F489233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1058 | 672 | 2116 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300042006|Ga0439432_094448|Ga0439432_094448_425_862 |
| Length | 145 |
| Sequence | MKRRILTPVWKENEPMGFAVMSMTGTAAARVKAIVENSGPDAKGIRVGIKKGGCAGMEYTIELVSEPNAKDDLIERDGAKVWVEPSAVLYLLGTEMDFETTTLRSGFTFTNPNQTSACGCGESVELKPADLAALAAQRQSEPAHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 85 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 89 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 90 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 91 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 92 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 108 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 187 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 193 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 194 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 195 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 196 | 3300041500 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT | Metatranscriptome | Unclassified |
| 197 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 198 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 199 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 207 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 310 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 318 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 320 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 321 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 322 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 325 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 332 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 333 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 337 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 338 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 340 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 364 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 365 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 366 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 367 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 368 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 369 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 370 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 371 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 372 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 373 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 374 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 375 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 376 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 377 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 378 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 379 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 380 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 381 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 382 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 383 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 384 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 385 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 386 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 387 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 388 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 389 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 390 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 391 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 392 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 393 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 394 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 395 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 396 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 397 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 398 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 399 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 400 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 401 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 402 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 403 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 404 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 405 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 406 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 407 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 408 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 409 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 410 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 411 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 412 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 413 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 414 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 415 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 416 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 417 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 418 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 419 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 420 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 421 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 422 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 423 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 424 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 425 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 426 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 427 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 428 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 429 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 430 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 431 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 432 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 433 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 434 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 435 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 436 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 437 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 438 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 439 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 440 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 441 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 442 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 443 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 444 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 445 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 446 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 447 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 448 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 449 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 450 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 451 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 452 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 453 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 454 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 455 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 456 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 457 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 458 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 459 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 460 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 461 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 462 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 463 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 464 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 465 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 466 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 467 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 468 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 469 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 470 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 471 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 472 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 473 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 474 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 475 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 476 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 477 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 478 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 479 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 480 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 481 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 482 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 483 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 484 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 485 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 486 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 487 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 488 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 489 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 490 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 491 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 492 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 493 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 494 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 495 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 496 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 497 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 498 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 499 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 500 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 501 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 502 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 503 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 504 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 505 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 506 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 507 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 508 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 509 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 510 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 511 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 512 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 513 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 514 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 515 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 516 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 517 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 518 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 519 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 520 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 521 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 522 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 523 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 524 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 525 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 526 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 527 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 528 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 529 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 530 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 531 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 532 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 533 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 534 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 535 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 536 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 537 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 538 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 539 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 540 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 541 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 542 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 543 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 544 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 545 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 546 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 547 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 548 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 549 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 550 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 551 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 552 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 553 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 554 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 555 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 556 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 557 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 558 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 559 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 560 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 561 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 562 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 563 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 564 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 565 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 566 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 567 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 568 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 569 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 570 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 571 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 572 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 573 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 574 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 575 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 576 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 577 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 578 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 579 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 580 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 581 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 582 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 583 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 584 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 585 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 586 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 587 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 588 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 589 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 590 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 591 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 592 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 593 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 594 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 595 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 596 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 597 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 598 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 599 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 600 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 601 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 602 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 603 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 604 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 605 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 606 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 607 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 608 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 609 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 610 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 611 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 612 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 613 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 614 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 615 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 616 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 617 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 618 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 619 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 620 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 621 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 622 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 623 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 624 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 625 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 626 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 627 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 628 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 629 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 630 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 631 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 632 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 633 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 634 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 635 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 636 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 637 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 638 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 639 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 640 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 641 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 642 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 643 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 644 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 645 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 646 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 647 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 648 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 649 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 650 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 651 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 652 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 653 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 654 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 655 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 656 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 657 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 658 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 659 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 660 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 661 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 662 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 663 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 664 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 665 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 666 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 667 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 668 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 669 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 670 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 671 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 672 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 67.11 |
| Metatranscriptomes | 3.69 |
| Isolates | 29.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.47 |
| Bulb | 0 |
| Endosphere | 24.01 |
| Nodule | 19.75 |
| Rhizoplane | 3.69 |
| Rhizosphere | 31.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439432_094448 | 3300042006 | Bacteria | 898 |
| 2 | JGI24740J21852_10000493 | 3300001979 | Bacteria | 16930 |
| 3 | JGI25155J39150_1000215 | 3300002704 | Bacteria | 23334 |
| 4 | JGI25156J39149_1000491 | 3300002705 | Bacteria | 23712 |
| 5 | JGI25162J39368_1002390 | 3300002737 | Bacteria | 7381 |
| 6 | JGI25162J39368_1002612 | 3300002737 | Bacteria | 6743 |
| 7 | JGI25154J39366_1000407 | 3300002738 | Bacteria | 23364 |
| 8 | JGI25158J39367_1000050 | 3300002739 | Bacteria | 27257 |
| 9 | JGI25158J39367_1000062 | 3300002739 | Bacteria | 24133 |
| 10 | JGI25157J39369_1000515 | 3300002741 | Bacteria | 23712 |
| 11 | JGI25152J39213_1000882 | 3300002773 | Bacteria | 14768 |
| 12 | JGI25152J39213_1001368 | 3300002773 | Bacteria | 10639 |
| 13 | JGI25152J39213_1004354 | 3300002773 | Bacteria | 4485 |
| 14 | JGI25152J39213_1005142 | 3300002773 | Bacteria | 3919 |
| 15 | JGI25152J39213_1010012 | 3300002773 | Bacteria | 2202 |
| 16 | JGI25152J39213_1010021 | 3300002773 | Bacteria | 2199 |
| 17 | JGI25152J39213_1010514 | 3300002773 | Bacteria | 2111 |
| 18 | JGI25150J39212_1000070 | 3300002774 | Bacteria | 61799 |
| 19 | JGI25159J45721_1000220 | 3300002987 | Bacteria | 26975 |
| 20 | JGI25159J45721_1000293 | 3300002987 | Bacteria | 23430 |
| 21 | JGI25151J46595_10000208 | 3300003187 | Bacteria | 71857 |
| 22 | JGI25151J46595_10002724 | 3300003187 | Bacteria | 10310 |
| 23 | JGI25151J46595_10003717 | 3300003187 | Bacteria | 8292 |
| 24 | JGI25151J46595_10061494 | 3300003187 | Bacteria | 1194 |
| 25 | JGI25151J46595_10102587 | 3300003187 | Bacteria | 767 |
| 26 | JGI25151J46595_10125013 | 3300003187 | Bacteria | 649 |
| 27 | JGI25165J46597_1002236 | 3300003214 | Bacteria | 6742 |
| 28 | JGI25165J46597_1013291 | 3300003214 | Bacteria | 1135 |
| 29 | JGI25165J46597_1045737 | 3300003214 | Bacteria | 561 |
| 30 | JGI25153J46596_10005239 | 3300003215 | Bacteria | 6822 |
| 31 | JGI25153J46596_10007174 | 3300003215 | Bacteria | 5525 |
| 32 | JGI25153J46596_10012399 | 3300003215 | Bacteria | 3679 |
| 33 | JGI25153J46596_10017134 | 3300003215 | Bacteria | 2868 |
| 34 | JGI25153J46596_10024079 | 3300003215 | Bacteria | 2202 |
| 35 | JGI25153J46596_10024110 | 3300003215 | Bacteria | 2199 |
| 36 | Ga0006777J48905_1071315 | 3300003308 | Bacteria | 519 |
| 37 | rootH1_10007619 | 3300003316 | Bacteria | 2172 |
| 38 | rootL2_10144815 | 3300003322 | Bacteria | 2132 |
| 39 | rootH1_10173941 | 3300003323 | Bacteria | 2359 |
| 40 | JGI25160J50197_1000010 | 3300003354 | Bacteria | 279365 |
| 41 | JGI25160J50197_1001320 | 3300003354 | Bacteria | 12521 |
| 42 | JGI25160J50197_1009199 | 3300003354 | Bacteria | 3686 |
| 43 | JGI25161J50226_1000006 | 3300003374 | Bacteria | 279563 |
| 44 | JGI25161J50226_1000055 | 3300003374 | Bacteria | 104131 |
| 45 | JGI25161J50226_1003482 | 3300003374 | Bacteria | 3583 |
| 46 | Ga0006562J51391_1011003 | 3300003578 | Bacteria | 594 |
| 47 | Ga0006562J51391_1015089 | 3300003578 | Bacteria | 1077 |
| 48 | Ga0006780_1034804 | 3300003735 | Bacteria | 517 |
| 49 | Ga0055539_1010828 | 3300003752 | Bacteria | 1128 |
| 50 | Ga0055526_1004543 | 3300003771 | Bacteria | 8297 |
| 51 | Ga0055526_1005021 | 3300003771 | Bacteria | 7738 |
| 52 | Ga0055526_1018953 | 3300003771 | Bacteria | 2533 |
| 53 | Ga0055526_1030878 | 3300003771 | Bacteria | 1552 |
| 54 | Ga0055524_1006400 | 3300003775 | Bacteria | 5109 |
| 55 | Ga0055524_1006486 | 3300003775 | Bacteria | 5071 |
| 56 | Ga0055524_1010891 | 3300003775 | Bacteria | 3591 |
| 57 | Ga0055524_1014571 | 3300003775 | Bacteria | 2908 |
| 58 | Ga0055524_1014808 | 3300003775 | Bacteria | 2873 |
| 59 | Ga0055524_1090124 | 3300003775 | Bacteria | 534 |
| 60 | Ga0055536_1001994 | 3300003781 | Bacteria | 11712 |
| 61 | Ga0055528_1000222 | 3300003790 | Bacteria | 47898 |
| 62 | Ga0055528_1001131 | 3300003790 | Bacteria | 17456 |
| 63 | Ga0055528_1003737 | 3300003790 | Bacteria | 7510 |
| 64 | Ga0055528_1006581 | 3300003790 | Bacteria | 5257 |
| 65 | Ga0055528_1007309 | 3300003790 | Bacteria | 4901 |
| 66 | Ga0055528_1015876 | 3300003790 | Bacteria | 2694 |
| 67 | Ga0055530_10012055 | 3300003791 | Bacteria | 3044 |
| 68 | Ga0055540_1002477 | 3300003792 | Bacteria | 9704 |
| 69 | Ga0055540_1002600 | 3300003792 | Bacteria | 9399 |
| 70 | Ga0055540_1004537 | 3300003792 | Bacteria | 6195 |
| 71 | Ga0055540_1018459 | 3300003792 | Bacteria | 1911 |
| 72 | Ga0055531_10002361 | 3300003794 | Bacteria | 12693 |
| 73 | Ga0058692_1012421 | 3300003856 | Bacteria | 2016 |
| 74 | Ga0058692_1017684 | 3300003856 | Bacteria | 1559 |
| 75 | Ga0055543_1000014 | 3300004625 | Bacteria | 177906 |
| 76 | Ga0055543_1000032 | 3300004625 | Bacteria | 130218 |
| 77 | Ga0055543_1001284 | 3300004625 | Bacteria | 10327 |
| 78 | Ga0058859_11735091 | 3300004798 | Bacteria | 580 |
| 79 | Ga0065165_1000251 | 3300005262 | Bacteria | 93020 |
| 80 | Ga0065165_1007728 | 3300005262 | Bacteria | 5204 |
| 81 | Ga0065165_1008141 | 3300005262 | Bacteria | 4985 |
| 82 | Ga0065165_1009371 | 3300005262 | Bacteria | 4402 |
| 83 | Ga0065165_1010277 | 3300005262 | Bacteria | 4068 |
| 84 | Ga0065716_1006144 | 3300005277 | Bacteria | 827 |
| 85 | Ga0070658_11628835 | 3300005327 | Bacteria | 559 |
| 86 | Ga0070676_11288229 | 3300005328 | Bacteria | 558 |
| 87 | Ga0070670_102235645 | 3300005331 | Bacteria | 504 |
| 88 | Ga0070666_10277318 | 3300005335 | Bacteria | 1191 |
| 89 | Ga0070680_100479679 | 3300005336 | Bacteria | 1063 |
| 90 | Ga0070691_10444225 | 3300005341 | Bacteria | 739 |
| 91 | Ga0070668_100056375 | 3300005347 | Bacteria | 3035 |
| 92 | Ga0070668_101135544 | 3300005347 | Bacteria | 706 |
| 93 | Ga0070668_101265686 | 3300005347 | Bacteria | 670 |
| 94 | Ga0070669_100516076 | 3300005353 | Bacteria | 993 |
| 95 | Ga0070671_100015004 | 3300005355 | Bacteria | 6257 |
| 96 | Ga0070659_100708508 | 3300005366 | Bacteria | 871 |
| 97 | Ga0070667_100719536 | 3300005367 | Bacteria | 924 |
| 98 | Ga0070700_100078363 | 3300005441 | Bacteria | 2127 |
| 99 | Ga0070663_100185984 | 3300005455 | Bacteria | 1614 |
| 100 | Ga0070663_100327877 | 3300005455 | Bacteria | 1233 |
| 101 | Ga0070663_100892988 | 3300005455 | Bacteria | 767 |
| 102 | Ga0070681_10384584 | 3300005458 | Bacteria | 1314 |
| 103 | Ga0070665_100017458 | 3300005548 | Bacteria | 7205 |
| 104 | Ga0070665_100144234 | 3300005548 | Bacteria | 2385 |
| 105 | Ga0070665_101987164 | 3300005548 | Bacteria | 587 |
| 106 | Ga0068854_101363251 | 3300005578 | Bacteria | 640 |
| 107 | Ga0068856_100090914 | 3300005614 | Bacteria | 3037 |
| 108 | Ga0068860_100011367 | 3300005843 | Bacteria | 8773 |
| 109 | Ga0068862_100466932 | 3300005844 | Bacteria | 1192 |
| 110 | Ga0068862_101762160 | 3300005844 | Bacteria | 628 |
| 111 | Ga0081538_10100234 | 3300005981 | Bacteria | 1461 |
| 112 | Ga0075365_10000756 | 3300006038 | Bacteria | 13118 |
| 113 | Ga0075368_10006544 | 3300006042 | Bacteria | 4076 |
| 114 | Ga0075368_10083887 | 3300006042 | Bacteria | 1298 |
| 115 | Ga0075368_10207400 | 3300006042 | Bacteria | 830 |
| 116 | Ga0075363_100034113 | 3300006048 | Bacteria | 2655 |
| 117 | Ga0075363_100085198 | 3300006048 | Bacteria | 1733 |
| 118 | Ga0075364_10000588 | 3300006051 | Bacteria | 18752 |
| 119 | Ga0075364_10038531 | 3300006051 | Bacteria | 3096 |
| 120 | Ga0075364_10364891 | 3300006051 | Bacteria | 985 |
| 121 | Ga0075364_10763204 | 3300006051 | Bacteria | 659 |
| 122 | Ga0075432_10177480 | 3300006058 | Bacteria | 832 |
| 123 | Ga0070715_10946374 | 3300006163 | Bacteria | 533 |
| 124 | Ga0070712_100567161 | 3300006175 | Bacteria | 958 |
| 125 | Ga0075362_10001370 | 3300006177 | Bacteria | 7725 |
| 126 | Ga0075362_10021646 | 3300006177 | Bacteria | 2701 |
| 127 | Ga0075362_10058822 | 3300006177 | Bacteria | 1734 |
| 128 | Ga0075367_10000829 | 3300006178 | Bacteria | 12260 |
| 129 | Ga0075367_10002190 | 3300006178 | Bacteria | 8807 |
| 130 | Ga0075367_10036160 | 3300006178 | Bacteria | 2862 |
| 131 | Ga0075367_10067009 | 3300006178 | Bacteria | 2152 |
| 132 | Ga0075369_10005950 | 3300006186 | Bacteria | 4590 |
| 133 | Ga0075369_10007017 | 3300006186 | Bacteria | 4279 |
| 134 | Ga0075369_10012601 | 3300006186 | Bacteria | 3340 |
| 135 | Ga0075369_10017769 | 3300006186 | Bacteria | 2889 |
| 136 | Ga0075369_10237727 | 3300006186 | Bacteria | 845 |
| 137 | Ga0075366_10261609 | 3300006195 | Bacteria | 1056 |
| 138 | Ga0075370_10007341 | 3300006353 | Bacteria | 5611 |
| 139 | Ga0075370_10010671 | 3300006353 | Bacteria | 4813 |
| 140 | Ga0075370_10880672 | 3300006353 | Bacteria | 547 |
| 141 | Ga0075430_100173733 | 3300006846 | Bacteria | 1793 |
| 142 | Ga0075431_100205127 | 3300006847 | Bacteria | 2016 |
| 143 | Ga0075431_100356459 | 3300006847 | Bacteria | 1470 |
| 144 | Ga0068865_102081222 | 3300006881 | Bacteria | 516 |
| 145 | Ga0099826_10000117 | 3300006948 | Bacteria | 36698 |
| 146 | Ga0099826_10033503 | 3300006948 | Bacteria | 3685 |
| 147 | Ga0105251_10207618 | 3300009011 | Bacteria | 882 |
| 148 | Ga0105244_10145660 | 3300009036 | Bacteria | 1137 |
| 149 | Ga0105250_10221710 | 3300009092 | Bacteria | 802 |
| 150 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 151 | Ga0111539_10497418 | 3300009094 | Bacteria | 1420 |
| 152 | Ga0105245_10202838 | 3300009098 | Bacteria | 1905 |
| 153 | Ga0105247_10468941 | 3300009101 | Bacteria | 911 |
| 154 | Ga0114129_11374989 | 3300009147 | Bacteria | 872 |
| 155 | Ga0105243_10156938 | 3300009148 | Bacteria | 1958 |
| 156 | Ga0105243_11641641 | 3300009148 | Bacteria | 670 |
| 157 | Ga0105243_11731130 | 3300009148 | Bacteria | 655 |
| 158 | Ga0105248_10012698 | 3300009177 | Bacteria | 9296 |
| 159 | Ga0105248_11663373 | 3300009177 | Bacteria | 723 |
| 160 | Ga0105237_10001882 | 3300009545 | Bacteria | 26776 |
| 161 | Ga0105237_11930570 | 3300009545 | Bacteria | 599 |
| 162 | Ga0105238_10151748 | 3300009551 | Bacteria | 2292 |
| 163 | Ga0123341_1000004 | 3300009765 | Bacteria | 153727 |
| 164 | Ga0123342_1018578 | 3300009766 | Bacteria | 5495 |
| 165 | Ga0123342_1028932 | 3300009766 | Bacteria | 2933 |
| 166 | Ga0105239_10002014 | 3300010375 | Bacteria | 26368 |
| 167 | Ga0105239_10297106 | 3300010375 | Bacteria | 1819 |
| 168 | Ga0105239_11717616 | 3300010375 | Bacteria | 727 |
| 169 | Ga0105246_11690659 | 3300011119 | Bacteria | 601 |
| 170 | Ga0157336_1015709 | 3300012477 | Bacteria | 636 |
| 171 | Ga0157318_1036339 | 3300012482 | Bacteria | 509 |
| 172 | Ga0157314_1020052 | 3300012500 | Bacteria | 674 |
| 173 | Ga0157313_1038229 | 3300012503 | Bacteria | 577 |
| 174 | Ga0157326_1004013 | 3300012513 | Bacteria | 1546 |
| 175 | Ga0157373_10091427 | 3300013100 | Bacteria | 2143 |
| 176 | Ga0157373_10241962 | 3300013100 | Bacteria | 1275 |
| 177 | Ga0157373_10290076 | 3300013100 | Bacteria | 1160 |
| 178 | Ga0157373_11593629 | 3300013100 | Bacteria | 500 |
| 179 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 180 | Ga0157371_10037850 | 3300013102 | Bacteria | 3452 |
| 181 | Ga0157371_10376884 | 3300013102 | Bacteria | 1036 |
| 182 | Ga0157370_10000274 | 3300013104 | Bacteria | 65400 |
| 183 | Ga0157370_10003029 | 3300013104 | Bacteria | 19939 |
| 184 | Ga0157370_10752136 | 3300013104 | Bacteria | 888 |
| 185 | Ga0157369_11193503 | 3300013105 | Bacteria | 777 |
| 186 | Ga0157374_10742330 | 3300013296 | Bacteria | 996 |
| 187 | Ga0157378_10882951 | 3300013297 | Bacteria | 924 |
| 188 | Ga0157372_10202277 | 3300013307 | Bacteria | 2301 |
| 189 | Ga0157372_10672482 | 3300013307 | Bacteria | 1205 |
| 190 | Ga0157375_10617180 | 3300013308 | Bacteria | 1243 |
| 191 | Ga0157380_10902198 | 3300014326 | Bacteria | 910 |
| 192 | Ga0182008_10325844 | 3300014497 | Bacteria | 809 |
| 193 | Ga0157379_10618896 | 3300014968 | Bacteria | 1012 |
| 194 | Ga0157376_11439415 | 3300014969 | Bacteria | 721 |
| 195 | Ga0182007_10000711 | 3300015262 | Bacteria | 18942 |
| 196 | Ga0163161_10415253 | 3300017792 | Bacteria | 1082 |
| 197 | Ga0163161_10804756 | 3300017792 | Bacteria | 790 |
| 198 | Ga0206355_1170784 | 3300020076 | Bacteria | 803 |
| 199 | Ga0206351_10714990 | 3300020077 | Bacteria | 595 |
| 200 | Ga0206352_10371491 | 3300020078 | Bacteria | 517 |
| 201 | Ga0224712_10520244 | 3300022467 | Bacteria | 576 |
| 202 | Ga0209435_100045 | 3300025206 | Bacteria | 96483 |
| 203 | Ga0209436_100001 | 3300025208 | Bacteria | 304543 |
| 204 | Ga0209672_104292 | 3300025228 | Bacteria | 2682 |
| 205 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 206 | Ga0209437_100683 | 3300025233 | Bacteria | 18100 |
| 207 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 208 | Ga0207425_1001992 | 3300025245 | Bacteria | 7638 |
| 209 | Ga0207425_1004152 | 3300025245 | Bacteria | 4416 |
| 210 | Ga0207425_1007729 | 3300025245 | Bacteria | 2809 |
| 211 | Ga0207425_1013642 | 3300025245 | Bacteria | 1870 |
| 212 | Ga0207425_1038892 | 3300025245 | Bacteria | 913 |
| 213 | Ga0207425_1056240 | 3300025245 | Bacteria | 705 |
| 214 | Ga0209646_1000154 | 3300025246 | Bacteria | 96483 |
| 215 | Ga0209646_1014143 | 3300025246 | Bacteria | 1204 |
| 216 | Ga0209026_1000177 | 3300025250 | Bacteria | 96629 |
| 217 | Ga0209677_102447 | 3300025253 | Bacteria | 6976 |
| 218 | Ga0209148_1013402 | 3300025254 | Bacteria | 1475 |
| 219 | Ga0209759_1000795 | 3300025256 | Bacteria | 25746 |
| 220 | Ga0209759_1012909 | 3300025256 | Bacteria | 2288 |
| 221 | Ga0209129_1000069 | 3300025258 | Bacteria | 212790 |
| 222 | Ga0209129_1000133 | 3300025258 | Bacteria | 126018 |
| 223 | Ga0209129_1000880 | 3300025258 | Bacteria | 18487 |
| 224 | Ga0209129_1002492 | 3300025258 | Bacteria | 8979 |
| 225 | Ga0209129_1004911 | 3300025258 | Bacteria | 4987 |
| 226 | Ga0209129_1005326 | 3300025258 | Bacteria | 4603 |
| 227 | Ga0209129_1008393 | 3300025258 | Bacteria | 2881 |
| 228 | Ga0209129_1010222 | 3300025258 | Bacteria | 2369 |
| 229 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 230 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 231 | Ga0209233_1000221 | 3300025261 | Bacteria | 104090 |
| 232 | Ga0209565_1037304 | 3300025263 | Bacteria | 920 |
| 233 | Ga0209455_1017885 | 3300025272 | Bacteria | 1471 |
| 234 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 235 | Ga0209673_1000048 | 3300025273 | Bacteria | 287976 |
| 236 | Ga0209673_1002108 | 3300025273 | Bacteria | 14922 |
| 237 | Ga0209673_1003476 | 3300025273 | Bacteria | 9255 |
| 238 | Ga0209673_1004376 | 3300025273 | Bacteria | 7608 |
| 239 | Ga0209673_1026450 | 3300025273 | Bacteria | 1905 |
| 240 | Ga0209673_1040852 | 3300025273 | Bacteria | 1323 |
| 241 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 242 | Ga0209130_1000021 | 3300025284 | Bacteria | 374278 |
| 243 | Ga0209130_1013753 | 3300025284 | Bacteria | 2061 |
| 244 | Ga0209130_1030697 | 3300025284 | Bacteria | 1108 |
| 245 | Ga0209675_1093169 | 3300025291 | Bacteria | 541 |
| 246 | Ga0209676_1023289 | 3300025292 | Bacteria | 2030 |
| 247 | Ga0209676_1027846 | 3300025292 | Bacteria | 1771 |
| 248 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 249 | Ga0209025_1000572 | 3300025294 | Bacteria | 66863 |
| 250 | Ga0209025_1000787 | 3300025294 | Bacteria | 52060 |
| 251 | Ga0209025_1000803 | 3300025294 | Bacteria | 50798 |
| 252 | Ga0209025_1007047 | 3300025294 | Bacteria | 8513 |
| 253 | Ga0209025_1013063 | 3300025294 | Bacteria | 5251 |
| 254 | Ga0209025_1014129 | 3300025294 | Bacteria | 4948 |
| 255 | Ga0209025_1015082 | 3300025294 | Bacteria | 4690 |
| 256 | Ga0209025_1019159 | 3300025294 | Bacteria | 3822 |
| 257 | Ga0209025_1033243 | 3300025294 | Bacteria | 2388 |
| 258 | Ga0209025_1054224 | 3300025294 | Bacteria | 1563 |
| 259 | Ga0209564_1000375 | 3300025295 | Bacteria | 82204 |
| 260 | Ga0209564_1000570 | 3300025295 | Bacteria | 58555 |
| 261 | Ga0209564_1000631 | 3300025295 | Bacteria | 53697 |
| 262 | Ga0209564_1009645 | 3300025295 | Bacteria | 4563 |
| 263 | Ga0209564_1026738 | 3300025295 | Bacteria | 1896 |
| 264 | Ga0209564_1078010 | 3300025295 | Bacteria | 658 |
| 265 | Ga0209758_1000342 | 3300025297 | Bacteria | 86095 |
| 266 | Ga0209758_1000421 | 3300025297 | Bacteria | 71884 |
| 267 | Ga0209758_1000468 | 3300025297 | Bacteria | 66625 |
| 268 | Ga0209758_1000942 | 3300025297 | Bacteria | 39264 |
| 269 | Ga0209758_1003958 | 3300025297 | Bacteria | 12853 |
| 270 | Ga0209758_1022512 | 3300025297 | Bacteria | 2884 |
| 271 | Ga0209758_1022516 | 3300025297 | Bacteria | 2884 |
| 272 | Ga0209758_1082158 | 3300025297 | Bacteria | 971 |
| 273 | Ga0209050_1004988 | 3300025298 | Bacteria | 8635 |
| 274 | Ga0209050_1005655 | 3300025298 | Bacteria | 7740 |
| 275 | Ga0209256_1002453 | 3300025299 | Bacteria | 15124 |
| 276 | Ga0209256_1005734 | 3300025299 | Bacteria | 6963 |
| 277 | Ga0209256_1007991 | 3300025299 | Bacteria | 5029 |
| 278 | Ga0209256_1009330 | 3300025299 | Bacteria | 4324 |
| 279 | Ga0209256_1012872 | 3300025299 | Bacteria | 3152 |
| 280 | Ga0209256_1024014 | 3300025299 | Bacteria | 1804 |
| 281 | Ga0209256_1037585 | 3300025299 | Bacteria | 1260 |
| 282 | Ga0209256_1055214 | 3300025299 | Bacteria | 944 |
| 283 | Ga0209256_1079533 | 3300025299 | Bacteria | 719 |
| 284 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 285 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 286 | Ga0207426_1000039 | 3300025302 | Bacteria | 439937 |
| 287 | Ga0207426_1003019 | 3300025302 | Bacteria | 9756 |
| 288 | Ga0209051_1000445 | 3300025303 | Bacteria | 55846 |
| 289 | Ga0209051_1001553 | 3300025303 | Bacteria | 19008 |
| 290 | Ga0209051_1007905 | 3300025303 | Bacteria | 5732 |
| 291 | Ga0209051_1028176 | 3300025303 | Bacteria | 2223 |
| 292 | Ga0209051_1044776 | 3300025303 | Bacteria | 1538 |
| 293 | Ga0209257_1001375 | 3300025304 | Bacteria | 29208 |
| 294 | Ga0209257_1004317 | 3300025304 | Bacteria | 11162 |
| 295 | Ga0209257_1128584 | 3300025304 | Bacteria | 583 |
| 296 | Ga0207688_10652165 | 3300025901 | Bacteria | 665 |
| 297 | Ga0207680_10446938 | 3300025903 | Bacteria | 917 |
| 298 | Ga0207685_10270111 | 3300025905 | Bacteria | 830 |
| 299 | Ga0207645_10680053 | 3300025907 | Bacteria | 699 |
| 300 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 301 | Ga0207671_10000314 | 3300025914 | Bacteria | 71414 |
| 302 | Ga0207671_11177359 | 3300025914 | Bacteria | 600 |
| 303 | Ga0207693_10190086 | 3300025915 | Bacteria | 1616 |
| 304 | Ga0207652_10624676 | 3300025921 | Bacteria | 965 |
| 305 | Ga0207681_10809505 | 3300025923 | Bacteria | 783 |
| 306 | Ga0207694_10332294 | 3300025924 | Bacteria | 1256 |
| 307 | Ga0207650_10371693 | 3300025925 | Bacteria | 1179 |
| 308 | Ga0207644_10149297 | 3300025931 | Bacteria | 1807 |
| 309 | Ga0207709_10167445 | 3300025935 | Bacteria | 1539 |
| 310 | Ga0207709_10327796 | 3300025935 | Bacteria | 1148 |
| 311 | Ga0207669_11092189 | 3300025937 | Bacteria | 673 |
| 312 | Ga0207711_10051970 | 3300025941 | Bacteria | 3510 |
| 313 | Ga0207711_11076542 | 3300025941 | Bacteria | 744 |
| 314 | Ga0207667_11179032 | 3300025949 | Bacteria | 746 |
| 315 | Ga0207640_10076820 | 3300025981 | Bacteria | 2268 |
| 316 | Ga0207640_10899856 | 3300025981 | Bacteria | 773 |
| 317 | Ga0207658_11100088 | 3300025986 | Bacteria | 726 |
| 318 | Ga0207639_10351567 | 3300026041 | Bacteria | 1316 |
| 319 | Ga0207639_11773578 | 3300026041 | Bacteria | 578 |
| 320 | Ga0207708_10377182 | 3300026075 | Bacteria | 1169 |
| 321 | Ga0207702_10018015 | 3300026078 | Bacteria | 5845 |
| 322 | Ga0207702_10623376 | 3300026078 | Bacteria | 1059 |
| 323 | Ga0207674_11471237 | 3300026116 | Bacteria | 650 |
| 324 | Ga0207698_11838853 | 3300026142 | Bacteria | 621 |
| 325 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 326 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 327 | Ga0209371_1000058 | 3300027312 | Bacteria | 237920 |
| 328 | Ga0209371_1001102 | 3300027312 | Bacteria | 20054 |
| 329 | Ga0209371_1004687 | 3300027312 | Bacteria | 5806 |
| 330 | Ga0209983_1077394 | 3300027665 | Bacteria | 744 |
| 331 | Ga0209282_1005675 | 3300027666 | Bacteria | 7688 |
| 332 | Ga0209282_1043032 | 3300027666 | Bacteria | 2659 |
| 333 | Ga0209813_10005185 | 3300027866 | Bacteria | 3151 |
| 334 | Ga0209813_10075088 | 3300027866 | Bacteria | 1107 |
| 335 | Ga0209813_10215839 | 3300027866 | Bacteria | 716 |
| 336 | Ga0268266_10012142 | 3300028379 | Bacteria | 7456 |
| 337 | Ga0268266_10069211 | 3300028379 | Bacteria | 3058 |
| 338 | Ga0268266_10335561 | 3300028379 | Bacteria | 1418 |
| 339 | Ga0268266_10555960 | 3300028379 | Bacteria | 1100 |
| 340 | Ga0268265_12428906 | 3300028380 | Bacteria | 530 |
| 341 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 342 | Ga0307515_10001876 | 3300028794 | Bacteria | 46792 |
| 343 | Ga0307515_10014201 | 3300028794 | Bacteria | 14800 |
| 344 | Ga0307515_10245958 | 3300028794 | Bacteria | 1550 |
| 345 | Ga0268256_1000056 | 3300030500 | Bacteria | 231684 |
| 346 | Ga0268256_1001773 | 3300030500 | Bacteria | 12177 |
| 347 | Ga0268256_1005673 | 3300030500 | Bacteria | 4835 |
| 348 | Ga0316181_1125298 | 3300030744 | Bacteria | 4996 |
| 349 | Ga0307513_10196979 | 3300031456 | Bacteria | 1860 |
| 350 | Ga0307513_10280224 | 3300031456 | Bacteria | 1445 |
| 351 | Ga0307513_10548913 | 3300031456 | Bacteria | 868 |
| 352 | Ga0307408_100259327 | 3300031548 | Bacteria | 1438 |
| 353 | Ga0307408_100359750 | 3300031548 | Bacteria | 1238 |
| 354 | Ga0307516_10426924 | 3300031730 | Bacteria | 983 |
| 355 | Ga0307405_10006169 | 3300031731 | Bacteria | 5872 |
| 356 | Ga0307405_10408406 | 3300031731 | Bacteria | 1065 |
| 357 | Ga0307405_10533313 | 3300031731 | Bacteria | 947 |
| 358 | Ga0307413_10487640 | 3300031824 | Bacteria | 987 |
| 359 | Ga0307406_10019411 | 3300031901 | Bacteria | 3989 |
| 360 | Ga0307412_10016051 | 3300031911 | Bacteria | 4451 |
| 361 | Ga0307412_10547840 | 3300031911 | Bacteria | 971 |
| 362 | Ga0373954_0654168 | 3300035118 | Bacteria | 521 |
| 363 | Ga0373961_0063716 | 3300035241 | Bacteria | 1125 |
| 364 | Ga0373935_0044291 | 3300035692 | Bacteria | 2804 |
| 365 | Ga0373927_0000343 | 3300035695 | Bacteria | 36640 |
| 366 | Ga0373925_0014749 | 3300037068 | Bacteria | 5646 |
| 367 | Ga0395905_0000417 | 3300037471 | Bacteria | 59694 |
| 368 | Ga0395905_0000510 | 3300037471 | Bacteria | 53278 |
| 369 | Ga0395901_0501956 | 3300038443 | Bacteria | 1235 |
| 370 | Ga0436365_0167701 | 3300039437 | Bacteria | 1052 |
| 371 | Ga0439465_0098697 | 3300041413 | Bacteria | 1006 |
| 372 | Ga0451787_171768 | 3300041441 | Bacteria | 1224 |
| 373 | Ga0451793_0417637 | 3300041452 | Bacteria | 1076 |
| 374 | Ga0451797_0850152 | 3300041453 | Bacteria | 1338 |
| 375 | Ga0451800_0211985 | 3300041459 | Bacteria | 843 |
| 376 | Ga0451807_0109277 | 3300041486 | Bacteria | 580 |
| 377 | Ga0451807_1324974 | 3300041486 | Bacteria | 857 |
| 378 | Ga0451835_0475184 | 3300041492 | Bacteria | 2443 |
| 379 | Ga0451839_1012362 | 3300041496 | Bacteria | 567 |
| 380 | Ga0451840_13150 | 3300041497 | Bacteria | 1378 |
| 381 | Ga0451841_1202596 | 3300041498 | Bacteria | 2201 |
| 382 | Ga0451844_03674 | 3300041500 | Bacteria | 546 |
| 383 | Ga0451846_28374 | 3300041502 | Bacteria | 2243 |
| 384 | Ga0451848_08569 | 3300041504 | Bacteria | 1191 |
| 385 | Ga0451850_18058 | 3300041506 | Bacteria | 1117 |
| 386 | Ga0451853_3274431 | 3300041512 | Bacteria | 2109 |
| 387 | Ga0452271_92729 | 3300041916 | Bacteria | 1876 |
| 388 | Ga0439449_0004832 | 3300042007 | Bacteria | 5197 |
| 389 | Ga0439449_0100753 | 3300042007 | Bacteria | 1068 |
| 390 | Ga0466982_0542145 | 3300044672 | Bacteria | 591 |
| 391 | Ga0466963_0058302 | 3300044694 | Bacteria | 2574 |
| 392 | Ga0466964_0118839 | 3300044706 | Bacteria | 1189 |
| 393 | Ga0466971_0150226 | 3300044719 | Bacteria | 1087 |
| 394 | Ga0466970_0036193 | 3300044765 | Bacteria | 2614 |
| 395 | Ga0466970_0749027 | 3300044765 | Bacteria | 571 |
| 396 | Ga0466958_0054106 | 3300045836 | Bacteria | 2434 |
| 397 | Ga0466967_1154027 | 3300045976 | Bacteria | 772 |
| 398 | Ga0495617_073869 | 3300046452 | Bacteria | 1120 |
| 399 | Ga0495638_0048331 | 3300046460 | Bacteria | 2663 |
| 400 | Ga0495638_0283936 | 3300046460 | Bacteria | 898 |
| 401 | Ga0495650_0058946 | 3300046471 | Bacteria | 1548 |
| 402 | Ga0495650_0093122 | 3300046471 | Bacteria | 1143 |
| 403 | Ga0495605_0037945 | 3300046474 | Bacteria | 2420 |
| 404 | Ga0495639_0568203 | 3300046475 | Bacteria | 582 |
| 405 | Ga0495662_0182778 | 3300046476 | Bacteria | 1033 |
| 406 | Ga0495664_0103760 | 3300046477 | Bacteria | 1714 |
| 407 | Ga0495584_0455354 | 3300046491 | Bacteria | 651 |
| 408 | Ga0495585_0029057 | 3300046492 | Bacteria | 3150 |
| 409 | Ga0495585_0263498 | 3300046492 | Bacteria | 856 |
| 410 | Ga0495596_0320417 | 3300046500 | Bacteria | 603 |
| 411 | Ga0495607_0034222 | 3300046501 | Bacteria | 3084 |
| 412 | Ga0495607_0235991 | 3300046501 | Bacteria | 887 |
| 413 | Ga0495583_0027440 | 3300046506 | Bacteria | 2810 |
| 414 | Ga0495583_0047898 | 3300046506 | Bacteria | 1963 |
| 415 | Ga0495606_0018841 | 3300046507 | Bacteria | 5161 |
| 416 | Ga0495606_0029226 | 3300046507 | Bacteria | 3875 |
| 417 | Ga0495606_0126085 | 3300046507 | Bacteria | 1526 |
| 418 | Ga0495606_0143390 | 3300046507 | Bacteria | 1409 |
| 419 | Ga0495606_0314364 | 3300046507 | Bacteria | 844 |
| 420 | Ga0495606_0425710 | 3300046507 | Bacteria | 685 |
| 421 | Ga0495610_0002799 | 3300046512 | Bacteria | 14263 |
| 422 | Ga0495610_0024025 | 3300046512 | Bacteria | 3297 |
| 423 | Ga0495610_0246889 | 3300046512 | Bacteria | 709 |
| 424 | Ga0495616_0276015 | 3300046513 | Bacteria | 715 |
| 425 | Ga0495620_0030263 | 3300046515 | Bacteria | 2495 |
| 426 | Ga0495620_0048016 | 3300046515 | Bacteria | 1834 |
| 427 | Ga0495631_0028888 | 3300046518 | Bacteria | 2527 |
| 428 | Ga0495632_0025395 | 3300046519 | Bacteria | 3134 |
| 429 | Ga0495632_0049563 | 3300046519 | Bacteria | 2075 |
| 430 | Ga0495643_0026643 | 3300046522 | Bacteria | 3259 |
| 431 | Ga0495644_0384914 | 3300046523 | Bacteria | 554 |
| 432 | Ga0495648_0029022 | 3300046524 | Bacteria | 3677 |
| 433 | Ga0495648_0225586 | 3300046524 | Bacteria | 921 |
| 434 | Ga0495654_0003447 | 3300046530 | Bacteria | 9678 |
| 435 | Ga0495654_0181021 | 3300046530 | Bacteria | 913 |
| 436 | Ga0495609_0147674 | 3300046538 | Bacteria | 1001 |
| 437 | Ga0495597_0021952 | 3300046542 | Bacteria | 2964 |
| 438 | Ga0495633_0039287 | 3300046558 | Bacteria | 2259 |
| 439 | Ga0495633_0046888 | 3300046558 | Bacteria | 2043 |
| 440 | Ga0495633_0215281 | 3300046558 | Bacteria | 880 |
| 441 | Ga0495656_0150641 | 3300046615 | Bacteria | 1123 |
| 442 | Ga0495668_0080050 | 3300046616 | Bacteria | 1793 |
| 443 | Ga0495668_0146539 | 3300046616 | Bacteria | 1292 |
| 444 | Ga0495611_0095296 | 3300046648 | Bacteria | 1377 |
| 445 | Ga0495611_0397597 | 3300046648 | Bacteria | 630 |
| 446 | Ga0495625_0079872 | 3300046660 | Bacteria | 2279 |
| 447 | Ga0495625_0204041 | 3300046660 | Bacteria | 1303 |
| 448 | Ga0495625_0631884 | 3300046660 | Bacteria | 639 |
| 449 | Ga0495635_0386798 | 3300046663 | Bacteria | 930 |
| 450 | Ga0495657_0273909 | 3300046675 | Bacteria | 1011 |
| 451 | Ga0495658_0165201 | 3300046683 | Bacteria | 1367 |
| 452 | Ga0495624_0345888 | 3300046690 | Bacteria | 894 |
| 453 | Ga0495670_0287765 | 3300046691 | Bacteria | 879 |
| 454 | Ga0495600_0038572 | 3300046809 | Bacteria | 3109 |
| 455 | Ga0495660_0310840 | 3300046810 | Bacteria | 711 |
| 456 | Ga0495604_0128323 | 3300047317 | Bacteria | 1825 |
| 457 | Ga0495672_0059475 | 3300047320 | Bacteria | 2211 |
| 458 | Ga0495687_077288 | 3300047443 | Bacteria | 1315 |
| 459 | Ga0495687_119074 | 3300047443 | Bacteria | 956 |
| 460 | Ga0495687_187095 | 3300047443 | Bacteria | 670 |
| 461 | Ga0495677_0242670 | 3300047445 | Bacteria | 704 |
| 462 | Ga0495673_0078133 | 3300047469 | Bacteria | 1377 |
| 463 | Ga0495686_0008883 | 3300047472 | Bacteria | 7307 |
| 464 | Ga0495686_0035922 | 3300047472 | Bacteria | 3181 |
| 465 | Ga0495615_0114001 | 3300048090 | Bacteria | 776 |
| 466 | Ga0495626_0069218 | 3300048091 | Bacteria | 1590 |
| 467 | Ga0495626_0170621 | 3300048091 | Bacteria | 907 |
| 468 | Ga0496100_0142389 | 3300048903 | Bacteria | 1701 |
| 469 | Ga0496101_0070666 | 3300048904 | Bacteria | 2557 |
| 470 | Ga0496101_0137302 | 3300048904 | Bacteria | 1862 |
| 471 | Ga0496101_0993593 | 3300048904 | Bacteria | 660 |
| 472 | Ga0496102_0027835 | 3300048905 | Bacteria | 5048 |
| 473 | Ga0496102_0112678 | 3300048905 | Bacteria | 2537 |
| 474 | Ga0496102_1664484 | 3300048905 | Bacteria | 556 |
| 475 | Ga0496103_0015173 | 3300048906 | Bacteria | 4580 |
| 476 | Ga0496103_0065750 | 3300048906 | Bacteria | 2262 |
| 477 | Ga0496104_0031444 | 3300048907 | Bacteria | 4936 |
| 478 | Ga0496104_0532155 | 3300048907 | Bacteria | 1086 |
| 479 | Ga0496105_0029755 | 3300048908 | Bacteria | 4471 |
| 480 | Ga0496105_1211455 | 3300048908 | Bacteria | 555 |
| 481 | Ga0496106_0015087 | 3300048909 | Bacteria | 5719 |
| 482 | Ga0496106_0185807 | 3300048909 | Bacteria | 1651 |
| 483 | Ga0496107_0403196 | 3300048910 | Bacteria | 1017 |
| 484 | Ga0496108_0645419 | 3300048911 | Bacteria | 920 |
| 485 | Ga0496109_0325330 | 3300048912 | Bacteria | 1451 |
| 486 | Ga0496110_0024182 | 3300048913 | Bacteria | 5174 |
| 487 | Ga0496110_0842715 | 3300048913 | Bacteria | 822 |
| 488 | Ga0496110_1606830 | 3300048913 | Bacteria | 560 |
| 489 | Ga0496111_0026685 | 3300048914 | Bacteria | 4080 |
| 490 | Ga0496112_0553383 | 3300048915 | Bacteria | 1084 |
| 491 | Ga0496113_0173809 | 3300048916 | Bacteria | 1706 |
| 492 | Ga0496114_0073568 | 3300048917 | Bacteria | 2876 |
| 493 | Ga0496114_0164122 | 3300048917 | Bacteria | 1933 |
| 494 | Ga0496116_0000061 | 3300048919 | Bacteria | 271860 |
| 495 | Ga0496116_0004401 | 3300048919 | Bacteria | 13471 |
| 496 | Ga0496116_0041972 | 3300048919 | Bacteria | 3133 |
| 497 | Ga0496116_0055113 | 3300048919 | Bacteria | 2613 |
| 498 | Ga0496116_0062085 | 3300048919 | Bacteria | 2414 |
| 499 | Ga0496116_0064173 | 3300048919 | Bacteria | 2361 |
| 500 | Ga0496116_0069160 | 3300048919 | Bacteria | 2246 |
| 501 | Ga0496116_0101931 | 3300048919 | Bacteria | 1712 |
| 502 | Ga0496116_0108716 | 3300048919 | Bacteria | 1636 |
| 503 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 504 | Ga0496117_0000641 | 3300048920 | Bacteria | 56335 |
| 505 | Ga0496117_0006730 | 3300048920 | Bacteria | 11478 |
| 506 | Ga0496117_0006987 | 3300048920 | Bacteria | 11187 |
| 507 | Ga0496117_0021873 | 3300048920 | Bacteria | 5154 |
| 508 | Ga0496117_0056403 | 3300048920 | Bacteria | 2736 |
| 509 | Ga0496117_0061750 | 3300048920 | Bacteria | 2573 |
| 510 | Ga0496117_0211518 | 3300048920 | Bacteria | 1087 |
| 511 | Ga0496117_0234842 | 3300048920 | Bacteria | 1011 |
| 512 | Ga0496117_0296638 | 3300048920 | Bacteria | 858 |
| 513 | Ga0496117_0480762 | 3300048920 | Bacteria | 607 |
| 514 | Ga0496118_0002328 | 3300048921 | Bacteria | 25774 |
| 515 | Ga0496118_0016547 | 3300048921 | Bacteria | 6761 |
| 516 | Ga0496118_0019839 | 3300048921 | Bacteria | 5992 |
| 517 | Ga0496118_0042034 | 3300048921 | Bacteria | 3611 |
| 518 | Ga0496118_0042441 | 3300048921 | Bacteria | 3588 |
| 519 | Ga0496118_0251438 | 3300048921 | Bacteria | 1004 |
| 520 | Ga0496118_0343264 | 3300048921 | Bacteria | 799 |
| 521 | Ga0496119_0007704 | 3300048922 | Bacteria | 9634 |
| 522 | Ga0496119_0027725 | 3300048922 | Bacteria | 3884 |
| 523 | Ga0496119_0047978 | 3300048922 | Bacteria | 2652 |
| 524 | Ga0496119_0057430 | 3300048922 | Bacteria | 2351 |
| 525 | Ga0496119_0087635 | 3300048922 | Bacteria | 1776 |
| 526 | Ga0496119_0093957 | 3300048922 | Bacteria | 1698 |
| 527 | Ga0496119_0169431 | 3300048922 | Bacteria | 1154 |
| 528 | Ga0496119_0585806 | 3300048922 | Bacteria | 509 |
| 529 | Ga0496120_0000951 | 3300048923 | Bacteria | 39539 |
| 530 | Ga0496120_0013700 | 3300048923 | Bacteria | 5443 |
| 531 | Ga0496120_0065222 | 3300048923 | Bacteria | 2019 |
| 532 | Ga0496120_0066629 | 3300048923 | Bacteria | 1991 |
| 533 | Ga0496120_0205188 | 3300048923 | Bacteria | 952 |
| 534 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 535 | Ga0496121_0002428 | 3300048924 | Bacteria | 28484 |
| 536 | Ga0496121_0004370 | 3300048924 | Bacteria | 19103 |
| 537 | Ga0496121_0007053 | 3300048924 | Bacteria | 13646 |
| 538 | Ga0496121_0030273 | 3300048924 | Bacteria | 4974 |
| 539 | Ga0496121_0030540 | 3300048924 | Bacteria | 4947 |
| 540 | Ga0496121_0040901 | 3300048924 | Bacteria | 4060 |
| 541 | Ga0496121_0046259 | 3300048924 | Bacteria | 3727 |
| 542 | Ga0496121_0072004 | 3300048924 | Bacteria | 2776 |
| 543 | Ga0496121_0158703 | 3300048924 | Bacteria | 1656 |
| 544 | Ga0496121_0248902 | 3300048924 | Bacteria | 1234 |
| 545 | Ga0496121_0359104 | 3300048924 | Bacteria | 968 |
| 546 | Ga0496121_0458325 | 3300048924 | Bacteria | 820 |
| 547 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 548 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 549 | Ga0496122_0000399 | 3300048925 | Bacteria | 92476 |
| 550 | Ga0496122_0021330 | 3300048925 | Bacteria | 5803 |
| 551 | Ga0496122_0023670 | 3300048925 | Bacteria | 5401 |
| 552 | Ga0496122_0029101 | 3300048925 | Bacteria | 4668 |
| 553 | Ga0496122_0055166 | 3300048925 | Bacteria | 2976 |
| 554 | Ga0496122_0059954 | 3300048925 | Bacteria | 2806 |
| 555 | Ga0496122_0065628 | 3300048925 | Bacteria | 2630 |
| 556 | Ga0496122_0070910 | 3300048925 | Bacteria | 2485 |
| 557 | Ga0496122_0084824 | 3300048925 | Bacteria | 2189 |
| 558 | Ga0496122_0092119 | 3300048925 | Bacteria | 2061 |
| 559 | Ga0496122_0098138 | 3300048925 | Bacteria | 1968 |
| 560 | Ga0496122_0133209 | 3300048925 | Bacteria | 1573 |
| 561 | Ga0496122_0172476 | 3300048925 | Bacteria | 1301 |
| 562 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 563 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 564 | Ga0496123_0003753 | 3300048926 | Bacteria | 16655 |
| 565 | Ga0496123_0005051 | 3300048926 | Bacteria | 13491 |
| 566 | Ga0496123_0023077 | 3300048926 | Bacteria | 4775 |
| 567 | Ga0496123_0028615 | 3300048926 | Bacteria | 4120 |
| 568 | Ga0496123_0029510 | 3300048926 | Bacteria | 4035 |
| 569 | Ga0496123_0048891 | 3300048926 | Bacteria | 2841 |
| 570 | Ga0496123_0064479 | 3300048926 | Bacteria | 2334 |
| 571 | Ga0496123_0068749 | 3300048926 | Bacteria | 2228 |
| 572 | Ga0496123_0097691 | 3300048926 | Bacteria | 1720 |
| 573 | Ga0496123_0117681 | 3300048926 | Bacteria | 1502 |
| 574 | Ga0496123_0126523 | 3300048926 | Bacteria | 1425 |
| 575 | Ga0496123_0128170 | 3300048926 | Bacteria | 1412 |
| 576 | Ga0496123_0204942 | 3300048926 | Bacteria | 1007 |
| 577 | Ga0496123_0208749 | 3300048926 | Bacteria | 994 |
| 578 | Ga0496123_0417845 | 3300048926 | Bacteria | 605 |
| 579 | Ga0496124_0001375 | 3300048927 | Bacteria | 36436 |
| 580 | Ga0496124_0004615 | 3300048927 | Bacteria | 15952 |
| 581 | Ga0496124_0004859 | 3300048927 | Bacteria | 15455 |
| 582 | Ga0496124_0008172 | 3300048927 | Bacteria | 10978 |
| 583 | Ga0496124_0009560 | 3300048927 | Bacteria | 9963 |
| 584 | Ga0496124_0010738 | 3300048927 | Bacteria | 9233 |
| 585 | Ga0496124_0018921 | 3300048927 | Bacteria | 6430 |
| 586 | Ga0496124_0019034 | 3300048927 | Bacteria | 6407 |
| 587 | Ga0496124_0023319 | 3300048927 | Bacteria | 5651 |
| 588 | Ga0496124_0031603 | 3300048927 | Bacteria | 4685 |
| 589 | Ga0496124_0043530 | 3300048927 | Bacteria | 3860 |
| 590 | Ga0496124_0064727 | 3300048927 | Bacteria | 3051 |
| 591 | Ga0496124_0076994 | 3300048927 | Bacteria | 2752 |
| 592 | Ga0496124_0108934 | 3300048927 | Bacteria | 2233 |
| 593 | Ga0496124_0134555 | 3300048927 | Bacteria | 1959 |
| 594 | Ga0496124_0143902 | 3300048927 | Bacteria | 1878 |
| 595 | Ga0496124_0259680 | 3300048927 | Bacteria | 1279 |
| 596 | Ga0496124_0478127 | 3300048927 | Bacteria | 842 |
| 597 | Ga0496125_0000155 | 3300048928 | Bacteria | 151541 |
| 598 | Ga0496125_0001650 | 3300048928 | Bacteria | 31436 |
| 599 | Ga0496125_0011951 | 3300048928 | Bacteria | 8646 |
| 600 | Ga0496125_0022579 | 3300048928 | Bacteria | 5837 |
| 601 | Ga0496125_0040552 | 3300048928 | Bacteria | 3992 |
| 602 | Ga0496125_0103805 | 3300048928 | Bacteria | 2084 |
| 603 | Ga0496125_0126493 | 3300048928 | Bacteria | 1810 |
| 604 | Ga0496125_0130507 | 3300048928 | Bacteria | 1770 |
| 605 | Ga0496125_0297465 | 3300048928 | Bacteria | 990 |
| 606 | Ga0496126_0000081 | 3300048929 | Bacteria | 218818 |
| 607 | Ga0496126_0001055 | 3300048929 | Bacteria | 46595 |
| 608 | Ga0496126_0020861 | 3300048929 | Bacteria | 6414 |
| 609 | Ga0496126_0025790 | 3300048929 | Bacteria | 5647 |
| 610 | Ga0496126_0203486 | 3300048929 | Bacteria | 1670 |
| 611 | Ga0496126_0276402 | 3300048929 | Bacteria | 1392 |
| 612 | Ga0496126_0283981 | 3300048929 | Bacteria | 1370 |
| 613 | Ga0496126_0785365 | 3300048929 | Bacteria | 732 |
| 614 | Ga0496126_1225144 | 3300048929 | Bacteria | 550 |
| 615 | Ga0495678_021753 | 3300049459 | Bacteria | 2818 |
| 616 | Ga0495682_0340079 | 3300049460 | Bacteria | 529 |
| 617 | Ga0501032_0230599 | 3300049569 | Bacteria | 1204 |
| 618 | Ga0501033_0006625 | 3300049570 | Bacteria | 9057 |
| 619 | Ga0501033_0365760 | 3300049570 | Bacteria | 1009 |
| 620 | Ga0501034_0324030 | 3300049571 | Bacteria | 1473 |
| 621 | Ga0501034_0558517 | 3300049571 | Bacteria | 1053 |
| 622 | Ga0501034_0745454 | 3300049571 | Bacteria | 875 |
| 623 | Ga0501036_0087090 | 3300049572 | Bacteria | 2640 |
| 624 | Ga0501037_0826255 | 3300049573 | Bacteria | 611 |
| 625 | Ga0501038_0114422 | 3300049574 | Bacteria | 2231 |
| 626 | Ga0501039_0398683 | 3300049575 | Bacteria | 1081 |
| 627 | Ga0501040_0956525 | 3300049576 | Bacteria | 621 |
| 628 | Ga0501043_0097514 | 3300049579 | Bacteria | 2311 |
| 629 | Ga0501046_0252411 | 3300049580 | Bacteria | 1298 |
| 630 | Ga0501047_0157407 | 3300049581 | Bacteria | 2145 |
| 631 | Ga0501072_0272005 | 3300049588 | Bacteria | 1348 |
| 632 | Ga0501072_0743674 | 3300049588 | Bacteria | 770 |
| 633 | Ga0501073_0047442 | 3300049589 | Bacteria | 3019 |
| 634 | Ga0501073_0360341 | 3300049589 | Bacteria | 1004 |
| 635 | Ga0501075_1552763 | 3300049591 | Bacteria | 501 |
| 636 | Ga0501076_0564486 | 3300049592 | Bacteria | 939 |
| 637 | Ga0501076_0761675 | 3300049592 | Bacteria | 799 |
| 638 | Ga0501227_080014 | 3300049665 | Bacteria | 856 |
| 639 | Ga0501080_0618362 | 3300049742 | Bacteria | 960 |
| 640 | Ga0501083_0056452 | 3300049744 | Bacteria | 2631 |
| 641 | Ga0501083_0232129 | 3300049744 | Bacteria | 1201 |
| 642 | Ga0501241_030522 | 3300049758 | Bacteria | 1018 |
| 643 | Ga0501035_0011205 | 3300049822 | Bacteria | 8304 |
| 644 | Ga0501035_0813170 | 3300049822 | Bacteria | 746 |
| 645 | Ga0501044_0227271 | 3300049823 | Bacteria | 1815 |
| 646 | Ga0501044_0798699 | 3300049823 | Bacteria | 823 |
| 647 | nmdc:mga03683_3930_c1 | 3300050489 | Bacteria | 4861 |
| 648 | nmdc:mga03683_40613_c1 | 3300050489 | Bacteria | 1909 |
| 649 | nmdc:mga03683_89964_c1 | 3300050489 | Bacteria | 1337 |
| 650 | nmdc:mga03n38_7216_c1 | 3300050490 | Bacteria | 3919 |
| 651 | nmdc:mga00v17_1054035_c1 | 3300050491 | Bacteria | 510 |
| 652 | nmdc:mga00v17_1316_c1 | 3300050491 | Bacteria | 13009 |
| 653 | nmdc:mga00v17_40_c1 | 3300050491 | Bacteria | 80338 |
| 654 | nmdc:mga00v17_417329_c1 | 3300050491 | Bacteria | 872 |
| 655 | nmdc:mga00v17_645713_c1 | 3300050491 | Bacteria | 681 |
| 656 | nmdc:mga0yw44_39303_c1 | 3300050492 | Bacteria | 2805 |
| 657 | nmdc:mga0yw44_39838_c1 | 3300050492 | Bacteria | 2788 |
| 658 | nmdc:mga0yw44_61756_c1 | 3300050492 | Bacteria | 2300 |
| 659 | nmdc:mga0k408_123477_c1 | 3300050493 | Bacteria | 1535 |
| 660 | nmdc:mga0k408_3552_c1 | 3300050493 | Bacteria | 8244 |
| 661 | nmdc:mga0k408_77389_c1 | 3300050493 | Bacteria | 1945 |
| 662 | nmdc:mga06z11_29591_c1 | 3300050494 | Bacteria | 2640 |
| 663 | nmdc:mga06z11_498651_c1 | 3300050494 | Bacteria | 738 |
| 664 | nmdc:mga04h51_130513_c1 | 3300050495 | Bacteria | 945 |
| 665 | nmdc:mga07m45_334060_c1 | 3300050496 | Bacteria | 881 |
| 666 | nmdc:mga07m45_776269_c1 | 3300050496 | Bacteria | 550 |
| 667 | nmdc:mga07m45_8386_c1 | 3300050496 | Bacteria | 5311 |
| 668 | nmdc:mga05p37_1299293_c1 | 3300050507 | Bacteria | 742 |
| 669 | nmdc:mga0qj67_281133_c1 | 3300050509 | Bacteria | 1349 |
| 670 | nmdc:mga06r32_1711525_c1 | 3300050510 | Bacteria | 566 |
| 671 | nmdc:mga06r32_208537_c1 | 3300050510 | Bacteria | 1942 |
| 672 | nmdc:mga06r32_382246_c1 | 3300050510 | Bacteria | 1391 |
| 673 | nmdc:mga08y16_1256106_c1 | 3300050511 | Bacteria | 709 |
| 674 | nmdc:mga0sz30_18572_c1 | 3300050516 | Bacteria | 1647 |
| 675 | nmdc:mga0sz30_265_c1 | 3300050516 | Bacteria | 20071 |
| 676 | nmdc:mga0sz30_4566_c1 | 3300050516 | Bacteria | 1851 |
| 677 | nmdc:mga0sz30_95762_c1 | 3300050516 | Bacteria | 588 |
| 678 | Ga0500610_0047061 | 3300053079 | Bacteria | 2241 |
| 679 | Ga0500643_024841 | 3300053087 | Bacteria | 1896 |
| 680 | Ga0500643_025791 | 3300053087 | Bacteria | 1849 |
| 681 | Ga0500644_0002689 | 3300053088 | Bacteria | 4442 |
| 682 | Ga0500557_014583 | 3300053105 | Bacteria | 2101 |
| 683 | Ga0500560_059980 | 3300053107 | Bacteria | 1238 |
| 684 | Ga0500569_000941 | 3300053109 | Bacteria | 5234 |
| 685 | Ga0500569_007733 | 3300053109 | Bacteria | 2426 |
| 686 | Ga0500572_033612 | 3300053111 | Bacteria | 1448 |
| 687 | Ga0500594_0012885 | 3300053118 | Bacteria | 1979 |
| 688 | Ga0500607_293124 | 3300053121 | Bacteria | 608 |
| 689 | Ga0500608_017344 | 3300053122 | Bacteria | 3270 |
| 690 | Ga0500608_081168 | 3300053122 | Bacteria | 1530 |
| 691 | Ga0500618_000190 | 3300053125 | Bacteria | 50341 |
| 692 | Ga0500618_000619 | 3300053125 | Bacteria | 21597 |
| 693 | Ga0500618_009408 | 3300053125 | Bacteria | 2668 |
| 694 | Ga0500618_024796 | 3300053125 | Bacteria | 1442 |
| 695 | Ga0500618_034710 | 3300053125 | Bacteria | 1173 |
| 696 | Ga0500642_0209384 | 3300053130 | Bacteria | 905 |
| 697 | Ga0500658_0000262 | 3300053134 | Bacteria | 24241 |
| 698 | Ga0500658_0023929 | 3300053134 | Bacteria | 2337 |
| 699 | Ga0500559_0014361 | 3300053136 | Bacteria | 3347 |
| 700 | Ga0500561_0000314 | 3300053137 | Bacteria | 8270 |
| 701 | Ga0500568_0007314 | 3300053139 | Bacteria | 5428 |
| 702 | Ga0500568_0023435 | 3300053139 | Bacteria | 2625 |
| 703 | Ga0500573_0010605 | 3300053140 | Bacteria | 5143 |
| 704 | Ga0500590_099708 | 3300053148 | Bacteria | 1396 |
| 705 | Ga0500604_0066786 | 3300053151 | Bacteria | 1140 |
| 706 | Ga0500616_0021838 | 3300053153 | Bacteria | 3580 |
| 707 | Ga0500616_0034244 | 3300053153 | Bacteria | 2767 |
| 708 | Ga0500616_0110437 | 3300053153 | Bacteria | 1329 |
| 709 | Ga0500622_0000830 | 3300053156 | Bacteria | 26470 |
| 710 | Ga0500622_0007788 | 3300053156 | Bacteria | 6042 |
| 711 | Ga0500622_0217992 | 3300053156 | Bacteria | 857 |
| 712 | Ga0500624_000222 | 3300053157 | Bacteria | 21107 |
| 713 | Ga0500624_022504 | 3300053157 | Bacteria | 1026 |
| 714 | Ga0500627_0119307 | 3300053158 | Bacteria | 1189 |
| 715 | Ga0500627_0181906 | 3300053158 | Bacteria | 946 |
| 716 | Ga0500627_0260482 | 3300053158 | Bacteria | 765 |
| 717 | Ga0500633_0272638 | 3300053160 | Bacteria | 626 |
| 718 | Ga0500634_0009966 | 3300053161 | Bacteria | 4837 |
| 719 | Ga0500634_0304943 | 3300053161 | Bacteria | 629 |
| 720 | Ga0500636_0000115 | 3300053177 | Bacteria | 41660 |
| 721 | Ga0500636_0002063 | 3300053177 | Bacteria | 11088 |
| 722 | Ga0500565_026180 | 3300053734 | Bacteria | 738 |
| 723 | Ga0501084_0667713 | 3300054114 | Bacteria | 877 |
| 724 | Ga0587084_073933 | 3300059477 | Bacteria | 648 |
| 725 | Ga0587066_063503 | 3300059490 | Bacteria | 760 |
| 726 | Ga0587066_088296 | 3300059490 | Bacteria | 684 |
| 727 | Ga0587073_0100797 | 3300059492 | Bacteria | 750 |
| 728 | Ga0587073_0194053 | 3300059492 | Bacteria | 604 |
| 729 | Ga0587077_073191 | 3300059493 | Bacteria | 770 |
| 730 | Ga0587083_0222556 | 3300059505 | Bacteria | 550 |
| 731 | Ga0587088_020713 | 3300059508 | Bacteria | 1093 |
| 732 | Ga0587088_167536 | 3300059508 | Bacteria | 542 |
| 733 | Ga0587090_000175 | 3300059510 | Bacteria | 4472 |
| 734 | Ga0587091_007538 | 3300059511 | Bacteria | 1574 |
| 735 | Ga0587091_039285 | 3300059511 | Bacteria | 926 |
| 736 | Ga0587094_056360 | 3300059513 | Bacteria | 678 |
| 737 | Ga0587106_041200 | 3300059605 | Bacteria | 785 |
| 738 | Ga0587128_031127 | 3300059630 | Bacteria | 884 |
| 739 | Ga0587067_067651 | 3300059640 | Bacteria | 764 |
| 740 | Ga0587072_044684 | 3300059643 | Bacteria | 871 |
| 741 | Ga0587072_062511 | 3300059643 | Bacteria | 770 |
| 742 | Ga0587075_088827 | 3300059644 | Bacteria | 601 |
| 743 | Ga0587076_094276 | 3300059645 | Bacteria | 659 |
| 744 | Ga0587076_169313 | 3300059645 | Bacteria | 543 |
| 745 | Ga0587102_044756 | 3300059649 | Bacteria | 581 |
| 746 | Ga0587107_029483 | 3300059652 | Bacteria | 826 |
| 747 | Ga0587071_078413 | 3300060344 | Bacteria | 732 |
| 748 | Ga0501082_0926653 | 3300060353 | Bacteria | 762 |
| 749 | Ga0530510_1006086 | 3300061734 | Bacteria | 638 |
| 750 | 2509386762 | 2509276021 | Bacteria | 7634384 |
| 751 | 2509443167 | 2509276033 | Bacteria | 7180565 |
| 752 | 2510133233 | 2510065019 | Bacteria | 6903379 |
| 753 | 2510843478 | 2510461069 | Bacteria | 5505000 |
| 754 | 2510894599 | 2510461076 | Bacteria | 8618824 |
| 755 | 2511135038 | 2510917022 | Bacteria | 6504556 |
| 756 | 2511168728 | 2510917026 | Bacteria | 7046020 |
| 757 | 2511182346 | 2510917028 | Bacteria | 6185411 |
| 758 | 2511200010 | 2510917030 | Bacteria | 7460662 |
| 759 | 2513572291 | 2513237084 | Bacteria | 7231967 |
| 760 | 2513579647 | 2513237085 | Bacteria | 7695351 |
| 761 | 2513594511 | 2513237088 | Bacteria | 6927906 |
| 762 | 2513634414 | 2513237093 | Bacteria | 7545552 |
| 763 | 2513708812 | 2513237103 | Bacteria | 7647401 |
| 764 | 2513864569 | 2513237138 | Bacteria | 7368160 |
| 765 | 2513913101 | 2513237144 | Bacteria | 7530820 |
| 766 | 2513926320 | 2513237146 | Bacteria | 7166346 |
| 767 | 2514021548 | 2513237162 | Bacteria | 7468464 |
| 768 | 2515112189 | 2515075009 | Bacteria | 7288508 |
| 769 | 2515637258 | 2515154113 | Bacteria | 7807172 |
| 770 | 2515639693 | 2515154114 | Bacteria | 7848616 |
| 771 | 2515657337 | 2515154116 | Bacteria | 7552979 |
| 772 | 2515738658 | 2515154134 | Bacteria | 7220242 |
| 773 | 2517035921 | 2516653077 | Bacteria | 7555578 |
| 774 | 2517076317 | 2516653085 | Bacteria | 7346596 |
| 775 | 2517095073 | 2517093000 | Bacteria | 7412387 |
| 776 | 2517406705 | 2517287029 | Bacteria | 6905599 |
| 777 | 2520379337 | 2519899620 | Bacteria | 6499161 |
| 778 | 2524460354 | 2524023209 | Bacteria | 6679728 |
| 779 | 2530645448 | 2529292951 | Bacteria | 6916614 |
| 780 | 2535516424 | 2534681796 | Bacteria | 7146037 |
| 781 | 2554247982 | 2554235003 | Bacteria | 5877155 |
| 782 | 2559295100 | 2558860242 | Bacteria | 5568029 |
| 783 | 2561466451 | 2558860983 | Bacteria | 4133860 |
| 784 | 2585200090 | 2582581294 | Bacteria | 6626667 |
| 785 | 2585224270 | 2582581298 | Bacteria | 7315509 |
| 786 | 2585232822 | 2582581299 | Bacteria | 6518058 |
| 787 | 2585254679 | 2582581304 | Bacteria | 5831370 |
| 788 | 2585270777 | 2582581307 | Bacteria | 6597605 |
| 789 | 2585277129 | 2582581308 | Bacteria | 7413247 |
| 790 | 2585323862 | 2582581315 | Bacteria | 7318924 |
| 791 | 2585331840 | 2582581316 | Bacteria | 7774528 |
| 792 | 2585401937 | 2582581867 | Bacteria | 7184437 |
| 793 | 2585527560 | 2585427526 | Bacteria | 7258840 |
| 794 | 2585534135 | 2585427527 | Bacteria | 7273426 |
| 795 | 2585537456 | 2585427528 | Bacteria | 6842387 |
| 796 | 2585546391 | 2585427529 | Bacteria | 7395659 |
| 797 | 2585552013 | 2585427530 | Bacteria | 7383882 |
| 798 | 2585558500 | 2585427531 | Bacteria | 6992870 |
| 799 | 2585821722 | 2585427590 | Bacteria | 6824633 |
| 800 | 2585835412 | 2585427593 | Bacteria | 7141551 |
| 801 | 2585846664 | 2585427594 | Bacteria | 6180594 |
| 802 | 2585897867 | 2585427608 | Bacteria | 6544331 |
| 803 | 2585904530 | 2585427609 | Bacteria | 6667127 |
| 804 | 2585995829 | 2585427633 | Bacteria | 6413184 |
| 805 | 2586000392 | 2585427634 | Bacteria | 6455027 |
| 806 | 2587980354 | 2585428125 | Bacteria | 6662905 |
| 807 | 2599417799 | 2599185170 | Bacteria | 7295545 |
| 808 | 2599601412 | 2599185210 | Bacteria | 5624189 |
| 809 | 2599721458 | 2599185236 | Bacteria | 6875203 |
| 810 | 2600374583 | 2600254933 | Bacteria | 4750527 |
| 811 | 2601612038 | 2600255279 | Bacteria | 5605316 |
| 812 | 2601749178 | 2600255308 | Bacteria | 5611129 |
| 813 | 2616292548 | 2615840624 | Bacteria | 6557588 |
| 814 | 2616308506 | 2615840626 | Bacteria | 7921970 |
| 815 | 2616557191 | 2615840698 | Bacteria | 7319877 |
| 816 | 2617385677 | 2617270742 | Bacteria | 6808054 |
| 817 | 2643811785 | 2643221558 | Bacteria | 5460675 |
| 818 | 2643854519 | 2643221568 | Bacteria | 5187270 |
| 819 | 2643919511 | 2643221582 | Bacteria | 5804683 |
| 820 | 2644003696 | 2643221599 | Bacteria | 6292121 |
| 821 | 2644192846 | 2643221634 | Bacteria | 6705461 |
| 822 | 2644239509 | 2643221643 | Bacteria | 5749658 |
| 823 | 2644300257 | 2643221653 | Bacteria | 4569637 |
| 824 | 2644520256 | 2643221693 | Bacteria | 5513853 |
| 825 | 2644658483 | 2643221719 | Bacteria | 4568197 |
| 826 | 2671111790 | 2667528174 | Bacteria | 6435400 |
| 827 | 2719181093 | 2718217882 | Bacteria | 6556348 |
| 828 | 2719385707 | 2718217927 | Bacteria | 6972593 |
| 829 | 2719665526 | 2718217997 | Bacteria | 6740740 |
| 830 | 2719731842 | 2718218009 | Bacteria | 6478651 |
| 831 | 2720491946 | 2718218199 | Bacteria | 6740745 |
| 832 | 2720613213 | 2718218232 | Bacteria | 6720332 |
| 833 | 2720620088 | 2718218233 | Bacteria | 6662049 |
| 834 | 2720631513 | 2718218235 | Bacteria | 6630699 |
| 835 | 2720775241 | 2718218269 | Bacteria | 6906114 |
| 836 | 2721147187 | 2718218363 | Bacteria | 6524337 |
| 837 | 2721158719 | 2718218365 | Bacteria | 6274507 |
| 838 | 2721164105 | 2718218366 | Bacteria | 6425255 |
| 839 | 2721399487 | 2718218423 | Bacteria | 6438183 |
| 840 | 2722840275 | 2721755514 | Bacteria | 6424414 |
| 841 | 2723026858 | 2721755556 | Bacteria | 6745503 |
| 842 | 2723560475 | 2721755684 | Bacteria | 6859907 |
| 843 | 2723567060 | 2721755685 | Bacteria | 6704835 |
| 844 | 2724038300 | 2721755809 | Bacteria | 6438790 |
| 845 | 2724044598 | 2721755810 | Bacteria | 6479005 |
| 846 | 2724089848 | 2721755819 | Bacteria | 6906405 |
| 847 | 2724104325 | 2721755822 | Bacteria | 6726041 |
| 848 | 2724110120 | 2721755823 | Bacteria | 6752556 |
| 849 | 2730107794 | 2728369352 | Bacteria | 6745171 |
| 850 | 2730164330 | 2728369365 | Bacteria | 6555560 |
| 851 | 2730298351 | 2728369397 | Bacteria | 6274511 |
| 852 | 2738801985 | 2738541293 | Bacteria | 7065685 |
| 853 | 2738946138 | 2738541317 | Bacteria | 5340176 |
| 854 | 2739036423 | 2738541333 | Bacteria | 7106503 |
| 855 | 2766063088 | 2765235942 | Bacteria | 7445910 |
| 856 | 2776913615 | 2775507049 | Bacteria | 6284736 |
| 857 | 2778173943 | 2775507266 | Bacteria | 7392367 |
| 858 | 2793294591 | 2791355256 | Bacteria | 6798008 |
| 859 | 2793312163 | 2791355259 | Bacteria | 7254731 |
| 860 | 2793322107 | 2791355260 | Bacteria | 6598818 |
| 861 | 2793326587 | 2791355261 | Bacteria | 6661293 |
| 862 | 2793335813 | 2791355262 | Bacteria | 6774204 |
| 863 | 2793341441 | 2791355263 | Bacteria | 6872478 |
| 864 | 2793349166 | 2791355264 | Bacteria | 6429314 |
| 865 | 2793356710 | 2791355265 | Bacteria | 6539969 |
| 866 | 2793361249 | 2791355266 | Bacteria | 7116587 |
| 867 | 2793369337 | 2791355267 | Bacteria | 7222458 |
| 868 | 2805925627 | 2802429605 | Bacteria | 6875453 |
| 869 | 2805933653 | 2802429606 | Bacteria | 6346811 |
| 870 | 2806045973 | 2802429633 | Bacteria | 7341974 |
| 871 | 2806054353 | 2802429634 | Bacteria | 7083200 |
| 872 | 2806060358 | 2802429635 | Bacteria | 7650140 |
| 873 | 2806065186 | 2802429636 | Bacteria | 7597525 |
| 874 | 2806072453 | 2802429637 | Bacteria | 7067217 |
| 875 | 2808985186 | 2808606387 | Bacteria | 5697198 |
| 876 | 2819242125 | 2818991272 | Bacteria | 4622173 |
| 877 | 2819559618 | 2818991439 | Bacteria | 6907412 |
| 878 | 2819612910 | 2818991448 | Bacteria | 6772224 |
| 879 | 2819637983 | 2818991453 | Bacteria | 7181617 |
| 880 | 2819687243 | 2818991461 | Bacteria | 7026071 |
| 881 | 2821127957 | 2821123053 | Bacteria | 7836056 |
| 882 | 2838020994 | 2838016132 | Bacteria | 6577831 |
| 883 | 2838029023 | 2838022645 | Bacteria | 6494267 |
| 884 | 2838030169 | 2838029111 | Bacteria | 6603031 |
| 885 | 2838037985 | 2838035591 | Bacteria | 7166484 |
| 886 | 2838043345 | 2838042994 | Bacteria | 6046894 |
| 887 | 2838052506 | 2838048938 | Bacteria | 6044578 |
| 888 | 2838066031 | 2838061910 | Bacteria | 6794874 |
| 889 | 2838073505 | 2838068647 | Bacteria | 6208656 |
| 890 | 2838667304 | 2838661181 | Bacteria | 7385261 |
| 891 | 2838672109 | 2838668709 | Bacteria | 6671819 |
| 892 | 2838676046 | 2838675328 | Bacteria | 4909118 |
| 893 | 2838682308 | 2838680041 | Bacteria | 6545511 |
| 894 | 2838689411 | 2838686498 | Bacteria | 7807632 |
| 895 | 2838696879 | 2838694306 | Bacteria | 6853137 |
| 896 | 2838704611 | 2838701080 | Bacteria | 6669771 |
| 897 | 2838709880 | 2838707686 | Bacteria | 6619912 |
| 898 | 2838714928 | 2838714209 | Bacteria | 5525906 |
| 899 | 2838721271 | 2838719591 | Bacteria | 5523910 |
| 900 | 2838725688 | 2838724970 | Bacteria | 4908691 |
| 901 | 2838730744 | 2838729681 | Bacteria | 7400765 |
| 902 | 2838738369 | 2838736955 | Bacteria | 5760694 |
| 903 | 2838743685 | 2838742623 | Bacteria | 7396178 |
| 904 | 2841841262 | 2841840854 | Bacteria | 5761912 |
| 905 | 2841848237 | 2841846520 | Bacteria | 5345850 |
| 906 | 2841857761 | 2841851746 | Bacteria | 7532261 |
| 907 | 2841859218 | 2841859092 | Bacteria | 5436171 |
| 908 | 2841864642 | 2841864319 | Bacteria | 6742987 |
| 909 | 2842078054 | 2842077413 | Bacteria | 6508645 |
| 910 | 2842110583 | 2842110456 | Bacteria | 7656360 |
| 911 | 2842119437 | 2842118031 | Bacteria | 7033875 |
| 912 | 2842125733 | 2842124991 | Bacteria | 5346824 |
| 913 | 2842130941 | 2842130223 | Bacteria | 4909145 |
| 914 | 2842141040 | 2842140634 | Bacteria | 5759631 |
| 915 | 2842148649 | 2842146304 | Bacteria | 5957337 |
| 916 | 2842153889 | 2842152218 | Bacteria | 4908957 |
| 917 | 2842157502 | 2842156927 | Bacteria | 6894975 |
| 918 | 2842164694 | 2842163707 | Bacteria | 6916235 |
| 919 | 2842171172 | 2842170452 | Bacteria | 5525737 |
| 920 | 2842177509 | 2842175837 | Bacteria | 4908771 |
| 921 | 2842180913 | 2842180545 | Bacteria | 6888678 |
| 922 | 2842188037 | 2842187318 | Bacteria | 5524014 |
| 923 | 2842194590 | 2842192696 | Bacteria | 6147454 |
| 924 | 2842205202 | 2842198810 | Bacteria | 6608673 |
| 925 | 2842206117 | 2842205361 | Bacteria | 6340321 |
| 926 | 2842212348 | 2842211629 | Bacteria | 5523832 |
| 927 | 2842217143 | 2842217011 | Bacteria | 7497767 |
| 928 | 2842226033 | 2842224351 | Bacteria | 5524473 |
| 929 | 2842231028 | 2842229732 | Bacteria | 7475766 |
| 930 | 2842239293 | 2842237096 | Bacteria | 6620661 |
| 931 | 2842244864 | 2842243621 | Bacteria | 7421798 |
| 932 | 2842254291 | 2842250916 | Bacteria | 6579627 |
| 933 | 2842258677 | 2842257432 | Bacteria | 7401195 |
| 934 | 2842268193 | 2842264693 | Bacteria | 6472963 |
| 935 | 2842273431 | 2842271015 | Bacteria | 7807131 |
| 936 | 2842279574 | 2842278818 | Bacteria | 6340002 |
| 937 | 2842286215 | 2842285085 | Bacteria | 6011953 |
| 938 | 2842291717 | 2842291075 | Bacteria | 7076806 |
| 939 | 2842302119 | 2842298080 | Bacteria | 6123127 |
| 940 | 2842304208 | 2842304105 | Bacteria | 7023636 |
| 941 | 2842313831 | 2842311132 | Bacteria | 6616990 |
| 942 | 2842317988 | 2842317721 | Bacteria | 6793725 |
| 943 | 2842345921 | 2842341865 | Bacteria | 7003929 |
| 944 | 2842357414 | 2842357229 | Bacteria | 6485165 |
| 945 | 2842364451 | 2842363717 | Bacteria | 6844742 |
| 946 | 2842372874 | 2842370503 | Bacteria | 7038661 |
| 947 | 2842378113 | 2842377471 | Bacteria | 7140707 |
| 948 | 2842385946 | 2842384541 | Bacteria | 7057858 |
| 949 | 2842397582 | 2842395702 | Bacteria | 6780583 |
| 950 | 2842403582 | 2842402390 | Bacteria | 6681310 |
| 951 | 2842409045 | 2842409023 | Bacteria | 6687331 |
| 952 | 2842415699 | 2842415677 | Bacteria | 6596907 |
| 953 | 2842427989 | 2842422224 | Bacteria | 6239196 |
| 954 | 2842431572 | 2842428310 | Bacteria | 6767288 |
| 955 | 2842438468 | 2842434925 | Bacteria | 6502746 |
| 956 | 2842445098 | 2842441272 | Bacteria | 6769273 |
| 957 | 2842452416 | 2842447887 | Bacteria | 6754142 |
| 958 | 2842465944 | 2842462802 | Bacteria | 6588055 |
| 959 | 2842473083 | 2842469257 | Bacteria | 6752936 |
| 960 | 2842476546 | 2842475841 | Bacteria | 6603183 |
| 961 | 2842484911 | 2842482326 | Bacteria | 7212537 |
| 962 | 2842489945 | 2842489311 | Bacteria | 6620893 |
| 963 | 2842496258 | 2842495871 | Bacteria | 6820686 |
| 964 | 2842503697 | 2842502639 | Bacteria | 6604161 |
| 965 | 2842515214 | 2842509118 | Bacteria | 6850950 |
| 966 | 2842516002 | 2842515876 | Bacteria | 5436280 |
| 967 | 2844459248 | 2844454524 | Bacteria | 7952546 |
| 968 | 2852389819 | 2852387548 | Bacteria | 8025568 |
| 969 | 2854899479 | 2854896431 | Bacteria | 5869725 |
| 970 | 2854918301 | 2854916844 | Bacteria | 5725939 |
| 971 | 2857518633 | 2857516855 | Bacteria | 7787325 |
| 972 | 2857534999 | 2857531043 | Bacteria | 6754041 |
| 973 | 2891374402 | 2891373044 | Bacteria | 5202277 |
| 974 | 2899793998 | 2899792073 | Bacteria | 4926588 |
| 975 | 2899807582 | 2899803654 | Bacteria | 5577784 |
| 976 | 2899846395 | 2899845264 | Bacteria | 5672268 |
| 977 | 2913311277 | 2913308742 | Bacteria | 5350706 |
| 978 | 2919106993 | 2919100787 | Bacteria | 7710546 |
| 979 | 2919115018 | 2919114240 | Bacteria | 5700270 |
| 980 | 2919168857 | 2919166419 | Bacteria | 4952238 |
| 981 | 2919175164 | 2919171160 | Bacteria | 6499771 |
| 982 | 2919411763 | 2919408235 | Bacteria | 6149349 |
| 983 | 2923557855 | 2923556063 | Bacteria | 6793593 |
| 984 | 2926755983 | 2926754445 | Bacteria | 5964435 |
| 985 | 2926763080 | 2926760298 | Bacteria | 5505990 |
| 986 | 2929140501 | 2929138655 | Bacteria | 5810547 |
| 987 | 2933008535 | 2933006813 | Bacteria | 4912075 |
| 988 | 2933013352 | 2933011516 | Bacteria | 5439334 |
| 989 | 2933021109 | 2933016740 | Bacteria | 6355406 |
| 990 | 2933571485 | 2933570622 | Bacteria | 7023390 |
| 991 | 2933586611 | 2933586486 | Bacteria | 7667493 |
| 992 | 2933596873 | 2933594066 | Bacteria | 5594265 |
| 993 | 2933604013 | 2933599457 | Bacteria | 5858799 |
| 994 | 2935897265 | 2935894831 | Bacteria | 6620579 |
| 995 | 2935904657 | 2935901341 | Bacteria | 7341747 |
| 996 | 2936385060 | 2936381700 | Bacteria | 7006523 |
| 997 | 2978971544 | 2978969890 | Bacteria | 5400756 |
| 998 | 2979094426 | 2979089926 | Bacteria | 5670289 |
| 999 | 2979098191 | 2979095461 | Bacteria | 5669583 |
| 1000 | 2979103666 | 2979100975 | Bacteria | 5423623 |
| 1001 | 2984511770 | 2984509177 | Bacteria | 5274802 |
| 1002 | 2984521870 | 2984518228 | Bacteria | 5277463 |
| 1003 | 2984541168 | 2984537506 | Bacteria | 5277481 |
| 1004 | 2984588689 | 2984587000 | Bacteria | 5263363 |
| 1005 | 2984603448 | 2984601300 | Bacteria | 5455244 |
| 1006 | 2989353294 | 2989349275 | Bacteria | 6349068 |
| 1007 | 2989778596 | 2989776772 | Bacteria | 4843317 |
| 1008 | 2996891626 | 2996887358 | Bacteria | 5795980 |
| 1009 | 2996898231 | 2996893221 | Bacteria | 5823108 |
| 1010 | 3003933597 | 3003930520 | Bacteria | 5667563 |
| 1011 | 3005415223 | 3005409236 | Bacteria | 7188837 |
| 1012 | 3005420179 | 3005416602 | Bacteria | 7064308 |
| 1013 | 3005447434 | 3005445848 | Bacteria | 6906074 |
| 1014 | 3005454144 | 3005452660 | Bacteria | 5889319 |
| 1015 | 639648453 | 639633055 | Bacteria | 7751309 |
| 1016 | 650740303 | 650716007 | Bacteria | 5573770 |
| 1017 | 8003571354 | 8003570095 | Bacteria | 5747666 |
| 1018 | 8005250907 | 8005246636 | Bacteria | 4933972 |
| 1019 | 8005262956 | 8005258706 | Bacteria | 6184835 |
| 1020 | 8005280484 | 8005275841 | Bacteria | 6929066 |
| 1021 | 8005283102 | 8005282627 | Bacteria | 6675747 |
| 1022 | 8005290337 | 8005289223 | Bacteria | 6634003 |
| 1023 | 8005302470 | 8005301065 | Bacteria | 6614431 |
| 1024 | 8005314448 | 8005307578 | Bacteria | 7395396 |
| 1025 | 8005317130 | 8005314921 | Bacteria | 7072929 |
| 1026 | 8005326153 | 8005321885 | Bacteria | 5795980 |
| 1027 | 8005379114 | 8005376324 | Bacteria | 6590079 |
| 1028 | 8005388246 | 8005382845 | Bacteria | 6732062 |
| 1029 | 8005397228 | 8005395548 | Bacteria | 6806915 |
| 1030 | 8005432051 | 8005430974 | Bacteria | 6689030 |
| 1031 | 8005462851 | 8005460587 | Bacteria | 7157962 |
| 1032 | 8005485071 | 8005484373 | Bacteria | 6297373 |
| 1033 | 8005500250 | 8005497431 | Bacteria | 6477605 |
| 1034 | 8005545072 | 8005542996 | Bacteria | 7077758 |
| 1035 | 8005557805 | 8005556819 | Bacteria | 6908598 |
| 1036 | 8005568978 | 8005563573 | Bacteria | 7153261 |
| 1037 | 8005574790 | 8005570704 | Bacteria | 6957481 |
| 1038 | 8005621624 | 8005619151 | Bacteria | 7030230 |
| 1039 | 8005626445 | 8005626139 | Bacteria | 6534237 |
| 1040 | 8005648806 | 8005645114 | Bacteria | 6950293 |
| 1041 | 8005659530 | 8005658619 | Bacteria | 4500593 |
| 1042 | 8005671666 | 8005668836 | Bacteria | 6953162 |
| 1043 | 8005683265 | 8005682033 | Bacteria | 6726518 |
| 1044 | 8005694483 | 8005688590 | Bacteria | 6610080 |
| 1045 | 8005700110 | 8005695170 | Bacteria | 6912330 |
| 1046 | 8018129824 | 8018127388 | Bacteria | 7351159 |
| 1047 | 8018166890 | 8018163183 | Bacteria | 7277977 |
| 1048 | 8018179923 | 8018176218 | Bacteria | 6896178 |
| 1049 | 8023685476 | 8023680758 | Bacteria | 7729763 |
| 1050 | 8024492332 | 8024486573 | Bacteria | 6540512 |
| 1051 | 8024506678 | 8024501048 | Bacteria | 6427847 |
| 1052 | 8046773868 | 8046767195 | Bacteria | 7547379 |
| 1053 | 8054462889 | 8054460903 | Bacteria | 4872905 |
| 1054 | 8055435090 | 8055431914 | Bacteria | 4551896 |
| 1055 | 8056376543 | 8056375014 | Bacteria | 7006639 |
| 1056 | 8056388179 | 8056382006 | Bacteria | 6408074 |
| 1057 | 8057576756 | 8057575449 | Bacteria | 7367519 |
| 1058 | 8057875154 | 8057874678 | Bacteria | 7494653 |
| 1059 | Ga0439432_094448 | |||
| 1060 | JGI24740J21852_10000493 | |||
| 1061 | JGI25155J39150_1000215 | |||
| 1062 | JGI25156J39149_1000491 | |||
| 1063 | JGI25162J39368_1002390 | |||
| 1064 | JGI25162J39368_1002612 | |||
| 1065 | JGI25154J39366_1000407 | |||
| 1066 | JGI25158J39367_1000050 | |||
| 1067 | JGI25158J39367_1000062 | |||
| 1068 | JGI25157J39369_1000515 | |||
| 1069 | JGI25152J39213_1000882 | |||
| 1070 | JGI25152J39213_1001368 | |||
| 1071 | JGI25152J39213_1004354 | |||
| 1072 | JGI25152J39213_1005142 | |||
| 1073 | JGI25152J39213_1010012 | |||
| 1074 | JGI25152J39213_1010021 | |||
| 1075 | JGI25152J39213_1010514 | |||
| 1076 | JGI25150J39212_1000070 | |||
| 1077 | JGI25159J45721_1000220 | |||
| 1078 | JGI25159J45721_1000293 | |||
| 1079 | JGI25151J46595_10000208 | |||
| 1080 | JGI25151J46595_10002724 | |||
| 1081 | JGI25151J46595_10003717 | |||
| 1082 | JGI25151J46595_10061494 | |||
| 1083 | JGI25151J46595_10102587 | |||
| 1084 | JGI25151J46595_10125013 | |||
| 1085 | JGI25165J46597_1002236 | |||
| 1086 | JGI25165J46597_1013291 | |||
| 1087 | JGI25165J46597_1045737 | |||
| 1088 | JGI25153J46596_10005239 | |||
| 1089 | JGI25153J46596_10007174 | |||
| 1090 | JGI25153J46596_10012399 | |||
| 1091 | JGI25153J46596_10017134 | |||
| 1092 | JGI25153J46596_10024079 | |||
| 1093 | JGI25153J46596_10024110 | |||
| 1094 | Ga0006777J48905_1071315 | |||
| 1095 | rootH1_10007619 | |||
| 1096 | rootL2_10144815 | |||
| 1097 | rootH1_10173941 | |||
| 1098 | JGI25160J50197_1000010 | |||
| 1099 | JGI25160J50197_1001320 | |||
| 1100 | JGI25160J50197_1009199 | |||
| 1101 | JGI25161J50226_1000006 | |||
| 1102 | JGI25161J50226_1000055 | |||
| 1103 | JGI25161J50226_1003482 | |||
| 1104 | Ga0006562J51391_1011003 | |||
| 1105 | Ga0006562J51391_1015089 | |||
| 1106 | Ga0006780_1034804 | |||
| 1107 | Ga0055539_1010828 | |||
| 1108 | Ga0055526_1004543 | |||
| 1109 | Ga0055526_1005021 | |||
| 1110 | Ga0055526_1018953 | |||
| 1111 | Ga0055526_1030878 | |||
| 1112 | Ga0055524_1006400 | |||
| 1113 | Ga0055524_1006486 | |||
| 1114 | Ga0055524_1010891 | |||
| 1115 | Ga0055524_1014571 | |||
| 1116 | Ga0055524_1014808 | |||
| 1117 | Ga0055524_1090124 | |||
| 1118 | Ga0055536_1001994 | |||
| 1119 | Ga0055528_1000222 | |||
| 1120 | Ga0055528_1001131 | |||
| 1121 | Ga0055528_1003737 | |||
| 1122 | Ga0055528_1006581 | |||
| 1123 | Ga0055528_1007309 | |||
| 1124 | Ga0055528_1015876 | |||
| 1125 | Ga0055530_10012055 | |||
| 1126 | Ga0055540_1002477 | |||
| 1127 | Ga0055540_1002600 | |||
| 1128 | Ga0055540_1004537 | |||
| 1129 | Ga0055540_1018459 | |||
| 1130 | Ga0055531_10002361 | |||
| 1131 | Ga0058692_1012421 | |||
| 1132 | Ga0058692_1017684 | |||
| 1133 | Ga0055543_1000014 | |||
| 1134 | Ga0055543_1000032 | |||
| 1135 | Ga0055543_1001284 | |||
| 1136 | Ga0058859_11735091 | |||
| 1137 | Ga0065165_1000251 | |||
| 1138 | Ga0065165_1007728 | |||
| 1139 | Ga0065165_1008141 | |||
| 1140 | Ga0065165_1009371 | |||
| 1141 | Ga0065165_1010277 | |||
| 1142 | Ga0065716_1006144 | |||
| 1143 | Ga0070658_11628835 | |||
| 1144 | Ga0070676_11288229 | |||
| 1145 | Ga0070670_102235645 | |||
| 1146 | Ga0070666_10277318 | |||
| 1147 | Ga0070680_100479679 | |||
| 1148 | Ga0070691_10444225 | |||
| 1149 | Ga0070668_100056375 | |||
| 1150 | Ga0070668_101135544 | |||
| 1151 | Ga0070668_101265686 | |||
| 1152 | Ga0070669_100516076 | |||
| 1153 | Ga0070671_100015004 | |||
| 1154 | Ga0070659_100708508 | |||
| 1155 | Ga0070667_100719536 | |||
| 1156 | Ga0070700_100078363 | |||
| 1157 | Ga0070663_100185984 | |||
| 1158 | Ga0070663_100327877 | |||
| 1159 | Ga0070663_100892988 | |||
| 1160 | Ga0070681_10384584 | |||
| 1161 | Ga0070665_100017458 | |||
| 1162 | Ga0070665_100144234 | |||
| 1163 | Ga0070665_101987164 | |||
| 1164 | Ga0068854_101363251 | |||
| 1165 | Ga0068856_100090914 | |||
| 1166 | Ga0068860_100011367 | |||
| 1167 | Ga0068862_100466932 | |||
| 1168 | Ga0068862_101762160 | |||
| 1169 | Ga0081538_10100234 | |||
| 1170 | Ga0075365_10000756 | |||
| 1171 | Ga0075368_10006544 | |||
| 1172 | Ga0075368_10083887 | |||
| 1173 | Ga0075368_10207400 | |||
| 1174 | Ga0075363_100034113 | |||
| 1175 | Ga0075363_100085198 | |||
| 1176 | Ga0075364_10000588 | |||
| 1177 | Ga0075364_10038531 | |||
| 1178 | Ga0075364_10364891 | |||
| 1179 | Ga0075364_10763204 | |||
| 1180 | Ga0075432_10177480 | |||
| 1181 | Ga0070715_10946374 | |||
| 1182 | Ga0070712_100567161 | |||
| 1183 | Ga0075362_10001370 | |||
| 1184 | Ga0075362_10021646 | |||
| 1185 | Ga0075362_10058822 | |||
| 1186 | Ga0075367_10000829 | |||
| 1187 | Ga0075367_10002190 | |||
| 1188 | Ga0075367_10036160 | |||
| 1189 | Ga0075367_10067009 | |||
| 1190 | Ga0075369_10005950 | |||
| 1191 | Ga0075369_10007017 | |||
| 1192 | Ga0075369_10012601 | |||
| 1193 | Ga0075369_10017769 | |||
| 1194 | Ga0075369_10237727 | |||
| 1195 | Ga0075366_10261609 | |||
| 1196 | Ga0075370_10007341 | |||
| 1197 | Ga0075370_10010671 | |||
| 1198 | Ga0075370_10880672 | |||
| 1199 | Ga0075430_100173733 | |||
| 1200 | Ga0075431_100205127 | |||
| 1201 | Ga0075431_100356459 | |||
| 1202 | Ga0068865_102081222 | |||
| 1203 | Ga0099826_10000117 | |||
| 1204 | Ga0099826_10033503 | |||
| 1205 | Ga0105251_10207618 | |||
| 1206 | Ga0105244_10145660 | |||
| 1207 | Ga0105250_10221710 | |||
| 1208 | Ga0105240_10000005 | |||
| 1209 | Ga0111539_10497418 | |||
| 1210 | Ga0105245_10202838 | |||
| 1211 | Ga0105247_10468941 | |||
| 1212 | Ga0114129_11374989 | |||
| 1213 | Ga0105243_10156938 | |||
| 1214 | Ga0105243_11641641 | |||
| 1215 | Ga0105243_11731130 | |||
| 1216 | Ga0105248_10012698 | |||
| 1217 | Ga0105248_11663373 | |||
| 1218 | Ga0105237_10001882 | |||
| 1219 | Ga0105237_11930570 | |||
| 1220 | Ga0105238_10151748 | |||
| 1221 | Ga0123341_1000004 | |||
| 1222 | Ga0123342_1018578 | |||
| 1223 | Ga0123342_1028932 | |||
| 1224 | Ga0105239_10002014 | |||
| 1225 | Ga0105239_10297106 | |||
| 1226 | Ga0105239_11717616 | |||
| 1227 | Ga0105246_11690659 | |||
| 1228 | Ga0157336_1015709 | |||
| 1229 | Ga0157318_1036339 | |||
| 1230 | Ga0157314_1020052 | |||
| 1231 | Ga0157313_1038229 | |||
| 1232 | Ga0157326_1004013 | |||
| 1233 | Ga0157373_10091427 | |||
| 1234 | Ga0157373_10241962 | |||
| 1235 | Ga0157373_10290076 | |||
| 1236 | Ga0157373_11593629 | |||
| 1237 | Ga0157371_10000015 | |||
| 1238 | Ga0157371_10037850 | |||
| 1239 | Ga0157371_10376884 | |||
| 1240 | Ga0157370_10000274 | |||
| 1241 | Ga0157370_10003029 | |||
| 1242 | Ga0157370_10752136 | |||
| 1243 | Ga0157369_11193503 | |||
| 1244 | Ga0157374_10742330 | |||
| 1245 | Ga0157378_10882951 | |||
| 1246 | Ga0157372_10202277 | |||
| 1247 | Ga0157372_10672482 | |||
| 1248 | Ga0157375_10617180 | |||
| 1249 | Ga0157380_10902198 | |||
| 1250 | Ga0182008_10325844 | |||
| 1251 | Ga0157379_10618896 | |||
| 1252 | Ga0157376_11439415 | |||
| 1253 | Ga0182007_10000711 | |||
| 1254 | Ga0163161_10415253 | |||
| 1255 | Ga0163161_10804756 | |||
| 1256 | Ga0206355_1170784 | |||
| 1257 | Ga0206351_10714990 | |||
| 1258 | Ga0206352_10371491 | |||
| 1259 | Ga0224712_10520244 | |||
| 1260 | Ga0209435_100045 | |||
| 1261 | Ga0209436_100001 | |||
| 1262 | Ga0209672_104292 | |||
| 1263 | Ga0209437_100047 | |||
| 1264 | Ga0209437_100683 | |||
| 1265 | Ga0207425_1000024 | |||
| 1266 | Ga0207425_1001992 | |||
| 1267 | Ga0207425_1004152 | |||
| 1268 | Ga0207425_1007729 | |||
| 1269 | Ga0207425_1013642 | |||
| 1270 | Ga0207425_1038892 | |||
| 1271 | Ga0207425_1056240 | |||
| 1272 | Ga0209646_1000154 | |||
| 1273 | Ga0209646_1014143 | |||
| 1274 | Ga0209026_1000177 | |||
| 1275 | Ga0209677_102447 | |||
| 1276 | Ga0209148_1013402 | |||
| 1277 | Ga0209759_1000795 | |||
| 1278 | Ga0209759_1012909 | |||
| 1279 | Ga0209129_1000069 | |||
| 1280 | Ga0209129_1000133 | |||
| 1281 | Ga0209129_1000880 | |||
| 1282 | Ga0209129_1002492 | |||
| 1283 | Ga0209129_1004911 | |||
| 1284 | Ga0209129_1005326 | |||
| 1285 | Ga0209129_1008393 | |||
| 1286 | Ga0209129_1010222 | |||
| 1287 | Ga0209233_1000048 | |||
| 1288 | Ga0209233_1000069 | |||
| 1289 | Ga0209233_1000221 | |||
| 1290 | Ga0209565_1037304 | |||
| 1291 | Ga0209455_1017885 | |||
| 1292 | Ga0209673_1000013 | |||
| 1293 | Ga0209673_1000048 | |||
| 1294 | Ga0209673_1002108 | |||
| 1295 | Ga0209673_1003476 | |||
| 1296 | Ga0209673_1004376 | |||
| 1297 | Ga0209673_1026450 | |||
| 1298 | Ga0209673_1040852 | |||
| 1299 | Ga0209130_1000004 | |||
| 1300 | Ga0209130_1000021 | |||
| 1301 | Ga0209130_1013753 | |||
| 1302 | Ga0209130_1030697 | |||
| 1303 | Ga0209675_1093169 | |||
| 1304 | Ga0209676_1023289 | |||
| 1305 | Ga0209676_1027846 | |||
| 1306 | Ga0209025_1000050 | |||
| 1307 | Ga0209025_1000572 | |||
| 1308 | Ga0209025_1000787 | |||
| 1309 | Ga0209025_1000803 | |||
| 1310 | Ga0209025_1007047 | |||
| 1311 | Ga0209025_1013063 | |||
| 1312 | Ga0209025_1014129 | |||
| 1313 | Ga0209025_1015082 | |||
| 1314 | Ga0209025_1019159 | |||
| 1315 | Ga0209025_1033243 | |||
| 1316 | Ga0209025_1054224 | |||
| 1317 | Ga0209564_1000375 | |||
| 1318 | Ga0209564_1000570 | |||
| 1319 | Ga0209564_1000631 | |||
| 1320 | Ga0209564_1009645 | |||
| 1321 | Ga0209564_1026738 | |||
| 1322 | Ga0209564_1078010 | |||
| 1323 | Ga0209758_1000342 | |||
| 1324 | Ga0209758_1000421 | |||
| 1325 | Ga0209758_1000468 | |||
| 1326 | Ga0209758_1000942 | |||
| 1327 | Ga0209758_1003958 | |||
| 1328 | Ga0209758_1022512 | |||
| 1329 | Ga0209758_1022516 | |||
| 1330 | Ga0209758_1082158 | |||
| 1331 | Ga0209050_1004988 | |||
| 1332 | Ga0209050_1005655 | |||
| 1333 | Ga0209256_1002453 | |||
| 1334 | Ga0209256_1005734 | |||
| 1335 | Ga0209256_1007991 | |||
| 1336 | Ga0209256_1009330 | |||
| 1337 | Ga0209256_1012872 | |||
| 1338 | Ga0209256_1024014 | |||
| 1339 | Ga0209256_1037585 | |||
| 1340 | Ga0209256_1055214 | |||
| 1341 | Ga0209256_1079533 | |||
| 1342 | Ga0207426_1000003 | |||
| 1343 | Ga0207426_1000010 | |||
| 1344 | Ga0207426_1000039 | |||
| 1345 | Ga0207426_1003019 | |||
| 1346 | Ga0209051_1000445 | |||
| 1347 | Ga0209051_1001553 | |||
| 1348 | Ga0209051_1007905 | |||
| 1349 | Ga0209051_1028176 | |||
| 1350 | Ga0209051_1044776 | |||
| 1351 | Ga0209257_1001375 | |||
| 1352 | Ga0209257_1004317 | |||
| 1353 | Ga0209257_1128584 | |||
| 1354 | Ga0207688_10652165 | |||
| 1355 | Ga0207680_10446938 | |||
| 1356 | Ga0207685_10270111 | |||
| 1357 | Ga0207645_10680053 | |||
| 1358 | Ga0207695_10000011 | |||
| 1359 | Ga0207671_10000314 | |||
| 1360 | Ga0207671_11177359 | |||
| 1361 | Ga0207693_10190086 | |||
| 1362 | Ga0207652_10624676 | |||
| 1363 | Ga0207681_10809505 | |||
| 1364 | Ga0207694_10332294 | |||
| 1365 | Ga0207650_10371693 | |||
| 1366 | Ga0207644_10149297 | |||
| 1367 | Ga0207709_10167445 | |||
| 1368 | Ga0207709_10327796 | |||
| 1369 | Ga0207669_11092189 | |||
| 1370 | Ga0207711_10051970 | |||
| 1371 | Ga0207711_11076542 | |||
| 1372 | Ga0207667_11179032 | |||
| 1373 | Ga0207640_10076820 | |||
| 1374 | Ga0207640_10899856 | |||
| 1375 | Ga0207658_11100088 | |||
| 1376 | Ga0207639_10351567 | |||
| 1377 | Ga0207639_11773578 | |||
| 1378 | Ga0207708_10377182 | |||
| 1379 | Ga0207702_10018015 | |||
| 1380 | Ga0207702_10623376 | |||
| 1381 | Ga0207674_11471237 | |||
| 1382 | Ga0207698_11838853 | |||
| 1383 | Ga0209281_1000036 | |||
| 1384 | Ga0209281_1000047 | |||
| 1385 | Ga0209371_1000058 | |||
| 1386 | Ga0209371_1001102 | |||
| 1387 | Ga0209371_1004687 | |||
| 1388 | Ga0209983_1077394 | |||
| 1389 | Ga0209282_1005675 | |||
| 1390 | Ga0209282_1043032 | |||
| 1391 | Ga0209813_10005185 | |||
| 1392 | Ga0209813_10075088 | |||
| 1393 | Ga0209813_10215839 | |||
| 1394 | Ga0268266_10012142 | |||
| 1395 | Ga0268266_10069211 | |||
| 1396 | Ga0268266_10335561 | |||
| 1397 | Ga0268266_10555960 | |||
| 1398 | Ga0268265_12428906 | |||
| 1399 | Ga0268264_10000043 | |||
| 1400 | Ga0307515_10001876 | |||
| 1401 | Ga0307515_10014201 | |||
| 1402 | Ga0307515_10245958 | |||
| 1403 | Ga0268256_1000056 | |||
| 1404 | Ga0268256_1001773 | |||
| 1405 | Ga0268256_1005673 | |||
| 1406 | Ga0316181_1125298 | |||
| 1407 | Ga0307513_10196979 | |||
| 1408 | Ga0307513_10280224 | |||
| 1409 | Ga0307513_10548913 | |||
| 1410 | Ga0307408_100259327 | |||
| 1411 | Ga0307408_100359750 | |||
| 1412 | Ga0307516_10426924 | |||
| 1413 | Ga0307405_10006169 | |||
| 1414 | Ga0307405_10408406 | |||
| 1415 | Ga0307405_10533313 | |||
| 1416 | Ga0307413_10487640 | |||
| 1417 | Ga0307406_10019411 | |||
| 1418 | Ga0307412_10016051 | |||
| 1419 | Ga0307412_10547840 | |||
| 1420 | Ga0373954_0654168 | |||
| 1421 | Ga0373961_0063716 | |||
| 1422 | Ga0373935_0044291 | |||
| 1423 | Ga0373927_0000343 | |||
| 1424 | Ga0373925_0014749 | |||
| 1425 | Ga0395905_0000417 | |||
| 1426 | Ga0395905_0000510 | |||
| 1427 | Ga0395901_0501956 | |||
| 1428 | Ga0436365_0167701 | |||
| 1429 | Ga0439465_0098697 | |||
| 1430 | Ga0451787_171768 | |||
| 1431 | Ga0451793_0417637 | |||
| 1432 | Ga0451797_0850152 | |||
| 1433 | Ga0451800_0211985 | |||
| 1434 | Ga0451807_0109277 | |||
| 1435 | Ga0451807_1324974 | |||
| 1436 | Ga0451835_0475184 | |||
| 1437 | Ga0451839_1012362 | |||
| 1438 | Ga0451840_13150 | |||
| 1439 | Ga0451841_1202596 | |||
| 1440 | Ga0451844_03674 | |||
| 1441 | Ga0451846_28374 | |||
| 1442 | Ga0451848_08569 | |||
| 1443 | Ga0451850_18058 | |||
| 1444 | Ga0451853_3274431 | |||
| 1445 | Ga0452271_92729 | |||
| 1446 | Ga0439449_0004832 | |||
| 1447 | Ga0439449_0100753 | |||
| 1448 | Ga0466982_0542145 | |||
| 1449 | Ga0466963_0058302 | |||
| 1450 | Ga0466964_0118839 | |||
| 1451 | Ga0466971_0150226 | |||
| 1452 | Ga0466970_0036193 | |||
| 1453 | Ga0466970_0749027 | |||
| 1454 | Ga0466958_0054106 | |||
| 1455 | Ga0466967_1154027 | |||
| 1456 | Ga0495617_073869 | |||
| 1457 | Ga0495638_0048331 | |||
| 1458 | Ga0495638_0283936 | |||
| 1459 | Ga0495650_0058946 | |||
| 1460 | Ga0495650_0093122 | |||
| 1461 | Ga0495605_0037945 | |||
| 1462 | Ga0495639_0568203 | |||
| 1463 | Ga0495662_0182778 | |||
| 1464 | Ga0495664_0103760 | |||
| 1465 | Ga0495584_0455354 | |||
| 1466 | Ga0495585_0029057 | |||
| 1467 | Ga0495585_0263498 | |||
| 1468 | Ga0495596_0320417 | |||
| 1469 | Ga0495607_0034222 | |||
| 1470 | Ga0495607_0235991 | |||
| 1471 | Ga0495583_0027440 | |||
| 1472 | Ga0495583_0047898 | |||
| 1473 | Ga0495606_0018841 | |||
| 1474 | Ga0495606_0029226 | |||
| 1475 | Ga0495606_0126085 | |||
| 1476 | Ga0495606_0143390 | |||
| 1477 | Ga0495606_0314364 | |||
| 1478 | Ga0495606_0425710 | |||
| 1479 | Ga0495610_0002799 | |||
| 1480 | Ga0495610_0024025 | |||
| 1481 | Ga0495610_0246889 | |||
| 1482 | Ga0495616_0276015 | |||
| 1483 | Ga0495620_0030263 | |||
| 1484 | Ga0495620_0048016 | |||
| 1485 | Ga0495631_0028888 | |||
| 1486 | Ga0495632_0025395 | |||
| 1487 | Ga0495632_0049563 | |||
| 1488 | Ga0495643_0026643 | |||
| 1489 | Ga0495644_0384914 | |||
| 1490 | Ga0495648_0029022 | |||
| 1491 | Ga0495648_0225586 | |||
| 1492 | Ga0495654_0003447 | |||
| 1493 | Ga0495654_0181021 | |||
| 1494 | Ga0495609_0147674 | |||
| 1495 | Ga0495597_0021952 | |||
| 1496 | Ga0495633_0039287 | |||
| 1497 | Ga0495633_0046888 | |||
| 1498 | Ga0495633_0215281 | |||
| 1499 | Ga0495656_0150641 | |||
| 1500 | Ga0495668_0080050 | |||
| 1501 | Ga0495668_0146539 | |||
| 1502 | Ga0495611_0095296 | |||
| 1503 | Ga0495611_0397597 | |||
| 1504 | Ga0495625_0079872 | |||
| 1505 | Ga0495625_0204041 | |||
| 1506 | Ga0495625_0631884 | |||
| 1507 | Ga0495635_0386798 | |||
| 1508 | Ga0495657_0273909 | |||
| 1509 | Ga0495658_0165201 | |||
| 1510 | Ga0495624_0345888 | |||
| 1511 | Ga0495670_0287765 | |||
| 1512 | Ga0495600_0038572 | |||
| 1513 | Ga0495660_0310840 | |||
| 1514 | Ga0495604_0128323 | |||
| 1515 | Ga0495672_0059475 | |||
| 1516 | Ga0495687_077288 | |||
| 1517 | Ga0495687_119074 | |||
| 1518 | Ga0495687_187095 | |||
| 1519 | Ga0495677_0242670 | |||
| 1520 | Ga0495673_0078133 | |||
| 1521 | Ga0495686_0008883 | |||
| 1522 | Ga0495686_0035922 | |||
| 1523 | Ga0495615_0114001 | |||
| 1524 | Ga0495626_0069218 | |||
| 1525 | Ga0495626_0170621 | |||
| 1526 | Ga0496100_0142389 | |||
| 1527 | Ga0496101_0070666 | |||
| 1528 | Ga0496101_0137302 | |||
| 1529 | Ga0496101_0993593 | |||
| 1530 | Ga0496102_0027835 | |||
| 1531 | Ga0496102_0112678 | |||
| 1532 | Ga0496102_1664484 | |||
| 1533 | Ga0496103_0015173 | |||
| 1534 | Ga0496103_0065750 | |||
| 1535 | Ga0496104_0031444 | |||
| 1536 | Ga0496104_0532155 | |||
| 1537 | Ga0496105_0029755 | |||
| 1538 | Ga0496105_1211455 | |||
| 1539 | Ga0496106_0015087 | |||
| 1540 | Ga0496106_0185807 | |||
| 1541 | Ga0496107_0403196 | |||
| 1542 | Ga0496108_0645419 | |||
| 1543 | Ga0496109_0325330 | |||
| 1544 | Ga0496110_0024182 | |||
| 1545 | Ga0496110_0842715 | |||
| 1546 | Ga0496110_1606830 | |||
| 1547 | Ga0496111_0026685 | |||
| 1548 | Ga0496112_0553383 | |||
| 1549 | Ga0496113_0173809 | |||
| 1550 | Ga0496114_0073568 | |||
| 1551 | Ga0496114_0164122 | |||
| 1552 | Ga0496116_0000061 | |||
| 1553 | Ga0496116_0004401 | |||
| 1554 | Ga0496116_0041972 | |||
| 1555 | Ga0496116_0055113 | |||
| 1556 | Ga0496116_0062085 | |||
| 1557 | Ga0496116_0064173 | |||
| 1558 | Ga0496116_0069160 | |||
| 1559 | Ga0496116_0101931 | |||
| 1560 | Ga0496116_0108716 | |||
| 1561 | Ga0496117_0000002 | |||
| 1562 | Ga0496117_0000641 | |||
| 1563 | Ga0496117_0006730 | |||
| 1564 | Ga0496117_0006987 | |||
| 1565 | Ga0496117_0021873 | |||
| 1566 | Ga0496117_0056403 | |||
| 1567 | Ga0496117_0061750 | |||
| 1568 | Ga0496117_0211518 | |||
| 1569 | Ga0496117_0234842 | |||
| 1570 | Ga0496117_0296638 | |||
| 1571 | Ga0496117_0480762 | |||
| 1572 | Ga0496118_0002328 | |||
| 1573 | Ga0496118_0016547 | |||
| 1574 | Ga0496118_0019839 | |||
| 1575 | Ga0496118_0042034 | |||
| 1576 | Ga0496118_0042441 | |||
| 1577 | Ga0496118_0251438 | |||
| 1578 | Ga0496118_0343264 | |||
| 1579 | Ga0496119_0007704 | |||
| 1580 | Ga0496119_0027725 | |||
| 1581 | Ga0496119_0047978 | |||
| 1582 | Ga0496119_0057430 | |||
| 1583 | Ga0496119_0087635 | |||
| 1584 | Ga0496119_0093957 | |||
| 1585 | Ga0496119_0169431 | |||
| 1586 | Ga0496119_0585806 | |||
| 1587 | Ga0496120_0000951 | |||
| 1588 | Ga0496120_0013700 | |||
| 1589 | Ga0496120_0065222 | |||
| 1590 | Ga0496120_0066629 | |||
| 1591 | Ga0496120_0205188 | |||
| 1592 | Ga0496121_0000003 | |||
| 1593 | Ga0496121_0002428 | |||
| 1594 | Ga0496121_0004370 | |||
| 1595 | Ga0496121_0007053 | |||
| 1596 | Ga0496121_0030273 | |||
| 1597 | Ga0496121_0030540 | |||
| 1598 | Ga0496121_0040901 | |||
| 1599 | Ga0496121_0046259 | |||
| 1600 | Ga0496121_0072004 | |||
| 1601 | Ga0496121_0158703 | |||
| 1602 | Ga0496121_0248902 | |||
| 1603 | Ga0496121_0359104 | |||
| 1604 | Ga0496121_0458325 | |||
| 1605 | Ga0496122_0000001 | |||
| 1606 | Ga0496122_0000025 | |||
| 1607 | Ga0496122_0000399 | |||
| 1608 | Ga0496122_0021330 | |||
| 1609 | Ga0496122_0023670 | |||
| 1610 | Ga0496122_0029101 | |||
| 1611 | Ga0496122_0055166 | |||
| 1612 | Ga0496122_0059954 | |||
| 1613 | Ga0496122_0065628 | |||
| 1614 | Ga0496122_0070910 | |||
| 1615 | Ga0496122_0084824 | |||
| 1616 | Ga0496122_0092119 | |||
| 1617 | Ga0496122_0098138 | |||
| 1618 | Ga0496122_0133209 | |||
| 1619 | Ga0496122_0172476 | |||
| 1620 | Ga0496123_0000001 | |||
| 1621 | Ga0496123_0000032 | |||
| 1622 | Ga0496123_0003753 | |||
| 1623 | Ga0496123_0005051 | |||
| 1624 | Ga0496123_0023077 | |||
| 1625 | Ga0496123_0028615 | |||
| 1626 | Ga0496123_0029510 | |||
| 1627 | Ga0496123_0048891 | |||
| 1628 | Ga0496123_0064479 | |||
| 1629 | Ga0496123_0068749 | |||
| 1630 | Ga0496123_0097691 | |||
| 1631 | Ga0496123_0117681 | |||
| 1632 | Ga0496123_0126523 | |||
| 1633 | Ga0496123_0128170 | |||
| 1634 | Ga0496123_0204942 | |||
| 1635 | Ga0496123_0208749 | |||
| 1636 | Ga0496123_0417845 | |||
| 1637 | Ga0496124_0001375 | |||
| 1638 | Ga0496124_0004615 | |||
| 1639 | Ga0496124_0004859 | |||
| 1640 | Ga0496124_0008172 | |||
| 1641 | Ga0496124_0009560 | |||
| 1642 | Ga0496124_0010738 | |||
| 1643 | Ga0496124_0018921 | |||
| 1644 | Ga0496124_0019034 | |||
| 1645 | Ga0496124_0023319 | |||
| 1646 | Ga0496124_0031603 | |||
| 1647 | Ga0496124_0043530 | |||
| 1648 | Ga0496124_0064727 | |||
| 1649 | Ga0496124_0076994 | |||
| 1650 | Ga0496124_0108934 | |||
| 1651 | Ga0496124_0134555 | |||
| 1652 | Ga0496124_0143902 | |||
| 1653 | Ga0496124_0259680 | |||
| 1654 | Ga0496124_0478127 | |||
| 1655 | Ga0496125_0000155 | |||
| 1656 | Ga0496125_0001650 | |||
| 1657 | Ga0496125_0011951 | |||
| 1658 | Ga0496125_0022579 | |||
| 1659 | Ga0496125_0040552 | |||
| 1660 | Ga0496125_0103805 | |||
| 1661 | Ga0496125_0126493 | |||
| 1662 | Ga0496125_0130507 | |||
| 1663 | Ga0496125_0297465 | |||
| 1664 | Ga0496126_0000081 | |||
| 1665 | Ga0496126_0001055 | |||
| 1666 | Ga0496126_0020861 | |||
| 1667 | Ga0496126_0025790 | |||
| 1668 | Ga0496126_0203486 | |||
| 1669 | Ga0496126_0276402 | |||
| 1670 | Ga0496126_0283981 | |||
| 1671 | Ga0496126_0785365 | |||
| 1672 | Ga0496126_1225144 | |||
| 1673 | Ga0495678_021753 | |||
| 1674 | Ga0495682_0340079 | |||
| 1675 | Ga0501032_0230599 | |||
| 1676 | Ga0501033_0006625 | |||
| 1677 | Ga0501033_0365760 | |||
| 1678 | Ga0501034_0324030 | |||
| 1679 | Ga0501034_0558517 | |||
| 1680 | Ga0501034_0745454 | |||
| 1681 | Ga0501036_0087090 | |||
| 1682 | Ga0501037_0826255 | |||
| 1683 | Ga0501038_0114422 | |||
| 1684 | Ga0501039_0398683 | |||
| 1685 | Ga0501040_0956525 | |||
| 1686 | Ga0501043_0097514 | |||
| 1687 | Ga0501046_0252411 | |||
| 1688 | Ga0501047_0157407 | |||
| 1689 | Ga0501072_0272005 | |||
| 1690 | Ga0501072_0743674 | |||
| 1691 | Ga0501073_0047442 | |||
| 1692 | Ga0501073_0360341 | |||
| 1693 | Ga0501075_1552763 | |||
| 1694 | Ga0501076_0564486 | |||
| 1695 | Ga0501076_0761675 | |||
| 1696 | Ga0501227_080014 | |||
| 1697 | Ga0501080_0618362 | |||
| 1698 | Ga0501083_0056452 | |||
| 1699 | Ga0501083_0232129 | |||
| 1700 | Ga0501241_030522 | |||
| 1701 | Ga0501035_0011205 | |||
| 1702 | Ga0501035_0813170 | |||
| 1703 | Ga0501044_0227271 | |||
| 1704 | Ga0501044_0798699 | |||
| 1705 | nmdc:mga03683_3930_c1 | |||
| 1706 | nmdc:mga03683_40613_c1 | |||
| 1707 | nmdc:mga03683_89964_c1 | |||
| 1708 | nmdc:mga03n38_7216_c1 | |||
| 1709 | nmdc:mga00v17_1054035_c1 | |||
| 1710 | nmdc:mga00v17_1316_c1 | |||
| 1711 | nmdc:mga00v17_40_c1 | |||
| 1712 | nmdc:mga00v17_417329_c1 | |||
| 1713 | nmdc:mga00v17_645713_c1 | |||
| 1714 | nmdc:mga0yw44_39303_c1 | |||
| 1715 | nmdc:mga0yw44_39838_c1 | |||
| 1716 | nmdc:mga0yw44_61756_c1 | |||
| 1717 | nmdc:mga0k408_123477_c1 | |||
| 1718 | nmdc:mga0k408_3552_c1 | |||
| 1719 | nmdc:mga0k408_77389_c1 | |||
| 1720 | nmdc:mga06z11_29591_c1 | |||
| 1721 | nmdc:mga06z11_498651_c1 | |||
| 1722 | nmdc:mga04h51_130513_c1 | |||
| 1723 | nmdc:mga07m45_334060_c1 | |||
| 1724 | nmdc:mga07m45_776269_c1 | |||
| 1725 | nmdc:mga07m45_8386_c1 | |||
| 1726 | nmdc:mga05p37_1299293_c1 | |||
| 1727 | nmdc:mga0qj67_281133_c1 | |||
| 1728 | nmdc:mga06r32_1711525_c1 | |||
| 1729 | nmdc:mga06r32_208537_c1 | |||
| 1730 | nmdc:mga06r32_382246_c1 | |||
| 1731 | nmdc:mga08y16_1256106_c1 | |||
| 1732 | nmdc:mga0sz30_18572_c1 | |||
| 1733 | nmdc:mga0sz30_265_c1 | |||
| 1734 | nmdc:mga0sz30_4566_c1 | |||
| 1735 | nmdc:mga0sz30_95762_c1 | |||
| 1736 | Ga0500610_0047061 | |||
| 1737 | Ga0500643_024841 | |||
| 1738 | Ga0500643_025791 | |||
| 1739 | Ga0500644_0002689 | |||
| 1740 | Ga0500557_014583 | |||
| 1741 | Ga0500560_059980 | |||
| 1742 | Ga0500569_000941 | |||
| 1743 | Ga0500569_007733 | |||
| 1744 | Ga0500572_033612 | |||
| 1745 | Ga0500594_0012885 | |||
| 1746 | Ga0500607_293124 | |||
| 1747 | Ga0500608_017344 | |||
| 1748 | Ga0500608_081168 | |||
| 1749 | Ga0500618_000190 | |||
| 1750 | Ga0500618_000619 | |||
| 1751 | Ga0500618_009408 | |||
| 1752 | Ga0500618_024796 | |||
| 1753 | Ga0500618_034710 | |||
| 1754 | Ga0500642_0209384 | |||
| 1755 | Ga0500658_0000262 | |||
| 1756 | Ga0500658_0023929 | |||
| 1757 | Ga0500559_0014361 | |||
| 1758 | Ga0500561_0000314 | |||
| 1759 | Ga0500568_0007314 | |||
| 1760 | Ga0500568_0023435 | |||
| 1761 | Ga0500573_0010605 | |||
| 1762 | Ga0500590_099708 | |||
| 1763 | Ga0500604_0066786 | |||
| 1764 | Ga0500616_0021838 | |||
| 1765 | Ga0500616_0034244 | |||
| 1766 | Ga0500616_0110437 | |||
| 1767 | Ga0500622_0000830 | |||
| 1768 | Ga0500622_0007788 | |||
| 1769 | Ga0500622_0217992 | |||
| 1770 | Ga0500624_000222 | |||
| 1771 | Ga0500624_022504 | |||
| 1772 | Ga0500627_0119307 | |||
| 1773 | Ga0500627_0181906 | |||
| 1774 | Ga0500627_0260482 | |||
| 1775 | Ga0500633_0272638 | |||
| 1776 | Ga0500634_0009966 | |||
| 1777 | Ga0500634_0304943 | |||
| 1778 | Ga0500636_0000115 | |||
| 1779 | Ga0500636_0002063 | |||
| 1780 | Ga0500565_026180 | |||
| 1781 | Ga0501084_0667713 | |||
| 1782 | Ga0587084_073933 | |||
| 1783 | Ga0587066_063503 | |||
| 1784 | Ga0587066_088296 | |||
| 1785 | Ga0587073_0100797 | |||
| 1786 | Ga0587073_0194053 | |||
| 1787 | Ga0587077_073191 | |||
| 1788 | Ga0587083_0222556 | |||
| 1789 | Ga0587088_020713 | |||
| 1790 | Ga0587088_167536 | |||
| 1791 | Ga0587090_000175 | |||
| 1792 | Ga0587091_007538 | |||
| 1793 | Ga0587091_039285 | |||
| 1794 | Ga0587094_056360 | |||
| 1795 | Ga0587106_041200 | |||
| 1796 | Ga0587128_031127 | |||
| 1797 | Ga0587067_067651 | |||
| 1798 | Ga0587072_044684 | |||
| 1799 | Ga0587072_062511 | |||
| 1800 | Ga0587075_088827 | |||
| 1801 | Ga0587076_094276 | |||
| 1802 | Ga0587076_169313 | |||
| 1803 | Ga0587102_044756 | |||
| 1804 | Ga0587107_029483 | |||
| 1805 | Ga0587071_078413 | |||
| 1806 | Ga0501082_0926653 | |||
| 1807 | Ga0530510_1006086 | |||
| 1808 | 2509386762 | |||
| 1809 | 2509443167 | |||
| 1810 | 2510133233 | |||
| 1811 | 2510843478 | |||
| 1812 | 2510894599 | |||
| 1813 | 2511135038 | |||
| 1814 | 2511168728 | |||
| 1815 | 2511182346 | |||
| 1816 | 2511200010 | |||
| 1817 | 2513572291 | |||
| 1818 | 2513579647 | |||
| 1819 | 2513594511 | |||
| 1820 | 2513634414 | |||
| 1821 | 2513708812 | |||
| 1822 | 2513864569 | |||
| 1823 | 2513913101 | |||
| 1824 | 2513926320 | |||
| 1825 | 2514021548 | |||
| 1826 | 2515112189 | |||
| 1827 | 2515637258 | |||
| 1828 | 2515639693 | |||
| 1829 | 2515657337 | |||
| 1830 | 2515738658 | |||
| 1831 | 2517035921 | |||
| 1832 | 2517076317 | |||
| 1833 | 2517095073 | |||
| 1834 | 2517406705 | |||
| 1835 | 2520379337 | |||
| 1836 | 2524460354 | |||
| 1837 | 2530645448 | |||
| 1838 | 2535516424 | |||
| 1839 | 2554247982 | |||
| 1840 | 2559295100 | |||
| 1841 | 2561466451 | |||
| 1842 | 2585200090 | |||
| 1843 | 2585224270 | |||
| 1844 | 2585232822 | |||
| 1845 | 2585254679 | |||
| 1846 | 2585270777 | |||
| 1847 | 2585277129 | |||
| 1848 | 2585323862 | |||
| 1849 | 2585331840 | |||
| 1850 | 2585401937 | |||
| 1851 | 2585527560 | |||
| 1852 | 2585534135 | |||
| 1853 | 2585537456 | |||
| 1854 | 2585546391 | |||
| 1855 | 2585552013 | |||
| 1856 | 2585558500 | |||
| 1857 | 2585821722 | |||
| 1858 | 2585835412 | |||
| 1859 | 2585846664 | |||
| 1860 | 2585897867 | |||
| 1861 | 2585904530 | |||
| 1862 | 2585995829 | |||
| 1863 | 2586000392 | |||
| 1864 | 2587980354 | |||
| 1865 | 2599417799 | |||
| 1866 | 2599601412 | |||
| 1867 | 2599721458 | |||
| 1868 | 2600374583 | |||
| 1869 | 2601612038 | |||
| 1870 | 2601749178 | |||
| 1871 | 2616292548 | |||
| 1872 | 2616308506 | |||
| 1873 | 2616557191 | |||
| 1874 | 2617385677 | |||
| 1875 | 2643811785 | |||
| 1876 | 2643854519 | |||
| 1877 | 2643919511 | |||
| 1878 | 2644003696 | |||
| 1879 | 2644192846 | |||
| 1880 | 2644239509 | |||
| 1881 | 2644300257 | |||
| 1882 | 2644520256 | |||
| 1883 | 2644658483 | |||
| 1884 | 2671111790 | |||
| 1885 | 2719181093 | |||
| 1886 | 2719385707 | |||
| 1887 | 2719665526 | |||
| 1888 | 2719731842 | |||
| 1889 | 2720491946 | |||
| 1890 | 2720613213 | |||
| 1891 | 2720620088 | |||
| 1892 | 2720631513 | |||
| 1893 | 2720775241 | |||
| 1894 | 2721147187 | |||
| 1895 | 2721158719 | |||
| 1896 | 2721164105 | |||
| 1897 | 2721399487 | |||
| 1898 | 2722840275 | |||
| 1899 | 2723026858 | |||
| 1900 | 2723560475 | |||
| 1901 | 2723567060 | |||
| 1902 | 2724038300 | |||
| 1903 | 2724044598 | |||
| 1904 | 2724089848 | |||
| 1905 | 2724104325 | |||
| 1906 | 2724110120 | |||
| 1907 | 2730107794 | |||
| 1908 | 2730164330 | |||
| 1909 | 2730298351 | |||
| 1910 | 2738801985 | |||
| 1911 | 2738946138 | |||
| 1912 | 2739036423 | |||
| 1913 | 2766063088 | |||
| 1914 | 2776913615 | |||
| 1915 | 2778173943 | |||
| 1916 | 2793294591 | |||
| 1917 | 2793312163 | |||
| 1918 | 2793322107 | |||
| 1919 | 2793326587 | |||
| 1920 | 2793335813 | |||
| 1921 | 2793341441 | |||
| 1922 | 2793349166 | |||
| 1923 | 2793356710 | |||
| 1924 | 2793361249 | |||
| 1925 | 2793369337 | |||
| 1926 | 2805925627 | |||
| 1927 | 2805933653 | |||
| 1928 | 2806045973 | |||
| 1929 | 2806054353 | |||
| 1930 | 2806060358 | |||
| 1931 | 2806065186 | |||
| 1932 | 2806072453 | |||
| 1933 | 2808985186 | |||
| 1934 | 2819242125 | |||
| 1935 | 2819559618 | |||
| 1936 | 2819612910 | |||
| 1937 | 2819637983 | |||
| 1938 | 2819687243 | |||
| 1939 | 2821127957 | |||
| 1940 | 2838020994 | |||
| 1941 | 2838029023 | |||
| 1942 | 2838030169 | |||
| 1943 | 2838037985 | |||
| 1944 | 2838043345 | |||
| 1945 | 2838052506 | |||
| 1946 | 2838066031 | |||
| 1947 | 2838073505 | |||
| 1948 | 2838667304 | |||
| 1949 | 2838672109 | |||
| 1950 | 2838676046 | |||
| 1951 | 2838682308 | |||
| 1952 | 2838689411 | |||
| 1953 | 2838696879 | |||
| 1954 | 2838704611 | |||
| 1955 | 2838709880 | |||
| 1956 | 2838714928 | |||
| 1957 | 2838721271 | |||
| 1958 | 2838725688 | |||
| 1959 | 2838730744 | |||
| 1960 | 2838738369 | |||
| 1961 | 2838743685 | |||
| 1962 | 2841841262 | |||
| 1963 | 2841848237 | |||
| 1964 | 2841857761 | |||
| 1965 | 2841859218 | |||
| 1966 | 2841864642 | |||
| 1967 | 2842078054 | |||
| 1968 | 2842110583 | |||
| 1969 | 2842119437 | |||
| 1970 | 2842125733 | |||
| 1971 | 2842130941 | |||
| 1972 | 2842141040 | |||
| 1973 | 2842148649 | |||
| 1974 | 2842153889 | |||
| 1975 | 2842157502 | |||
| 1976 | 2842164694 | |||
| 1977 | 2842171172 | |||
| 1978 | 2842177509 | |||
| 1979 | 2842180913 | |||
| 1980 | 2842188037 | |||
| 1981 | 2842194590 | |||
| 1982 | 2842205202 | |||
| 1983 | 2842206117 | |||
| 1984 | 2842212348 | |||
| 1985 | 2842217143 | |||
| 1986 | 2842226033 | |||
| 1987 | 2842231028 | |||
| 1988 | 2842239293 | |||
| 1989 | 2842244864 | |||
| 1990 | 2842254291 | |||
| 1991 | 2842258677 | |||
| 1992 | 2842268193 | |||
| 1993 | 2842273431 | |||
| 1994 | 2842279574 | |||
| 1995 | 2842286215 | |||
| 1996 | 2842291717 | |||
| 1997 | 2842302119 | |||
| 1998 | 2842304208 | |||
| 1999 | 2842313831 | |||
| 2000 | 2842317988 | |||
| 2001 | 2842345921 | |||
| 2002 | 2842357414 | |||
| 2003 | 2842364451 | |||
| 2004 | 2842372874 | |||
| 2005 | 2842378113 | |||
| 2006 | 2842385946 | |||
| 2007 | 2842397582 | |||
| 2008 | 2842403582 | |||
| 2009 | 2842409045 | |||
| 2010 | 2842415699 | |||
| 2011 | 2842427989 | |||
| 2012 | 2842431572 | |||
| 2013 | 2842438468 | |||
| 2014 | 2842445098 | |||
| 2015 | 2842452416 | |||
| 2016 | 2842465944 | |||
| 2017 | 2842473083 | |||
| 2018 | 2842476546 | |||
| 2019 | 2842484911 | |||
| 2020 | 2842489945 | |||
| 2021 | 2842496258 | |||
| 2022 | 2842503697 | |||
| 2023 | 2842515214 | |||
| 2024 | 2842516002 | |||
| 2025 | 2844459248 | |||
| 2026 | 2852389819 | |||
| 2027 | 2854899479 | |||
| 2028 | 2854918301 | |||
| 2029 | 2857518633 | |||
| 2030 | 2857534999 | |||
| 2031 | 2891374402 | |||
| 2032 | 2899793998 | |||
| 2033 | 2899807582 | |||
| 2034 | 2899846395 | |||
| 2035 | 2913311277 | |||
| 2036 | 2919106993 | |||
| 2037 | 2919115018 | |||
| 2038 | 2919168857 | |||
| 2039 | 2919175164 | |||
| 2040 | 2919411763 | |||
| 2041 | 2923557855 | |||
| 2042 | 2926755983 | |||
| 2043 | 2926763080 | |||
| 2044 | 2929140501 | |||
| 2045 | 2933008535 | |||
| 2046 | 2933013352 | |||
| 2047 | 2933021109 | |||
| 2048 | 2933571485 | |||
| 2049 | 2933586611 | |||
| 2050 | 2933596873 | |||
| 2051 | 2933604013 | |||
| 2052 | 2935897265 | |||
| 2053 | 2935904657 | |||
| 2054 | 2936385060 | |||
| 2055 | 2978971544 | |||
| 2056 | 2979094426 | |||
| 2057 | 2979098191 | |||
| 2058 | 2979103666 | |||
| 2059 | 2984511770 | |||
| 2060 | 2984521870 | |||
| 2061 | 2984541168 | |||
| 2062 | 2984588689 | |||
| 2063 | 2984603448 | |||
| 2064 | 2989353294 | |||
| 2065 | 2989778596 | |||
| 2066 | 2996891626 | |||
| 2067 | 2996898231 | |||
| 2068 | 3003933597 | |||
| 2069 | 3005415223 | |||
| 2070 | 3005420179 | |||
| 2071 | 3005447434 | |||
| 2072 | 3005454144 | |||
| 2073 | 639648453 | |||
| 2074 | 650740303 | |||
| 2075 | 8003571354 | |||
| 2076 | 8005250907 | |||
| 2077 | 8005262956 | |||
| 2078 | 8005280484 | |||
| 2079 | 8005283102 | |||
| 2080 | 8005290337 | |||
| 2081 | 8005302470 | |||
| 2082 | 8005314448 | |||
| 2083 | 8005317130 | |||
| 2084 | 8005326153 | |||
| 2085 | 8005379114 | |||
| 2086 | 8005388246 | |||
| 2087 | 8005397228 | |||
| 2088 | 8005432051 | |||
| 2089 | 8005462851 | |||
| 2090 | 8005485071 | |||
| 2091 | 8005500250 | |||
| 2092 | 8005545072 | |||
| 2093 | 8005557805 | |||
| 2094 | 8005568978 | |||
| 2095 | 8005574790 | |||
| 2096 | 8005621624 | |||
| 2097 | 8005626445 | |||
| 2098 | 8005648806 | |||
| 2099 | 8005659530 | |||
| 2100 | 8005671666 | |||
| 2101 | 8005683265 | |||
| 2102 | 8005694483 | |||
| 2103 | 8005700110 | |||
| 2104 | 8018129824 | |||
| 2105 | 8018166890 | |||
| 2106 | 8018179923 | |||
| 2107 | 8023685476 | |||
| 2108 | 8024492332 | |||
| 2109 | 8024506678 | |||
| 2110 | 8046773868 | |||
| 2111 | 8054462889 | |||
| 2112 | 8055435090 | |||
| 2113 | 8056376543 | |||
| 2114 | 8056388179 | |||
| 2115 | 8057576756 | |||
| 2116 | 8057875154 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.877 | 1 | 99 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8629 | 6 | 99 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8236 | 6 | 99 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.816 | 6 | 101 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.806 | 1 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8962 | 6 | 99 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8779 | 6 | 99 | 2.60.300.12 |
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8621 | 6 | 89 | 2.60.300.12 |
| af_I3ITR1_24_129_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8356 | 6 | 108 | 2.60.300.12 |
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8254 | 6 | 89 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537URB9-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.923 | 5 | 96 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A6N8UQF9-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.908 | 7 | 98 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A2P1P872-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.9034 | 1 | 108 |
GO:0005737
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A2E8KEE8-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.8975 | 2 | 94 |
GO:0005506
GO:0005829 GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A4Q3NPK0-F1-model_v4 | deleted | 0.8867 | 6 | 97 |
|