F489239
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1058 | 443 | 2116 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0053029|Ga0496109_0053029_429_1034 |
| Length | 201 |
| Sequence | MQKWLRSLPLEPVEVNLGMPYTVTRTAIPDVLVLEPKVFGDARGFFFESFNARNFREVTGLNVDFVQDNHSKSAKGVLRGLHYQIQNPQGKLVHVVQGAVFDVAVDLRKSSPTFGQWVGHVLDAENHKQLWIPPGFAHGFVVLSESAEFLYKTTDYWYPEHERSLLWNDPTVAVAWPIDFAPQLAAKDAAGKLFGEAETFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 247 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 372 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 373 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 374 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 375 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 376 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 377 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 378 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 379 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 380 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 400 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 401 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 402 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 403 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 404 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 405 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 406 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 407 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 408 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 409 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 410 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 411 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 412 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 413 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 414 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 415 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 416 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 417 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 418 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 419 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 420 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 421 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 422 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 423 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 424 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 425 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 426 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 427 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 428 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 429 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 430 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 431 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 432 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 433 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 434 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 435 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 436 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 437 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 438 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 439 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 440 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 441 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 442 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 443 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.09 |
| Metatranscriptomes | 0.66 |
| Isolates | 4.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.25 |
| Nodule | 1.13 |
| Rhizoplane | 3.5 |
| Rhizosphere | 85.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0053029 | 3300048912 | Bacteria | 3698 |
| 2 | JGI24739J22299_10001077 | 3300001989 | Bacteria | 10168 |
| 3 | JGI24748J21848_1018955 | 3300002074 | Bacteria | 826 |
| 4 | JGI25156J39149_1001449 | 3300002705 | Bacteria | 10068 |
| 5 | JGI25159J45721_1007464 | 3300002987 | Bacteria | 3131 |
| 6 | rootL2_10093023 | 3300003322 | Bacteria | 6762 |
| 7 | rootL2_10280545 | 3300003322 | Bacteria | 1971 |
| 8 | JGI25161J50226_1000115 | 3300003374 | Bacteria | 62500 |
| 9 | Ga0055533_1000948 | 3300003756 | Bacteria | 8561 |
| 10 | Ga0055533_1003019 | 3300003756 | Bacteria | 3583 |
| 11 | Ga0055532_1000401 | 3300003758 | Bacteria | 21502 |
| 12 | Ga0055525_1000246 | 3300003759 | Bacteria | 54885 |
| 13 | Ga0055527_1000430 | 3300003760 | Bacteria | 16963 |
| 14 | Ga0055527_1000691 | 3300003760 | Bacteria | 9798 |
| 15 | Ga0055535_1000857 | 3300003761 | Bacteria | 21511 |
| 16 | Ga0055542_1000846 | 3300003762 | Bacteria | 21511 |
| 17 | Ga0055542_1001567 | 3300003762 | Bacteria | 10713 |
| 18 | Ga0055529_1000614 | 3300003763 | Bacteria | 26846 |
| 19 | Ga0055528_1006287 | 3300003790 | Bacteria | 5403 |
| 20 | Ga0055541_1001121 | 3300003841 | Bacteria | 6032 |
| 21 | Ga0055541_1006047 | 3300003841 | Bacteria | 2082 |
| 22 | Ga0055543_1000094 | 3300004625 | Bacteria | 78040 |
| 23 | Ga0065165_1000434 | 3300005262 | Bacteria | 65848 |
| 24 | Ga0070658_10033009 | 3300005327 | Bacteria | 4163 |
| 25 | Ga0070658_10056675 | 3300005327 | Bacteria | 3186 |
| 26 | Ga0070658_10207871 | 3300005327 | Bacteria | 1653 |
| 27 | Ga0070658_10237583 | 3300005327 | Bacteria | 1544 |
| 28 | Ga0070658_10853105 | 3300005327 | Bacteria | 792 |
| 29 | Ga0070676_10000300 | 3300005328 | Bacteria | 22179 |
| 30 | Ga0070676_10022641 | 3300005328 | Bacteria | 3526 |
| 31 | Ga0070676_10058870 | 3300005328 | Bacteria | 2278 |
| 32 | Ga0070676_10194777 | 3300005328 | Bacteria | 1325 |
| 33 | Ga0070676_10314199 | 3300005328 | Bacteria | 1066 |
| 34 | Ga0070683_100040268 | 3300005329 | Bacteria | 4295 |
| 35 | Ga0070683_100064940 | 3300005329 | Bacteria | 3398 |
| 36 | Ga0070683_100737784 | 3300005329 | Bacteria | 944 |
| 37 | Ga0070690_100001976 | 3300005330 | Bacteria | 10925 |
| 38 | Ga0070670_100000010 | 3300005331 | Bacteria | 277365 |
| 39 | Ga0070670_100197473 | 3300005331 | Bacteria | 1748 |
| 40 | Ga0070677_10000444 | 3300005333 | Bacteria | 14135 |
| 41 | Ga0068869_100019562 | 3300005334 | Bacteria | 4629 |
| 42 | Ga0068869_100030702 | 3300005334 | Bacteria | 3775 |
| 43 | Ga0070666_10000386 | 3300005335 | Bacteria | 27689 |
| 44 | Ga0070666_10061649 | 3300005335 | Bacteria | 2540 |
| 45 | Ga0070680_100614545 | 3300005336 | Bacteria | 933 |
| 46 | Ga0068868_100035991 | 3300005338 | Bacteria | 3829 |
| 47 | Ga0068868_100085789 | 3300005338 | Bacteria | 2530 |
| 48 | Ga0070660_100001619 | 3300005339 | Bacteria | 15487 |
| 49 | Ga0070660_100048057 | 3300005339 | Bacteria | 3276 |
| 50 | Ga0070660_100056007 | 3300005339 | Bacteria | 3049 |
| 51 | Ga0070660_100071737 | 3300005339 | Bacteria | 2704 |
| 52 | Ga0070660_100148020 | 3300005339 | Bacteria | 1887 |
| 53 | Ga0070660_100164209 | 3300005339 | Bacteria | 1791 |
| 54 | Ga0070660_100400821 | 3300005339 | Bacteria | 1134 |
| 55 | Ga0070660_100657266 | 3300005339 | Bacteria | 878 |
| 56 | Ga0070689_100002818 | 3300005340 | Bacteria | 11428 |
| 57 | Ga0070661_100048416 | 3300005344 | Bacteria | 3111 |
| 58 | Ga0070661_100058648 | 3300005344 | Bacteria | 2821 |
| 59 | Ga0070661_100179454 | 3300005344 | Bacteria | 1610 |
| 60 | Ga0070668_100004602 | 3300005347 | Bacteria | 10215 |
| 61 | Ga0070668_100328085 | 3300005347 | Bacteria | 1290 |
| 62 | Ga0070669_100025920 | 3300005353 | Bacteria | 4216 |
| 63 | Ga0070675_100000235 | 3300005354 | Bacteria | 35666 |
| 64 | Ga0070671_100014294 | 3300005355 | Bacteria | 6410 |
| 65 | Ga0070671_100025124 | 3300005355 | Bacteria | 4884 |
| 66 | Ga0070671_100055767 | 3300005355 | Bacteria | 3287 |
| 67 | Ga0070671_100181930 | 3300005355 | Bacteria | 1780 |
| 68 | Ga0070674_100012603 | 3300005356 | Bacteria | 5196 |
| 69 | Ga0070673_100002777 | 3300005364 | Bacteria | 10764 |
| 70 | Ga0070673_100026921 | 3300005364 | Bacteria | 4255 |
| 71 | Ga0070673_100096546 | 3300005364 | Bacteria | 2426 |
| 72 | Ga0070673_100633665 | 3300005364 | Bacteria | 977 |
| 73 | Ga0070688_100000391 | 3300005365 | Bacteria | 22192 |
| 74 | Ga0070688_100003549 | 3300005365 | Bacteria | 8039 |
| 75 | Ga0070659_100007308 | 3300005366 | Bacteria | 8020 |
| 76 | Ga0070659_100074498 | 3300005366 | Bacteria | 2704 |
| 77 | Ga0070659_100117753 | 3300005366 | Bacteria | 2148 |
| 78 | Ga0070659_100146558 | 3300005366 | Bacteria | 1924 |
| 79 | Ga0070659_100719131 | 3300005366 | Bacteria | 864 |
| 80 | Ga0070659_101223010 | 3300005366 | Bacteria | 665 |
| 81 | Ga0070659_101251122 | 3300005366 | Bacteria | 657 |
| 82 | Ga0070667_100000124 | 3300005367 | Bacteria | 98412 |
| 83 | Ga0070667_100012546 | 3300005367 | Bacteria | 7008 |
| 84 | Ga0070667_100041759 | 3300005367 | Bacteria | 3847 |
| 85 | Ga0070667_100541931 | 3300005367 | Bacteria | 1069 |
| 86 | Ga0070709_10174418 | 3300005434 | Bacteria | 1505 |
| 87 | Ga0070709_10376687 | 3300005434 | Bacteria | 1054 |
| 88 | Ga0070709_10390742 | 3300005434 | Bacteria | 1037 |
| 89 | Ga0070714_100024730 | 3300005435 | Bacteria | 4949 |
| 90 | Ga0070714_100036938 | 3300005435 | Bacteria | 4101 |
| 91 | Ga0070714_100066890 | 3300005435 | Bacteria | 3097 |
| 92 | Ga0070714_100083062 | 3300005435 | Bacteria | 2792 |
| 93 | Ga0070714_100415863 | 3300005435 | Bacteria | 1273 |
| 94 | Ga0070713_100000093 | 3300005436 | Bacteria | 57164 |
| 95 | Ga0070713_100016492 | 3300005436 | Bacteria | 5555 |
| 96 | Ga0070713_100026608 | 3300005436 | Bacteria | 4544 |
| 97 | Ga0070710_10019044 | 3300005437 | Bacteria | 3542 |
| 98 | Ga0070710_10179433 | 3300005437 | Bacteria | 1325 |
| 99 | Ga0070701_10263751 | 3300005438 | Bacteria | 1045 |
| 100 | Ga0070711_100014795 | 3300005439 | Bacteria | 4925 |
| 101 | Ga0070711_101305880 | 3300005439 | Bacteria | 630 |
| 102 | Ga0070705_100079533 | 3300005440 | Bacteria | 2008 |
| 103 | Ga0070705_100385271 | 3300005440 | Bacteria | 1033 |
| 104 | Ga0070694_100580750 | 3300005444 | Bacteria | 900 |
| 105 | Ga0070708_100122003 | 3300005445 | Bacteria | 2405 |
| 106 | Ga0070663_100000499 | 3300005455 | Bacteria | 20724 |
| 107 | Ga0070663_100001362 | 3300005455 | Bacteria | 13368 |
| 108 | Ga0070663_100006870 | 3300005455 | Bacteria | 6888 |
| 109 | Ga0070663_100360129 | 3300005455 | Bacteria | 1180 |
| 110 | Ga0070678_100003783 | 3300005456 | Bacteria | 8486 |
| 111 | Ga0070662_100793296 | 3300005457 | Bacteria | 805 |
| 112 | Ga0070681_10288673 | 3300005458 | Bacteria | 1551 |
| 113 | Ga0068867_100003026 | 3300005459 | Bacteria | 11854 |
| 114 | Ga0070685_10000001 | 3300005466 | Bacteria | 349867 |
| 115 | Ga0070685_10001033 | 3300005466 | Bacteria | 14936 |
| 116 | Ga0070685_10609338 | 3300005466 | Bacteria | 787 |
| 117 | Ga0070706_100038366 | 3300005467 | Bacteria | 4420 |
| 118 | Ga0070707_100506148 | 3300005468 | Bacteria | 1169 |
| 119 | Ga0070698_100392462 | 3300005471 | Bacteria | 1321 |
| 120 | Ga0070699_100826473 | 3300005518 | Bacteria | 848 |
| 121 | Ga0070679_100041918 | 3300005530 | Bacteria | 4557 |
| 122 | Ga0070679_100216812 | 3300005530 | Bacteria | 1876 |
| 123 | Ga0070679_100228132 | 3300005530 | Bacteria | 1822 |
| 124 | Ga0070679_100255006 | 3300005530 | Bacteria | 1710 |
| 125 | Ga0070679_100308184 | 3300005530 | Bacteria | 1533 |
| 126 | Ga0070679_100359158 | 3300005530 | Bacteria | 1404 |
| 127 | Ga0070684_100045274 | 3300005535 | Bacteria | 3810 |
| 128 | Ga0070684_100121421 | 3300005535 | Bacteria | 2350 |
| 129 | Ga0070684_100369854 | 3300005535 | Bacteria | 1320 |
| 130 | Ga0068853_100005939 | 3300005539 | Bacteria | 9642 |
| 131 | Ga0068853_100212328 | 3300005539 | Bacteria | 1764 |
| 132 | Ga0068853_100330016 | 3300005539 | Bacteria | 1415 |
| 133 | Ga0070672_100004095 | 3300005543 | Bacteria | 9522 |
| 134 | Ga0070672_100024487 | 3300005543 | Bacteria | 4463 |
| 135 | Ga0070672_100167064 | 3300005543 | Bacteria | 1828 |
| 136 | Ga0070672_100214528 | 3300005543 | Bacteria | 1613 |
| 137 | Ga0070686_100392589 | 3300005544 | Unclassified | 1053 |
| 138 | Ga0070686_100445155 | 3300005544 | Bacteria | 995 |
| 139 | Ga0070696_100842715 | 3300005546 | Bacteria | 757 |
| 140 | Ga0070693_100011666 | 3300005547 | Bacteria | 4430 |
| 141 | Ga0070665_100003582 | 3300005548 | Bacteria | 16453 |
| 142 | Ga0070665_100008038 | 3300005548 | Bacteria | 10684 |
| 143 | Ga0070665_100016415 | 3300005548 | Bacteria | 7424 |
| 144 | Ga0068855_100000446 | 3300005563 | Bacteria | 51081 |
| 145 | Ga0068855_100078780 | 3300005563 | Bacteria | 3822 |
| 146 | Ga0068855_100277610 | 3300005563 | Bacteria | 1862 |
| 147 | Ga0068855_100427769 | 3300005563 | Bacteria | 1447 |
| 148 | Ga0068855_100481728 | 3300005563 | Bacteria | 1350 |
| 149 | Ga0068855_100871235 | 3300005563 | Bacteria | 953 |
| 150 | Ga0070664_100034625 | 3300005564 | Bacteria | 4236 |
| 151 | Ga0070664_100046725 | 3300005564 | Bacteria | 3657 |
| 152 | Ga0070664_100175803 | 3300005564 | Bacteria | 1901 |
| 153 | Ga0070664_100540038 | 3300005564 | Bacteria | 1077 |
| 154 | Ga0068854_100067432 | 3300005578 | Bacteria | 2607 |
| 155 | Ga0068854_100193913 | 3300005578 | Bacteria | 1593 |
| 156 | Ga0068854_100363625 | 3300005578 | Bacteria | 1188 |
| 157 | Ga0068854_100858646 | 3300005578 | Bacteria | 795 |
| 158 | Ga0068856_100064505 | 3300005614 | Bacteria | 3619 |
| 159 | Ga0070702_100207958 | 3300005615 | Bacteria | 1300 |
| 160 | Ga0068852_100000557 | 3300005616 | Bacteria | 24514 |
| 161 | Ga0068852_100005163 | 3300005616 | Bacteria | 9310 |
| 162 | Ga0068852_100012738 | 3300005616 | Bacteria | 6402 |
| 163 | Ga0068852_100022774 | 3300005616 | Bacteria | 5030 |
| 164 | Ga0068852_100173074 | 3300005616 | Bacteria | 2025 |
| 165 | Ga0068852_100183393 | 3300005616 | Bacteria | 1970 |
| 166 | Ga0068852_100277326 | 3300005616 | Bacteria | 1615 |
| 167 | Ga0068852_100391862 | 3300005616 | Bacteria | 1364 |
| 168 | Ga0068852_101415146 | 3300005616 | Bacteria | 717 |
| 169 | Ga0068859_100056556 | 3300005617 | Bacteria | 3949 |
| 170 | Ga0068859_100063075 | 3300005617 | Bacteria | 3736 |
| 171 | Ga0068859_100202306 | 3300005617 | Bacteria | 2071 |
| 172 | Ga0068864_100000018 | 3300005618 | Bacteria | 277365 |
| 173 | Ga0068864_100001480 | 3300005618 | Bacteria | 19352 |
| 174 | Ga0068861_100406726 | 3300005719 | Bacteria | 1209 |
| 175 | Ga0068861_100929172 | 3300005719 | Bacteria | 826 |
| 176 | Ga0068861_100998374 | 3300005719 | Bacteria | 799 |
| 177 | Ga0068851_10002512 | 3300005834 | Bacteria | 8064 |
| 178 | Ga0068851_10003593 | 3300005834 | Bacteria | 6914 |
| 179 | Ga0068851_10021814 | 3300005834 | Bacteria | 3112 |
| 180 | Ga0068851_10177868 | 3300005834 | Bacteria | 1177 |
| 181 | Ga0068870_10011536 | 3300005840 | Bacteria | 4100 |
| 182 | Ga0068870_10074022 | 3300005840 | Bacteria | 1865 |
| 183 | Ga0068863_100008456 | 3300005841 | Bacteria | 10052 |
| 184 | Ga0068863_100125206 | 3300005841 | Bacteria | 2451 |
| 185 | Ga0068863_101022489 | 3300005841 | Bacteria | 829 |
| 186 | Ga0068858_100009965 | 3300005842 | Bacteria | 9024 |
| 187 | Ga0068858_100223217 | 3300005842 | Bacteria | 1785 |
| 188 | Ga0068860_100000736 | 3300005843 | Bacteria | 37295 |
| 189 | Ga0068860_100068491 | 3300005843 | Bacteria | 3372 |
| 190 | Ga0068860_100072712 | 3300005843 | Bacteria | 3268 |
| 191 | Ga0068862_100573438 | 3300005844 | Bacteria | 1080 |
| 192 | Ga0081539_10001028 | 3300005985 | Bacteria | 51439 |
| 193 | Ga0070717_10143372 | 3300006028 | Bacteria | 2062 |
| 194 | Ga0070716_100008148 | 3300006173 | Bacteria | 5190 |
| 195 | Ga0070716_100455564 | 3300006173 | Bacteria | 933 |
| 196 | Ga0070712_100100990 | 3300006175 | Bacteria | 2133 |
| 197 | Ga0070712_100230844 | 3300006175 | Bacteria | 1470 |
| 198 | Ga0075366_10100668 | 3300006195 | Bacteria | 1734 |
| 199 | Ga0075366_10129117 | 3300006195 | Bacteria | 1525 |
| 200 | Ga0097621_100023861 | 3300006237 | Bacteria | 4768 |
| 201 | Ga0097621_100226125 | 3300006237 | Bacteria | 1632 |
| 202 | Ga0068871_100044715 | 3300006358 | Bacteria | 3563 |
| 203 | Ga0068871_100608013 | 3300006358 | Bacteria | 995 |
| 204 | Ga0075430_100122232 | 3300006846 | Bacteria | 2170 |
| 205 | Ga0075434_100192697 | 3300006871 | Bacteria | 2059 |
| 206 | Ga0068865_100383428 | 3300006881 | Bacteria | 1147 |
| 207 | Ga0075436_100058459 | 3300006914 | Bacteria | 2663 |
| 208 | Ga0097620_100056549 | 3300006931 | Bacteria | 3949 |
| 209 | Ga0097620_100063074 | 3300006931 | Bacteria | 3736 |
| 210 | Ga0097620_100202324 | 3300006931 | Bacteria | 2071 |
| 211 | Ga0075435_100389573 | 3300007076 | Bacteria | 1198 |
| 212 | Ga0105251_10003483 | 3300009011 | Bacteria | 11396 |
| 213 | Ga0105251_10117833 | 3300009011 | Bacteria | 1207 |
| 214 | Ga0105250_10036182 | 3300009092 | Bacteria | 1981 |
| 215 | Ga0105240_10066908 | 3300009093 | Bacteria | 4455 |
| 216 | Ga0105240_10356211 | 3300009093 | Bacteria | 1659 |
| 217 | Ga0105240_10367061 | 3300009093 | Bacteria | 1629 |
| 218 | Ga0105240_10428861 | 3300009093 | Bacteria | 1484 |
| 219 | Ga0105240_10555605 | 3300009093 | Bacteria | 1269 |
| 220 | Ga0111539_10028815 | 3300009094 | Bacteria | 6772 |
| 221 | Ga0105245_10059875 | 3300009098 | Bacteria | 3429 |
| 222 | Ga0105245_11630101 | 3300009098 | Bacteria | 697 |
| 223 | Ga0105247_10003623 | 3300009101 | Bacteria | 10025 |
| 224 | Ga0105247_10050287 | 3300009101 | Bacteria | 2564 |
| 225 | Ga0105243_10024540 | 3300009148 | Bacteria | 4599 |
| 226 | Ga0105243_11727046 | 3300009148 | Unclassified | 655 |
| 227 | Ga0105241_10007108 | 3300009174 | Bacteria | 8244 |
| 228 | Ga0105241_10055307 | 3300009174 | Bacteria | 3040 |
| 229 | Ga0105241_10216202 | 3300009174 | Bacteria | 1608 |
| 230 | Ga0105242_10022479 | 3300009176 | Bacteria | 4960 |
| 231 | Ga0105242_10269707 | 3300009176 | Bacteria | 1541 |
| 232 | Ga0105248_10028584 | 3300009177 | Bacteria | 6213 |
| 233 | Ga0105248_10733966 | 3300009177 | Bacteria | 1114 |
| 234 | Ga0105237_10016306 | 3300009545 | Bacteria | 7722 |
| 235 | Ga0105237_10126806 | 3300009545 | Bacteria | 2547 |
| 236 | Ga0105237_10145172 | 3300009545 | Bacteria | 2368 |
| 237 | Ga0105237_10331166 | 3300009545 | Bacteria | 1527 |
| 238 | Ga0105238_10017261 | 3300009551 | Bacteria | 7331 |
| 239 | Ga0105238_10020728 | 3300009551 | Bacteria | 6695 |
| 240 | Ga0105238_10076951 | 3300009551 | Bacteria | 3329 |
| 241 | Ga0105238_10142432 | 3300009551 | Bacteria | 2374 |
| 242 | Ga0105238_10456731 | 3300009551 | Bacteria | 1275 |
| 243 | Ga0105249_10039672 | 3300009553 | Bacteria | 4275 |
| 244 | Ga0105249_10110467 | 3300009553 | Bacteria | 2598 |
| 245 | Ga0105249_11546349 | 3300009553 | Bacteria | 736 |
| 246 | Ga0105239_10005029 | 3300010375 | Bacteria | 15613 |
| 247 | Ga0105239_10073052 | 3300010375 | Bacteria | 3771 |
| 248 | Ga0105239_10204498 | 3300010375 | Bacteria | 2213 |
| 249 | Ga0105239_11086198 | 3300010375 | Bacteria | 921 |
| 250 | Ga0105246_10083341 | 3300011119 | Bacteria | 2284 |
| 251 | Ga0105246_10634285 | 3300011119 | Bacteria | 928 |
| 252 | Ga0157373_10026681 | 3300013100 | Bacteria | 4170 |
| 253 | Ga0157373_10028005 | 3300013100 | Bacteria | 4065 |
| 254 | Ga0157373_10159381 | 3300013100 | Bacteria | 1588 |
| 255 | Ga0157373_10218121 | 3300013100 | Bacteria | 1346 |
| 256 | Ga0157371_10000787 | 3300013102 | Bacteria | 36521 |
| 257 | Ga0157371_10010442 | 3300013102 | Bacteria | 7235 |
| 258 | Ga0157371_10176789 | 3300013102 | Bacteria | 1526 |
| 259 | Ga0157370_10066110 | 3300013104 | Bacteria | 3420 |
| 260 | Ga0157370_10084826 | 3300013104 | Bacteria | 2976 |
| 261 | Ga0157370_10520106 | 3300013104 | Bacteria | 1092 |
| 262 | Ga0157369_10000233 | 3300013105 | Bacteria | 76995 |
| 263 | Ga0157369_10151219 | 3300013105 | Bacteria | 2453 |
| 264 | Ga0157369_10650420 | 3300013105 | Bacteria | 1087 |
| 265 | Ga0157369_11010194 | 3300013105 | Bacteria | 851 |
| 266 | Ga0157374_10000102 | 3300013296 | Bacteria | 78555 |
| 267 | Ga0157374_10000922 | 3300013296 | Bacteria | 25588 |
| 268 | Ga0157374_10477807 | 3300013296 | Bacteria | 1249 |
| 269 | Ga0157378_10196590 | 3300013297 | Bacteria | 1905 |
| 270 | Ga0157378_11403798 | 3300013297 | Bacteria | 741 |
| 271 | Ga0163162_10072103 | 3300013306 | Bacteria | 3508 |
| 272 | Ga0163162_10429519 | 3300013306 | Bacteria | 1453 |
| 273 | Ga0163162_11335935 | 3300013306 | Bacteria | 815 |
| 274 | Ga0157372_10015261 | 3300013307 | Bacteria | 8228 |
| 275 | Ga0157372_10045705 | 3300013307 | Bacteria | 4858 |
| 276 | Ga0157372_10093274 | 3300013307 | Bacteria | 3426 |
| 277 | Ga0157372_10110309 | 3300013307 | Bacteria | 3151 |
| 278 | Ga0157372_10126617 | 3300013307 | Bacteria | 2937 |
| 279 | Ga0157372_10169840 | 3300013307 | Bacteria | 2523 |
| 280 | Ga0157372_10182283 | 3300013307 | Bacteria | 2431 |
| 281 | Ga0157372_10212457 | 3300013307 | Bacteria | 2242 |
| 282 | Ga0157372_10224781 | 3300013307 | Bacteria | 2176 |
| 283 | Ga0157372_10229050 | 3300013307 | Bacteria | 2154 |
| 284 | Ga0157372_10543868 | 3300013307 | Bacteria | 1354 |
| 285 | Ga0157372_11675352 | 3300013307 | Bacteria | 732 |
| 286 | Ga0157375_10000781 | 3300013308 | Bacteria | 27817 |
| 287 | Ga0157375_10061164 | 3300013308 | Bacteria | 3738 |
| 288 | Ga0157375_10114100 | 3300013308 | Bacteria | 2803 |
| 289 | Ga0157375_10185244 | 3300013308 | Bacteria | 2235 |
| 290 | Ga0163163_10000203 | 3300014325 | Bacteria | 61545 |
| 291 | Ga0163163_10008748 | 3300014325 | Bacteria | 9007 |
| 292 | Ga0157380_10000221 | 3300014326 | Bacteria | 34047 |
| 293 | Ga0157380_10757852 | 3300014326 | Bacteria | 983 |
| 294 | Ga0182008_10020983 | 3300014497 | Bacteria | 3359 |
| 295 | Ga0182008_10028409 | 3300014497 | Bacteria | 2828 |
| 296 | Ga0157379_10157007 | 3300014968 | Bacteria | 2053 |
| 297 | Ga0157379_10595425 | 3300014968 | Bacteria | 1032 |
| 298 | Ga0157376_10017970 | 3300014969 | Bacteria | 5408 |
| 299 | Ga0157376_10109229 | 3300014969 | Bacteria | 2431 |
| 300 | Ga0157376_10546062 | 3300014969 | Bacteria | 1146 |
| 301 | Ga0182006_1000392 | 3300015261 | Bacteria | 35983 |
| 302 | Ga0182006_1076350 | 3300015261 | Bacteria | 1231 |
| 303 | Ga0182007_10000207 | 3300015262 | Bacteria | 39296 |
| 304 | Ga0182007_10007661 | 3300015262 | Bacteria | 4499 |
| 305 | Ga0182007_10017454 | 3300015262 | Bacteria | 2620 |
| 306 | Ga0182005_1002413 | 3300015265 | Bacteria | 6688 |
| 307 | Ga0183361_10030 | 3300016635 | Bacteria | 55672 |
| 308 | Ga0206356_10936544 | 3300020070 | Bacteria | 682 |
| 309 | Ga0206353_11819478 | 3300020082 | Bacteria | 2390 |
| 310 | Ga0206353_11871602 | 3300020082 | Bacteria | 761 |
| 311 | Ga0213872_10109157 | 3300021361 | Bacteria | 1229 |
| 312 | Ga0209436_100042 | 3300025208 | Bacteria | 73600 |
| 313 | Ga0209784_101038 | 3300025224 | Bacteria | 4883 |
| 314 | Ga0209566_100200 | 3300025225 | Bacteria | 61991 |
| 315 | Ga0209566_100554 | 3300025225 | Bacteria | 25069 |
| 316 | Ga0209566_100564 | 3300025225 | Bacteria | 24326 |
| 317 | Ga0209674_100150 | 3300025226 | Bacteria | 96511 |
| 318 | Ga0209674_100382 | 3300025226 | Bacteria | 23424 |
| 319 | Ga0209674_100813 | 3300025226 | Bacteria | 10407 |
| 320 | Ga0209672_100028 | 3300025228 | Bacteria | 341962 |
| 321 | Ga0209672_100489 | 3300025228 | Bacteria | 22048 |
| 322 | Ga0209672_100496 | 3300025228 | Bacteria | 21881 |
| 323 | Ga0209147_100117 | 3300025229 | Bacteria | 143852 |
| 324 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 325 | Ga0209563_109555 | 3300025230 | Bacteria | 1459 |
| 326 | Ga0209258_100112 | 3300025242 | Bacteria | 192884 |
| 327 | Ga0209677_102157 | 3300025253 | Bacteria | 7690 |
| 328 | Ga0209677_102170 | 3300025253 | Bacteria | 7656 |
| 329 | Ga0209677_107693 | 3300025253 | Bacteria | 2233 |
| 330 | Ga0209148_1000043 | 3300025254 | Bacteria | 461531 |
| 331 | Ga0209148_1000314 | 3300025254 | Bacteria | 68636 |
| 332 | Ga0209759_1000379 | 3300025256 | Bacteria | 55581 |
| 333 | Ga0209759_1000711 | 3300025256 | Bacteria | 29498 |
| 334 | Ga0209759_1003670 | 3300025256 | Bacteria | 6026 |
| 335 | Ga0209455_1000050 | 3300025272 | Bacteria | 373239 |
| 336 | Ga0209673_1000070 | 3300025273 | Bacteria | 241592 |
| 337 | Ga0209130_1000227 | 3300025284 | Bacteria | 73760 |
| 338 | Ga0209564_1012617 | 3300025295 | Bacteria | 3666 |
| 339 | Ga0207656_10001586 | 3300025321 | Bacteria | 7571 |
| 340 | Ga0207696_1032103 | 3300025711 | Bacteria | 1583 |
| 341 | Ga0207713_1000451 | 3300025735 | Bacteria | 43043 |
| 342 | Ga0207682_10000165 | 3300025893 | Bacteria | 30318 |
| 343 | Ga0207692_10079765 | 3300025898 | Bacteria | 1747 |
| 344 | Ga0207710_10003333 | 3300025900 | Bacteria | 7176 |
| 345 | Ga0207680_10000251 | 3300025903 | Bacteria | 25767 |
| 346 | Ga0207680_10035280 | 3300025903 | Bacteria | 2870 |
| 347 | Ga0207680_10178994 | 3300025903 | Bacteria | 1433 |
| 348 | Ga0207680_10324634 | 3300025903 | Bacteria | 1077 |
| 349 | Ga0207647_10013556 | 3300025904 | Bacteria | 5644 |
| 350 | Ga0207647_10041727 | 3300025904 | Bacteria | 2883 |
| 351 | Ga0207647_10052298 | 3300025904 | Bacteria | 2521 |
| 352 | Ga0207685_10029894 | 3300025905 | Bacteria | 1934 |
| 353 | Ga0207699_10054253 | 3300025906 | Bacteria | 2380 |
| 354 | Ga0207699_10102794 | 3300025906 | Bacteria | 1817 |
| 355 | Ga0207645_10000045 | 3300025907 | Bacteria | 85310 |
| 356 | Ga0207645_10064008 | 3300025907 | Bacteria | 2350 |
| 357 | Ga0207643_10026319 | 3300025908 | Bacteria | 3219 |
| 358 | Ga0207705_10201515 | 3300025909 | Bacteria | 1508 |
| 359 | Ga0207705_10216104 | 3300025909 | Bacteria | 1455 |
| 360 | Ga0207705_10267288 | 3300025909 | Bacteria | 1307 |
| 361 | Ga0207705_10270781 | 3300025909 | Bacteria | 1299 |
| 362 | Ga0207705_10435750 | 3300025909 | Bacteria | 1016 |
| 363 | Ga0207684_10321716 | 3300025910 | Bacteria | 1333 |
| 364 | Ga0207654_10004639 | 3300025911 | Bacteria | 6941 |
| 365 | Ga0207654_10453351 | 3300025911 | Bacteria | 900 |
| 366 | Ga0207707_10206517 | 3300025912 | Bacteria | 1712 |
| 367 | Ga0207707_10412914 | 3300025912 | Bacteria | 1158 |
| 368 | Ga0207707_10489963 | 3300025912 | Bacteria | 1049 |
| 369 | Ga0207695_10008527 | 3300025913 | Bacteria | 12811 |
| 370 | Ga0207695_10011136 | 3300025913 | Bacteria | 10916 |
| 371 | Ga0207695_10182686 | 3300025913 | Bacteria | 2018 |
| 372 | Ga0207695_10345555 | 3300025913 | Bacteria | 1375 |
| 373 | Ga0207671_10030279 | 3300025914 | Bacteria | 4037 |
| 374 | Ga0207671_10067076 | 3300025914 | Bacteria | 2671 |
| 375 | Ga0207671_10357269 | 3300025914 | Bacteria | 1159 |
| 376 | Ga0207671_10375187 | 3300025914 | Bacteria | 1130 |
| 377 | Ga0207693_10004419 | 3300025915 | Bacteria | 11886 |
| 378 | Ga0207693_10016506 | 3300025915 | Bacteria | 5899 |
| 379 | Ga0207693_10226295 | 3300025915 | Bacteria | 1469 |
| 380 | Ga0207663_10062311 | 3300025916 | Bacteria | 2370 |
| 381 | Ga0207660_10184347 | 3300025917 | Bacteria | 1623 |
| 382 | Ga0207660_10253446 | 3300025917 | Bacteria | 1389 |
| 383 | Ga0207657_10000258 | 3300025919 | Bacteria | 56256 |
| 384 | Ga0207657_10002002 | 3300025919 | Bacteria | 22017 |
| 385 | Ga0207657_10005627 | 3300025919 | Bacteria | 13079 |
| 386 | Ga0207657_10006421 | 3300025919 | Bacteria | 12194 |
| 387 | Ga0207657_10017533 | 3300025919 | Bacteria | 6862 |
| 388 | Ga0207657_10064037 | 3300025919 | Bacteria | 3140 |
| 389 | Ga0207657_10139774 | 3300025919 | Bacteria | 1979 |
| 390 | Ga0207657_10322984 | 3300025919 | Bacteria | 1220 |
| 391 | Ga0207649_10005560 | 3300025920 | Bacteria | 6816 |
| 392 | Ga0207649_10361529 | 3300025920 | Bacteria | 1077 |
| 393 | Ga0207652_10024741 | 3300025921 | Bacteria | 4983 |
| 394 | Ga0207652_10095051 | 3300025921 | Bacteria | 2625 |
| 395 | Ga0207652_10123673 | 3300025921 | Bacteria | 2304 |
| 396 | Ga0207681_10013915 | 3300025923 | Bacteria | 4985 |
| 397 | Ga0207681_10145539 | 3300025923 | Bacteria | 1770 |
| 398 | Ga0207694_10052663 | 3300025924 | Bacteria | 3155 |
| 399 | Ga0207694_10101106 | 3300025924 | Bacteria | 2284 |
| 400 | Ga0207694_10117754 | 3300025924 | Bacteria | 2118 |
| 401 | Ga0207694_10335509 | 3300025924 | Bacteria | 1250 |
| 402 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 403 | Ga0207650_10037386 | 3300025925 | Bacteria | 3537 |
| 404 | Ga0207650_10063290 | 3300025925 | Bacteria | 2766 |
| 405 | Ga0207659_10014293 | 3300025926 | Bacteria | 5114 |
| 406 | Ga0207687_10005040 | 3300025927 | Bacteria | 8744 |
| 407 | Ga0207687_10132360 | 3300025927 | Bacteria | 1882 |
| 408 | Ga0207687_10769199 | 3300025927 | Bacteria | 820 |
| 409 | Ga0207700_10000214 | 3300025928 | Bacteria | 34620 |
| 410 | Ga0207700_10038855 | 3300025928 | Bacteria | 3458 |
| 411 | Ga0207664_10000853 | 3300025929 | Bacteria | 20620 |
| 412 | Ga0207664_10007991 | 3300025929 | Bacteria | 7355 |
| 413 | Ga0207664_10047207 | 3300025929 | Bacteria | 3382 |
| 414 | Ga0207664_10086947 | 3300025929 | Bacteria | 2555 |
| 415 | Ga0207664_10155402 | 3300025929 | Bacteria | 1947 |
| 416 | Ga0207644_10011801 | 3300025931 | Bacteria | 5785 |
| 417 | Ga0207644_10014141 | 3300025931 | Bacteria | 5337 |
| 418 | Ga0207644_10137141 | 3300025931 | Bacteria | 1880 |
| 419 | Ga0207690_10000485 | 3300025932 | Bacteria | 25649 |
| 420 | Ga0207690_10100810 | 3300025932 | Bacteria | 2062 |
| 421 | Ga0207690_10355801 | 3300025932 | Bacteria | 1159 |
| 422 | Ga0207706_10000023 | 3300025933 | Bacteria | 153979 |
| 423 | Ga0207706_10340931 | 3300025933 | Bacteria | 1304 |
| 424 | Ga0207706_10713632 | 3300025933 | Bacteria | 856 |
| 425 | Ga0207686_10012630 | 3300025934 | Bacteria | 4647 |
| 426 | Ga0207686_10229876 | 3300025934 | Bacteria | 1344 |
| 427 | Ga0207709_10007786 | 3300025935 | Bacteria | 5938 |
| 428 | Ga0207670_10005050 | 3300025936 | Bacteria | 7195 |
| 429 | Ga0207669_10002574 | 3300025937 | Bacteria | 7752 |
| 430 | Ga0207665_10009098 | 3300025939 | Bacteria | 6521 |
| 431 | Ga0207665_10052787 | 3300025939 | Bacteria | 2739 |
| 432 | Ga0207665_10655475 | 3300025939 | Bacteria | 823 |
| 433 | Ga0207691_10000279 | 3300025940 | Bacteria | 50526 |
| 434 | Ga0207691_10019010 | 3300025940 | Bacteria | 6507 |
| 435 | Ga0207711_10000087 | 3300025941 | Bacteria | 98302 |
| 436 | Ga0207711_10091412 | 3300025941 | Bacteria | 2677 |
| 437 | Ga0207689_10027196 | 3300025942 | Bacteria | 4789 |
| 438 | Ga0207689_10076115 | 3300025942 | Bacteria | 2759 |
| 439 | Ga0207679_10025570 | 3300025945 | Bacteria | 4062 |
| 440 | Ga0207679_10131717 | 3300025945 | Bacteria | 2007 |
| 441 | Ga0207679_10497595 | 3300025945 | Bacteria | 1087 |
| 442 | Ga0207679_11401621 | 3300025945 | Bacteria | 641 |
| 443 | Ga0207667_10002136 | 3300025949 | Bacteria | 24781 |
| 444 | Ga0207667_10003269 | 3300025949 | Bacteria | 20008 |
| 445 | Ga0207667_10004129 | 3300025949 | Bacteria | 17847 |
| 446 | Ga0207667_10094099 | 3300025949 | Bacteria | 3094 |
| 447 | Ga0207667_10132077 | 3300025949 | Bacteria | 2572 |
| 448 | Ga0207667_10217078 | 3300025949 | Bacteria | 1960 |
| 449 | Ga0207667_10241309 | 3300025949 | Bacteria | 1849 |
| 450 | Ga0207667_11650123 | 3300025949 | Bacteria | 609 |
| 451 | Ga0207651_10008555 | 3300025960 | Bacteria | 5534 |
| 452 | Ga0207651_10019463 | 3300025960 | Bacteria | 4069 |
| 453 | Ga0207712_10018021 | 3300025961 | Bacteria | 4594 |
| 454 | Ga0207712_10181914 | 3300025961 | Bacteria | 1652 |
| 455 | Ga0207712_11138569 | 3300025961 | Bacteria | 695 |
| 456 | Ga0207668_10002332 | 3300025972 | Bacteria | 11091 |
| 457 | Ga0207668_10005740 | 3300025972 | Bacteria | 7313 |
| 458 | Ga0207668_10595752 | 3300025972 | Bacteria | 962 |
| 459 | Ga0207640_10062101 | 3300025981 | Bacteria | 2477 |
| 460 | Ga0207640_10204607 | 3300025981 | Bacteria | 1499 |
| 461 | Ga0207640_10482341 | 3300025981 | Bacteria | 1029 |
| 462 | Ga0207658_10000007 | 3300025986 | Bacteria | 329651 |
| 463 | Ga0207658_10009855 | 3300025986 | Bacteria | 6488 |
| 464 | Ga0207658_10040299 | 3300025986 | Bacteria | 3375 |
| 465 | Ga0207658_10462105 | 3300025986 | Bacteria | 1125 |
| 466 | Ga0207677_10003044 | 3300026023 | Bacteria | 8866 |
| 467 | Ga0207677_10004160 | 3300026023 | Bacteria | 7745 |
| 468 | Ga0207677_10208152 | 3300026023 | Bacteria | 1560 |
| 469 | Ga0207703_10000522 | 3300026035 | Bacteria | 39489 |
| 470 | Ga0207703_10389424 | 3300026035 | Bacteria | 1291 |
| 471 | Ga0207639_10280920 | 3300026041 | Bacteria | 1464 |
| 472 | Ga0207678_10000110 | 3300026067 | Bacteria | 67527 |
| 473 | Ga0207678_10017290 | 3300026067 | Bacteria | 6331 |
| 474 | Ga0207678_10462816 | 3300026067 | Bacteria | 1103 |
| 475 | Ga0207702_10000523 | 3300026078 | Bacteria | 43069 |
| 476 | Ga0207702_10024567 | 3300026078 | Bacteria | 5001 |
| 477 | Ga0207702_10056187 | 3300026078 | Bacteria | 3341 |
| 478 | Ga0207702_10214039 | 3300026078 | Bacteria | 1793 |
| 479 | Ga0207702_10686431 | 3300026078 | Bacteria | 1009 |
| 480 | Ga0207702_11265912 | 3300026078 | Bacteria | 732 |
| 481 | Ga0207641_10029599 | 3300026088 | Bacteria | 4530 |
| 482 | Ga0207641_10065135 | 3300026088 | Bacteria | 3116 |
| 483 | Ga0207641_10118174 | 3300026088 | Bacteria | 2361 |
| 484 | Ga0207648_10031644 | 3300026089 | Bacteria | 4677 |
| 485 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 486 | Ga0207676_10000140 | 3300026095 | Bacteria | 62993 |
| 487 | Ga0207674_10000429 | 3300026116 | Bacteria | 54858 |
| 488 | Ga0207674_10013722 | 3300026116 | Bacteria | 8969 |
| 489 | Ga0207674_10364123 | 3300026116 | Bacteria | 1398 |
| 490 | Ga0207675_100032799 | 3300026118 | Bacteria | 4839 |
| 491 | Ga0207675_100459906 | 3300026118 | Bacteria | 1262 |
| 492 | Ga0207683_10000003 | 3300026121 | Bacteria | 191866 |
| 493 | Ga0207683_10758906 | 3300026121 | Bacteria | 900 |
| 494 | Ga0207698_10004881 | 3300026142 | Bacteria | 8222 |
| 495 | Ga0207698_10005292 | 3300026142 | Bacteria | 7946 |
| 496 | Ga0207698_10009962 | 3300026142 | Bacteria | 6080 |
| 497 | Ga0207698_10031754 | 3300026142 | Bacteria | 3816 |
| 498 | Ga0207698_10096150 | 3300026142 | Bacteria | 2440 |
| 499 | Ga0207698_10165424 | 3300026142 | Bacteria | 1940 |
| 500 | Ga0207698_10496802 | 3300026142 | Bacteria | 1186 |
| 501 | Ga0207698_10576101 | 3300026142 | Bacteria | 1107 |
| 502 | Ga0209982_1007869 | 3300027552 | Bacteria | 1557 |
| 503 | Ga0209970_1005309 | 3300027614 | Bacteria | 2128 |
| 504 | Ga0209970_1031695 | 3300027614 | Bacteria | 920 |
| 505 | Ga0209983_1034448 | 3300027665 | Bacteria | 1085 |
| 506 | Ga0209974_10008582 | 3300027876 | Bacteria | 3490 |
| 507 | Ga0209974_10068229 | 3300027876 | Bacteria | 1211 |
| 508 | Ga0207428_10075422 | 3300027907 | Bacteria | 2643 |
| 509 | Ga0268266_10019939 | 3300028379 | Bacteria | 5713 |
| 510 | Ga0268266_10034141 | 3300028379 | Bacteria | 4325 |
| 511 | Ga0268266_10051803 | 3300028379 | Bacteria | 3524 |
| 512 | Ga0268266_10237247 | 3300028379 | Bacteria | 1682 |
| 513 | Ga0268265_10563480 | 3300028380 | Bacteria | 1083 |
| 514 | Ga0268265_11803300 | 3300028380 | Bacteria | 618 |
| 515 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 516 | Ga0268264_10012993 | 3300028381 | Bacteria | 6845 |
| 517 | Ga0268264_10054042 | 3300028381 | Bacteria | 3352 |
| 518 | Ga0265338_10237083 | 3300028800 | Bacteria | 1353 |
| 519 | Ga0265325_10007758 | 3300031241 | Bacteria | 6396 |
| 520 | Ga0265340_10196935 | 3300031247 | Bacteria | 907 |
| 521 | Ga0307408_100398843 | 3300031548 | Bacteria | 1181 |
| 522 | Ga0265313_10039139 | 3300031595 | Bacteria | 2354 |
| 523 | Ga0316575_10015854 | 3300031665 | Bacteria | 2844 |
| 524 | Ga0265314_10046941 | 3300031711 | Bacteria | 3044 |
| 525 | Ga0265314_10370427 | 3300031711 | Bacteria | 782 |
| 526 | Ga0373944_0276158 | 3300035089 | Bacteria | 626 |
| 527 | Ga0373923_0030460 | 3300035111 | Bacteria | 2170 |
| 528 | Ga0373939_0073568 | 3300035114 | Bacteria | 1119 |
| 529 | Ga0373953_0003388 | 3300035117 | Bacteria | 4955 |
| 530 | Ga0373954_0014040 | 3300035118 | Bacteria | 3570 |
| 531 | Ga0373956_0011700 | 3300035119 | Bacteria | 3619 |
| 532 | Ga0373957_0048357 | 3300035120 | Bacteria | 1620 |
| 533 | Ga0373943_0101847 | 3300035170 | Bacteria | 1503 |
| 534 | Ga0373946_0173801 | 3300035171 | Bacteria | 1018 |
| 535 | Ga0373955_0003437 | 3300035172 | Bacteria | 6960 |
| 536 | Ga0373961_0045587 | 3300035241 | Bacteria | 1283 |
| 537 | Ga0373924_0027321 | 3300035410 | Bacteria | 2268 |
| 538 | Ga0373935_0135543 | 3300035692 | Bacteria | 1658 |
| 539 | Ga0373935_0210066 | 3300035692 | Bacteria | 1348 |
| 540 | Ga0373935_0653050 | 3300035692 | Bacteria | 772 |
| 541 | Ga0373927_0158821 | 3300035695 | Bacteria | 1481 |
| 542 | Ga0373927_0335905 | 3300035695 | Bacteria | 995 |
| 543 | Ga0373933_0028881 | 3300035724 | Bacteria | 3201 |
| 544 | Ga0373933_0073764 | 3300035724 | Bacteria | 2080 |
| 545 | Ga0373947_0015124 | 3300035725 | Bacteria | 4429 |
| 546 | Ga0373947_0190505 | 3300035725 | Bacteria | 1338 |
| 547 | Ga0373937_0095041 | 3300036401 | Bacteria | 2763 |
| 548 | Ga0395899_0000613 | 3300037312 | Bacteria | 37148 |
| 549 | Ga0395899_0002073 | 3300037312 | Bacteria | 16470 |
| 550 | Ga0395899_0021960 | 3300037312 | Bacteria | 4840 |
| 551 | Ga0395899_0028388 | 3300037312 | Bacteria | 4214 |
| 552 | Ga0395899_0044157 | 3300037312 | Bacteria | 3322 |
| 553 | Ga0395899_0050305 | 3300037312 | Bacteria | 3094 |
| 554 | Ga0395899_0110211 | 3300037312 | Bacteria | 1980 |
| 555 | Ga0395899_0128593 | 3300037312 | Bacteria | 1810 |
| 556 | Ga0395899_0391563 | 3300037312 | Bacteria | 921 |
| 557 | Ga0395899_0499591 | 3300037312 | Bacteria | 789 |
| 558 | Ga0395900_0000167 | 3300037418 | Bacteria | 106898 |
| 559 | Ga0395900_0000435 | 3300037418 | Bacteria | 60001 |
| 560 | Ga0395900_0000540 | 3300037418 | Bacteria | 52884 |
| 561 | Ga0395900_0001484 | 3300037418 | Bacteria | 27947 |
| 562 | Ga0395900_0001683 | 3300037418 | Bacteria | 25733 |
| 563 | Ga0395900_0002454 | 3300037418 | Bacteria | 20427 |
| 564 | Ga0395900_0003153 | 3300037418 | Bacteria | 17882 |
| 565 | Ga0395900_0018721 | 3300037418 | Bacteria | 7062 |
| 566 | Ga0395900_0028593 | 3300037418 | Bacteria | 5712 |
| 567 | Ga0395900_0051797 | 3300037418 | Bacteria | 4227 |
| 568 | Ga0395900_0064970 | 3300037418 | Bacteria | 3748 |
| 569 | Ga0395900_0099821 | 3300037418 | Bacteria | 2982 |
| 570 | Ga0395900_0110854 | 3300037418 | Bacteria | 2819 |
| 571 | Ga0395900_0267165 | 3300037418 | Bacteria | 1706 |
| 572 | Ga0395900_0284405 | 3300037418 | Bacteria | 1645 |
| 573 | Ga0395900_0377387 | 3300037418 | Bacteria | 1386 |
| 574 | Ga0395900_0431669 | 3300037418 | Bacteria | 1276 |
| 575 | Ga0395898_0001362 | 3300037466 | Bacteria | 35179 |
| 576 | Ga0395898_0004238 | 3300037466 | Bacteria | 15726 |
| 577 | Ga0395898_0006962 | 3300037466 | Bacteria | 12020 |
| 578 | Ga0395898_0010949 | 3300037466 | Bacteria | 9459 |
| 579 | Ga0395898_0020629 | 3300037466 | Bacteria | 6693 |
| 580 | Ga0395898_0024435 | 3300037466 | Bacteria | 6095 |
| 581 | Ga0395898_0051244 | 3300037466 | Bacteria | 4037 |
| 582 | Ga0395898_0135440 | 3300037466 | Bacteria | 2358 |
| 583 | Ga0395898_0144130 | 3300037466 | Bacteria | 2280 |
| 584 | Ga0395898_0206678 | 3300037466 | Bacteria | 1873 |
| 585 | Ga0395898_0277599 | 3300037466 | Bacteria | 1598 |
| 586 | Ga0395898_0310840 | 3300037466 | Bacteria | 1503 |
| 587 | Ga0395898_0421554 | 3300037466 | Bacteria | 1272 |
| 588 | Ga0395898_0752982 | 3300037466 | Bacteria | 915 |
| 589 | Ga0395905_0031572 | 3300037471 | Bacteria | 4986 |
| 590 | Ga0395905_0045196 | 3300037471 | Bacteria | 4131 |
| 591 | Ga0395905_0091497 | 3300037471 | Bacteria | 2852 |
| 592 | Ga0395905_0258945 | 3300037471 | Bacteria | 1624 |
| 593 | Ga0395905_0553301 | 3300037471 | Bacteria | 1052 |
| 594 | Ga0395901_0000154 | 3300038443 | Bacteria | 89750 |
| 595 | Ga0395901_0000441 | 3300038443 | Bacteria | 48497 |
| 596 | Ga0395901_0002340 | 3300038443 | Bacteria | 19318 |
| 597 | Ga0395901_0007582 | 3300038443 | Bacteria | 10961 |
| 598 | Ga0395901_0028365 | 3300038443 | Bacteria | 5755 |
| 599 | Ga0395901_0058843 | 3300038443 | Bacteria | 3997 |
| 600 | Ga0395901_0069786 | 3300038443 | Bacteria | 3660 |
| 601 | Ga0395901_0075865 | 3300038443 | Bacteria | 3507 |
| 602 | Ga0395901_0092933 | 3300038443 | Bacteria | 3158 |
| 603 | Ga0395901_0096836 | 3300038443 | Bacteria | 3092 |
| 604 | Ga0395901_0099256 | 3300038443 | Bacteria | 3053 |
| 605 | Ga0395901_0148567 | 3300038443 | Bacteria | 2463 |
| 606 | Ga0395901_0466532 | 3300038443 | Bacteria | 1289 |
| 607 | Ga0395901_0514954 | 3300038443 | Bacteria | 1216 |
| 608 | Ga0436365_0002256 | 3300039437 | Bacteria | 787 |
| 609 | Ga0436361_0849159 | 3300039447 | Bacteria | 9448 |
| 610 | Ga0451807_1097321 | 3300041486 | Bacteria | 995 |
| 611 | Ga0451807_2387373 | 3300041486 | Bacteria | 1311 |
| 612 | Ga0451853_1554031 | 3300041512 | Bacteria | 1119 |
| 613 | Ga0439448_0017988 | 3300042005 | Bacteria | 2161 |
| 614 | Ga0439448_0176440 | 3300042005 | Bacteria | 746 |
| 615 | Ga0451577_0547041 | 3300042876 | Bacteria | 1051 |
| 616 | Ga0466969_0007501 | 3300044656 | Bacteria | 5800 |
| 617 | Ga0466969_0064157 | 3300044656 | Bacteria | 1779 |
| 618 | Ga0466972_0000883 | 3300044658 | Bacteria | 14415 |
| 619 | Ga0466982_0120675 | 3300044672 | Bacteria | 1617 |
| 620 | Ga0453683_0770715 | 3300044673 | Bacteria | 632 |
| 621 | Ga0466965_0023752 | 3300044683 | Bacteria | 2961 |
| 622 | Ga0466966_0000401 | 3300044684 | Bacteria | 27805 |
| 623 | Ga0466966_0008592 | 3300044684 | Bacteria | 6760 |
| 624 | Ga0466966_0015451 | 3300044684 | Bacteria | 5046 |
| 625 | Ga0466966_0338917 | 3300044684 | Bacteria | 903 |
| 626 | Ga0466961_0002662 | 3300044693 | Bacteria | 11074 |
| 627 | Ga0466961_0082206 | 3300044693 | Bacteria | 2038 |
| 628 | Ga0466961_0423144 | 3300044693 | Bacteria | 807 |
| 629 | Ga0466963_0081735 | 3300044694 | Bacteria | 2189 |
| 630 | Ga0466963_0313653 | 3300044694 | Bacteria | 1103 |
| 631 | Ga0466964_0000063 | 3300044706 | Bacteria | 23331 |
| 632 | Ga0466964_0025320 | 3300044706 | Bacteria | 2316 |
| 633 | Ga0466964_0132676 | 3300044706 | Bacteria | 1136 |
| 634 | Ga0453684_0159650 | 3300044712 | Bacteria | 2668 |
| 635 | Ga0466971_0011629 | 3300044719 | Bacteria | 3853 |
| 636 | Ga0466957_0006532 | 3300044842 | Bacteria | 6586 |
| 637 | Ga0466957_0006885 | 3300044842 | Bacteria | 6424 |
| 638 | Ga0466959_0001459 | 3300045049 | Bacteria | 14478 |
| 639 | Ga0466959_0092665 | 3300045049 | Bacteria | 2169 |
| 640 | Ga0451576_0014936 | 3300045051 | Bacteria | 8626 |
| 641 | Ga0451576_0319372 | 3300045051 | Bacteria | 1625 |
| 642 | Ga0451576_0728895 | 3300045051 | Bacteria | 1041 |
| 643 | Ga0466958_0029306 | 3300045836 | Bacteria | 3267 |
| 644 | Ga0466958_0041926 | 3300045836 | Bacteria | 2755 |
| 645 | Ga0466967_0577695 | 3300045976 | Bacteria | 1108 |
| 646 | Ga0495617_000086 | 3300046452 | Bacteria | 67731 |
| 647 | Ga0495617_078298 | 3300046452 | Bacteria | 1084 |
| 648 | Ga0495592_0009580 | 3300046454 | Bacteria | 7289 |
| 649 | Ga0495592_0202365 | 3300046454 | Bacteria | 1339 |
| 650 | Ga0495603_0002780 | 3300046455 | Bacteria | 10316 |
| 651 | Ga0495603_0013453 | 3300046455 | Bacteria | 4950 |
| 652 | Ga0495603_0326769 | 3300046455 | Bacteria | 880 |
| 653 | Ga0495590_0000017 | 3300046457 | Bacteria | 216944 |
| 654 | Ga0495590_0000313 | 3300046457 | Bacteria | 25385 |
| 655 | Ga0495590_0027555 | 3300046457 | Unclassified | 1993 |
| 656 | Ga0495590_0042277 | 3300046457 | Bacteria | 1588 |
| 657 | Ga0495590_0112897 | 3300046457 | Bacteria | 970 |
| 658 | Ga0495591_000099 | 3300046458 | Bacteria | 99689 |
| 659 | Ga0495591_003399 | 3300046458 | Bacteria | 8251 |
| 660 | Ga0495591_010525 | 3300046458 | Bacteria | 3578 |
| 661 | Ga0495629_0079790 | 3300046459 | Bacteria | 2285 |
| 662 | Ga0495638_0026219 | 3300046460 | Bacteria | 3780 |
| 663 | Ga0495653_0135177 | 3300046463 | Bacteria | 1740 |
| 664 | Ga0495653_0226347 | 3300046463 | Bacteria | 1254 |
| 665 | Ga0495653_0306845 | 3300046463 | Bacteria | 1033 |
| 666 | Ga0495653_0340745 | 3300046463 | Bacteria | 966 |
| 667 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 668 | Ga0495650_0013587 | 3300046471 | Bacteria | 4296 |
| 669 | Ga0495650_0038566 | 3300046471 | Bacteria | 2069 |
| 670 | Ga0495580_0001658 | 3300046472 | Bacteria | 19583 |
| 671 | Ga0495580_0003991 | 3300046472 | Bacteria | 12452 |
| 672 | Ga0495580_0004314 | 3300046472 | Bacteria | 11960 |
| 673 | Ga0495580_0006790 | 3300046472 | Bacteria | 9279 |
| 674 | Ga0495580_0007817 | 3300046472 | Bacteria | 8559 |
| 675 | Ga0495580_0277580 | 3300046472 | Bacteria | 1143 |
| 676 | Ga0495580_0278877 | 3300046472 | Bacteria | 1140 |
| 677 | Ga0495582_0029504 | 3300046473 | Bacteria | 3011 |
| 678 | Ga0495582_0084210 | 3300046473 | Bacteria | 1767 |
| 679 | Ga0495605_0001241 | 3300046474 | Bacteria | 16986 |
| 680 | Ga0495605_0011473 | 3300046474 | Bacteria | 4936 |
| 681 | Ga0495605_0175575 | 3300046474 | Bacteria | 944 |
| 682 | Ga0495662_0084964 | 3300046476 | Bacteria | 1541 |
| 683 | Ga0495664_0006370 | 3300046477 | Bacteria | 6523 |
| 684 | Ga0495664_0054029 | 3300046477 | Bacteria | 2388 |
| 685 | Ga0495664_0062569 | 3300046477 | Bacteria | 2217 |
| 686 | Ga0495584_0000043 | 3300046491 | Bacteria | 90007 |
| 687 | Ga0495584_0000304 | 3300046491 | Bacteria | 34788 |
| 688 | Ga0495584_0000321 | 3300046491 | Bacteria | 33487 |
| 689 | Ga0495584_0001042 | 3300046491 | Bacteria | 17317 |
| 690 | Ga0495584_0002286 | 3300046491 | Bacteria | 10929 |
| 691 | Ga0495584_0033749 | 3300046491 | Bacteria | 2590 |
| 692 | Ga0495584_0067276 | 3300046491 | Bacteria | 1801 |
| 693 | Ga0495585_0001199 | 3300046492 | Bacteria | 21091 |
| 694 | Ga0495585_0006971 | 3300046492 | Bacteria | 6956 |
| 695 | Ga0495585_0012689 | 3300046492 | Bacteria | 4959 |
| 696 | Ga0495585_0015432 | 3300046492 | Bacteria | 4439 |
| 697 | Ga0495585_0030744 | 3300046492 | Bacteria | 3053 |
| 698 | Ga0495585_0368071 | 3300046492 | Bacteria | 696 |
| 699 | Ga0495594_0007213 | 3300046499 | Bacteria | 5718 |
| 700 | Ga0495594_0306623 | 3300046499 | Bacteria | 904 |
| 701 | Ga0495596_0006572 | 3300046500 | Bacteria | 5334 |
| 702 | Ga0495596_0012491 | 3300046500 | Bacteria | 3635 |
| 703 | Ga0495596_0019524 | 3300046500 | Bacteria | 2782 |
| 704 | Ga0495596_0019766 | 3300046500 | Bacteria | 2763 |
| 705 | Ga0495596_0060737 | 3300046500 | Bacteria | 1472 |
| 706 | Ga0495596_0061621 | 3300046500 | Bacteria | 1460 |
| 707 | Ga0495596_0064085 | 3300046500 | Bacteria | 1430 |
| 708 | Ga0495607_0000892 | 3300046501 | Bacteria | 27863 |
| 709 | Ga0495607_0001281 | 3300046501 | Bacteria | 22511 |
| 710 | Ga0495607_0004475 | 3300046501 | Bacteria | 10251 |
| 711 | Ga0495607_0026604 | 3300046501 | Bacteria | 3589 |
| 712 | Ga0495607_0137627 | 3300046501 | Bacteria | 1263 |
| 713 | Ga0495607_0152079 | 3300046501 | Bacteria | 1183 |
| 714 | Ga0495607_0278106 | 3300046501 | Bacteria | 795 |
| 715 | Ga0495583_0001132 | 3300046506 | Bacteria | 29206 |
| 716 | Ga0495583_0001553 | 3300046506 | Bacteria | 22732 |
| 717 | Ga0495583_0005103 | 3300046506 | Bacteria | 9049 |
| 718 | Ga0495583_0005285 | 3300046506 | Bacteria | 8835 |
| 719 | Ga0495583_0009451 | 3300046506 | Bacteria | 5823 |
| 720 | Ga0495606_0003768 | 3300046507 | Bacteria | 15763 |
| 721 | Ga0495606_0033616 | 3300046507 | Bacteria | 3534 |
| 722 | Ga0495606_0151145 | 3300046507 | Bacteria | 1362 |
| 723 | Ga0495606_0230712 | 3300046507 | Bacteria | 1037 |
| 724 | Ga0495606_0542686 | 3300046507 | Bacteria | 580 |
| 725 | Ga0495610_0001471 | 3300046512 | Bacteria | 20781 |
| 726 | Ga0495616_0013633 | 3300046513 | Bacteria | 4578 |
| 727 | Ga0495616_0026336 | 3300046513 | Bacteria | 3097 |
| 728 | Ga0495616_0063197 | 3300046513 | Bacteria | 1810 |
| 729 | Ga0495618_0001931 | 3300046514 | Bacteria | 13580 |
| 730 | Ga0495618_0046153 | 3300046514 | Bacteria | 2749 |
| 731 | Ga0495620_0040908 | 3300046515 | Bacteria | 2036 |
| 732 | Ga0495628_0040523 | 3300046516 | Bacteria | 3721 |
| 733 | Ga0495628_0104192 | 3300046516 | Bacteria | 2187 |
| 734 | Ga0495628_0191751 | 3300046516 | Bacteria | 1543 |
| 735 | Ga0495628_0230789 | 3300046516 | Bacteria | 1387 |
| 736 | Ga0495628_0300415 | 3300046516 | Bacteria | 1188 |
| 737 | Ga0495630_0018650 | 3300046517 | Bacteria | 5097 |
| 738 | Ga0495630_0045828 | 3300046517 | Bacteria | 3268 |
| 739 | Ga0495630_0117643 | 3300046517 | Bacteria | 2015 |
| 740 | Ga0495630_0249048 | 3300046517 | Bacteria | 1357 |
| 741 | Ga0495631_0005556 | 3300046518 | Bacteria | 6591 |
| 742 | Ga0495631_0006423 | 3300046518 | Bacteria | 6065 |
| 743 | Ga0495631_0030600 | 3300046518 | Bacteria | 2441 |
| 744 | Ga0495632_0000139 | 3300046519 | Bacteria | 74242 |
| 745 | Ga0495632_0001117 | 3300046519 | Bacteria | 23014 |
| 746 | Ga0495632_0028718 | 3300046519 | Bacteria | 2901 |
| 747 | Ga0495637_0000026 | 3300046520 | Bacteria | 158526 |
| 748 | Ga0495637_0029807 | 3300046520 | Bacteria | 2426 |
| 749 | Ga0495637_0071775 | 3300046520 | Bacteria | 1395 |
| 750 | Ga0495643_0000435 | 3300046522 | Bacteria | 54331 |
| 751 | Ga0495643_0012063 | 3300046522 | Bacteria | 5227 |
| 752 | Ga0495643_0018297 | 3300046522 | Bacteria | 4075 |
| 753 | Ga0495644_0010160 | 3300046523 | Bacteria | 3626 |
| 754 | Ga0495644_0110357 | 3300046523 | Bacteria | 1043 |
| 755 | Ga0495648_0000839 | 3300046524 | Bacteria | 32396 |
| 756 | Ga0495648_0049487 | 3300046524 | Bacteria | 2576 |
| 757 | Ga0495648_0087024 | 3300046524 | Bacteria | 1760 |
| 758 | Ga0495648_0115739 | 3300046524 | Bacteria | 1450 |
| 759 | Ga0495666_0012950 | 3300046526 | Bacteria | 4156 |
| 760 | Ga0495666_0027659 | 3300046526 | Bacteria | 2791 |
| 761 | Ga0495642_0007863 | 3300046528 | Bacteria | 4084 |
| 762 | Ga0495642_0013195 | 3300046528 | Bacteria | 3192 |
| 763 | Ga0495642_0025668 | 3300046528 | Bacteria | 2336 |
| 764 | Ga0495642_0052486 | 3300046528 | Bacteria | 1679 |
| 765 | Ga0495642_0071276 | 3300046528 | Bacteria | 1454 |
| 766 | Ga0495652_0145973 | 3300046529 | Bacteria | 1854 |
| 767 | Ga0495652_0340563 | 3300046529 | Bacteria | 1077 |
| 768 | Ga0495654_0102933 | 3300046530 | Bacteria | 1312 |
| 769 | Ga0495665_0013876 | 3300046531 | Bacteria | 4351 |
| 770 | Ga0495665_0059668 | 3300046531 | Bacteria | 2014 |
| 771 | Ga0495665_0068309 | 3300046531 | Bacteria | 1874 |
| 772 | Ga0495665_0216069 | 3300046531 | Bacteria | 992 |
| 773 | Ga0495640_0057329 | 3300046533 | Bacteria | 2659 |
| 774 | Ga0495586_0010988 | 3300046535 | Bacteria | 4810 |
| 775 | Ga0495587_0008224 | 3300046536 | Bacteria | 6717 |
| 776 | Ga0495587_0126287 | 3300046536 | Bacteria | 1463 |
| 777 | Ga0495598_0033960 | 3300046537 | Bacteria | 1451 |
| 778 | Ga0495609_0000262 | 3300046538 | Bacteria | 49441 |
| 779 | Ga0495609_0000385 | 3300046538 | Bacteria | 37400 |
| 780 | Ga0495609_0063615 | 3300046538 | Bacteria | 1628 |
| 781 | Ga0495609_0107677 | 3300046538 | Bacteria | 1204 |
| 782 | Ga0495621_0011231 | 3300046539 | Bacteria | 2764 |
| 783 | Ga0495597_0015276 | 3300046542 | Bacteria | 3637 |
| 784 | Ga0495597_0018863 | 3300046542 | Bacteria | 3233 |
| 785 | Ga0495645_0025086 | 3300046543 | Bacteria | 4327 |
| 786 | Ga0495645_0226210 | 3300046543 | Bacteria | 1255 |
| 787 | Ga0495622_0042602 | 3300046557 | Bacteria | 2110 |
| 788 | Ga0495622_0108988 | 3300046557 | Unclassified | 1268 |
| 789 | Ga0495633_0000649 | 3300046558 | Bacteria | 32293 |
| 790 | Ga0495633_0004247 | 3300046558 | Bacteria | 9171 |
| 791 | Ga0495633_0328090 | 3300046558 | Bacteria | 694 |
| 792 | Ga0495667_0106515 | 3300046559 | Bacteria | 1812 |
| 793 | Ga0495667_0175077 | 3300046559 | Bacteria | 1378 |
| 794 | Ga0495656_0296006 | 3300046615 | Bacteria | 828 |
| 795 | Ga0495668_0029786 | 3300046616 | Bacteria | 3084 |
| 796 | Ga0495668_0040547 | 3300046616 | Bacteria | 2596 |
| 797 | Ga0495668_0127258 | 3300046616 | Bacteria | 1394 |
| 798 | Ga0495668_0196871 | 3300046616 | Bacteria | 1103 |
| 799 | Ga0495634_0305674 | 3300046642 | Bacteria | 961 |
| 800 | Ga0495611_0000185 | 3300046648 | Bacteria | 44393 |
| 801 | Ga0495611_0000341 | 3300046648 | Bacteria | 30353 |
| 802 | Ga0495611_0022375 | 3300046648 | Bacteria | 2735 |
| 803 | Ga0495611_0111971 | 3300046648 | Bacteria | 1271 |
| 804 | Ga0495611_0124837 | 3300046648 | Bacteria | 1200 |
| 805 | Ga0495625_0019023 | 3300046660 | Bacteria | 5345 |
| 806 | Ga0495625_0171136 | 3300046660 | Bacteria | 1450 |
| 807 | Ga0495635_0079173 | 3300046663 | Bacteria | 2249 |
| 808 | Ga0495635_0270524 | 3300046663 | Bacteria | 1143 |
| 809 | Ga0495661_0000190 | 3300046665 | Bacteria | 71131 |
| 810 | Ga0495661_0000610 | 3300046665 | Bacteria | 36400 |
| 811 | Ga0495661_0002382 | 3300046665 | Bacteria | 14514 |
| 812 | Ga0495661_0003409 | 3300046665 | Bacteria | 11750 |
| 813 | Ga0495661_0003497 | 3300046665 | Bacteria | 11571 |
| 814 | Ga0495661_0028623 | 3300046665 | Bacteria | 3564 |
| 815 | Ga0495661_0049201 | 3300046665 | Bacteria | 2557 |
| 816 | Ga0495661_0072142 | 3300046665 | Bacteria | 2015 |
| 817 | Ga0495661_0072472 | 3300046665 | Bacteria | 2009 |
| 818 | Ga0495661_0087065 | 3300046665 | Bacteria | 1787 |
| 819 | Ga0495661_0106889 | 3300046665 | Bacteria | 1565 |
| 820 | Ga0495588_0322351 | 3300046674 | Bacteria | 813 |
| 821 | Ga0495657_0105102 | 3300046675 | Bacteria | 1795 |
| 822 | Ga0495657_0134261 | 3300046675 | Bacteria | 1548 |
| 823 | Ga0495599_0043361 | 3300046678 | Bacteria | 2823 |
| 824 | Ga0495599_0081335 | 3300046678 | Bacteria | 2023 |
| 825 | Ga0495623_0034925 | 3300046679 | Bacteria | 3224 |
| 826 | Ga0495623_0040233 | 3300046679 | Bacteria | 2985 |
| 827 | Ga0495646_0017836 | 3300046680 | Bacteria | 4498 |
| 828 | Ga0495646_0101192 | 3300046680 | Bacteria | 1652 |
| 829 | Ga0495646_0120598 | 3300046680 | Bacteria | 1484 |
| 830 | Ga0495669_0021066 | 3300046684 | Bacteria | 2826 |
| 831 | Ga0495669_0042404 | 3300046684 | Bacteria | 2023 |
| 832 | Ga0495669_0092685 | 3300046684 | Bacteria | 1396 |
| 833 | Ga0495613_0006974 | 3300046689 | Bacteria | 8421 |
| 834 | Ga0495613_0113860 | 3300046689 | Bacteria | 1947 |
| 835 | Ga0495624_0005502 | 3300046690 | Bacteria | 9119 |
| 836 | Ga0495624_0053938 | 3300046690 | Bacteria | 2536 |
| 837 | Ga0495624_0068489 | 3300046690 | Bacteria | 2212 |
| 838 | Ga0495670_0035407 | 3300046691 | Bacteria | 2488 |
| 839 | Ga0495670_0215967 | 3300046691 | Bacteria | 1018 |
| 840 | Ga0495671_0000388 | 3300046692 | Bacteria | 36280 |
| 841 | Ga0495671_0001051 | 3300046692 | Bacteria | 19191 |
| 842 | Ga0495671_0065839 | 3300046692 | Bacteria | 1783 |
| 843 | Ga0495649_0000463 | 3300046694 | Bacteria | 34901 |
| 844 | Ga0495649_0002276 | 3300046694 | Bacteria | 13639 |
| 845 | Ga0495649_0008473 | 3300046694 | Bacteria | 6187 |
| 846 | Ga0495649_0081178 | 3300046694 | Bacteria | 1734 |
| 847 | Ga0495649_0229646 | 3300046694 | Bacteria | 958 |
| 848 | Ga0495649_0355283 | 3300046694 | Bacteria | 740 |
| 849 | Ga0495589_0002567 | 3300046794 | Bacteria | 10097 |
| 850 | Ga0495589_0014338 | 3300046794 | Bacteria | 4083 |
| 851 | Ga0495589_0027399 | 3300046794 | Bacteria | 2881 |
| 852 | Ga0495589_0045998 | 3300046794 | Bacteria | 2166 |
| 853 | Ga0495589_0067885 | 3300046794 | Bacteria | 1745 |
| 854 | Ga0495589_0076639 | 3300046794 | Bacteria | 1630 |
| 855 | Ga0495589_0212526 | 3300046794 | Bacteria | 910 |
| 856 | Ga0495600_0000982 | 3300046809 | Bacteria | 15361 |
| 857 | Ga0495660_0004921 | 3300046810 | Bacteria | 8049 |
| 858 | Ga0495660_0011842 | 3300046810 | Bacteria | 5058 |
| 859 | Ga0495660_0024088 | 3300046810 | Bacteria | 3468 |
| 860 | Ga0495660_0043377 | 3300046810 | Bacteria | 2481 |
| 861 | Ga0495660_0151094 | 3300046810 | Bacteria | 1146 |
| 862 | Ga0495581_0062062 | 3300047315 | Bacteria | 2159 |
| 863 | Ga0495581_0067607 | 3300047315 | Bacteria | 2066 |
| 864 | Ga0495604_0003076 | 3300047317 | Bacteria | 13342 |
| 865 | Ga0495604_0162934 | 3300047317 | Bacteria | 1574 |
| 866 | Ga0495604_0211021 | 3300047317 | Bacteria | 1342 |
| 867 | Ga0495604_0246909 | 3300047317 | Bacteria | 1218 |
| 868 | Ga0495636_0006493 | 3300047318 | Bacteria | 4596 |
| 869 | Ga0495674_0028018 | 3300047319 | Bacteria | 5142 |
| 870 | Ga0495674_0039429 | 3300047319 | Bacteria | 4234 |
| 871 | Ga0495674_0096950 | 3300047319 | Bacteria | 2512 |
| 872 | Ga0495674_0140669 | 3300047319 | Bacteria | 2029 |
| 873 | Ga0495674_0143624 | 3300047319 | Bacteria | 2004 |
| 874 | Ga0495672_0000186 | 3300047320 | Bacteria | 89947 |
| 875 | Ga0495672_0000649 | 3300047320 | Bacteria | 38619 |
| 876 | Ga0495672_0181486 | 3300047320 | Bacteria | 1065 |
| 877 | Ga0495676_0000037 | 3300047321 | Bacteria | 115856 |
| 878 | Ga0495676_0012523 | 3300047321 | Bacteria | 7637 |
| 879 | Ga0495676_0092176 | 3300047321 | Bacteria | 2262 |
| 880 | Ga0495676_0155587 | 3300047321 | Bacteria | 1622 |
| 881 | Ga0495680_0011582 | 3300047322 | Bacteria | 7795 |
| 882 | Ga0495683_0001297 | 3300047323 | Bacteria | 16887 |
| 883 | Ga0495683_0024273 | 3300047323 | Bacteria | 3112 |
| 884 | Ga0495683_0029031 | 3300047323 | Bacteria | 2827 |
| 885 | Ga0495683_0056039 | 3300047323 | Bacteria | 1961 |
| 886 | Ga0495687_000425 | 3300047443 | Bacteria | 52066 |
| 887 | Ga0495687_059549 | 3300047443 | Bacteria | 1579 |
| 888 | Ga0495675_0012706 | 3300047444 | Bacteria | 5300 |
| 889 | Ga0495675_0080046 | 3300047444 | Bacteria | 2058 |
| 890 | Ga0495677_0000276 | 3300047445 | Bacteria | 22535 |
| 891 | Ga0495677_0004922 | 3300047445 | Bacteria | 5092 |
| 892 | Ga0495677_0012036 | 3300047445 | Bacteria | 3158 |
| 893 | Ga0495677_0114481 | 3300047445 | Bacteria | 1026 |
| 894 | Ga0495677_0139451 | 3300047445 | Bacteria | 931 |
| 895 | Ga0495679_000062 | 3300047446 | Bacteria | 107181 |
| 896 | Ga0495679_000326 | 3300047446 | Bacteria | 37937 |
| 897 | Ga0495679_000552 | 3300047446 | Bacteria | 26335 |
| 898 | Ga0495679_002011 | 3300047446 | Bacteria | 10766 |
| 899 | Ga0495679_020772 | 3300047446 | Bacteria | 2281 |
| 900 | Ga0495673_0017319 | 3300047469 | Bacteria | 3664 |
| 901 | Ga0495681_0006426 | 3300047470 | Bacteria | 7728 |
| 902 | Ga0495681_0021361 | 3300047470 | Bacteria | 3491 |
| 903 | Ga0495681_0064699 | 3300047470 | Bacteria | 1674 |
| 904 | Ga0495684_0174601 | 3300047471 | Bacteria | 1596 |
| 905 | Ga0495684_0240071 | 3300047471 | Bacteria | 1322 |
| 906 | Ga0495686_0012926 | 3300047472 | Bacteria | 5821 |
| 907 | Ga0495686_0027160 | 3300047472 | Bacteria | 3739 |
| 908 | Ga0495686_0039853 | 3300047472 | Bacteria | 2998 |
| 909 | Ga0495593_0001237 | 3300047673 | Bacteria | 14948 |
| 910 | Ga0495593_0020488 | 3300047673 | Bacteria | 3704 |
| 911 | Ga0495593_0102804 | 3300047673 | Bacteria | 1464 |
| 912 | Ga0495602_0020770 | 3300048088 | Bacteria | 6482 |
| 913 | Ga0495602_0100794 | 3300048088 | Bacteria | 2370 |
| 914 | Ga0495614_0008933 | 3300048089 | Bacteria | 4445 |
| 915 | Ga0495614_0019082 | 3300048089 | Bacteria | 2968 |
| 916 | Ga0495614_0446895 | 3300048089 | Bacteria | 611 |
| 917 | Ga0495626_0000003 | 3300048091 | Bacteria | 427774 |
| 918 | Ga0495626_0000906 | 3300048091 | Bacteria | 26152 |
| 919 | Ga0495626_0001683 | 3300048091 | Bacteria | 17033 |
| 920 | Ga0495626_0003415 | 3300048091 | Bacteria | 10211 |
| 921 | Ga0495626_0003978 | 3300048091 | Bacteria | 9234 |
| 922 | Ga0495626_0006103 | 3300048091 | Bacteria | 6915 |
| 923 | Ga0495626_0039823 | 3300048091 | Bacteria | 2222 |
| 924 | Ga0495626_0045740 | 3300048091 | Bacteria | 2042 |
| 925 | Ga0495626_0169579 | 3300048091 | Bacteria | 910 |
| 926 | Ga0496100_0085559 | 3300048903 | Bacteria | 2140 |
| 927 | Ga0496100_0207202 | 3300048903 | Bacteria | 1432 |
| 928 | Ga0496101_0017498 | 3300048904 | Bacteria | 4862 |
| 929 | Ga0496101_0048938 | 3300048904 | Bacteria | 3039 |
| 930 | Ga0496101_0051760 | 3300048904 | Bacteria | 2960 |
| 931 | Ga0496101_0069132 | 3300048904 | Bacteria | 2583 |
| 932 | Ga0496102_0026169 | 3300048905 | Bacteria | 5200 |
| 933 | Ga0496102_0033317 | 3300048905 | Bacteria | 4628 |
| 934 | Ga0496102_0135675 | 3300048905 | Bacteria | 2306 |
| 935 | Ga0496102_0469738 | 3300048905 | Bacteria | 1179 |
| 936 | Ga0496102_0754792 | 3300048905 | Bacteria | 896 |
| 937 | Ga0496103_0094697 | 3300048906 | Bacteria | 1887 |
| 938 | Ga0496103_0197867 | 3300048906 | Bacteria | 1292 |
| 939 | Ga0496104_0004559 | 3300048907 | Bacteria | 12076 |
| 940 | Ga0496104_0149528 | 3300048907 | Bacteria | 2242 |
| 941 | Ga0496105_0010155 | 3300048908 | Bacteria | 7396 |
| 942 | Ga0496105_0141356 | 3300048908 | Bacteria | 1981 |
| 943 | Ga0496105_0184633 | 3300048908 | Bacteria | 1707 |
| 944 | Ga0496106_0001203 | 3300048909 | Bacteria | 19325 |
| 945 | Ga0496106_0018942 | 3300048909 | Bacteria | 5099 |
| 946 | Ga0496106_0472021 | 3300048909 | Bacteria | 1008 |
| 947 | Ga0496107_0078157 | 3300048910 | Bacteria | 2411 |
| 948 | Ga0496108_0265054 | 3300048911 | Bacteria | 1495 |
| 949 | Ga0496110_0000262 | 3300048913 | Bacteria | 34117 |
| 950 | Ga0496110_0270665 | 3300048913 | Bacteria | 1546 |
| 951 | Ga0496111_0637599 | 3300048914 | Bacteria | 778 |
| 952 | Ga0496112_0003465 | 3300048915 | Bacteria | 13044 |
| 953 | Ga0496112_0062528 | 3300048915 | Bacteria | 3672 |
| 954 | Ga0496112_0348801 | 3300048915 | Bacteria | 1423 |
| 955 | Ga0496112_0428893 | 3300048915 | Bacteria | 1260 |
| 956 | Ga0496113_0173090 | 3300048916 | Bacteria | 1710 |
| 957 | Ga0496114_0017203 | 3300048917 | Bacteria | 5832 |
| 958 | Ga0496116_0003752 | 3300048919 | Bacteria | 14856 |
| 959 | Ga0496116_0129961 | 3300048919 | Bacteria | 1438 |
| 960 | Ga0496117_0055350 | 3300048920 | Bacteria | 2772 |
| 961 | Ga0496117_0083648 | 3300048920 | Bacteria | 2085 |
| 962 | Ga0496117_0321185 | 3300048920 | Bacteria | 811 |
| 963 | Ga0496118_0027201 | 3300048921 | Bacteria | 4847 |
| 964 | Ga0496118_0034654 | 3300048921 | Bacteria | 4113 |
| 965 | Ga0496118_0112077 | 3300048921 | Bacteria | 1807 |
| 966 | Ga0496121_0004302 | 3300048924 | Bacteria | 19300 |
| 967 | Ga0496121_0018688 | 3300048924 | Bacteria | 6976 |
| 968 | Ga0496121_0049842 | 3300048924 | Bacteria | 3545 |
| 969 | Ga0496121_0139200 | 3300048924 | Bacteria | 1803 |
| 970 | Ga0496121_0237395 | 3300048924 | Bacteria | 1273 |
| 971 | Ga0496122_0000248 | 3300048925 | Bacteria | 121158 |
| 972 | Ga0496122_0009508 | 3300048925 | Bacteria | 10226 |
| 973 | Ga0496122_0044196 | 3300048925 | Bacteria | 3480 |
| 974 | Ga0496123_0000122 | 3300048926 | Bacteria | 158966 |
| 975 | Ga0496123_0004343 | 3300048926 | Bacteria | 15007 |
| 976 | Ga0496123_0127768 | 3300048926 | Bacteria | 1415 |
| 977 | Ga0496124_0101368 | 3300048927 | Bacteria | 2333 |
| 978 | Ga0496124_0149523 | 3300048927 | Bacteria | 1834 |
| 979 | Ga0496124_0241106 | 3300048927 | Bacteria | 1344 |
| 980 | Ga0496124_0556712 | 3300048927 | Bacteria | 756 |
| 981 | Ga0496125_0009189 | 3300048928 | Bacteria | 10214 |
| 982 | Ga0496125_0021547 | 3300048928 | Bacteria | 6008 |
| 983 | Ga0496125_0459558 | 3300048928 | Bacteria | 727 |
| 984 | Ga0496126_0472208 | 3300048929 | Bacteria | 1006 |
| 985 | Ga0496126_0574425 | 3300048929 | Bacteria | 891 |
| 986 | Ga0495678_000196 | 3300049459 | Bacteria | 70932 |
| 987 | Ga0495678_000487 | 3300049459 | Bacteria | 39369 |
| 988 | Ga0495678_001145 | 3300049459 | Bacteria | 22035 |
| 989 | Ga0495678_076916 | 3300049459 | Bacteria | 1208 |
| 990 | Ga0495682_0000080 | 3300049460 | Bacteria | 84736 |
| 991 | Ga0495682_0034323 | 3300049460 | Bacteria | 1871 |
| 992 | Ga0495682_0041407 | 3300049460 | Bacteria | 1688 |
| 993 | Ga0495682_0066514 | 3300049460 | Bacteria | 1299 |
| 994 | Ga0495682_0066659 | 3300049460 | Bacteria | 1297 |
| 995 | Ga0501067_0294999 | 3300049583 | Bacteria | 903 |
| 996 | Ga0501069_0499227 | 3300049585 | Bacteria | 726 |
| 997 | Ga0501072_0186237 | 3300049588 | Bacteria | 1656 |
| 998 | Ga0501035_0002771 | 3300049822 | Bacteria | 16977 |
| 999 | Ga0501045_0193725 | 3300049824 | Bacteria | 1515 |
| 1000 | nmdc:mga0k408_167074_c1 | 3300050493 | Bacteria | 944 |
| 1001 | nmdc:mga0qj67_90304_c1 | 3300050509 | Bacteria | 2461 |
| 1002 | nmdc:mga06r32_512193_c1 | 3300050510 | Bacteria | 1176 |
| 1003 | nmdc:mga08y16_26196_c1 | 3300050511 | Bacteria | 6149 |
| 1004 | nmdc:mga0n895_297787_c1 | 3300050512 | Bacteria | 1635 |
| 1005 | nmdc:mga08x19_318906_c1 | 3300050514 | Bacteria | 1081 |
| 1006 | nmdc:mga0a205_444181_c1 | 3300050515 | Bacteria | 1157 |
| 1007 | Ga0495601_0652944 | 3300053077 | Bacteria | 673 |
| 1008 | Ga0500636_0326636 | 3300053177 | Bacteria | 743 |
| 1009 | Ga0587093_032409 | 3300059478 | Bacteria | 758 |
| 1010 | Ga0587083_0000272 | 3300059505 | Bacteria | 4051 |
| 1011 | Ga0587083_0021676 | 3300059505 | Bacteria | 1196 |
| 1012 | Ga0587088_005302 | 3300059508 | Bacteria | 1686 |
| 1013 | Ga0466962_0005072 | 3300061719 | Bacteria | 6334 |
| 1014 | 2509127427 | 2508501125 | Bacteria | 7208311 |
| 1015 | 2512347647 | 2512047030 | Bacteria | 9031815 |
| 1016 | 2513555951 | 2513237082 | Bacteria | 8640282 |
| 1017 | 2515679310 | 2515154122 | Bacteria | 8609520 |
| 1018 | 2515688523 | 2515154123 | Bacteria | 6387382 |
| 1019 | 2516017123 | 2515154189 | Bacteria | 9629850 |
| 1020 | 2519457998 | 2519103095 | Bacteria | 6629912 |
| 1021 | 2527080287 | 2526164713 | Bacteria | 6780608 |
| 1022 | 2597030152 | 2596583598 | Bacteria | 5251611 |
| 1023 | 2599739301 | 2599185239 | Bacteria | 8686614 |
| 1024 | 2643798220 | 2643221556 | Bacteria | 7251154 |
| 1025 | 2644475223 | 2643221684 | Bacteria | 7145183 |
| 1026 | 2719639247 | 2718217991 | Bacteria | 7829542 |
| 1027 | 2753565956 | 2751185846 | Bacteria | 7242164 |
| 1028 | 2809144670 | 2808606418 | Bacteria | 6724496 |
| 1029 | 2819621011 | 2818991450 | Bacteria | 6962147 |
| 1030 | 2819632684 | 2818991452 | Bacteria | 8442785 |
| 1031 | 2842457930 | 2842454564 | Bacteria | 8730687 |
| 1032 | 2856290338 | 2856287931 | Bacteria | 7223934 |
| 1033 | 2857362637 | 2857357740 | Bacteria | 9937880 |
| 1034 | 2870068984 | 2870068957 | Bacteria | 8925310 |
| 1035 | 2885277195 | 2885270888 | Bacteria | 9831543 |
| 1036 | 2900636099 | 2900634093 | Bacteria | 10263517 |
| 1037 | 2904438279 | 2904434214 | Bacteria | 6230908 |
| 1038 | 2904565859 | 2904564687 | Bacteria | 7609577 |
| 1039 | 2904572902 | 2904571731 | Bacteria | 7608790 |
| 1040 | 2904620847 | 2904615490 | Bacteria | 10047340 |
| 1041 | 2919530049 | 2919527303 | Bacteria | 7718827 |
| 1042 | 2921644683 | 2921643360 | Bacteria | 11448031 |
| 1043 | 2928109814 | 2928108538 | Bacteria | 7360024 |
| 1044 | 2928136733 | 2928135762 | Bacteria | 7259641 |
| 1045 | 2928159728 | 2928157003 | Bacteria | 7522202 |
| 1046 | 2928173206 | 2928170801 | Bacteria | 8785406 |
| 1047 | 2928510466 | 2928503688 | Bacteria | 7268108 |
| 1048 | 2928538573 | 2928536128 | Bacteria | 7657547 |
| 1049 | 2981994171 | 2981990288 | Bacteria | 7590678 |
| 1050 | 640486038 | 640427133 | Bacteria | 4567418 |
| 1051 | 642422951 | 641736151 | Bacteria | 7477263 |
| 1052 | 642594108 | 642555112 | Bacteria | 8676562 |
| 1053 | 642620441 | 642555113 | Bacteria | 8214658 |
| 1054 | 8021122574 | 8021120328 | Bacteria | 8782274 |
| 1055 | 8021126695 | 8021120328 | Bacteria | 8782274 |
| 1056 | 8039099225 | 8039098773 | Bacteria | 6602928 |
| 1057 | 8040171716 | 8040167225 | Bacteria | 6542727 |
| 1058 | 8055266571 | 8055266321 | Bacteria | 7999742 |
| 1059 | Ga0496109_0053029 | |||
| 1060 | JGI24739J22299_10001077 | |||
| 1061 | JGI24748J21848_1018955 | |||
| 1062 | JGI25156J39149_1001449 | |||
| 1063 | JGI25159J45721_1007464 | |||
| 1064 | rootL2_10093023 | |||
| 1065 | rootL2_10280545 | |||
| 1066 | JGI25161J50226_1000115 | |||
| 1067 | Ga0055533_1000948 | |||
| 1068 | Ga0055533_1003019 | |||
| 1069 | Ga0055532_1000401 | |||
| 1070 | Ga0055525_1000246 | |||
| 1071 | Ga0055527_1000430 | |||
| 1072 | Ga0055527_1000691 | |||
| 1073 | Ga0055535_1000857 | |||
| 1074 | Ga0055542_1000846 | |||
| 1075 | Ga0055542_1001567 | |||
| 1076 | Ga0055529_1000614 | |||
| 1077 | Ga0055528_1006287 | |||
| 1078 | Ga0055541_1001121 | |||
| 1079 | Ga0055541_1006047 | |||
| 1080 | Ga0055543_1000094 | |||
| 1081 | Ga0065165_1000434 | |||
| 1082 | Ga0070658_10033009 | |||
| 1083 | Ga0070658_10056675 | |||
| 1084 | Ga0070658_10207871 | |||
| 1085 | Ga0070658_10237583 | |||
| 1086 | Ga0070658_10853105 | |||
| 1087 | Ga0070676_10000300 | |||
| 1088 | Ga0070676_10022641 | |||
| 1089 | Ga0070676_10058870 | |||
| 1090 | Ga0070676_10194777 | |||
| 1091 | Ga0070676_10314199 | |||
| 1092 | Ga0070683_100040268 | |||
| 1093 | Ga0070683_100064940 | |||
| 1094 | Ga0070683_100737784 | |||
| 1095 | Ga0070690_100001976 | |||
| 1096 | Ga0070670_100000010 | |||
| 1097 | Ga0070670_100197473 | |||
| 1098 | Ga0070677_10000444 | |||
| 1099 | Ga0068869_100019562 | |||
| 1100 | Ga0068869_100030702 | |||
| 1101 | Ga0070666_10000386 | |||
| 1102 | Ga0070666_10061649 | |||
| 1103 | Ga0070680_100614545 | |||
| 1104 | Ga0068868_100035991 | |||
| 1105 | Ga0068868_100085789 | |||
| 1106 | Ga0070660_100001619 | |||
| 1107 | Ga0070660_100048057 | |||
| 1108 | Ga0070660_100056007 | |||
| 1109 | Ga0070660_100071737 | |||
| 1110 | Ga0070660_100148020 | |||
| 1111 | Ga0070660_100164209 | |||
| 1112 | Ga0070660_100400821 | |||
| 1113 | Ga0070660_100657266 | |||
| 1114 | Ga0070689_100002818 | |||
| 1115 | Ga0070661_100048416 | |||
| 1116 | Ga0070661_100058648 | |||
| 1117 | Ga0070661_100179454 | |||
| 1118 | Ga0070668_100004602 | |||
| 1119 | Ga0070668_100328085 | |||
| 1120 | Ga0070669_100025920 | |||
| 1121 | Ga0070675_100000235 | |||
| 1122 | Ga0070671_100014294 | |||
| 1123 | Ga0070671_100025124 | |||
| 1124 | Ga0070671_100055767 | |||
| 1125 | Ga0070671_100181930 | |||
| 1126 | Ga0070674_100012603 | |||
| 1127 | Ga0070673_100002777 | |||
| 1128 | Ga0070673_100026921 | |||
| 1129 | Ga0070673_100096546 | |||
| 1130 | Ga0070673_100633665 | |||
| 1131 | Ga0070688_100000391 | |||
| 1132 | Ga0070688_100003549 | |||
| 1133 | Ga0070659_100007308 | |||
| 1134 | Ga0070659_100074498 | |||
| 1135 | Ga0070659_100117753 | |||
| 1136 | Ga0070659_100146558 | |||
| 1137 | Ga0070659_100719131 | |||
| 1138 | Ga0070659_101223010 | |||
| 1139 | Ga0070659_101251122 | |||
| 1140 | Ga0070667_100000124 | |||
| 1141 | Ga0070667_100012546 | |||
| 1142 | Ga0070667_100041759 | |||
| 1143 | Ga0070667_100541931 | |||
| 1144 | Ga0070709_10174418 | |||
| 1145 | Ga0070709_10376687 | |||
| 1146 | Ga0070709_10390742 | |||
| 1147 | Ga0070714_100024730 | |||
| 1148 | Ga0070714_100036938 | |||
| 1149 | Ga0070714_100066890 | |||
| 1150 | Ga0070714_100083062 | |||
| 1151 | Ga0070714_100415863 | |||
| 1152 | Ga0070713_100000093 | |||
| 1153 | Ga0070713_100016492 | |||
| 1154 | Ga0070713_100026608 | |||
| 1155 | Ga0070710_10019044 | |||
| 1156 | Ga0070710_10179433 | |||
| 1157 | Ga0070701_10263751 | |||
| 1158 | Ga0070711_100014795 | |||
| 1159 | Ga0070711_101305880 | |||
| 1160 | Ga0070705_100079533 | |||
| 1161 | Ga0070705_100385271 | |||
| 1162 | Ga0070694_100580750 | |||
| 1163 | Ga0070708_100122003 | |||
| 1164 | Ga0070663_100000499 | |||
| 1165 | Ga0070663_100001362 | |||
| 1166 | Ga0070663_100006870 | |||
| 1167 | Ga0070663_100360129 | |||
| 1168 | Ga0070678_100003783 | |||
| 1169 | Ga0070662_100793296 | |||
| 1170 | Ga0070681_10288673 | |||
| 1171 | Ga0068867_100003026 | |||
| 1172 | Ga0070685_10000001 | |||
| 1173 | Ga0070685_10001033 | |||
| 1174 | Ga0070685_10609338 | |||
| 1175 | Ga0070706_100038366 | |||
| 1176 | Ga0070707_100506148 | |||
| 1177 | Ga0070698_100392462 | |||
| 1178 | Ga0070699_100826473 | |||
| 1179 | Ga0070679_100041918 | |||
| 1180 | Ga0070679_100216812 | |||
| 1181 | Ga0070679_100228132 | |||
| 1182 | Ga0070679_100255006 | |||
| 1183 | Ga0070679_100308184 | |||
| 1184 | Ga0070679_100359158 | |||
| 1185 | Ga0070684_100045274 | |||
| 1186 | Ga0070684_100121421 | |||
| 1187 | Ga0070684_100369854 | |||
| 1188 | Ga0068853_100005939 | |||
| 1189 | Ga0068853_100212328 | |||
| 1190 | Ga0068853_100330016 | |||
| 1191 | Ga0070672_100004095 | |||
| 1192 | Ga0070672_100024487 | |||
| 1193 | Ga0070672_100167064 | |||
| 1194 | Ga0070672_100214528 | |||
| 1195 | Ga0070686_100392589 | |||
| 1196 | Ga0070686_100445155 | |||
| 1197 | Ga0070696_100842715 | |||
| 1198 | Ga0070693_100011666 | |||
| 1199 | Ga0070665_100003582 | |||
| 1200 | Ga0070665_100008038 | |||
| 1201 | Ga0070665_100016415 | |||
| 1202 | Ga0068855_100000446 | |||
| 1203 | Ga0068855_100078780 | |||
| 1204 | Ga0068855_100277610 | |||
| 1205 | Ga0068855_100427769 | |||
| 1206 | Ga0068855_100481728 | |||
| 1207 | Ga0068855_100871235 | |||
| 1208 | Ga0070664_100034625 | |||
| 1209 | Ga0070664_100046725 | |||
| 1210 | Ga0070664_100175803 | |||
| 1211 | Ga0070664_100540038 | |||
| 1212 | Ga0068854_100067432 | |||
| 1213 | Ga0068854_100193913 | |||
| 1214 | Ga0068854_100363625 | |||
| 1215 | Ga0068854_100858646 | |||
| 1216 | Ga0068856_100064505 | |||
| 1217 | Ga0070702_100207958 | |||
| 1218 | Ga0068852_100000557 | |||
| 1219 | Ga0068852_100005163 | |||
| 1220 | Ga0068852_100012738 | |||
| 1221 | Ga0068852_100022774 | |||
| 1222 | Ga0068852_100173074 | |||
| 1223 | Ga0068852_100183393 | |||
| 1224 | Ga0068852_100277326 | |||
| 1225 | Ga0068852_100391862 | |||
| 1226 | Ga0068852_101415146 | |||
| 1227 | Ga0068859_100056556 | |||
| 1228 | Ga0068859_100063075 | |||
| 1229 | Ga0068859_100202306 | |||
| 1230 | Ga0068864_100000018 | |||
| 1231 | Ga0068864_100001480 | |||
| 1232 | Ga0068861_100406726 | |||
| 1233 | Ga0068861_100929172 | |||
| 1234 | Ga0068861_100998374 | |||
| 1235 | Ga0068851_10002512 | |||
| 1236 | Ga0068851_10003593 | |||
| 1237 | Ga0068851_10021814 | |||
| 1238 | Ga0068851_10177868 | |||
| 1239 | Ga0068870_10011536 | |||
| 1240 | Ga0068870_10074022 | |||
| 1241 | Ga0068863_100008456 | |||
| 1242 | Ga0068863_100125206 | |||
| 1243 | Ga0068863_101022489 | |||
| 1244 | Ga0068858_100009965 | |||
| 1245 | Ga0068858_100223217 | |||
| 1246 | Ga0068860_100000736 | |||
| 1247 | Ga0068860_100068491 | |||
| 1248 | Ga0068860_100072712 | |||
| 1249 | Ga0068862_100573438 | |||
| 1250 | Ga0081539_10001028 | |||
| 1251 | Ga0070717_10143372 | |||
| 1252 | Ga0070716_100008148 | |||
| 1253 | Ga0070716_100455564 | |||
| 1254 | Ga0070712_100100990 | |||
| 1255 | Ga0070712_100230844 | |||
| 1256 | Ga0075366_10100668 | |||
| 1257 | Ga0075366_10129117 | |||
| 1258 | Ga0097621_100023861 | |||
| 1259 | Ga0097621_100226125 | |||
| 1260 | Ga0068871_100044715 | |||
| 1261 | Ga0068871_100608013 | |||
| 1262 | Ga0075430_100122232 | |||
| 1263 | Ga0075434_100192697 | |||
| 1264 | Ga0068865_100383428 | |||
| 1265 | Ga0075436_100058459 | |||
| 1266 | Ga0097620_100056549 | |||
| 1267 | Ga0097620_100063074 | |||
| 1268 | Ga0097620_100202324 | |||
| 1269 | Ga0075435_100389573 | |||
| 1270 | Ga0105251_10003483 | |||
| 1271 | Ga0105251_10117833 | |||
| 1272 | Ga0105250_10036182 | |||
| 1273 | Ga0105240_10066908 | |||
| 1274 | Ga0105240_10356211 | |||
| 1275 | Ga0105240_10367061 | |||
| 1276 | Ga0105240_10428861 | |||
| 1277 | Ga0105240_10555605 | |||
| 1278 | Ga0111539_10028815 | |||
| 1279 | Ga0105245_10059875 | |||
| 1280 | Ga0105245_11630101 | |||
| 1281 | Ga0105247_10003623 | |||
| 1282 | Ga0105247_10050287 | |||
| 1283 | Ga0105243_10024540 | |||
| 1284 | Ga0105243_11727046 | |||
| 1285 | Ga0105241_10007108 | |||
| 1286 | Ga0105241_10055307 | |||
| 1287 | Ga0105241_10216202 | |||
| 1288 | Ga0105242_10022479 | |||
| 1289 | Ga0105242_10269707 | |||
| 1290 | Ga0105248_10028584 | |||
| 1291 | Ga0105248_10733966 | |||
| 1292 | Ga0105237_10016306 | |||
| 1293 | Ga0105237_10126806 | |||
| 1294 | Ga0105237_10145172 | |||
| 1295 | Ga0105237_10331166 | |||
| 1296 | Ga0105238_10017261 | |||
| 1297 | Ga0105238_10020728 | |||
| 1298 | Ga0105238_10076951 | |||
| 1299 | Ga0105238_10142432 | |||
| 1300 | Ga0105238_10456731 | |||
| 1301 | Ga0105249_10039672 | |||
| 1302 | Ga0105249_10110467 | |||
| 1303 | Ga0105249_11546349 | |||
| 1304 | Ga0105239_10005029 | |||
| 1305 | Ga0105239_10073052 | |||
| 1306 | Ga0105239_10204498 | |||
| 1307 | Ga0105239_11086198 | |||
| 1308 | Ga0105246_10083341 | |||
| 1309 | Ga0105246_10634285 | |||
| 1310 | Ga0157373_10026681 | |||
| 1311 | Ga0157373_10028005 | |||
| 1312 | Ga0157373_10159381 | |||
| 1313 | Ga0157373_10218121 | |||
| 1314 | Ga0157371_10000787 | |||
| 1315 | Ga0157371_10010442 | |||
| 1316 | Ga0157371_10176789 | |||
| 1317 | Ga0157370_10066110 | |||
| 1318 | Ga0157370_10084826 | |||
| 1319 | Ga0157370_10520106 | |||
| 1320 | Ga0157369_10000233 | |||
| 1321 | Ga0157369_10151219 | |||
| 1322 | Ga0157369_10650420 | |||
| 1323 | Ga0157369_11010194 | |||
| 1324 | Ga0157374_10000102 | |||
| 1325 | Ga0157374_10000922 | |||
| 1326 | Ga0157374_10477807 | |||
| 1327 | Ga0157378_10196590 | |||
| 1328 | Ga0157378_11403798 | |||
| 1329 | Ga0163162_10072103 | |||
| 1330 | Ga0163162_10429519 | |||
| 1331 | Ga0163162_11335935 | |||
| 1332 | Ga0157372_10015261 | |||
| 1333 | Ga0157372_10045705 | |||
| 1334 | Ga0157372_10093274 | |||
| 1335 | Ga0157372_10110309 | |||
| 1336 | Ga0157372_10126617 | |||
| 1337 | Ga0157372_10169840 | |||
| 1338 | Ga0157372_10182283 | |||
| 1339 | Ga0157372_10212457 | |||
| 1340 | Ga0157372_10224781 | |||
| 1341 | Ga0157372_10229050 | |||
| 1342 | Ga0157372_10543868 | |||
| 1343 | Ga0157372_11675352 | |||
| 1344 | Ga0157375_10000781 | |||
| 1345 | Ga0157375_10061164 | |||
| 1346 | Ga0157375_10114100 | |||
| 1347 | Ga0157375_10185244 | |||
| 1348 | Ga0163163_10000203 | |||
| 1349 | Ga0163163_10008748 | |||
| 1350 | Ga0157380_10000221 | |||
| 1351 | Ga0157380_10757852 | |||
| 1352 | Ga0182008_10020983 | |||
| 1353 | Ga0182008_10028409 | |||
| 1354 | Ga0157379_10157007 | |||
| 1355 | Ga0157379_10595425 | |||
| 1356 | Ga0157376_10017970 | |||
| 1357 | Ga0157376_10109229 | |||
| 1358 | Ga0157376_10546062 | |||
| 1359 | Ga0182006_1000392 | |||
| 1360 | Ga0182006_1076350 | |||
| 1361 | Ga0182007_10000207 | |||
| 1362 | Ga0182007_10007661 | |||
| 1363 | Ga0182007_10017454 | |||
| 1364 | Ga0182005_1002413 | |||
| 1365 | Ga0183361_10030 | |||
| 1366 | Ga0206356_10936544 | |||
| 1367 | Ga0206353_11819478 | |||
| 1368 | Ga0206353_11871602 | |||
| 1369 | Ga0213872_10109157 | |||
| 1370 | Ga0209436_100042 | |||
| 1371 | Ga0209784_101038 | |||
| 1372 | Ga0209566_100200 | |||
| 1373 | Ga0209566_100554 | |||
| 1374 | Ga0209566_100564 | |||
| 1375 | Ga0209674_100150 | |||
| 1376 | Ga0209674_100382 | |||
| 1377 | Ga0209674_100813 | |||
| 1378 | Ga0209672_100028 | |||
| 1379 | Ga0209672_100489 | |||
| 1380 | Ga0209672_100496 | |||
| 1381 | Ga0209147_100117 | |||
| 1382 | Ga0209563_100007 | |||
| 1383 | Ga0209563_109555 | |||
| 1384 | Ga0209258_100112 | |||
| 1385 | Ga0209677_102157 | |||
| 1386 | Ga0209677_102170 | |||
| 1387 | Ga0209677_107693 | |||
| 1388 | Ga0209148_1000043 | |||
| 1389 | Ga0209148_1000314 | |||
| 1390 | Ga0209759_1000379 | |||
| 1391 | Ga0209759_1000711 | |||
| 1392 | Ga0209759_1003670 | |||
| 1393 | Ga0209455_1000050 | |||
| 1394 | Ga0209673_1000070 | |||
| 1395 | Ga0209130_1000227 | |||
| 1396 | Ga0209564_1012617 | |||
| 1397 | Ga0207656_10001586 | |||
| 1398 | Ga0207696_1032103 | |||
| 1399 | Ga0207713_1000451 | |||
| 1400 | Ga0207682_10000165 | |||
| 1401 | Ga0207692_10079765 | |||
| 1402 | Ga0207710_10003333 | |||
| 1403 | Ga0207680_10000251 | |||
| 1404 | Ga0207680_10035280 | |||
| 1405 | Ga0207680_10178994 | |||
| 1406 | Ga0207680_10324634 | |||
| 1407 | Ga0207647_10013556 | |||
| 1408 | Ga0207647_10041727 | |||
| 1409 | Ga0207647_10052298 | |||
| 1410 | Ga0207685_10029894 | |||
| 1411 | Ga0207699_10054253 | |||
| 1412 | Ga0207699_10102794 | |||
| 1413 | Ga0207645_10000045 | |||
| 1414 | Ga0207645_10064008 | |||
| 1415 | Ga0207643_10026319 | |||
| 1416 | Ga0207705_10201515 | |||
| 1417 | Ga0207705_10216104 | |||
| 1418 | Ga0207705_10267288 | |||
| 1419 | Ga0207705_10270781 | |||
| 1420 | Ga0207705_10435750 | |||
| 1421 | Ga0207684_10321716 | |||
| 1422 | Ga0207654_10004639 | |||
| 1423 | Ga0207654_10453351 | |||
| 1424 | Ga0207707_10206517 | |||
| 1425 | Ga0207707_10412914 | |||
| 1426 | Ga0207707_10489963 | |||
| 1427 | Ga0207695_10008527 | |||
| 1428 | Ga0207695_10011136 | |||
| 1429 | Ga0207695_10182686 | |||
| 1430 | Ga0207695_10345555 | |||
| 1431 | Ga0207671_10030279 | |||
| 1432 | Ga0207671_10067076 | |||
| 1433 | Ga0207671_10357269 | |||
| 1434 | Ga0207671_10375187 | |||
| 1435 | Ga0207693_10004419 | |||
| 1436 | Ga0207693_10016506 | |||
| 1437 | Ga0207693_10226295 | |||
| 1438 | Ga0207663_10062311 | |||
| 1439 | Ga0207660_10184347 | |||
| 1440 | Ga0207660_10253446 | |||
| 1441 | Ga0207657_10000258 | |||
| 1442 | Ga0207657_10002002 | |||
| 1443 | Ga0207657_10005627 | |||
| 1444 | Ga0207657_10006421 | |||
| 1445 | Ga0207657_10017533 | |||
| 1446 | Ga0207657_10064037 | |||
| 1447 | Ga0207657_10139774 | |||
| 1448 | Ga0207657_10322984 | |||
| 1449 | Ga0207649_10005560 | |||
| 1450 | Ga0207649_10361529 | |||
| 1451 | Ga0207652_10024741 | |||
| 1452 | Ga0207652_10095051 | |||
| 1453 | Ga0207652_10123673 | |||
| 1454 | Ga0207681_10013915 | |||
| 1455 | Ga0207681_10145539 | |||
| 1456 | Ga0207694_10052663 | |||
| 1457 | Ga0207694_10101106 | |||
| 1458 | Ga0207694_10117754 | |||
| 1459 | Ga0207694_10335509 | |||
| 1460 | Ga0207650_10000003 | |||
| 1461 | Ga0207650_10037386 | |||
| 1462 | Ga0207650_10063290 | |||
| 1463 | Ga0207659_10014293 | |||
| 1464 | Ga0207687_10005040 | |||
| 1465 | Ga0207687_10132360 | |||
| 1466 | Ga0207687_10769199 | |||
| 1467 | Ga0207700_10000214 | |||
| 1468 | Ga0207700_10038855 | |||
| 1469 | Ga0207664_10000853 | |||
| 1470 | Ga0207664_10007991 | |||
| 1471 | Ga0207664_10047207 | |||
| 1472 | Ga0207664_10086947 | |||
| 1473 | Ga0207664_10155402 | |||
| 1474 | Ga0207644_10011801 | |||
| 1475 | Ga0207644_10014141 | |||
| 1476 | Ga0207644_10137141 | |||
| 1477 | Ga0207690_10000485 | |||
| 1478 | Ga0207690_10100810 | |||
| 1479 | Ga0207690_10355801 | |||
| 1480 | Ga0207706_10000023 | |||
| 1481 | Ga0207706_10340931 | |||
| 1482 | Ga0207706_10713632 | |||
| 1483 | Ga0207686_10012630 | |||
| 1484 | Ga0207686_10229876 | |||
| 1485 | Ga0207709_10007786 | |||
| 1486 | Ga0207670_10005050 | |||
| 1487 | Ga0207669_10002574 | |||
| 1488 | Ga0207665_10009098 | |||
| 1489 | Ga0207665_10052787 | |||
| 1490 | Ga0207665_10655475 | |||
| 1491 | Ga0207691_10000279 | |||
| 1492 | Ga0207691_10019010 | |||
| 1493 | Ga0207711_10000087 | |||
| 1494 | Ga0207711_10091412 | |||
| 1495 | Ga0207689_10027196 | |||
| 1496 | Ga0207689_10076115 | |||
| 1497 | Ga0207679_10025570 | |||
| 1498 | Ga0207679_10131717 | |||
| 1499 | Ga0207679_10497595 | |||
| 1500 | Ga0207679_11401621 | |||
| 1501 | Ga0207667_10002136 | |||
| 1502 | Ga0207667_10003269 | |||
| 1503 | Ga0207667_10004129 | |||
| 1504 | Ga0207667_10094099 | |||
| 1505 | Ga0207667_10132077 | |||
| 1506 | Ga0207667_10217078 | |||
| 1507 | Ga0207667_10241309 | |||
| 1508 | Ga0207667_11650123 | |||
| 1509 | Ga0207651_10008555 | |||
| 1510 | Ga0207651_10019463 | |||
| 1511 | Ga0207712_10018021 | |||
| 1512 | Ga0207712_10181914 | |||
| 1513 | Ga0207712_11138569 | |||
| 1514 | Ga0207668_10002332 | |||
| 1515 | Ga0207668_10005740 | |||
| 1516 | Ga0207668_10595752 | |||
| 1517 | Ga0207640_10062101 | |||
| 1518 | Ga0207640_10204607 | |||
| 1519 | Ga0207640_10482341 | |||
| 1520 | Ga0207658_10000007 | |||
| 1521 | Ga0207658_10009855 | |||
| 1522 | Ga0207658_10040299 | |||
| 1523 | Ga0207658_10462105 | |||
| 1524 | Ga0207677_10003044 | |||
| 1525 | Ga0207677_10004160 | |||
| 1526 | Ga0207677_10208152 | |||
| 1527 | Ga0207703_10000522 | |||
| 1528 | Ga0207703_10389424 | |||
| 1529 | Ga0207639_10280920 | |||
| 1530 | Ga0207678_10000110 | |||
| 1531 | Ga0207678_10017290 | |||
| 1532 | Ga0207678_10462816 | |||
| 1533 | Ga0207702_10000523 | |||
| 1534 | Ga0207702_10024567 | |||
| 1535 | Ga0207702_10056187 | |||
| 1536 | Ga0207702_10214039 | |||
| 1537 | Ga0207702_10686431 | |||
| 1538 | Ga0207702_11265912 | |||
| 1539 | Ga0207641_10029599 | |||
| 1540 | Ga0207641_10065135 | |||
| 1541 | Ga0207641_10118174 | |||
| 1542 | Ga0207648_10031644 | |||
| 1543 | Ga0207676_10000003 | |||
| 1544 | Ga0207676_10000140 | |||
| 1545 | Ga0207674_10000429 | |||
| 1546 | Ga0207674_10013722 | |||
| 1547 | Ga0207674_10364123 | |||
| 1548 | Ga0207675_100032799 | |||
| 1549 | Ga0207675_100459906 | |||
| 1550 | Ga0207683_10000003 | |||
| 1551 | Ga0207683_10758906 | |||
| 1552 | Ga0207698_10004881 | |||
| 1553 | Ga0207698_10005292 | |||
| 1554 | Ga0207698_10009962 | |||
| 1555 | Ga0207698_10031754 | |||
| 1556 | Ga0207698_10096150 | |||
| 1557 | Ga0207698_10165424 | |||
| 1558 | Ga0207698_10496802 | |||
| 1559 | Ga0207698_10576101 | |||
| 1560 | Ga0209982_1007869 | |||
| 1561 | Ga0209970_1005309 | |||
| 1562 | Ga0209970_1031695 | |||
| 1563 | Ga0209983_1034448 | |||
| 1564 | Ga0209974_10008582 | |||
| 1565 | Ga0209974_10068229 | |||
| 1566 | Ga0207428_10075422 | |||
| 1567 | Ga0268266_10019939 | |||
| 1568 | Ga0268266_10034141 | |||
| 1569 | Ga0268266_10051803 | |||
| 1570 | Ga0268266_10237247 | |||
| 1571 | Ga0268265_10563480 | |||
| 1572 | Ga0268265_11803300 | |||
| 1573 | Ga0268264_10000009 | |||
| 1574 | Ga0268264_10012993 | |||
| 1575 | Ga0268264_10054042 | |||
| 1576 | Ga0265338_10237083 | |||
| 1577 | Ga0265325_10007758 | |||
| 1578 | Ga0265340_10196935 | |||
| 1579 | Ga0307408_100398843 | |||
| 1580 | Ga0265313_10039139 | |||
| 1581 | Ga0316575_10015854 | |||
| 1582 | Ga0265314_10046941 | |||
| 1583 | Ga0265314_10370427 | |||
| 1584 | Ga0373944_0276158 | |||
| 1585 | Ga0373923_0030460 | |||
| 1586 | Ga0373939_0073568 | |||
| 1587 | Ga0373953_0003388 | |||
| 1588 | Ga0373954_0014040 | |||
| 1589 | Ga0373956_0011700 | |||
| 1590 | Ga0373957_0048357 | |||
| 1591 | Ga0373943_0101847 | |||
| 1592 | Ga0373946_0173801 | |||
| 1593 | Ga0373955_0003437 | |||
| 1594 | Ga0373961_0045587 | |||
| 1595 | Ga0373924_0027321 | |||
| 1596 | Ga0373935_0135543 | |||
| 1597 | Ga0373935_0210066 | |||
| 1598 | Ga0373935_0653050 | |||
| 1599 | Ga0373927_0158821 | |||
| 1600 | Ga0373927_0335905 | |||
| 1601 | Ga0373933_0028881 | |||
| 1602 | Ga0373933_0073764 | |||
| 1603 | Ga0373947_0015124 | |||
| 1604 | Ga0373947_0190505 | |||
| 1605 | Ga0373937_0095041 | |||
| 1606 | Ga0395899_0000613 | |||
| 1607 | Ga0395899_0002073 | |||
| 1608 | Ga0395899_0021960 | |||
| 1609 | Ga0395899_0028388 | |||
| 1610 | Ga0395899_0044157 | |||
| 1611 | Ga0395899_0050305 | |||
| 1612 | Ga0395899_0110211 | |||
| 1613 | Ga0395899_0128593 | |||
| 1614 | Ga0395899_0391563 | |||
| 1615 | Ga0395899_0499591 | |||
| 1616 | Ga0395900_0000167 | |||
| 1617 | Ga0395900_0000435 | |||
| 1618 | Ga0395900_0000540 | |||
| 1619 | Ga0395900_0001484 | |||
| 1620 | Ga0395900_0001683 | |||
| 1621 | Ga0395900_0002454 | |||
| 1622 | Ga0395900_0003153 | |||
| 1623 | Ga0395900_0018721 | |||
| 1624 | Ga0395900_0028593 | |||
| 1625 | Ga0395900_0051797 | |||
| 1626 | Ga0395900_0064970 | |||
| 1627 | Ga0395900_0099821 | |||
| 1628 | Ga0395900_0110854 | |||
| 1629 | Ga0395900_0267165 | |||
| 1630 | Ga0395900_0284405 | |||
| 1631 | Ga0395900_0377387 | |||
| 1632 | Ga0395900_0431669 | |||
| 1633 | Ga0395898_0001362 | |||
| 1634 | Ga0395898_0004238 | |||
| 1635 | Ga0395898_0006962 | |||
| 1636 | Ga0395898_0010949 | |||
| 1637 | Ga0395898_0020629 | |||
| 1638 | Ga0395898_0024435 | |||
| 1639 | Ga0395898_0051244 | |||
| 1640 | Ga0395898_0135440 | |||
| 1641 | Ga0395898_0144130 | |||
| 1642 | Ga0395898_0206678 | |||
| 1643 | Ga0395898_0277599 | |||
| 1644 | Ga0395898_0310840 | |||
| 1645 | Ga0395898_0421554 | |||
| 1646 | Ga0395898_0752982 | |||
| 1647 | Ga0395905_0031572 | |||
| 1648 | Ga0395905_0045196 | |||
| 1649 | Ga0395905_0091497 | |||
| 1650 | Ga0395905_0258945 | |||
| 1651 | Ga0395905_0553301 | |||
| 1652 | Ga0395901_0000154 | |||
| 1653 | Ga0395901_0000441 | |||
| 1654 | Ga0395901_0002340 | |||
| 1655 | Ga0395901_0007582 | |||
| 1656 | Ga0395901_0028365 | |||
| 1657 | Ga0395901_0058843 | |||
| 1658 | Ga0395901_0069786 | |||
| 1659 | Ga0395901_0075865 | |||
| 1660 | Ga0395901_0092933 | |||
| 1661 | Ga0395901_0096836 | |||
| 1662 | Ga0395901_0099256 | |||
| 1663 | Ga0395901_0148567 | |||
| 1664 | Ga0395901_0466532 | |||
| 1665 | Ga0395901_0514954 | |||
| 1666 | Ga0436365_0002256 | |||
| 1667 | Ga0436361_0849159 | |||
| 1668 | Ga0451807_1097321 | |||
| 1669 | Ga0451807_2387373 | |||
| 1670 | Ga0451853_1554031 | |||
| 1671 | Ga0439448_0017988 | |||
| 1672 | Ga0439448_0176440 | |||
| 1673 | Ga0451577_0547041 | |||
| 1674 | Ga0466969_0007501 | |||
| 1675 | Ga0466969_0064157 | |||
| 1676 | Ga0466972_0000883 | |||
| 1677 | Ga0466982_0120675 | |||
| 1678 | Ga0453683_0770715 | |||
| 1679 | Ga0466965_0023752 | |||
| 1680 | Ga0466966_0000401 | |||
| 1681 | Ga0466966_0008592 | |||
| 1682 | Ga0466966_0015451 | |||
| 1683 | Ga0466966_0338917 | |||
| 1684 | Ga0466961_0002662 | |||
| 1685 | Ga0466961_0082206 | |||
| 1686 | Ga0466961_0423144 | |||
| 1687 | Ga0466963_0081735 | |||
| 1688 | Ga0466963_0313653 | |||
| 1689 | Ga0466964_0000063 | |||
| 1690 | Ga0466964_0025320 | |||
| 1691 | Ga0466964_0132676 | |||
| 1692 | Ga0453684_0159650 | |||
| 1693 | Ga0466971_0011629 | |||
| 1694 | Ga0466957_0006532 | |||
| 1695 | Ga0466957_0006885 | |||
| 1696 | Ga0466959_0001459 | |||
| 1697 | Ga0466959_0092665 | |||
| 1698 | Ga0451576_0014936 | |||
| 1699 | Ga0451576_0319372 | |||
| 1700 | Ga0451576_0728895 | |||
| 1701 | Ga0466958_0029306 | |||
| 1702 | Ga0466958_0041926 | |||
| 1703 | Ga0466967_0577695 | |||
| 1704 | Ga0495617_000086 | |||
| 1705 | Ga0495617_078298 | |||
| 1706 | Ga0495592_0009580 | |||
| 1707 | Ga0495592_0202365 | |||
| 1708 | Ga0495603_0002780 | |||
| 1709 | Ga0495603_0013453 | |||
| 1710 | Ga0495603_0326769 | |||
| 1711 | Ga0495590_0000017 | |||
| 1712 | Ga0495590_0000313 | |||
| 1713 | Ga0495590_0027555 | |||
| 1714 | Ga0495590_0042277 | |||
| 1715 | Ga0495590_0112897 | |||
| 1716 | Ga0495591_000099 | |||
| 1717 | Ga0495591_003399 | |||
| 1718 | Ga0495591_010525 | |||
| 1719 | Ga0495629_0079790 | |||
| 1720 | Ga0495638_0026219 | |||
| 1721 | Ga0495653_0135177 | |||
| 1722 | Ga0495653_0226347 | |||
| 1723 | Ga0495653_0306845 | |||
| 1724 | Ga0495653_0340745 | |||
| 1725 | Ga0495650_0000015 | |||
| 1726 | Ga0495650_0013587 | |||
| 1727 | Ga0495650_0038566 | |||
| 1728 | Ga0495580_0001658 | |||
| 1729 | Ga0495580_0003991 | |||
| 1730 | Ga0495580_0004314 | |||
| 1731 | Ga0495580_0006790 | |||
| 1732 | Ga0495580_0007817 | |||
| 1733 | Ga0495580_0277580 | |||
| 1734 | Ga0495580_0278877 | |||
| 1735 | Ga0495582_0029504 | |||
| 1736 | Ga0495582_0084210 | |||
| 1737 | Ga0495605_0001241 | |||
| 1738 | Ga0495605_0011473 | |||
| 1739 | Ga0495605_0175575 | |||
| 1740 | Ga0495662_0084964 | |||
| 1741 | Ga0495664_0006370 | |||
| 1742 | Ga0495664_0054029 | |||
| 1743 | Ga0495664_0062569 | |||
| 1744 | Ga0495584_0000043 | |||
| 1745 | Ga0495584_0000304 | |||
| 1746 | Ga0495584_0000321 | |||
| 1747 | Ga0495584_0001042 | |||
| 1748 | Ga0495584_0002286 | |||
| 1749 | Ga0495584_0033749 | |||
| 1750 | Ga0495584_0067276 | |||
| 1751 | Ga0495585_0001199 | |||
| 1752 | Ga0495585_0006971 | |||
| 1753 | Ga0495585_0012689 | |||
| 1754 | Ga0495585_0015432 | |||
| 1755 | Ga0495585_0030744 | |||
| 1756 | Ga0495585_0368071 | |||
| 1757 | Ga0495594_0007213 | |||
| 1758 | Ga0495594_0306623 | |||
| 1759 | Ga0495596_0006572 | |||
| 1760 | Ga0495596_0012491 | |||
| 1761 | Ga0495596_0019524 | |||
| 1762 | Ga0495596_0019766 | |||
| 1763 | Ga0495596_0060737 | |||
| 1764 | Ga0495596_0061621 | |||
| 1765 | Ga0495596_0064085 | |||
| 1766 | Ga0495607_0000892 | |||
| 1767 | Ga0495607_0001281 | |||
| 1768 | Ga0495607_0004475 | |||
| 1769 | Ga0495607_0026604 | |||
| 1770 | Ga0495607_0137627 | |||
| 1771 | Ga0495607_0152079 | |||
| 1772 | Ga0495607_0278106 | |||
| 1773 | Ga0495583_0001132 | |||
| 1774 | Ga0495583_0001553 | |||
| 1775 | Ga0495583_0005103 | |||
| 1776 | Ga0495583_0005285 | |||
| 1777 | Ga0495583_0009451 | |||
| 1778 | Ga0495606_0003768 | |||
| 1779 | Ga0495606_0033616 | |||
| 1780 | Ga0495606_0151145 | |||
| 1781 | Ga0495606_0230712 | |||
| 1782 | Ga0495606_0542686 | |||
| 1783 | Ga0495610_0001471 | |||
| 1784 | Ga0495616_0013633 | |||
| 1785 | Ga0495616_0026336 | |||
| 1786 | Ga0495616_0063197 | |||
| 1787 | Ga0495618_0001931 | |||
| 1788 | Ga0495618_0046153 | |||
| 1789 | Ga0495620_0040908 | |||
| 1790 | Ga0495628_0040523 | |||
| 1791 | Ga0495628_0104192 | |||
| 1792 | Ga0495628_0191751 | |||
| 1793 | Ga0495628_0230789 | |||
| 1794 | Ga0495628_0300415 | |||
| 1795 | Ga0495630_0018650 | |||
| 1796 | Ga0495630_0045828 | |||
| 1797 | Ga0495630_0117643 | |||
| 1798 | Ga0495630_0249048 | |||
| 1799 | Ga0495631_0005556 | |||
| 1800 | Ga0495631_0006423 | |||
| 1801 | Ga0495631_0030600 | |||
| 1802 | Ga0495632_0000139 | |||
| 1803 | Ga0495632_0001117 | |||
| 1804 | Ga0495632_0028718 | |||
| 1805 | Ga0495637_0000026 | |||
| 1806 | Ga0495637_0029807 | |||
| 1807 | Ga0495637_0071775 | |||
| 1808 | Ga0495643_0000435 | |||
| 1809 | Ga0495643_0012063 | |||
| 1810 | Ga0495643_0018297 | |||
| 1811 | Ga0495644_0010160 | |||
| 1812 | Ga0495644_0110357 | |||
| 1813 | Ga0495648_0000839 | |||
| 1814 | Ga0495648_0049487 | |||
| 1815 | Ga0495648_0087024 | |||
| 1816 | Ga0495648_0115739 | |||
| 1817 | Ga0495666_0012950 | |||
| 1818 | Ga0495666_0027659 | |||
| 1819 | Ga0495642_0007863 | |||
| 1820 | Ga0495642_0013195 | |||
| 1821 | Ga0495642_0025668 | |||
| 1822 | Ga0495642_0052486 | |||
| 1823 | Ga0495642_0071276 | |||
| 1824 | Ga0495652_0145973 | |||
| 1825 | Ga0495652_0340563 | |||
| 1826 | Ga0495654_0102933 | |||
| 1827 | Ga0495665_0013876 | |||
| 1828 | Ga0495665_0059668 | |||
| 1829 | Ga0495665_0068309 | |||
| 1830 | Ga0495665_0216069 | |||
| 1831 | Ga0495640_0057329 | |||
| 1832 | Ga0495586_0010988 | |||
| 1833 | Ga0495587_0008224 | |||
| 1834 | Ga0495587_0126287 | |||
| 1835 | Ga0495598_0033960 | |||
| 1836 | Ga0495609_0000262 | |||
| 1837 | Ga0495609_0000385 | |||
| 1838 | Ga0495609_0063615 | |||
| 1839 | Ga0495609_0107677 | |||
| 1840 | Ga0495621_0011231 | |||
| 1841 | Ga0495597_0015276 | |||
| 1842 | Ga0495597_0018863 | |||
| 1843 | Ga0495645_0025086 | |||
| 1844 | Ga0495645_0226210 | |||
| 1845 | Ga0495622_0042602 | |||
| 1846 | Ga0495622_0108988 | |||
| 1847 | Ga0495633_0000649 | |||
| 1848 | Ga0495633_0004247 | |||
| 1849 | Ga0495633_0328090 | |||
| 1850 | Ga0495667_0106515 | |||
| 1851 | Ga0495667_0175077 | |||
| 1852 | Ga0495656_0296006 | |||
| 1853 | Ga0495668_0029786 | |||
| 1854 | Ga0495668_0040547 | |||
| 1855 | Ga0495668_0127258 | |||
| 1856 | Ga0495668_0196871 | |||
| 1857 | Ga0495634_0305674 | |||
| 1858 | Ga0495611_0000185 | |||
| 1859 | Ga0495611_0000341 | |||
| 1860 | Ga0495611_0022375 | |||
| 1861 | Ga0495611_0111971 | |||
| 1862 | Ga0495611_0124837 | |||
| 1863 | Ga0495625_0019023 | |||
| 1864 | Ga0495625_0171136 | |||
| 1865 | Ga0495635_0079173 | |||
| 1866 | Ga0495635_0270524 | |||
| 1867 | Ga0495661_0000190 | |||
| 1868 | Ga0495661_0000610 | |||
| 1869 | Ga0495661_0002382 | |||
| 1870 | Ga0495661_0003409 | |||
| 1871 | Ga0495661_0003497 | |||
| 1872 | Ga0495661_0028623 | |||
| 1873 | Ga0495661_0049201 | |||
| 1874 | Ga0495661_0072142 | |||
| 1875 | Ga0495661_0072472 | |||
| 1876 | Ga0495661_0087065 | |||
| 1877 | Ga0495661_0106889 | |||
| 1878 | Ga0495588_0322351 | |||
| 1879 | Ga0495657_0105102 | |||
| 1880 | Ga0495657_0134261 | |||
| 1881 | Ga0495599_0043361 | |||
| 1882 | Ga0495599_0081335 | |||
| 1883 | Ga0495623_0034925 | |||
| 1884 | Ga0495623_0040233 | |||
| 1885 | Ga0495646_0017836 | |||
| 1886 | Ga0495646_0101192 | |||
| 1887 | Ga0495646_0120598 | |||
| 1888 | Ga0495669_0021066 | |||
| 1889 | Ga0495669_0042404 | |||
| 1890 | Ga0495669_0092685 | |||
| 1891 | Ga0495613_0006974 | |||
| 1892 | Ga0495613_0113860 | |||
| 1893 | Ga0495624_0005502 | |||
| 1894 | Ga0495624_0053938 | |||
| 1895 | Ga0495624_0068489 | |||
| 1896 | Ga0495670_0035407 | |||
| 1897 | Ga0495670_0215967 | |||
| 1898 | Ga0495671_0000388 | |||
| 1899 | Ga0495671_0001051 | |||
| 1900 | Ga0495671_0065839 | |||
| 1901 | Ga0495649_0000463 | |||
| 1902 | Ga0495649_0002276 | |||
| 1903 | Ga0495649_0008473 | |||
| 1904 | Ga0495649_0081178 | |||
| 1905 | Ga0495649_0229646 | |||
| 1906 | Ga0495649_0355283 | |||
| 1907 | Ga0495589_0002567 | |||
| 1908 | Ga0495589_0014338 | |||
| 1909 | Ga0495589_0027399 | |||
| 1910 | Ga0495589_0045998 | |||
| 1911 | Ga0495589_0067885 | |||
| 1912 | Ga0495589_0076639 | |||
| 1913 | Ga0495589_0212526 | |||
| 1914 | Ga0495600_0000982 | |||
| 1915 | Ga0495660_0004921 | |||
| 1916 | Ga0495660_0011842 | |||
| 1917 | Ga0495660_0024088 | |||
| 1918 | Ga0495660_0043377 | |||
| 1919 | Ga0495660_0151094 | |||
| 1920 | Ga0495581_0062062 | |||
| 1921 | Ga0495581_0067607 | |||
| 1922 | Ga0495604_0003076 | |||
| 1923 | Ga0495604_0162934 | |||
| 1924 | Ga0495604_0211021 | |||
| 1925 | Ga0495604_0246909 | |||
| 1926 | Ga0495636_0006493 | |||
| 1927 | Ga0495674_0028018 | |||
| 1928 | Ga0495674_0039429 | |||
| 1929 | Ga0495674_0096950 | |||
| 1930 | Ga0495674_0140669 | |||
| 1931 | Ga0495674_0143624 | |||
| 1932 | Ga0495672_0000186 | |||
| 1933 | Ga0495672_0000649 | |||
| 1934 | Ga0495672_0181486 | |||
| 1935 | Ga0495676_0000037 | |||
| 1936 | Ga0495676_0012523 | |||
| 1937 | Ga0495676_0092176 | |||
| 1938 | Ga0495676_0155587 | |||
| 1939 | Ga0495680_0011582 | |||
| 1940 | Ga0495683_0001297 | |||
| 1941 | Ga0495683_0024273 | |||
| 1942 | Ga0495683_0029031 | |||
| 1943 | Ga0495683_0056039 | |||
| 1944 | Ga0495687_000425 | |||
| 1945 | Ga0495687_059549 | |||
| 1946 | Ga0495675_0012706 | |||
| 1947 | Ga0495675_0080046 | |||
| 1948 | Ga0495677_0000276 | |||
| 1949 | Ga0495677_0004922 | |||
| 1950 | Ga0495677_0012036 | |||
| 1951 | Ga0495677_0114481 | |||
| 1952 | Ga0495677_0139451 | |||
| 1953 | Ga0495679_000062 | |||
| 1954 | Ga0495679_000326 | |||
| 1955 | Ga0495679_000552 | |||
| 1956 | Ga0495679_002011 | |||
| 1957 | Ga0495679_020772 | |||
| 1958 | Ga0495673_0017319 | |||
| 1959 | Ga0495681_0006426 | |||
| 1960 | Ga0495681_0021361 | |||
| 1961 | Ga0495681_0064699 | |||
| 1962 | Ga0495684_0174601 | |||
| 1963 | Ga0495684_0240071 | |||
| 1964 | Ga0495686_0012926 | |||
| 1965 | Ga0495686_0027160 | |||
| 1966 | Ga0495686_0039853 | |||
| 1967 | Ga0495593_0001237 | |||
| 1968 | Ga0495593_0020488 | |||
| 1969 | Ga0495593_0102804 | |||
| 1970 | Ga0495602_0020770 | |||
| 1971 | Ga0495602_0100794 | |||
| 1972 | Ga0495614_0008933 | |||
| 1973 | Ga0495614_0019082 | |||
| 1974 | Ga0495614_0446895 | |||
| 1975 | Ga0495626_0000003 | |||
| 1976 | Ga0495626_0000906 | |||
| 1977 | Ga0495626_0001683 | |||
| 1978 | Ga0495626_0003415 | |||
| 1979 | Ga0495626_0003978 | |||
| 1980 | Ga0495626_0006103 | |||
| 1981 | Ga0495626_0039823 | |||
| 1982 | Ga0495626_0045740 | |||
| 1983 | Ga0495626_0169579 | |||
| 1984 | Ga0496100_0085559 | |||
| 1985 | Ga0496100_0207202 | |||
| 1986 | Ga0496101_0017498 | |||
| 1987 | Ga0496101_0048938 | |||
| 1988 | Ga0496101_0051760 | |||
| 1989 | Ga0496101_0069132 | |||
| 1990 | Ga0496102_0026169 | |||
| 1991 | Ga0496102_0033317 | |||
| 1992 | Ga0496102_0135675 | |||
| 1993 | Ga0496102_0469738 | |||
| 1994 | Ga0496102_0754792 | |||
| 1995 | Ga0496103_0094697 | |||
| 1996 | Ga0496103_0197867 | |||
| 1997 | Ga0496104_0004559 | |||
| 1998 | Ga0496104_0149528 | |||
| 1999 | Ga0496105_0010155 | |||
| 2000 | Ga0496105_0141356 | |||
| 2001 | Ga0496105_0184633 | |||
| 2002 | Ga0496106_0001203 | |||
| 2003 | Ga0496106_0018942 | |||
| 2004 | Ga0496106_0472021 | |||
| 2005 | Ga0496107_0078157 | |||
| 2006 | Ga0496108_0265054 | |||
| 2007 | Ga0496110_0000262 | |||
| 2008 | Ga0496110_0270665 | |||
| 2009 | Ga0496111_0637599 | |||
| 2010 | Ga0496112_0003465 | |||
| 2011 | Ga0496112_0062528 | |||
| 2012 | Ga0496112_0348801 | |||
| 2013 | Ga0496112_0428893 | |||
| 2014 | Ga0496113_0173090 | |||
| 2015 | Ga0496114_0017203 | |||
| 2016 | Ga0496116_0003752 | |||
| 2017 | Ga0496116_0129961 | |||
| 2018 | Ga0496117_0055350 | |||
| 2019 | Ga0496117_0083648 | |||
| 2020 | Ga0496117_0321185 | |||
| 2021 | Ga0496118_0027201 | |||
| 2022 | Ga0496118_0034654 | |||
| 2023 | Ga0496118_0112077 | |||
| 2024 | Ga0496121_0004302 | |||
| 2025 | Ga0496121_0018688 | |||
| 2026 | Ga0496121_0049842 | |||
| 2027 | Ga0496121_0139200 | |||
| 2028 | Ga0496121_0237395 | |||
| 2029 | Ga0496122_0000248 | |||
| 2030 | Ga0496122_0009508 | |||
| 2031 | Ga0496122_0044196 | |||
| 2032 | Ga0496123_0000122 | |||
| 2033 | Ga0496123_0004343 | |||
| 2034 | Ga0496123_0127768 | |||
| 2035 | Ga0496124_0101368 | |||
| 2036 | Ga0496124_0149523 | |||
| 2037 | Ga0496124_0241106 | |||
| 2038 | Ga0496124_0556712 | |||
| 2039 | Ga0496125_0009189 | |||
| 2040 | Ga0496125_0021547 | |||
| 2041 | Ga0496125_0459558 | |||
| 2042 | Ga0496126_0472208 | |||
| 2043 | Ga0496126_0574425 | |||
| 2044 | Ga0495678_000196 | |||
| 2045 | Ga0495678_000487 | |||
| 2046 | Ga0495678_001145 | |||
| 2047 | Ga0495678_076916 | |||
| 2048 | Ga0495682_0000080 | |||
| 2049 | Ga0495682_0034323 | |||
| 2050 | Ga0495682_0041407 | |||
| 2051 | Ga0495682_0066514 | |||
| 2052 | Ga0495682_0066659 | |||
| 2053 | Ga0501067_0294999 | |||
| 2054 | Ga0501069_0499227 | |||
| 2055 | Ga0501072_0186237 | |||
| 2056 | Ga0501035_0002771 | |||
| 2057 | Ga0501045_0193725 | |||
| 2058 | nmdc:mga0k408_167074_c1 | |||
| 2059 | nmdc:mga0qj67_90304_c1 | |||
| 2060 | nmdc:mga06r32_512193_c1 | |||
| 2061 | nmdc:mga08y16_26196_c1 | |||
| 2062 | nmdc:mga0n895_297787_c1 | |||
| 2063 | nmdc:mga08x19_318906_c1 | |||
| 2064 | nmdc:mga0a205_444181_c1 | |||
| 2065 | Ga0495601_0652944 | |||
| 2066 | Ga0500636_0326636 | |||
| 2067 | Ga0587093_032409 | |||
| 2068 | Ga0587083_0000272 | |||
| 2069 | Ga0587083_0021676 | |||
| 2070 | Ga0587088_005302 | |||
| 2071 | Ga0466962_0005072 | |||
| 2072 | 2509127427 | |||
| 2073 | 2512347647 | |||
| 2074 | 2513555951 | |||
| 2075 | 2515679310 | |||
| 2076 | 2515688523 | |||
| 2077 | 2516017123 | |||
| 2078 | 2519457998 | |||
| 2079 | 2527080287 | |||
| 2080 | 2597030152 | |||
| 2081 | 2599739301 | |||
| 2082 | 2643798220 | |||
| 2083 | 2644475223 | |||
| 2084 | 2719639247 | |||
| 2085 | 2753565956 | |||
| 2086 | 2809144670 | |||
| 2087 | 2819621011 | |||
| 2088 | 2819632684 | |||
| 2089 | 2842457930 | |||
| 2090 | 2856290338 | |||
| 2091 | 2857362637 | |||
| 2092 | 2870068984 | |||
| 2093 | 2885277195 | |||
| 2094 | 2900636099 | |||
| 2095 | 2904438279 | |||
| 2096 | 2904565859 | |||
| 2097 | 2904572902 | |||
| 2098 | 2904620847 | |||
| 2099 | 2919530049 | |||
| 2100 | 2921644683 | |||
| 2101 | 2928109814 | |||
| 2102 | 2928136733 | |||
| 2103 | 2928159728 | |||
| 2104 | 2928173206 | |||
| 2105 | 2928510466 | |||
| 2106 | 2928538573 | |||
| 2107 | 2981994171 | |||
| 2108 | 640486038 | |||
| 2109 | 642422951 | |||
| 2110 | 642594108 | |||
| 2111 | 642620441 | |||
| 2112 | 8021122574 | |||
| 2113 | 8021126695 | |||
| 2114 | 8039099225 | |||
| 2115 | 8040171716 | |||
| 2116 | 8055266571 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9836 | 1 | 183 |
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9816 | 3 | 176 |
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.9812 | 1 | 183 |
| 6din-assembly1.cif.gz_A-2 | high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase | 0.9785 | 2 | 183 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9783 | 1 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9743 | 1 | 183 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9691 | 1 | 183 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9622 | 4 | 178 | 2.60.120.10 |
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9616 | 3 | 183 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.952 | 4 | 178 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F8Z5C9-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase | 1.001 | 45 | 183 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7C8XNS0-F1-model_v4 | deleted | 0.9996 | 45 | 169 |
|
| AF-A0A124RDG4-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9978 | 1 | 183 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A3N8CQX4-F1-model_v4 | deleted | 0.9975 | 1 | 183 |
|
| AF-Q2SYI2-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9972 | 1 | 183 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |