1950 2838676046
1951 2838682308
1952 2838689411
1953 2838696879
1954 2838704611
1955 2838709880
1956 2838714928
1957 2838721271
1958 2838725688
1959 2838730744
1960 2838738369
1961 2838743685
1962 2841841262
1963 2841848237
1964 2841857761
1965 2841859218
1966 2841864642
1967 2842078054
1968 2842110583
1969 2842119437
1970 2842125733
1971 2842130941
1972 2842141040
1973 2842148649
1974 2842153889
1975 2842157502
1976 2842164694
1977 2842171172
1978 2842177509
1979 2842180913
1980 2842188037
1981 2842194590
1982 2842205202
1983 2842206117
1984 2842212348
1985 2842217143
1986 2842226033
1987 2842231028
1988 2842239293
1989 2842244864
1990 2842254291
1991 2842258677
1992 2842268193
1993 2842273431
1994 2842279574
1995 2842286215
1996 2842291717
1997 2842302119
1998 2842304208
1999 2842313831
2000 2842317988
2001 2842345921
2002 2842357414
2003 2842364451
2004 2842372874
2005 2842378113
2006 2842385946
2007 2842397582
2008 2842403582
2009 2842409045
2010 2842415699
2011 2842427989
2012 2842431572
2013 2842438468
2014 2842445098
2015 2842452416
2016 2842465944
2017 2842473083
2018 2842476546
2019 2842484911
2020 2842489945
2021 2842496258
2022 2842503697
2023 2842515214
2024 2842516002
2025 2844459248
2026 2852389819
2027 2854899479
2028 2854918301
2029 2857518633
2030 2857534999
2031 2891374402
2032 2899793998
2033 2899807582
2034 2899846395
2035 2913311277
2036 2919106993
2037 2919115018
2038 2919168857
2039 2919175164
2040 2919411763
2041 2923557855
2042 2926755983
2043 2926763080
2044 2929140501
2045 2933008535
2046 2933013352
2047 2933021109
2048 2933571485
2049 2933586611
2050 2933596873
2051 2933604013
2052 2935897265
2053 2935904657
2054 2936385060
2055 2978971544
2056 2979094426
2057 2979098191
2058 2979103666
2059 2984511770
2060 2984521870
2061 2984541168
2062 2984588689
2063 2984603448
2064 2989353294
2065 2989778596
2066 2996891626
2067 2996898231
2068 3003933597
2069 3005415223
2070 3005420179
2071 3005447434
2072 3005454144
2073 639648453
2074 650740303
2075 8003571354
2076 8005250907
2077 8005262956
2078 8005280484
2079 8005283102
2080 8005290337
2081 8005302470
2082 8005314448
2083 8005317130
2084 8005326153
2085 8005379114
2086 8005388246
2087 8005397228
2088 8005432051
2089 8005462851
2090 8005485071
2091 8005500250
2092 8005545072
2093 8005557805
2094 8005568978
2095 8005574790
2096 8005621624
2097 8005626445
2098 8005648806
2099 8005659530
2100 8005671666
2101 8005683265
2102 8005694483
2103 8005700110
2104 8018129824
2105 8018166890
2106 8018179923
2107 8023685476
2108 8024492332
2109 8024506678
2110 8046773868
2111 8054462889
2112 8055435090
2113 8056376543
2114 8056388179
2115 8057576756
2116 8057875154

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

20

122

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.877 1 99
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8629 6 99
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8236 6 99
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.816 6 101
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.806 1 99
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8962 6 99 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8779 6 99 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8621 6 89 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8356 6 108 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8254 6 89 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A537URB9-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.923 5 96 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A6N8UQF9-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.908 7 98 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A2P1P872-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9034 1 108 GO:0005737
GO:0016226
GO:0051537
GO:0097428
AF-A0A2E8KEE8-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.8975 2 94 GO:0005506
GO:0005829
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A4Q3NPK0-F1-model_v4 deleted 0.8867 6 97

Map