F489239

General Info

Members Datasets Scaffolds Average Seq Length
1058 443 2116 181

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0053029|Ga0496109_0053029_429_1034
Length 201
Sequence MQKWLRSLPLEPVEVNLGMPYTVTRTAIPDVLVLEPKVFGDARGFFFESFNARNFREVTGLNVDFVQDNHSKSAKGVLRGLHYQIQNPQGKLVHVVQGAVFDVAVDLRKSSPTFGQWVGHVLDAENHKQLWIPPGFAHGFVVLSESAEFLYKTTDYWYPEHERSLLWNDPTVAVAWPIDFAPQLAAKDAAGKLFGEAETFA

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
345 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
346 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
347 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
348 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
349 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
350 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
354 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
355 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
372 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
373 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
374 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
375 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
376 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
377 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
378 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
379 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
380 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
381 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
382 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
393 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
394 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
401 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
402 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
403 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
404 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
405 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
406 2519103095 Burkholderia sp. KJ006 Isolate Nodule
407 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
408 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
409 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
410 2643221556 Massilia sp. Root1485 Isolate Unclassified
411 2643221684 Massilia sp. Root133 Isolate Unclassified
412 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
413 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
414 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
415 2818991450 Burkholderia sp. 604 Isolate Unclassified
416 2818991452 Burkholderia cepacia 561 Isolate Unclassified
417 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
418 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
419 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
420 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
421 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
422 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
423 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
424 2904564687 Burkholderia sp. 571 Isolate Unclassified
425 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
426 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
427 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
428 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
429 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
430 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
431 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
432 2928170801 Burkholderia sp. 572 Isolate Unclassified
433 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
434 2928536128 Burkholderia sola 565 Isolate Unclassified
435 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
436 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
437 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
438 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
439 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
440 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
441 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
442 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
443 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.09
Metatranscriptomes 0.66
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.25
Nodule 1.13
Rhizoplane 3.5
Rhizosphere 85.63
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0053029 3300048912 Bacteria 3698
2 JGI24739J22299_10001077 3300001989 Bacteria 10168
3 JGI24748J21848_1018955 3300002074 Bacteria 826
4 JGI25156J39149_1001449 3300002705 Bacteria 10068
5 JGI25159J45721_1007464 3300002987 Bacteria 3131
6 rootL2_10093023 3300003322 Bacteria 6762
7 rootL2_10280545 3300003322 Bacteria 1971
8 JGI25161J50226_1000115 3300003374 Bacteria 62500
9 Ga0055533_1000948 3300003756 Bacteria 8561
10 Ga0055533_1003019 3300003756 Bacteria 3583
11 Ga0055532_1000401 3300003758 Bacteria 21502
12 Ga0055525_1000246 3300003759 Bacteria 54885
13 Ga0055527_1000430 3300003760 Bacteria 16963
14 Ga0055527_1000691 3300003760 Bacteria 9798
15 Ga0055535_1000857 3300003761 Bacteria 21511
16 Ga0055542_1000846 3300003762 Bacteria 21511
17 Ga0055542_1001567 3300003762 Bacteria 10713
18 Ga0055529_1000614 3300003763 Bacteria 26846
19 Ga0055528_1006287 3300003790 Bacteria 5403
20 Ga0055541_1001121 3300003841 Bacteria 6032
21 Ga0055541_1006047 3300003841 Bacteria 2082
22 Ga0055543_1000094 3300004625 Bacteria 78040
23 Ga0065165_1000434 3300005262 Bacteria 65848
24 Ga0070658_10033009 3300005327 Bacteria 4163
25 Ga0070658_10056675 3300005327 Bacteria 3186
26 Ga0070658_10207871 3300005327 Bacteria 1653
27 Ga0070658_10237583 3300005327 Bacteria 1544
28 Ga0070658_10853105 3300005327 Bacteria 792
29 Ga0070676_10000300 3300005328 Bacteria 22179
30 Ga0070676_10022641 3300005328 Bacteria 3526
31 Ga0070676_10058870 3300005328 Bacteria 2278
32 Ga0070676_10194777 3300005328 Bacteria 1325
33 Ga0070676_10314199 3300005328 Bacteria 1066
34 Ga0070683_100040268 3300005329 Bacteria 4295
35 Ga0070683_100064940 3300005329 Bacteria 3398
36 Ga0070683_100737784 3300005329 Bacteria 944
37 Ga0070690_100001976 3300005330 Bacteria 10925
38 Ga0070670_100000010 3300005331 Bacteria 277365
39 Ga0070670_100197473 3300005331 Bacteria 1748
40 Ga0070677_10000444 3300005333 Bacteria 14135
41 Ga0068869_100019562 3300005334 Bacteria 4629
42 Ga0068869_100030702 3300005334 Bacteria 3775
43 Ga0070666_10000386 3300005335 Bacteria 27689
44 Ga0070666_10061649 3300005335 Bacteria 2540
45 Ga0070680_100614545 3300005336 Bacteria 933
46 Ga0068868_100035991 3300005338 Bacteria 3829
47 Ga0068868_100085789 3300005338 Bacteria 2530
48 Ga0070660_100001619 3300005339 Bacteria 15487
49 Ga0070660_100048057 3300005339 Bacteria 3276
50 Ga0070660_100056007 3300005339 Bacteria 3049
51 Ga0070660_100071737 3300005339 Bacteria 2704
52 Ga0070660_100148020 3300005339 Bacteria 1887
53 Ga0070660_100164209 3300005339 Bacteria 1791
54 Ga0070660_100400821 3300005339 Bacteria 1134
55 Ga0070660_100657266 3300005339 Bacteria 878
56 Ga0070689_100002818 3300005340 Bacteria 11428
57 Ga0070661_100048416 3300005344 Bacteria 3111
58 Ga0070661_100058648 3300005344 Bacteria 2821
59 Ga0070661_100179454 3300005344 Bacteria 1610
60 Ga0070668_100004602 3300005347 Bacteria 10215
61 Ga0070668_100328085 3300005347 Bacteria 1290
62 Ga0070669_100025920 3300005353 Bacteria 4216
63 Ga0070675_100000235 3300005354 Bacteria 35666
64 Ga0070671_100014294 3300005355 Bacteria 6410
65 Ga0070671_100025124 3300005355 Bacteria 4884
66 Ga0070671_100055767 3300005355 Bacteria 3287
67 Ga0070671_100181930 3300005355 Bacteria 1780
68 Ga0070674_100012603 3300005356 Bacteria 5196
69 Ga0070673_100002777 3300005364 Bacteria 10764
70 Ga0070673_100026921 3300005364 Bacteria 4255
71 Ga0070673_100096546 3300005364 Bacteria 2426
72 Ga0070673_100633665 3300005364 Bacteria 977
73 Ga0070688_100000391 3300005365 Bacteria 22192
74 Ga0070688_100003549 3300005365 Bacteria 8039
75 Ga0070659_100007308 3300005366 Bacteria 8020
76 Ga0070659_100074498 3300005366 Bacteria 2704
77 Ga0070659_100117753 3300005366 Bacteria 2148
78 Ga0070659_100146558 3300005366 Bacteria 1924
79 Ga0070659_100719131 3300005366 Bacteria 864
80 Ga0070659_101223010 3300005366 Bacteria 665
81 Ga0070659_101251122 3300005366 Bacteria 657
82 Ga0070667_100000124 3300005367 Bacteria 98412
83 Ga0070667_100012546 3300005367 Bacteria 7008
84 Ga0070667_100041759 3300005367 Bacteria 3847
85 Ga0070667_100541931 3300005367 Bacteria 1069
86 Ga0070709_10174418 3300005434 Bacteria 1505
87 Ga0070709_10376687 3300005434 Bacteria 1054
88 Ga0070709_10390742 3300005434 Bacteria 1037
89 Ga0070714_100024730 3300005435 Bacteria 4949
90 Ga0070714_100036938 3300005435 Bacteria 4101
91 Ga0070714_100066890 3300005435 Bacteria 3097
92 Ga0070714_100083062 3300005435 Bacteria 2792
93 Ga0070714_100415863 3300005435 Bacteria 1273
94 Ga0070713_100000093 3300005436 Bacteria 57164
95 Ga0070713_100016492 3300005436 Bacteria 5555
96 Ga0070713_100026608 3300005436 Bacteria 4544
97 Ga0070710_10019044 3300005437 Bacteria 3542
98 Ga0070710_10179433 3300005437 Bacteria 1325
99 Ga0070701_10263751 3300005438 Bacteria 1045
100 Ga0070711_100014795 3300005439 Bacteria 4925
101 Ga0070711_101305880 3300005439 Bacteria 630
102 Ga0070705_100079533 3300005440 Bacteria 2008
103 Ga0070705_100385271 3300005440 Bacteria 1033
104 Ga0070694_100580750 3300005444 Bacteria 900
105 Ga0070708_100122003 3300005445 Bacteria 2405
106 Ga0070663_100000499 3300005455 Bacteria 20724
107 Ga0070663_100001362 3300005455 Bacteria 13368
108 Ga0070663_100006870 3300005455 Bacteria 6888
109 Ga0070663_100360129 3300005455 Bacteria 1180
110 Ga0070678_100003783 3300005456 Bacteria 8486
111 Ga0070662_100793296 3300005457 Bacteria 805
112 Ga0070681_10288673 3300005458 Bacteria 1551
113 Ga0068867_100003026 3300005459 Bacteria 11854
114 Ga0070685_10000001 3300005466 Bacteria 349867
115 Ga0070685_10001033 3300005466 Bacteria 14936
116 Ga0070685_10609338 3300005466 Bacteria 787
117 Ga0070706_100038366 3300005467 Bacteria 4420
118 Ga0070707_100506148 3300005468 Bacteria 1169
119 Ga0070698_100392462 3300005471 Bacteria 1321
120 Ga0070699_100826473 3300005518 Bacteria 848
121 Ga0070679_100041918 3300005530 Bacteria 4557
122 Ga0070679_100216812 3300005530 Bacteria 1876
123 Ga0070679_100228132 3300005530 Bacteria 1822
124 Ga0070679_100255006 3300005530 Bacteria 1710
125 Ga0070679_100308184 3300005530 Bacteria 1533
126 Ga0070679_100359158 3300005530 Bacteria 1404
127 Ga0070684_100045274 3300005535 Bacteria 3810
128 Ga0070684_100121421 3300005535 Bacteria 2350
129 Ga0070684_100369854 3300005535 Bacteria 1320
130 Ga0068853_100005939 3300005539 Bacteria 9642
131 Ga0068853_100212328 3300005539 Bacteria 1764
132 Ga0068853_100330016 3300005539 Bacteria 1415
133 Ga0070672_100004095 3300005543 Bacteria 9522
134 Ga0070672_100024487 3300005543 Bacteria 4463
135 Ga0070672_100167064 3300005543 Bacteria 1828
136 Ga0070672_100214528 3300005543 Bacteria 1613
137 Ga0070686_100392589 3300005544 Unclassified 1053
138 Ga0070686_100445155 3300005544 Bacteria 995
139 Ga0070696_100842715 3300005546 Bacteria 757
140 Ga0070693_100011666 3300005547 Bacteria 4430
141 Ga0070665_100003582 3300005548 Bacteria 16453
142 Ga0070665_100008038 3300005548 Bacteria 10684
143 Ga0070665_100016415 3300005548 Bacteria 7424
144 Ga0068855_100000446 3300005563 Bacteria 51081
145 Ga0068855_100078780 3300005563 Bacteria 3822
146 Ga0068855_100277610 3300005563 Bacteria 1862
147 Ga0068855_100427769 3300005563 Bacteria 1447
148 Ga0068855_100481728 3300005563 Bacteria 1350
149 Ga0068855_100871235 3300005563 Bacteria 953
150 Ga0070664_100034625 3300005564 Bacteria 4236
151 Ga0070664_100046725 3300005564 Bacteria 3657
152 Ga0070664_100175803 3300005564 Bacteria 1901
153 Ga0070664_100540038 3300005564 Bacteria 1077
154 Ga0068854_100067432 3300005578 Bacteria 2607
155 Ga0068854_100193913 3300005578 Bacteria 1593
156 Ga0068854_100363625 3300005578 Bacteria 1188
157 Ga0068854_100858646 3300005578 Bacteria 795
158 Ga0068856_100064505 3300005614 Bacteria 3619
159 Ga0070702_100207958 3300005615 Bacteria 1300
160 Ga0068852_100000557 3300005616 Bacteria 24514
161 Ga0068852_100005163 3300005616 Bacteria 9310
162 Ga0068852_100012738 3300005616 Bacteria 6402
163 Ga0068852_100022774 3300005616 Bacteria 5030
164 Ga0068852_100173074 3300005616 Bacteria 2025
165 Ga0068852_100183393 3300005616 Bacteria 1970
166 Ga0068852_100277326 3300005616 Bacteria 1615
167 Ga0068852_100391862 3300005616 Bacteria 1364
168 Ga0068852_101415146 3300005616 Bacteria 717
169 Ga0068859_100056556 3300005617 Bacteria 3949
170 Ga0068859_100063075 3300005617 Bacteria 3736
171 Ga0068859_100202306 3300005617 Bacteria 2071
172 Ga0068864_100000018 3300005618 Bacteria 277365
173 Ga0068864_100001480 3300005618 Bacteria 19352
174 Ga0068861_100406726 3300005719 Bacteria 1209
175 Ga0068861_100929172 3300005719 Bacteria 826
176 Ga0068861_100998374 3300005719 Bacteria 799
177 Ga0068851_10002512 3300005834 Bacteria 8064
178 Ga0068851_10003593 3300005834 Bacteria 6914
179 Ga0068851_10021814 3300005834 Bacteria 3112
180 Ga0068851_10177868 3300005834 Bacteria 1177
181 Ga0068870_10011536 3300005840 Bacteria 4100
182 Ga0068870_10074022 3300005840 Bacteria 1865
183 Ga0068863_100008456 3300005841 Bacteria 10052
184 Ga0068863_100125206 3300005841 Bacteria 2451
185 Ga0068863_101022489 3300005841 Bacteria 829
186 Ga0068858_100009965 3300005842 Bacteria 9024
187 Ga0068858_100223217 3300005842 Bacteria 1785
188 Ga0068860_100000736 3300005843 Bacteria 37295
189 Ga0068860_100068491 3300005843 Bacteria 3372
190 Ga0068860_100072712 3300005843 Bacteria 3268
191 Ga0068862_100573438 3300005844 Bacteria 1080
192 Ga0081539_10001028 3300005985 Bacteria 51439
193 Ga0070717_10143372 3300006028 Bacteria 2062
194 Ga0070716_100008148 3300006173 Bacteria 5190
195 Ga0070716_100455564 3300006173 Bacteria 933
196 Ga0070712_100100990 3300006175 Bacteria 2133
197 Ga0070712_100230844 3300006175 Bacteria 1470
198 Ga0075366_10100668 3300006195 Bacteria 1734
199 Ga0075366_10129117 3300006195 Bacteria 1525
200 Ga0097621_100023861 3300006237 Bacteria 4768
201 Ga0097621_100226125 3300006237 Bacteria 1632
202 Ga0068871_100044715 3300006358 Bacteria 3563
203 Ga0068871_100608013 3300006358 Bacteria 995
204 Ga0075430_100122232 3300006846 Bacteria 2170
205 Ga0075434_100192697 3300006871 Bacteria 2059
206 Ga0068865_100383428 3300006881 Bacteria 1147
207 Ga0075436_100058459 3300006914 Bacteria 2663
208 Ga0097620_100056549 3300006931 Bacteria 3949
209 Ga0097620_100063074 3300006931 Bacteria 3736
210 Ga0097620_100202324 3300006931 Bacteria 2071
211 Ga0075435_100389573 3300007076 Bacteria 1198
212 Ga0105251_10003483 3300009011 Bacteria 11396
213 Ga0105251_10117833 3300009011 Bacteria 1207
214 Ga0105250_10036182 3300009092 Bacteria 1981
215 Ga0105240_10066908 3300009093 Bacteria 4455
216 Ga0105240_10356211 3300009093 Bacteria 1659
217 Ga0105240_10367061 3300009093 Bacteria 1629
218 Ga0105240_10428861 3300009093 Bacteria 1484
219 Ga0105240_10555605 3300009093 Bacteria 1269
220 Ga0111539_10028815 3300009094 Bacteria 6772
221 Ga0105245_10059875 3300009098 Bacteria 3429
222 Ga0105245_11630101 3300009098 Bacteria 697
223 Ga0105247_10003623 3300009101 Bacteria 10025
224 Ga0105247_10050287 3300009101 Bacteria 2564
225 Ga0105243_10024540 3300009148 Bacteria 4599
226 Ga0105243_11727046 3300009148 Unclassified 655
227 Ga0105241_10007108 3300009174 Bacteria 8244
228 Ga0105241_10055307 3300009174 Bacteria 3040
229 Ga0105241_10216202 3300009174 Bacteria 1608
230 Ga0105242_10022479 3300009176 Bacteria 4960
231 Ga0105242_10269707 3300009176 Bacteria 1541
232 Ga0105248_10028584 3300009177 Bacteria 6213
233 Ga0105248_10733966 3300009177 Bacteria 1114
234 Ga0105237_10016306 3300009545 Bacteria 7722
235 Ga0105237_10126806 3300009545 Bacteria 2547
236 Ga0105237_10145172 3300009545 Bacteria 2368
237 Ga0105237_10331166 3300009545 Bacteria 1527
238 Ga0105238_10017261 3300009551 Bacteria 7331
239 Ga0105238_10020728 3300009551 Bacteria 6695
240 Ga0105238_10076951 3300009551 Bacteria 3329
241 Ga0105238_10142432 3300009551 Bacteria 2374
242 Ga0105238_10456731 3300009551 Bacteria 1275
243 Ga0105249_10039672 3300009553 Bacteria 4275
244 Ga0105249_10110467 3300009553 Bacteria 2598
245 Ga0105249_11546349 3300009553 Bacteria 736
246 Ga0105239_10005029 3300010375 Bacteria 15613
247 Ga0105239_10073052 3300010375 Bacteria 3771
248 Ga0105239_10204498 3300010375 Bacteria 2213
249 Ga0105239_11086198 3300010375 Bacteria 921
250 Ga0105246_10083341 3300011119 Bacteria 2284
251 Ga0105246_10634285 3300011119 Bacteria 928
252 Ga0157373_10026681 3300013100 Bacteria 4170
253 Ga0157373_10028005 3300013100 Bacteria 4065
254 Ga0157373_10159381 3300013100 Bacteria 1588
255 Ga0157373_10218121 3300013100 Bacteria 1346
256 Ga0157371_10000787 3300013102 Bacteria 36521
257 Ga0157371_10010442 3300013102 Bacteria 7235
258 Ga0157371_10176789 3300013102 Bacteria 1526
259 Ga0157370_10066110 3300013104 Bacteria 3420
260 Ga0157370_10084826 3300013104 Bacteria 2976
261 Ga0157370_10520106 3300013104 Bacteria 1092
262 Ga0157369_10000233 3300013105 Bacteria 76995
263 Ga0157369_10151219 3300013105 Bacteria 2453
264 Ga0157369_10650420 3300013105 Bacteria 1087
265 Ga0157369_11010194 3300013105 Bacteria 851
266 Ga0157374_10000102 3300013296 Bacteria 78555
267 Ga0157374_10000922 3300013296 Bacteria 25588
268 Ga0157374_10477807 3300013296 Bacteria 1249
269 Ga0157378_10196590 3300013297 Bacteria 1905
270 Ga0157378_11403798 3300013297 Bacteria 741
271 Ga0163162_10072103 3300013306 Bacteria 3508
272 Ga0163162_10429519 3300013306 Bacteria 1453
273 Ga0163162_11335935 3300013306 Bacteria 815
274 Ga0157372_10015261 3300013307 Bacteria 8228
275 Ga0157372_10045705 3300013307 Bacteria 4858
276 Ga0157372_10093274 3300013307 Bacteria 3426
277 Ga0157372_10110309 3300013307 Bacteria 3151
278 Ga0157372_10126617 3300013307 Bacteria 2937
279 Ga0157372_10169840 3300013307 Bacteria 2523
280 Ga0157372_10182283 3300013307 Bacteria 2431
281 Ga0157372_10212457 3300013307 Bacteria 2242
282 Ga0157372_10224781 3300013307 Bacteria 2176
283 Ga0157372_10229050 3300013307 Bacteria 2154
284 Ga0157372_10543868 3300013307 Bacteria 1354
285 Ga0157372_11675352 3300013307 Bacteria 732
286 Ga0157375_10000781 3300013308 Bacteria 27817
287 Ga0157375_10061164 3300013308 Bacteria 3738
288 Ga0157375_10114100 3300013308 Bacteria 2803
289 Ga0157375_10185244 3300013308 Bacteria 2235
290 Ga0163163_10000203 3300014325 Bacteria 61545
291 Ga0163163_10008748 3300014325 Bacteria 9007
292 Ga0157380_10000221 3300014326 Bacteria 34047
293 Ga0157380_10757852 3300014326 Bacteria 983
294 Ga0182008_10020983 3300014497 Bacteria 3359
295 Ga0182008_10028409 3300014497 Bacteria 2828
296 Ga0157379_10157007 3300014968 Bacteria 2053
297 Ga0157379_10595425 3300014968 Bacteria 1032
298 Ga0157376_10017970 3300014969 Bacteria 5408
299 Ga0157376_10109229 3300014969 Bacteria 2431
300 Ga0157376_10546062 3300014969 Bacteria 1146
301 Ga0182006_1000392 3300015261 Bacteria 35983
302 Ga0182006_1076350 3300015261 Bacteria 1231
303 Ga0182007_10000207 3300015262 Bacteria 39296
304 Ga0182007_10007661 3300015262 Bacteria 4499
305 Ga0182007_10017454 3300015262 Bacteria 2620
306 Ga0182005_1002413 3300015265 Bacteria 6688
307 Ga0183361_10030 3300016635 Bacteria 55672
308 Ga0206356_10936544 3300020070 Bacteria 682
309 Ga0206353_11819478 3300020082 Bacteria 2390
310 Ga0206353_11871602 3300020082 Bacteria 761
311 Ga0213872_10109157 3300021361 Bacteria 1229
312 Ga0209436_100042 3300025208 Bacteria 73600
313 Ga0209784_101038 3300025224 Bacteria 4883
314 Ga0209566_100200 3300025225 Bacteria 61991
315 Ga0209566_100554 3300025225 Bacteria 25069
316 Ga0209566_100564 3300025225 Bacteria 24326
317 Ga0209674_100150 3300025226 Bacteria 96511
318 Ga0209674_100382 3300025226 Bacteria 23424
319 Ga0209674_100813 3300025226 Bacteria 10407
320 Ga0209672_100028 3300025228 Bacteria 341962
321 Ga0209672_100489 3300025228 Bacteria 22048
322 Ga0209672_100496 3300025228 Bacteria 21881
323 Ga0209147_100117 3300025229 Bacteria 143852
324 Ga0209563_100007 3300025230 Bacteria 1579402
325 Ga0209563_109555 3300025230 Bacteria 1459
326 Ga0209258_100112 3300025242 Bacteria 192884
327 Ga0209677_102157 3300025253 Bacteria 7690
328 Ga0209677_102170 3300025253 Bacteria 7656
329 Ga0209677_107693 3300025253 Bacteria 2233
330 Ga0209148_1000043 3300025254 Bacteria 461531
331 Ga0209148_1000314 3300025254 Bacteria 68636
332 Ga0209759_1000379 3300025256 Bacteria 55581
333 Ga0209759_1000711 3300025256 Bacteria 29498
334 Ga0209759_1003670 3300025256 Bacteria 6026
335 Ga0209455_1000050 3300025272 Bacteria 373239
336 Ga0209673_1000070 3300025273 Bacteria 241592
337 Ga0209130_1000227 3300025284 Bacteria 73760
338 Ga0209564_1012617 3300025295 Bacteria 3666
339 Ga0207656_10001586 3300025321 Bacteria 7571
340 Ga0207696_1032103 3300025711 Bacteria 1583
341 Ga0207713_1000451 3300025735 Bacteria 43043
342 Ga0207682_10000165 3300025893 Bacteria 30318
343 Ga0207692_10079765 3300025898 Bacteria 1747
344 Ga0207710_10003333 3300025900 Bacteria 7176
345 Ga0207680_10000251 3300025903 Bacteria 25767
346 Ga0207680_10035280 3300025903 Bacteria 2870
347 Ga0207680_10178994 3300025903 Bacteria 1433
348 Ga0207680_10324634 3300025903 Bacteria 1077
349 Ga0207647_10013556 3300025904 Bacteria 5644
350 Ga0207647_10041727 3300025904 Bacteria 2883
351 Ga0207647_10052298 3300025904 Bacteria 2521
352 Ga0207685_10029894 3300025905 Bacteria 1934
353 Ga0207699_10054253 3300025906 Bacteria 2380
354 Ga0207699_10102794 3300025906 Bacteria 1817
355 Ga0207645_10000045 3300025907 Bacteria 85310
356 Ga0207645_10064008 3300025907 Bacteria 2350
357 Ga0207643_10026319 3300025908 Bacteria 3219
358 Ga0207705_10201515 3300025909 Bacteria 1508
359 Ga0207705_10216104 3300025909 Bacteria 1455
360 Ga0207705_10267288 3300025909 Bacteria 1307
361 Ga0207705_10270781 3300025909 Bacteria 1299
362 Ga0207705_10435750 3300025909 Bacteria 1016
363 Ga0207684_10321716 3300025910 Bacteria 1333
364 Ga0207654_10004639 3300025911 Bacteria 6941
365 Ga0207654_10453351 3300025911 Bacteria 900
366 Ga0207707_10206517 3300025912 Bacteria 1712
367 Ga0207707_10412914 3300025912 Bacteria 1158
368 Ga0207707_10489963 3300025912 Bacteria 1049
369 Ga0207695_10008527 3300025913 Bacteria 12811
370 Ga0207695_10011136 3300025913 Bacteria 10916
371 Ga0207695_10182686 3300025913 Bacteria 2018
372 Ga0207695_10345555 3300025913 Bacteria 1375
373 Ga0207671_10030279 3300025914 Bacteria 4037
374 Ga0207671_10067076 3300025914 Bacteria 2671
375 Ga0207671_10357269 3300025914 Bacteria 1159
376 Ga0207671_10375187 3300025914 Bacteria 1130
377 Ga0207693_10004419 3300025915 Bacteria 11886
378 Ga0207693_10016506 3300025915 Bacteria 5899
379 Ga0207693_10226295 3300025915 Bacteria 1469
380 Ga0207663_10062311 3300025916 Bacteria 2370
381 Ga0207660_10184347 3300025917 Bacteria 1623
382 Ga0207660_10253446 3300025917 Bacteria 1389
383 Ga0207657_10000258 3300025919 Bacteria 56256
384 Ga0207657_10002002 3300025919 Bacteria 22017
385 Ga0207657_10005627 3300025919 Bacteria 13079
386 Ga0207657_10006421 3300025919 Bacteria 12194
387 Ga0207657_10017533 3300025919 Bacteria 6862
388 Ga0207657_10064037 3300025919 Bacteria 3140
389 Ga0207657_10139774 3300025919 Bacteria 1979
390 Ga0207657_10322984 3300025919 Bacteria 1220
391 Ga0207649_10005560 3300025920 Bacteria 6816
392 Ga0207649_10361529 3300025920 Bacteria 1077
393 Ga0207652_10024741 3300025921 Bacteria 4983
394 Ga0207652_10095051 3300025921 Bacteria 2625
395 Ga0207652_10123673 3300025921 Bacteria 2304
396 Ga0207681_10013915 3300025923 Bacteria 4985
397 Ga0207681_10145539 3300025923 Bacteria 1770
398 Ga0207694_10052663 3300025924 Bacteria 3155
399 Ga0207694_10101106 3300025924 Bacteria 2284
400 Ga0207694_10117754 3300025924 Bacteria 2118
401 Ga0207694_10335509 3300025924 Bacteria 1250
402 Ga0207650_10000003 3300025925 Bacteria 1123235
403 Ga0207650_10037386 3300025925 Bacteria 3537
404 Ga0207650_10063290 3300025925 Bacteria 2766
405 Ga0207659_10014293 3300025926 Bacteria 5114
406 Ga0207687_10005040 3300025927 Bacteria 8744
407 Ga0207687_10132360 3300025927 Bacteria 1882
408 Ga0207687_10769199 3300025927 Bacteria 820
409 Ga0207700_10000214 3300025928 Bacteria 34620
410 Ga0207700_10038855 3300025928 Bacteria 3458
411 Ga0207664_10000853 3300025929 Bacteria 20620
412 Ga0207664_10007991 3300025929 Bacteria 7355
413 Ga0207664_10047207 3300025929 Bacteria 3382
414 Ga0207664_10086947 3300025929 Bacteria 2555
415 Ga0207664_10155402 3300025929 Bacteria 1947
416 Ga0207644_10011801 3300025931 Bacteria 5785
417 Ga0207644_10014141 3300025931 Bacteria 5337
418 Ga0207644_10137141 3300025931 Bacteria 1880
419 Ga0207690_10000485 3300025932 Bacteria 25649
420 Ga0207690_10100810 3300025932 Bacteria 2062
421 Ga0207690_10355801 3300025932 Bacteria 1159
422 Ga0207706_10000023 3300025933 Bacteria 153979
423 Ga0207706_10340931 3300025933 Bacteria 1304
424 Ga0207706_10713632 3300025933 Bacteria 856
425 Ga0207686_10012630 3300025934 Bacteria 4647
426 Ga0207686_10229876 3300025934 Bacteria 1344
427 Ga0207709_10007786 3300025935 Bacteria 5938
428 Ga0207670_10005050 3300025936 Bacteria 7195
429 Ga0207669_10002574 3300025937 Bacteria 7752
430 Ga0207665_10009098 3300025939 Bacteria 6521
431 Ga0207665_10052787 3300025939 Bacteria 2739
432 Ga0207665_10655475 3300025939 Bacteria 823
433 Ga0207691_10000279 3300025940 Bacteria 50526
434 Ga0207691_10019010 3300025940 Bacteria 6507
435 Ga0207711_10000087 3300025941 Bacteria 98302
436 Ga0207711_10091412 3300025941 Bacteria 2677
437 Ga0207689_10027196 3300025942 Bacteria 4789
438 Ga0207689_10076115 3300025942 Bacteria 2759
439 Ga0207679_10025570 3300025945 Bacteria 4062
440 Ga0207679_10131717 3300025945 Bacteria 2007
441 Ga0207679_10497595 3300025945 Bacteria 1087
442 Ga0207679_11401621 3300025945 Bacteria 641
443 Ga0207667_10002136 3300025949 Bacteria 24781
444 Ga0207667_10003269 3300025949 Bacteria 20008
445 Ga0207667_10004129 3300025949 Bacteria 17847
446 Ga0207667_10094099 3300025949 Bacteria 3094
447 Ga0207667_10132077 3300025949 Bacteria 2572
448 Ga0207667_10217078 3300025949 Bacteria 1960
449 Ga0207667_10241309 3300025949 Bacteria 1849
450 Ga0207667_11650123 3300025949 Bacteria 609
451 Ga0207651_10008555 3300025960 Bacteria 5534
452 Ga0207651_10019463 3300025960 Bacteria 4069
453 Ga0207712_10018021 3300025961 Bacteria 4594
454 Ga0207712_10181914 3300025961 Bacteria 1652
455 Ga0207712_11138569 3300025961 Bacteria 695
456 Ga0207668_10002332 3300025972 Bacteria 11091
457 Ga0207668_10005740 3300025972 Bacteria 7313
458 Ga0207668_10595752 3300025972 Bacteria 962
459 Ga0207640_10062101 3300025981 Bacteria 2477
460 Ga0207640_10204607 3300025981 Bacteria 1499
461 Ga0207640_10482341 3300025981 Bacteria 1029
462 Ga0207658_10000007 3300025986 Bacteria 329651
463 Ga0207658_10009855 3300025986 Bacteria 6488
464 Ga0207658_10040299 3300025986 Bacteria 3375
465 Ga0207658_10462105 3300025986 Bacteria 1125
466 Ga0207677_10003044 3300026023 Bacteria 8866
467 Ga0207677_10004160 3300026023 Bacteria 7745
468 Ga0207677_10208152 3300026023 Bacteria 1560
469 Ga0207703_10000522 3300026035 Bacteria 39489
470 Ga0207703_10389424 3300026035 Bacteria 1291
471 Ga0207639_10280920 3300026041 Bacteria 1464
472 Ga0207678_10000110 3300026067 Bacteria 67527
473 Ga0207678_10017290 3300026067 Bacteria 6331
474 Ga0207678_10462816 3300026067 Bacteria 1103
475 Ga0207702_10000523 3300026078 Bacteria 43069
476 Ga0207702_10024567 3300026078 Bacteria 5001
477 Ga0207702_10056187 3300026078 Bacteria 3341
478 Ga0207702_10214039 3300026078 Bacteria 1793
479 Ga0207702_10686431 3300026078 Bacteria 1009
480 Ga0207702_11265912 3300026078 Bacteria 732
481 Ga0207641_10029599 3300026088 Bacteria 4530
482 Ga0207641_10065135 3300026088 Bacteria 3116
483 Ga0207641_10118174 3300026088 Bacteria 2361
484 Ga0207648_10031644 3300026089 Bacteria 4677
485 Ga0207676_10000003 3300026095 Bacteria 1123235
486 Ga0207676_10000140 3300026095 Bacteria 62993
487 Ga0207674_10000429 3300026116 Bacteria 54858
488 Ga0207674_10013722 3300026116 Bacteria 8969
489 Ga0207674_10364123 3300026116 Bacteria 1398
490 Ga0207675_100032799 3300026118 Bacteria 4839
491 Ga0207675_100459906 3300026118 Bacteria 1262
492 Ga0207683_10000003 3300026121 Bacteria 191866
493 Ga0207683_10758906 3300026121 Bacteria 900
494 Ga0207698_10004881 3300026142 Bacteria 8222
495 Ga0207698_10005292 3300026142 Bacteria 7946
496 Ga0207698_10009962 3300026142 Bacteria 6080
497 Ga0207698_10031754 3300026142 Bacteria 3816
498 Ga0207698_10096150 3300026142 Bacteria 2440
499 Ga0207698_10165424 3300026142 Bacteria 1940
500 Ga0207698_10496802 3300026142 Bacteria 1186
501 Ga0207698_10576101 3300026142 Bacteria 1107
502 Ga0209982_1007869 3300027552 Bacteria 1557
503 Ga0209970_1005309 3300027614 Bacteria 2128
504 Ga0209970_1031695 3300027614 Bacteria 920
505 Ga0209983_1034448 3300027665 Bacteria 1085
506 Ga0209974_10008582 3300027876 Bacteria 3490
507 Ga0209974_10068229 3300027876 Bacteria 1211
508 Ga0207428_10075422 3300027907 Bacteria 2643
509 Ga0268266_10019939 3300028379 Bacteria 5713
510 Ga0268266_10034141 3300028379 Bacteria 4325
511 Ga0268266_10051803 3300028379 Bacteria 3524
512 Ga0268266_10237247 3300028379 Bacteria 1682
513 Ga0268265_10563480 3300028380 Bacteria 1083
514 Ga0268265_11803300 3300028380 Bacteria 618
515 Ga0268264_10000009 3300028381 Bacteria 724972
516 Ga0268264_10012993 3300028381 Bacteria 6845
517 Ga0268264_10054042 3300028381 Bacteria 3352
518 Ga0265338_10237083 3300028800 Bacteria 1353
519 Ga0265325_10007758 3300031241 Bacteria 6396
520 Ga0265340_10196935 3300031247 Bacteria 907
521 Ga0307408_100398843 3300031548 Bacteria 1181
522 Ga0265313_10039139 3300031595 Bacteria 2354
523 Ga0316575_10015854 3300031665 Bacteria 2844
524 Ga0265314_10046941 3300031711 Bacteria 3044
525 Ga0265314_10370427 3300031711 Bacteria 782
526 Ga0373944_0276158 3300035089 Bacteria 626
527 Ga0373923_0030460 3300035111 Bacteria 2170
528 Ga0373939_0073568 3300035114 Bacteria 1119
529 Ga0373953_0003388 3300035117 Bacteria 4955
530 Ga0373954_0014040 3300035118 Bacteria 3570
531 Ga0373956_0011700 3300035119 Bacteria 3619
532 Ga0373957_0048357 3300035120 Bacteria 1620
533 Ga0373943_0101847 3300035170 Bacteria 1503
534 Ga0373946_0173801 3300035171 Bacteria 1018
535 Ga0373955_0003437 3300035172 Bacteria 6960
536 Ga0373961_0045587 3300035241 Bacteria 1283
537 Ga0373924_0027321 3300035410 Bacteria 2268
538 Ga0373935_0135543 3300035692 Bacteria 1658
539 Ga0373935_0210066 3300035692 Bacteria 1348
540 Ga0373935_0653050 3300035692 Bacteria 772
541 Ga0373927_0158821 3300035695 Bacteria 1481
542 Ga0373927_0335905 3300035695 Bacteria 995
543 Ga0373933_0028881 3300035724 Bacteria 3201
544 Ga0373933_0073764 3300035724 Bacteria 2080
545 Ga0373947_0015124 3300035725 Bacteria 4429
546 Ga0373947_0190505 3300035725 Bacteria 1338
547 Ga0373937_0095041 3300036401 Bacteria 2763
548 Ga0395899_0000613 3300037312 Bacteria 37148
549 Ga0395899_0002073 3300037312 Bacteria 16470
550 Ga0395899_0021960 3300037312 Bacteria 4840
551 Ga0395899_0028388 3300037312 Bacteria 4214
552 Ga0395899_0044157 3300037312 Bacteria 3322
553 Ga0395899_0050305 3300037312 Bacteria 3094
554 Ga0395899_0110211 3300037312 Bacteria 1980
555 Ga0395899_0128593 3300037312 Bacteria 1810
556 Ga0395899_0391563 3300037312 Bacteria 921
557 Ga0395899_0499591 3300037312 Bacteria 789
558 Ga0395900_0000167 3300037418 Bacteria 106898
559 Ga0395900_0000435 3300037418 Bacteria 60001
560 Ga0395900_0000540 3300037418 Bacteria 52884
561 Ga0395900_0001484 3300037418 Bacteria 27947
562 Ga0395900_0001683 3300037418 Bacteria 25733
563 Ga0395900_0002454 3300037418 Bacteria 20427
564 Ga0395900_0003153 3300037418 Bacteria 17882
565 Ga0395900_0018721 3300037418 Bacteria 7062
566 Ga0395900_0028593 3300037418 Bacteria 5712
567 Ga0395900_0051797 3300037418 Bacteria 4227
568 Ga0395900_0064970 3300037418 Bacteria 3748
569 Ga0395900_0099821 3300037418 Bacteria 2982
570 Ga0395900_0110854 3300037418 Bacteria 2819
571 Ga0395900_0267165 3300037418 Bacteria 1706
572 Ga0395900_0284405 3300037418 Bacteria 1645
573 Ga0395900_0377387 3300037418 Bacteria 1386
574 Ga0395900_0431669 3300037418 Bacteria 1276
575 Ga0395898_0001362 3300037466 Bacteria 35179
576 Ga0395898_0004238 3300037466 Bacteria 15726
577 Ga0395898_0006962 3300037466 Bacteria 12020
578 Ga0395898_0010949 3300037466 Bacteria 9459
579 Ga0395898_0020629 3300037466 Bacteria 6693
580 Ga0395898_0024435 3300037466 Bacteria 6095
581 Ga0395898_0051244 3300037466 Bacteria 4037
582 Ga0395898_0135440 3300037466 Bacteria 2358
583 Ga0395898_0144130 3300037466 Bacteria 2280
584 Ga0395898_0206678 3300037466 Bacteria 1873
585 Ga0395898_0277599 3300037466 Bacteria 1598
586 Ga0395898_0310840 3300037466 Bacteria 1503
587 Ga0395898_0421554 3300037466 Bacteria 1272
588 Ga0395898_0752982 3300037466 Bacteria 915
589 Ga0395905_0031572 3300037471 Bacteria 4986
590 Ga0395905_0045196 3300037471 Bacteria 4131
591 Ga0395905_0091497 3300037471 Bacteria 2852
592 Ga0395905_0258945 3300037471 Bacteria 1624
593 Ga0395905_0553301 3300037471 Bacteria 1052
594 Ga0395901_0000154 3300038443 Bacteria 89750
595 Ga0395901_0000441 3300038443 Bacteria 48497
596 Ga0395901_0002340 3300038443 Bacteria 19318
597 Ga0395901_0007582 3300038443 Bacteria 10961
598 Ga0395901_0028365 3300038443 Bacteria 5755
599 Ga0395901_0058843 3300038443 Bacteria 3997
600 Ga0395901_0069786 3300038443 Bacteria 3660
601 Ga0395901_0075865 3300038443 Bacteria 3507
602 Ga0395901_0092933 3300038443 Bacteria 3158
603 Ga0395901_0096836 3300038443 Bacteria 3092
604 Ga0395901_0099256 3300038443 Bacteria 3053
605 Ga0395901_0148567 3300038443 Bacteria 2463
606 Ga0395901_0466532 3300038443 Bacteria 1289
607 Ga0395901_0514954 3300038443 Bacteria 1216
608 Ga0436365_0002256 3300039437 Bacteria 787
609 Ga0436361_0849159 3300039447 Bacteria 9448
610 Ga0451807_1097321 3300041486 Bacteria 995
611 Ga0451807_2387373 3300041486 Bacteria 1311
612 Ga0451853_1554031 3300041512 Bacteria 1119
613 Ga0439448_0017988 3300042005 Bacteria 2161
614 Ga0439448_0176440 3300042005 Bacteria 746
615 Ga0451577_0547041 3300042876 Bacteria 1051
616 Ga0466969_0007501 3300044656 Bacteria 5800
617 Ga0466969_0064157 3300044656 Bacteria 1779
618 Ga0466972_0000883 3300044658 Bacteria 14415
619 Ga0466982_0120675 3300044672 Bacteria 1617
620 Ga0453683_0770715 3300044673 Bacteria 632
621 Ga0466965_0023752 3300044683 Bacteria 2961
622 Ga0466966_0000401 3300044684 Bacteria 27805
623 Ga0466966_0008592 3300044684 Bacteria 6760
624 Ga0466966_0015451 3300044684 Bacteria 5046
625 Ga0466966_0338917 3300044684 Bacteria 903
626 Ga0466961_0002662 3300044693 Bacteria 11074
627 Ga0466961_0082206 3300044693 Bacteria 2038
628 Ga0466961_0423144 3300044693 Bacteria 807
629 Ga0466963_0081735 3300044694 Bacteria 2189
630 Ga0466963_0313653 3300044694 Bacteria 1103
631 Ga0466964_0000063 3300044706 Bacteria 23331
632 Ga0466964_0025320 3300044706 Bacteria 2316
633 Ga0466964_0132676 3300044706 Bacteria 1136
634 Ga0453684_0159650 3300044712 Bacteria 2668
635 Ga0466971_0011629 3300044719 Bacteria 3853
636 Ga0466957_0006532 3300044842 Bacteria 6586
637 Ga0466957_0006885 3300044842 Bacteria 6424
638 Ga0466959_0001459 3300045049 Bacteria 14478
639 Ga0466959_0092665 3300045049 Bacteria 2169
640 Ga0451576_0014936 3300045051 Bacteria 8626
641 Ga0451576_0319372 3300045051 Bacteria 1625
642 Ga0451576_0728895 3300045051 Bacteria 1041
643 Ga0466958_0029306 3300045836 Bacteria 3267
644 Ga0466958_0041926 3300045836 Bacteria 2755
645 Ga0466967_0577695 3300045976 Bacteria 1108
646 Ga0495617_000086 3300046452 Bacteria 67731
647 Ga0495617_078298 3300046452 Bacteria 1084
648 Ga0495592_0009580 3300046454 Bacteria 7289
649 Ga0495592_0202365 3300046454 Bacteria 1339
650 Ga0495603_0002780 3300046455 Bacteria 10316
651 Ga0495603_0013453 3300046455 Bacteria 4950
652 Ga0495603_0326769 3300046455 Bacteria 880
653 Ga0495590_0000017 3300046457 Bacteria 216944
654 Ga0495590_0000313 3300046457 Bacteria 25385
655 Ga0495590_0027555 3300046457 Unclassified 1993
656 Ga0495590_0042277 3300046457 Bacteria 1588
657 Ga0495590_0112897 3300046457 Bacteria 970
658 Ga0495591_000099 3300046458 Bacteria 99689
659 Ga0495591_003399 3300046458 Bacteria 8251
660 Ga0495591_010525 3300046458 Bacteria 3578
661 Ga0495629_0079790 3300046459 Bacteria 2285
662 Ga0495638_0026219 3300046460 Bacteria 3780
663 Ga0495653_0135177 3300046463 Bacteria 1740
664 Ga0495653_0226347 3300046463 Bacteria 1254
665 Ga0495653_0306845 3300046463 Bacteria 1033
666 Ga0495653_0340745 3300046463 Bacteria 966
667 Ga0495650_0000015 3300046471 Bacteria 557595
668 Ga0495650_0013587 3300046471 Bacteria 4296
669 Ga0495650_0038566 3300046471 Bacteria 2069
670 Ga0495580_0001658 3300046472 Bacteria 19583
671 Ga0495580_0003991 3300046472 Bacteria 12452
672 Ga0495580_0004314 3300046472 Bacteria 11960
673 Ga0495580_0006790 3300046472 Bacteria 9279
674 Ga0495580_0007817 3300046472 Bacteria 8559
675 Ga0495580_0277580 3300046472 Bacteria 1143
676 Ga0495580_0278877 3300046472 Bacteria 1140
677 Ga0495582_0029504 3300046473 Bacteria 3011
678 Ga0495582_0084210 3300046473 Bacteria 1767
679 Ga0495605_0001241 3300046474 Bacteria 16986
680 Ga0495605_0011473 3300046474 Bacteria 4936
681 Ga0495605_0175575 3300046474 Bacteria 944
682 Ga0495662_0084964 3300046476 Bacteria 1541
683 Ga0495664_0006370 3300046477 Bacteria 6523
684 Ga0495664_0054029 3300046477 Bacteria 2388
685 Ga0495664_0062569 3300046477 Bacteria 2217
686 Ga0495584_0000043 3300046491 Bacteria 90007
687 Ga0495584_0000304 3300046491 Bacteria 34788
688 Ga0495584_0000321 3300046491 Bacteria 33487
689 Ga0495584_0001042 3300046491 Bacteria 17317
690 Ga0495584_0002286 3300046491 Bacteria 10929
691 Ga0495584_0033749 3300046491 Bacteria 2590
692 Ga0495584_0067276 3300046491 Bacteria 1801
693 Ga0495585_0001199 3300046492 Bacteria 21091
694 Ga0495585_0006971 3300046492 Bacteria 6956
695 Ga0495585_0012689 3300046492 Bacteria 4959
696 Ga0495585_0015432 3300046492 Bacteria 4439
697 Ga0495585_0030744 3300046492 Bacteria 3053
698 Ga0495585_0368071 3300046492 Bacteria 696
699 Ga0495594_0007213 3300046499 Bacteria 5718
700 Ga0495594_0306623 3300046499 Bacteria 904
701 Ga0495596_0006572 3300046500 Bacteria 5334
702 Ga0495596_0012491 3300046500 Bacteria 3635
703 Ga0495596_0019524 3300046500 Bacteria 2782
704 Ga0495596_0019766 3300046500 Bacteria 2763
705 Ga0495596_0060737 3300046500 Bacteria 1472
706 Ga0495596_0061621 3300046500 Bacteria 1460
707 Ga0495596_0064085 3300046500 Bacteria 1430
708 Ga0495607_0000892 3300046501 Bacteria 27863
709 Ga0495607_0001281 3300046501 Bacteria 22511
710 Ga0495607_0004475 3300046501 Bacteria 10251
711 Ga0495607_0026604 3300046501 Bacteria 3589
712 Ga0495607_0137627 3300046501 Bacteria 1263
713 Ga0495607_0152079 3300046501 Bacteria 1183
714 Ga0495607_0278106 3300046501 Bacteria 795
715 Ga0495583_0001132 3300046506 Bacteria 29206
716 Ga0495583_0001553 3300046506 Bacteria 22732
717 Ga0495583_0005103 3300046506 Bacteria 9049
718 Ga0495583_0005285 3300046506 Bacteria 8835
719 Ga0495583_0009451 3300046506 Bacteria 5823
720 Ga0495606_0003768 3300046507 Bacteria 15763
721 Ga0495606_0033616 3300046507 Bacteria 3534
722 Ga0495606_0151145 3300046507 Bacteria 1362
723 Ga0495606_0230712 3300046507 Bacteria 1037
724 Ga0495606_0542686 3300046507 Bacteria 580
725 Ga0495610_0001471 3300046512 Bacteria 20781
726 Ga0495616_0013633 3300046513 Bacteria 4578
727 Ga0495616_0026336 3300046513 Bacteria 3097
728 Ga0495616_0063197 3300046513 Bacteria 1810
729 Ga0495618_0001931 3300046514 Bacteria 13580
730 Ga0495618_0046153 3300046514 Bacteria 2749
731 Ga0495620_0040908 3300046515 Bacteria 2036
732 Ga0495628_0040523 3300046516 Bacteria 3721
733 Ga0495628_0104192 3300046516 Bacteria 2187
734 Ga0495628_0191751 3300046516 Bacteria 1543
735 Ga0495628_0230789 3300046516 Bacteria 1387
736 Ga0495628_0300415 3300046516 Bacteria 1188
737 Ga0495630_0018650 3300046517 Bacteria 5097
738 Ga0495630_0045828 3300046517 Bacteria 3268
739 Ga0495630_0117643 3300046517 Bacteria 2015
740 Ga0495630_0249048 3300046517 Bacteria 1357
741 Ga0495631_0005556 3300046518 Bacteria 6591
742 Ga0495631_0006423 3300046518 Bacteria 6065
743 Ga0495631_0030600 3300046518 Bacteria 2441
744 Ga0495632_0000139 3300046519 Bacteria 74242
745 Ga0495632_0001117 3300046519 Bacteria 23014
746 Ga0495632_0028718 3300046519 Bacteria 2901
747 Ga0495637_0000026 3300046520 Bacteria 158526
748 Ga0495637_0029807 3300046520 Bacteria 2426
749 Ga0495637_0071775 3300046520 Bacteria 1395
750 Ga0495643_0000435 3300046522 Bacteria 54331
751 Ga0495643_0012063 3300046522 Bacteria 5227
752 Ga0495643_0018297 3300046522 Bacteria 4075
753 Ga0495644_0010160 3300046523 Bacteria 3626
754 Ga0495644_0110357 3300046523 Bacteria 1043
755 Ga0495648_0000839 3300046524 Bacteria 32396
756 Ga0495648_0049487 3300046524 Bacteria 2576
757 Ga0495648_0087024 3300046524 Bacteria 1760
758 Ga0495648_0115739 3300046524 Bacteria 1450
759 Ga0495666_0012950 3300046526 Bacteria 4156
760 Ga0495666_0027659 3300046526 Bacteria 2791
761 Ga0495642_0007863 3300046528 Bacteria 4084
762 Ga0495642_0013195 3300046528 Bacteria 3192
763 Ga0495642_0025668 3300046528 Bacteria 2336
764 Ga0495642_0052486 3300046528 Bacteria 1679
765 Ga0495642_0071276 3300046528 Bacteria 1454
766 Ga0495652_0145973 3300046529 Bacteria 1854
767 Ga0495652_0340563 3300046529 Bacteria 1077
768 Ga0495654_0102933 3300046530 Bacteria 1312
769 Ga0495665_0013876 3300046531 Bacteria 4351
770 Ga0495665_0059668 3300046531 Bacteria 2014
771 Ga0495665_0068309 3300046531 Bacteria 1874
772 Ga0495665_0216069 3300046531 Bacteria 992
773 Ga0495640_0057329 3300046533 Bacteria 2659
774 Ga0495586_0010988 3300046535 Bacteria 4810
775 Ga0495587_0008224 3300046536 Bacteria 6717
776 Ga0495587_0126287 3300046536 Bacteria 1463
777 Ga0495598_0033960 3300046537 Bacteria 1451
778 Ga0495609_0000262 3300046538 Bacteria 49441
779 Ga0495609_0000385 3300046538 Bacteria 37400
780 Ga0495609_0063615 3300046538 Bacteria 1628
781 Ga0495609_0107677 3300046538 Bacteria 1204
782 Ga0495621_0011231 3300046539 Bacteria 2764
783 Ga0495597_0015276 3300046542 Bacteria 3637
784 Ga0495597_0018863 3300046542 Bacteria 3233
785 Ga0495645_0025086 3300046543 Bacteria 4327
786 Ga0495645_0226210 3300046543 Bacteria 1255
787 Ga0495622_0042602 3300046557 Bacteria 2110
788 Ga0495622_0108988 3300046557 Unclassified 1268
789 Ga0495633_0000649 3300046558 Bacteria 32293
790 Ga0495633_0004247 3300046558 Bacteria 9171
791 Ga0495633_0328090 3300046558 Bacteria 694
792 Ga0495667_0106515 3300046559 Bacteria 1812
793 Ga0495667_0175077 3300046559 Bacteria 1378
794 Ga0495656_0296006 3300046615 Bacteria 828
795 Ga0495668_0029786 3300046616 Bacteria 3084
796 Ga0495668_0040547 3300046616 Bacteria 2596
797 Ga0495668_0127258 3300046616 Bacteria 1394
798 Ga0495668_0196871 3300046616 Bacteria 1103
799 Ga0495634_0305674 3300046642 Bacteria 961
800 Ga0495611_0000185 3300046648 Bacteria 44393
801 Ga0495611_0000341 3300046648 Bacteria 30353
802 Ga0495611_0022375 3300046648 Bacteria 2735
803 Ga0495611_0111971 3300046648 Bacteria 1271
804 Ga0495611_0124837 3300046648 Bacteria 1200
805 Ga0495625_0019023 3300046660 Bacteria 5345
806 Ga0495625_0171136 3300046660 Bacteria 1450
807 Ga0495635_0079173 3300046663 Bacteria 2249
808 Ga0495635_0270524 3300046663 Bacteria 1143
809 Ga0495661_0000190 3300046665 Bacteria 71131
810 Ga0495661_0000610 3300046665 Bacteria 36400
811 Ga0495661_0002382 3300046665 Bacteria 14514
812 Ga0495661_0003409 3300046665 Bacteria 11750
813 Ga0495661_0003497 3300046665 Bacteria 11571
814 Ga0495661_0028623 3300046665 Bacteria 3564
815 Ga0495661_0049201 3300046665 Bacteria 2557
816 Ga0495661_0072142 3300046665 Bacteria 2015
817 Ga0495661_0072472 3300046665 Bacteria 2009
818 Ga0495661_0087065 3300046665 Bacteria 1787
819 Ga0495661_0106889 3300046665 Bacteria 1565
820 Ga0495588_0322351 3300046674 Bacteria 813
821 Ga0495657_0105102 3300046675 Bacteria 1795
822 Ga0495657_0134261 3300046675 Bacteria 1548
823 Ga0495599_0043361 3300046678 Bacteria 2823
824 Ga0495599_0081335 3300046678 Bacteria 2023
825 Ga0495623_0034925 3300046679 Bacteria 3224
826 Ga0495623_0040233 3300046679 Bacteria 2985
827 Ga0495646_0017836 3300046680 Bacteria 4498
828 Ga0495646_0101192 3300046680 Bacteria 1652
829 Ga0495646_0120598 3300046680 Bacteria 1484
830 Ga0495669_0021066 3300046684 Bacteria 2826
831 Ga0495669_0042404 3300046684 Bacteria 2023
832 Ga0495669_0092685 3300046684 Bacteria 1396
833 Ga0495613_0006974 3300046689 Bacteria 8421
834 Ga0495613_0113860 3300046689 Bacteria 1947
835 Ga0495624_0005502 3300046690 Bacteria 9119
836 Ga0495624_0053938 3300046690 Bacteria 2536
837 Ga0495624_0068489 3300046690 Bacteria 2212
838 Ga0495670_0035407 3300046691 Bacteria 2488
839 Ga0495670_0215967 3300046691 Bacteria 1018
840 Ga0495671_0000388 3300046692 Bacteria 36280
841 Ga0495671_0001051 3300046692 Bacteria 19191
842 Ga0495671_0065839 3300046692 Bacteria 1783
843 Ga0495649_0000463 3300046694 Bacteria 34901
844 Ga0495649_0002276 3300046694 Bacteria 13639
845 Ga0495649_0008473 3300046694 Bacteria 6187
846 Ga0495649_0081178 3300046694 Bacteria 1734
847 Ga0495649_0229646 3300046694 Bacteria 958
848 Ga0495649_0355283 3300046694 Bacteria 740
849 Ga0495589_0002567 3300046794 Bacteria 10097
850 Ga0495589_0014338 3300046794 Bacteria 4083
851 Ga0495589_0027399 3300046794 Bacteria 2881
852 Ga0495589_0045998 3300046794 Bacteria 2166
853 Ga0495589_0067885 3300046794 Bacteria 1745
854 Ga0495589_0076639 3300046794 Bacteria 1630
855 Ga0495589_0212526 3300046794 Bacteria 910
856 Ga0495600_0000982 3300046809 Bacteria 15361
857 Ga0495660_0004921 3300046810 Bacteria 8049
858 Ga0495660_0011842 3300046810 Bacteria 5058
859 Ga0495660_0024088 3300046810 Bacteria 3468
860 Ga0495660_0043377 3300046810 Bacteria 2481
861 Ga0495660_0151094 3300046810 Bacteria 1146
862 Ga0495581_0062062 3300047315 Bacteria 2159
863 Ga0495581_0067607 3300047315 Bacteria 2066
864 Ga0495604_0003076 3300047317 Bacteria 13342
865 Ga0495604_0162934 3300047317 Bacteria 1574
866 Ga0495604_0211021 3300047317 Bacteria 1342
867 Ga0495604_0246909 3300047317 Bacteria 1218
868 Ga0495636_0006493 3300047318 Bacteria 4596
869 Ga0495674_0028018 3300047319 Bacteria 5142
870 Ga0495674_0039429 3300047319 Bacteria 4234
871 Ga0495674_0096950 3300047319 Bacteria 2512
872 Ga0495674_0140669 3300047319 Bacteria 2029
873 Ga0495674_0143624 3300047319 Bacteria 2004
874 Ga0495672_0000186 3300047320 Bacteria 89947
875 Ga0495672_0000649 3300047320 Bacteria 38619
876 Ga0495672_0181486 3300047320 Bacteria 1065
877 Ga0495676_0000037 3300047321 Bacteria 115856
878 Ga0495676_0012523 3300047321 Bacteria 7637
879 Ga0495676_0092176 3300047321 Bacteria 2262
880 Ga0495676_0155587 3300047321 Bacteria 1622
881 Ga0495680_0011582 3300047322 Bacteria 7795
882 Ga0495683_0001297 3300047323 Bacteria 16887
883 Ga0495683_0024273 3300047323 Bacteria 3112
884 Ga0495683_0029031 3300047323 Bacteria 2827
885 Ga0495683_0056039 3300047323 Bacteria 1961
886 Ga0495687_000425 3300047443 Bacteria 52066
887 Ga0495687_059549 3300047443 Bacteria 1579
888 Ga0495675_0012706 3300047444 Bacteria 5300
889 Ga0495675_0080046 3300047444 Bacteria 2058
890 Ga0495677_0000276 3300047445 Bacteria 22535
891 Ga0495677_0004922 3300047445 Bacteria 5092
892 Ga0495677_0012036 3300047445 Bacteria 3158
893 Ga0495677_0114481 3300047445 Bacteria 1026
894 Ga0495677_0139451 3300047445 Bacteria 931
895 Ga0495679_000062 3300047446 Bacteria 107181
896 Ga0495679_000326 3300047446 Bacteria 37937
897 Ga0495679_000552 3300047446 Bacteria 26335
898 Ga0495679_002011 3300047446 Bacteria 10766
899 Ga0495679_020772 3300047446 Bacteria 2281
900 Ga0495673_0017319 3300047469 Bacteria 3664
901 Ga0495681_0006426 3300047470 Bacteria 7728
902 Ga0495681_0021361 3300047470 Bacteria 3491
903 Ga0495681_0064699 3300047470 Bacteria 1674
904 Ga0495684_0174601 3300047471 Bacteria 1596
905 Ga0495684_0240071 3300047471 Bacteria 1322
906 Ga0495686_0012926 3300047472 Bacteria 5821
907 Ga0495686_0027160 3300047472 Bacteria 3739
908 Ga0495686_0039853 3300047472 Bacteria 2998
909 Ga0495593_0001237 3300047673 Bacteria 14948
910 Ga0495593_0020488 3300047673 Bacteria 3704
911 Ga0495593_0102804 3300047673 Bacteria 1464
912 Ga0495602_0020770 3300048088 Bacteria 6482
913 Ga0495602_0100794 3300048088 Bacteria 2370
914 Ga0495614_0008933 3300048089 Bacteria 4445
915 Ga0495614_0019082 3300048089 Bacteria 2968
916 Ga0495614_0446895 3300048089 Bacteria 611
917 Ga0495626_0000003 3300048091 Bacteria 427774
918 Ga0495626_0000906 3300048091 Bacteria 26152
919 Ga0495626_0001683 3300048091 Bacteria 17033
920 Ga0495626_0003415 3300048091 Bacteria 10211
921 Ga0495626_0003978 3300048091 Bacteria 9234
922 Ga0495626_0006103 3300048091 Bacteria 6915
923 Ga0495626_0039823 3300048091 Bacteria 2222
924 Ga0495626_0045740 3300048091 Bacteria 2042
925 Ga0495626_0169579 3300048091 Bacteria 910
926 Ga0496100_0085559 3300048903 Bacteria 2140
927 Ga0496100_0207202 3300048903 Bacteria 1432
928 Ga0496101_0017498 3300048904 Bacteria 4862
929 Ga0496101_0048938 3300048904 Bacteria 3039
930 Ga0496101_0051760 3300048904 Bacteria 2960
931 Ga0496101_0069132 3300048904 Bacteria 2583
932 Ga0496102_0026169 3300048905 Bacteria 5200
933 Ga0496102_0033317 3300048905 Bacteria 4628
934 Ga0496102_0135675 3300048905 Bacteria 2306
935 Ga0496102_0469738 3300048905 Bacteria 1179
936 Ga0496102_0754792 3300048905 Bacteria 896
937 Ga0496103_0094697 3300048906 Bacteria 1887
938 Ga0496103_0197867 3300048906 Bacteria 1292
939 Ga0496104_0004559 3300048907 Bacteria 12076
940 Ga0496104_0149528 3300048907 Bacteria 2242
941 Ga0496105_0010155 3300048908 Bacteria 7396
942 Ga0496105_0141356 3300048908 Bacteria 1981
943 Ga0496105_0184633 3300048908 Bacteria 1707
944 Ga0496106_0001203 3300048909 Bacteria 19325
945 Ga0496106_0018942 3300048909 Bacteria 5099
946 Ga0496106_0472021 3300048909 Bacteria 1008
947 Ga0496107_0078157 3300048910 Bacteria 2411
948 Ga0496108_0265054 3300048911 Bacteria 1495
949 Ga0496110_0000262 3300048913 Bacteria 34117
950 Ga0496110_0270665 3300048913 Bacteria 1546
951 Ga0496111_0637599 3300048914 Bacteria 778
952 Ga0496112_0003465 3300048915 Bacteria 13044
953 Ga0496112_0062528 3300048915 Bacteria 3672
954 Ga0496112_0348801 3300048915 Bacteria 1423
955 Ga0496112_0428893 3300048915 Bacteria 1260
956 Ga0496113_0173090 3300048916 Bacteria 1710
957 Ga0496114_0017203 3300048917 Bacteria 5832
958 Ga0496116_0003752 3300048919 Bacteria 14856
959 Ga0496116_0129961 3300048919 Bacteria 1438
960 Ga0496117_0055350 3300048920 Bacteria 2772
961 Ga0496117_0083648 3300048920 Bacteria 2085
962 Ga0496117_0321185 3300048920 Bacteria 811
963 Ga0496118_0027201 3300048921 Bacteria 4847
964 Ga0496118_0034654 3300048921 Bacteria 4113
965 Ga0496118_0112077 3300048921 Bacteria 1807
966 Ga0496121_0004302 3300048924 Bacteria 19300
967 Ga0496121_0018688 3300048924 Bacteria 6976
968 Ga0496121_0049842 3300048924 Bacteria 3545
969 Ga0496121_0139200 3300048924 Bacteria 1803
970 Ga0496121_0237395 3300048924 Bacteria 1273
971 Ga0496122_0000248 3300048925 Bacteria 121158
972 Ga0496122_0009508 3300048925 Bacteria 10226
973 Ga0496122_0044196 3300048925 Bacteria 3480
974 Ga0496123_0000122 3300048926 Bacteria 158966
975 Ga0496123_0004343 3300048926 Bacteria 15007
976 Ga0496123_0127768 3300048926 Bacteria 1415
977 Ga0496124_0101368 3300048927 Bacteria 2333
978 Ga0496124_0149523 3300048927 Bacteria 1834
979 Ga0496124_0241106 3300048927 Bacteria 1344
980 Ga0496124_0556712 3300048927 Bacteria 756
981 Ga0496125_0009189 3300048928 Bacteria 10214
982 Ga0496125_0021547 3300048928 Bacteria 6008
983 Ga0496125_0459558 3300048928 Bacteria 727
984 Ga0496126_0472208 3300048929 Bacteria 1006
985 Ga0496126_0574425 3300048929 Bacteria 891
986 Ga0495678_000196 3300049459 Bacteria 70932
987 Ga0495678_000487 3300049459 Bacteria 39369
988 Ga0495678_001145 3300049459 Bacteria 22035
989 Ga0495678_076916 3300049459 Bacteria 1208
990 Ga0495682_0000080 3300049460 Bacteria 84736
991 Ga0495682_0034323 3300049460 Bacteria 1871
992 Ga0495682_0041407 3300049460 Bacteria 1688
993 Ga0495682_0066514 3300049460 Bacteria 1299
994 Ga0495682_0066659 3300049460 Bacteria 1297
995 Ga0501067_0294999 3300049583 Bacteria 903
996 Ga0501069_0499227 3300049585 Bacteria 726
997 Ga0501072_0186237 3300049588 Bacteria 1656
998 Ga0501035_0002771 3300049822 Bacteria 16977
999 Ga0501045_0193725 3300049824 Bacteria 1515
1000 nmdc:mga0k408_167074_c1 3300050493 Bacteria 944
1001 nmdc:mga0qj67_90304_c1 3300050509 Bacteria 2461
1002 nmdc:mga06r32_512193_c1 3300050510 Bacteria 1176
1003 nmdc:mga08y16_26196_c1 3300050511 Bacteria 6149
1004 nmdc:mga0n895_297787_c1 3300050512 Bacteria 1635
1005 nmdc:mga08x19_318906_c1 3300050514 Bacteria 1081
1006 nmdc:mga0a205_444181_c1 3300050515 Bacteria 1157
1007 Ga0495601_0652944 3300053077 Bacteria 673
1008 Ga0500636_0326636 3300053177 Bacteria 743
1009 Ga0587093_032409 3300059478 Bacteria 758
1010 Ga0587083_0000272 3300059505 Bacteria 4051
1011 Ga0587083_0021676 3300059505 Bacteria 1196
1012 Ga0587088_005302 3300059508 Bacteria 1686
1013 Ga0466962_0005072 3300061719 Bacteria 6334
1014 2509127427 2508501125 Bacteria 7208311
1015 2512347647 2512047030 Bacteria 9031815
1016 2513555951 2513237082 Bacteria 8640282
1017 2515679310 2515154122 Bacteria 8609520
1018 2515688523 2515154123 Bacteria 6387382
1019 2516017123 2515154189 Bacteria 9629850
1020 2519457998 2519103095 Bacteria 6629912
1021 2527080287 2526164713 Bacteria 6780608
1022 2597030152 2596583598 Bacteria 5251611
1023 2599739301 2599185239 Bacteria 8686614
1024 2643798220 2643221556 Bacteria 7251154
1025 2644475223 2643221684 Bacteria 7145183
1026 2719639247 2718217991 Bacteria 7829542
1027 2753565956 2751185846 Bacteria 7242164
1028 2809144670 2808606418 Bacteria 6724496
1029 2819621011 2818991450 Bacteria 6962147
1030 2819632684 2818991452 Bacteria 8442785
1031 2842457930 2842454564 Bacteria 8730687
1032 2856290338 2856287931 Bacteria 7223934
1033 2857362637 2857357740 Bacteria 9937880
1034 2870068984 2870068957 Bacteria 8925310
1035 2885277195 2885270888 Bacteria 9831543
1036 2900636099 2900634093 Bacteria 10263517
1037 2904438279 2904434214 Bacteria 6230908
1038 2904565859 2904564687 Bacteria 7609577
1039 2904572902 2904571731 Bacteria 7608790
1040 2904620847 2904615490 Bacteria 10047340
1041 2919530049 2919527303 Bacteria 7718827
1042 2921644683 2921643360 Bacteria 11448031
1043 2928109814 2928108538 Bacteria 7360024
1044 2928136733 2928135762 Bacteria 7259641
1045 2928159728 2928157003 Bacteria 7522202
1046 2928173206 2928170801 Bacteria 8785406
1047 2928510466 2928503688 Bacteria 7268108
1048 2928538573 2928536128 Bacteria 7657547
1049 2981994171 2981990288 Bacteria 7590678
1050 640486038 640427133 Bacteria 4567418
1051 642422951 641736151 Bacteria 7477263
1052 642594108 642555112 Bacteria 8676562
1053 642620441 642555113 Bacteria 8214658
1054 8021122574 8021120328 Bacteria 8782274
1055 8021126695 8021120328 Bacteria 8782274
1056 8039099225 8039098773 Bacteria 6602928
1057 8040171716 8040167225 Bacteria 6542727
1058 8055266571 8055266321 Bacteria 7999742
1059 Ga0496109_0053029
1060 JGI24739J22299_10001077
1061 JGI24748J21848_1018955
1062 JGI25156J39149_1001449
1063 JGI25159J45721_1007464
1064 rootL2_10093023
1065 rootL2_10280545
1066 JGI25161J50226_1000115
1067 Ga0055533_1000948
1068 Ga0055533_1003019
1069 Ga0055532_1000401
1070 Ga0055525_1000246
1071 Ga0055527_1000430
1072 Ga0055527_1000691
1073 Ga0055535_1000857
1074 Ga0055542_1000846
1075 Ga0055542_1001567
1076 Ga0055529_1000614
1077 Ga0055528_1006287
1078 Ga0055541_1001121
1079 Ga0055541_1006047
1080 Ga0055543_1000094
1081 Ga0065165_1000434
1082 Ga0070658_10033009
1083 Ga0070658_10056675
1084 Ga0070658_10207871
1085 Ga0070658_10237583
1086 Ga0070658_10853105
1087 Ga0070676_10000300
1088 Ga0070676_10022641
1089 Ga0070676_10058870
1090 Ga0070676_10194777
1091 Ga0070676_10314199
1092 Ga0070683_100040268
1093 Ga0070683_100064940
1094 Ga0070683_100737784
1095 Ga0070690_100001976
1096 Ga0070670_100000010
1097 Ga0070670_100197473
1098 Ga0070677_10000444
1099 Ga0068869_100019562
1100 Ga0068869_100030702
1101 Ga0070666_10000386
1102 Ga0070666_10061649
1103 Ga0070680_100614545
1104 Ga0068868_100035991
1105 Ga0068868_100085789
1106 Ga0070660_100001619
1107 Ga0070660_100048057
1108 Ga0070660_100056007
1109 Ga0070660_100071737
1110 Ga0070660_100148020
1111 Ga0070660_100164209
1112 Ga0070660_100400821
1113 Ga0070660_100657266
1114 Ga0070689_100002818
1115 Ga0070661_100048416
1116 Ga0070661_100058648
1117 Ga0070661_100179454
1118 Ga0070668_100004602
1119 Ga0070668_100328085
1120 Ga0070669_100025920
1121 Ga0070675_100000235
1122 Ga0070671_100014294
1123 Ga0070671_100025124
1124 Ga0070671_100055767
1125 Ga0070671_100181930
1126 Ga0070674_100012603
1127 Ga0070673_100002777
1128 Ga0070673_100026921
1129 Ga0070673_100096546
1130 Ga0070673_100633665
1131 Ga0070688_100000391
1132 Ga0070688_100003549
1133 Ga0070659_100007308
1134 Ga0070659_100074498
1135 Ga0070659_100117753
1136 Ga0070659_100146558
1137 Ga0070659_100719131
1138 Ga0070659_101223010
1139 Ga0070659_101251122
1140 Ga0070667_100000124
1141 Ga0070667_100012546
1142 Ga0070667_100041759
1143 Ga0070667_100541931
1144 Ga0070709_10174418
1145 Ga0070709_10376687
1146 Ga0070709_10390742
1147 Ga0070714_100024730
1148 Ga0070714_100036938
1149 Ga0070714_100066890
1150 Ga0070714_100083062
1151 Ga0070714_100415863
1152 Ga0070713_100000093
1153 Ga0070713_100016492
1154 Ga0070713_100026608
1155 Ga0070710_10019044
1156 Ga0070710_10179433
1157 Ga0070701_10263751
1158 Ga0070711_100014795
1159 Ga0070711_101305880
1160 Ga0070705_100079533
1161 Ga0070705_100385271
1162 Ga0070694_100580750
1163 Ga0070708_100122003
1164 Ga0070663_100000499
1165 Ga0070663_100001362
1166 Ga0070663_100006870
1167 Ga0070663_100360129
1168 Ga0070678_100003783
1169 Ga0070662_100793296
1170 Ga0070681_10288673
1171 Ga0068867_100003026
1172 Ga0070685_10000001
1173 Ga0070685_10001033
1174 Ga0070685_10609338
1175 Ga0070706_100038366
1176 Ga0070707_100506148
1177 Ga0070698_100392462
1178 Ga0070699_100826473
1179 Ga0070679_100041918
1180 Ga0070679_100216812
1181 Ga0070679_100228132
1182 Ga0070679_100255006
1183 Ga0070679_100308184
1184 Ga0070679_100359158
1185 Ga0070684_100045274
1186 Ga0070684_100121421
1187 Ga0070684_100369854
1188 Ga0068853_100005939
1189 Ga0068853_100212328
1190 Ga0068853_100330016
1191 Ga0070672_100004095
1192 Ga0070672_100024487
1193 Ga0070672_100167064
1194 Ga0070672_100214528
1195 Ga0070686_100392589
1196 Ga0070686_100445155
1197 Ga0070696_100842715
1198 Ga0070693_100011666
1199 Ga0070665_100003582
1200 Ga0070665_100008038
1201 Ga0070665_100016415
1202 Ga0068855_100000446
1203 Ga0068855_100078780
1204 Ga0068855_100277610
1205 Ga0068855_100427769
1206 Ga0068855_100481728
1207 Ga0068855_100871235
1208 Ga0070664_100034625
1209 Ga0070664_100046725
1210 Ga0070664_100175803
1211 Ga0070664_100540038
1212 Ga0068854_100067432
1213 Ga0068854_100193913
1214 Ga0068854_100363625
1215 Ga0068854_100858646
1216 Ga0068856_100064505
1217 Ga0070702_100207958
1218 Ga0068852_100000557
1219 Ga0068852_100005163
1220 Ga0068852_100012738
1221 Ga0068852_100022774
1222 Ga0068852_100173074
1223 Ga0068852_100183393
1224 Ga0068852_100277326
1225 Ga0068852_100391862
1226 Ga0068852_101415146
1227 Ga0068859_100056556
1228 Ga0068859_100063075
1229 Ga0068859_100202306
1230 Ga0068864_100000018
1231 Ga0068864_100001480
1232 Ga0068861_100406726
1233 Ga0068861_100929172
1234 Ga0068861_100998374
1235 Ga0068851_10002512
1236 Ga0068851_10003593
1237 Ga0068851_10021814
1238 Ga0068851_10177868
1239 Ga0068870_10011536
1240 Ga0068870_10074022
1241 Ga0068863_100008456
1242 Ga0068863_100125206
1243 Ga0068863_101022489
1244 Ga0068858_100009965
1245 Ga0068858_100223217
1246 Ga0068860_100000736
1247 Ga0068860_100068491
1248 Ga0068860_100072712
1249 Ga0068862_100573438
1250 Ga0081539_10001028
1251 Ga0070717_10143372
1252 Ga0070716_100008148
1253 Ga0070716_100455564
1254 Ga0070712_100100990
1255 Ga0070712_100230844
1256 Ga0075366_10100668
1257 Ga0075366_10129117
1258 Ga0097621_100023861
1259 Ga0097621_100226125
1260 Ga0068871_100044715
1261 Ga0068871_100608013
1262 Ga0075430_100122232
1263 Ga0075434_100192697
1264 Ga0068865_100383428
1265 Ga0075436_100058459
1266 Ga0097620_100056549
1267 Ga0097620_100063074
1268 Ga0097620_100202324
1269 Ga0075435_100389573
1270 Ga0105251_10003483
1271 Ga0105251_10117833
1272 Ga0105250_10036182
1273 Ga0105240_10066908
1274 Ga0105240_10356211
1275 Ga0105240_10367061
1276 Ga0105240_10428861
1277 Ga0105240_10555605
1278 Ga0111539_10028815
1279 Ga0105245_10059875
1280 Ga0105245_11630101
1281 Ga0105247_10003623
1282 Ga0105247_10050287
1283 Ga0105243_10024540
1284 Ga0105243_11727046
1285 Ga0105241_10007108
1286 Ga0105241_10055307
1287 Ga0105241_10216202
1288 Ga0105242_10022479
1289 Ga0105242_10269707
1290 Ga0105248_10028584
1291 Ga0105248_10733966
1292 Ga0105237_10016306
1293 Ga0105237_10126806
1294 Ga0105237_10145172
1295 Ga0105237_10331166
1296 Ga0105238_10017261
1297 Ga0105238_10020728
1298 Ga0105238_10076951
1299 Ga0105238_10142432
1300 Ga0105238_10456731
1301 Ga0105249_10039672
1302 Ga0105249_10110467
1303 Ga0105249_11546349
1304 Ga0105239_10005029
1305 Ga0105239_10073052
1306 Ga0105239_10204498
1307 Ga0105239_11086198
1308 Ga0105246_10083341
1309 Ga0105246_10634285
1310 Ga0157373_10026681
1311 Ga0157373_10028005
1312 Ga0157373_10159381
1313 Ga0157373_10218121
1314 Ga0157371_10000787
1315 Ga0157371_10010442
1316 Ga0157371_10176789
1317 Ga0157370_10066110
1318 Ga0157370_10084826
1319 Ga0157370_10520106
1320 Ga0157369_10000233
1321 Ga0157369_10151219
1322 Ga0157369_10650420
1323 Ga0157369_11010194
1324 Ga0157374_10000102
1325 Ga0157374_10000922
1326 Ga0157374_10477807
1327 Ga0157378_10196590
1328 Ga0157378_11403798
1329 Ga0163162_10072103
1330 Ga0163162_10429519
1331 Ga0163162_11335935
1332 Ga0157372_10015261
1333 Ga0157372_10045705
1334 Ga0157372_10093274
1335 Ga0157372_10110309
1336 Ga0157372_10126617
1337 Ga0157372_10169840
1338 Ga0157372_10182283
1339 Ga0157372_10212457
1340 Ga0157372_10224781
1341 Ga0157372_10229050
1342 Ga0157372_10543868
1343 Ga0157372_11675352
1344 Ga0157375_10000781
1345 Ga0157375_10061164
1346 Ga0157375_10114100
1347 Ga0157375_10185244
1348 Ga0163163_10000203
1349 Ga0163163_10008748
1350 Ga0157380_10000221
1351 Ga0157380_10757852
1352 Ga0182008_10020983
1353 Ga0182008_10028409
1354 Ga0157379_10157007
1355 Ga0157379_10595425
1356 Ga0157376_10017970
1357 Ga0157376_10109229
1358 Ga0157376_10546062
1359 Ga0182006_1000392
1360 Ga0182006_1076350
1361 Ga0182007_10000207
1362 Ga0182007_10007661
1363 Ga0182007_10017454
1364 Ga0182005_1002413
1365 Ga0183361_10030
1366 Ga0206356_10936544
1367 Ga0206353_11819478
1368 Ga0206353_11871602
1369 Ga0213872_10109157
1370 Ga0209436_100042
1371 Ga0209784_101038
1372 Ga0209566_100200
1373 Ga0209566_100554
1374 Ga0209566_100564
1375 Ga0209674_100150
1376 Ga0209674_100382
1377 Ga0209674_100813
1378 Ga0209672_100028
1379 Ga0209672_100489
1380 Ga0209672_100496
1381 Ga0209147_100117
1382 Ga0209563_100007
1383 Ga0209563_109555
1384 Ga0209258_100112
1385 Ga0209677_102157
1386 Ga0209677_102170
1387 Ga0209677_107693
1388 Ga0209148_1000043
1389 Ga0209148_1000314
1390 Ga0209759_1000379
1391 Ga0209759_1000711
1392 Ga0209759_1003670
1393 Ga0209455_1000050
1394 Ga0209673_1000070
1395 Ga0209130_1000227
1396 Ga0209564_1012617
1397 Ga0207656_10001586
1398 Ga0207696_1032103
1399 Ga0207713_1000451
1400 Ga0207682_10000165
1401 Ga0207692_10079765
1402 Ga0207710_10003333
1403 Ga0207680_10000251
1404 Ga0207680_10035280
1405 Ga0207680_10178994
1406 Ga0207680_10324634
1407 Ga0207647_10013556
1408 Ga0207647_10041727
1409 Ga0207647_10052298
1410 Ga0207685_10029894
1411 Ga0207699_10054253
1412 Ga0207699_10102794
1413 Ga0207645_10000045
1414 Ga0207645_10064008
1415 Ga0207643_10026319
1416 Ga0207705_10201515
1417 Ga0207705_10216104
1418 Ga0207705_10267288
1419 Ga0207705_10270781
1420 Ga0207705_10435750
1421 Ga0207684_10321716
1422 Ga0207654_10004639
1423 Ga0207654_10453351
1424 Ga0207707_10206517
1425 Ga0207707_10412914
1426 Ga0207707_10489963
1427 Ga0207695_10008527
1428 Ga0207695_10011136
1429 Ga0207695_10182686
1430 Ga0207695_10345555
1431 Ga0207671_10030279
1432 Ga0207671_10067076
1433 Ga0207671_10357269
1434 Ga0207671_10375187
1435 Ga0207693_10004419
1436 Ga0207693_10016506
1437 Ga0207693_10226295
1438 Ga0207663_10062311
1439 Ga0207660_10184347
1440 Ga0207660_10253446
1441 Ga0207657_10000258
1442 Ga0207657_10002002
1443 Ga0207657_10005627
1444 Ga0207657_10006421
1445 Ga0207657_10017533
1446 Ga0207657_10064037
1447 Ga0207657_10139774
1448 Ga0207657_10322984
1449 Ga0207649_10005560
1450 Ga0207649_10361529
1451 Ga0207652_10024741
1452 Ga0207652_10095051
1453 Ga0207652_10123673
1454 Ga0207681_10013915
1455 Ga0207681_10145539
1456 Ga0207694_10052663
1457 Ga0207694_10101106
1458 Ga0207694_10117754
1459 Ga0207694_10335509
1460 Ga0207650_10000003
1461 Ga0207650_10037386
1462 Ga0207650_10063290
1463 Ga0207659_10014293
1464 Ga0207687_10005040
1465 Ga0207687_10132360
1466 Ga0207687_10769199
1467 Ga0207700_10000214
1468 Ga0207700_10038855
1469 Ga0207664_10000853
1470 Ga0207664_10007991
1471 Ga0207664_10047207
1472 Ga0207664_10086947
1473 Ga0207664_10155402
1474 Ga0207644_10011801
1475 Ga0207644_10014141
1476 Ga0207644_10137141
1477 Ga0207690_10000485
1478 Ga0207690_10100810
1479 Ga0207690_10355801
1480 Ga0207706_10000023
1481 Ga0207706_10340931
1482 Ga0207706_10713632
1483 Ga0207686_10012630
1484 Ga0207686_10229876
1485 Ga0207709_10007786
1486 Ga0207670_10005050
1487 Ga0207669_10002574
1488 Ga0207665_10009098
1489 Ga0207665_10052787
1490 Ga0207665_10655475
1491 Ga0207691_10000279
1492 Ga0207691_10019010
1493 Ga0207711_10000087
1494 Ga0207711_10091412
1495 Ga0207689_10027196
1496 Ga0207689_10076115
1497 Ga0207679_10025570
1498 Ga0207679_10131717
1499 Ga0207679_10497595
1500 Ga0207679_11401621
1501 Ga0207667_10002136
1502 Ga0207667_10003269
1503 Ga0207667_10004129
1504 Ga0207667_10094099
1505 Ga0207667_10132077
1506 Ga0207667_10217078
1507 Ga0207667_10241309
1508 Ga0207667_11650123
1509 Ga0207651_10008555
1510 Ga0207651_10019463
1511 Ga0207712_10018021
1512 Ga0207712_10181914
1513 Ga0207712_11138569
1514 Ga0207668_10002332
1515 Ga0207668_10005740
1516 Ga0207668_10595752
1517 Ga0207640_10062101
1518 Ga0207640_10204607
1519 Ga0207640_10482341
1520 Ga0207658_10000007
1521 Ga0207658_10009855
1522 Ga0207658_10040299
1523 Ga0207658_10462105
1524 Ga0207677_10003044
1525 Ga0207677_10004160
1526 Ga0207677_10208152
1527 Ga0207703_10000522
1528 Ga0207703_10389424
1529 Ga0207639_10280920
1530 Ga0207678_10000110
1531 Ga0207678_10017290
1532 Ga0207678_10462816
1533 Ga0207702_10000523
1534 Ga0207702_10024567
1535 Ga0207702_10056187
1536 Ga0207702_10214039
1537 Ga0207702_10686431
1538 Ga0207702_11265912
1539 Ga0207641_10029599
1540 Ga0207641_10065135
1541 Ga0207641_10118174
1542 Ga0207648_10031644
1543 Ga0207676_10000003
1544 Ga0207676_10000140
1545 Ga0207674_10000429
1546 Ga0207674_10013722
1547 Ga0207674_10364123
1548 Ga0207675_100032799
1549 Ga0207675_100459906
1550 Ga0207683_10000003
1551 Ga0207683_10758906
1552 Ga0207698_10004881
1553 Ga0207698_10005292
1554 Ga0207698_10009962
1555 Ga0207698_10031754
1556 Ga0207698_10096150
1557 Ga0207698_10165424
1558 Ga0207698_10496802
1559 Ga0207698_10576101
1560 Ga0209982_1007869
1561 Ga0209970_1005309
1562 Ga0209970_1031695
1563 Ga0209983_1034448
1564 Ga0209974_10008582
1565 Ga0209974_10068229
1566 Ga0207428_10075422
1567 Ga0268266_10019939
1568 Ga0268266_10034141
1569 Ga0268266_10051803
1570 Ga0268266_10237247
1571 Ga0268265_10563480
1572 Ga0268265_11803300
1573 Ga0268264_10000009
1574 Ga0268264_10012993
1575 Ga0268264_10054042
1576 Ga0265338_10237083
1577 Ga0265325_10007758
1578 Ga0265340_10196935
1579 Ga0307408_100398843
1580 Ga0265313_10039139
1581 Ga0316575_10015854
1582 Ga0265314_10046941
1583 Ga0265314_10370427
1584 Ga0373944_0276158
1585 Ga0373923_0030460
1586 Ga0373939_0073568
1587 Ga0373953_0003388
1588 Ga0373954_0014040
1589 Ga0373956_0011700
1590 Ga0373957_0048357
1591 Ga0373943_0101847
1592 Ga0373946_0173801
1593 Ga0373955_0003437
1594 Ga0373961_0045587
1595 Ga0373924_0027321
1596 Ga0373935_0135543
1597 Ga0373935_0210066
1598 Ga0373935_0653050
1599 Ga0373927_0158821
1600 Ga0373927_0335905
1601 Ga0373933_0028881
1602 Ga0373933_0073764
1603 Ga0373947_0015124
1604 Ga0373947_0190505
1605 Ga0373937_0095041
1606 Ga0395899_0000613
1607 Ga0395899_0002073
1608 Ga0395899_0021960
1609 Ga0395899_0028388
1610 Ga0395899_0044157
1611 Ga0395899_0050305
1612 Ga0395899_0110211
1613 Ga0395899_0128593
1614 Ga0395899_0391563
1615 Ga0395899_0499591
1616 Ga0395900_0000167
1617 Ga0395900_0000435
1618 Ga0395900_0000540
1619 Ga0395900_0001484
1620 Ga0395900_0001683
1621 Ga0395900_0002454
1622 Ga0395900_0003153
1623 Ga0395900_0018721
1624 Ga0395900_0028593
1625 Ga0395900_0051797
1626 Ga0395900_0064970
1627 Ga0395900_0099821
1628 Ga0395900_0110854
1629 Ga0395900_0267165
1630 Ga0395900_0284405
1631 Ga0395900_0377387
1632 Ga0395900_0431669
1633 Ga0395898_0001362
1634 Ga0395898_0004238
1635 Ga0395898_0006962
1636 Ga0395898_0010949
1637 Ga0395898_0020629
1638 Ga0395898_0024435
1639 Ga0395898_0051244
1640 Ga0395898_0135440
1641 Ga0395898_0144130
1642 Ga0395898_0206678
1643 Ga0395898_0277599
1644 Ga0395898_0310840
1645 Ga0395898_0421554
1646 Ga0395898_0752982
1647 Ga0395905_0031572
1648 Ga0395905_0045196
1649 Ga0395905_0091497
1650 Ga0395905_0258945
1651 Ga0395905_0553301
1652 Ga0395901_0000154
1653 Ga0395901_0000441
1654 Ga0395901_0002340
1655 Ga0395901_0007582
1656 Ga0395901_0028365
1657 Ga0395901_0058843
1658 Ga0395901_0069786
1659 Ga0395901_0075865
1660 Ga0395901_0092933
1661 Ga0395901_0096836
1662 Ga0395901_0099256
1663 Ga0395901_0148567
1664 Ga0395901_0466532
1665 Ga0395901_0514954
1666 Ga0436365_0002256
1667 Ga0436361_0849159
1668 Ga0451807_1097321
1669 Ga0451807_2387373
1670 Ga0451853_1554031
1671 Ga0439448_0017988
1672 Ga0439448_0176440
1673 Ga0451577_0547041
1674 Ga0466969_0007501
1675 Ga0466969_0064157
1676 Ga0466972_0000883
1677 Ga0466982_0120675
1678 Ga0453683_0770715
1679 Ga0466965_0023752
1680 Ga0466966_0000401
1681 Ga0466966_0008592
1682 Ga0466966_0015451
1683 Ga0466966_0338917
1684 Ga0466961_0002662
1685 Ga0466961_0082206
1686 Ga0466961_0423144
1687 Ga0466963_0081735
1688 Ga0466963_0313653
1689 Ga0466964_0000063
1690 Ga0466964_0025320
1691 Ga0466964_0132676
1692 Ga0453684_0159650
1693 Ga0466971_0011629
1694 Ga0466957_0006532
1695 Ga0466957_0006885
1696 Ga0466959_0001459
1697 Ga0466959_0092665
1698 Ga0451576_0014936
1699 Ga0451576_0319372
1700 Ga0451576_0728895
1701 Ga0466958_0029306
1702 Ga0466958_0041926
1703 Ga0466967_0577695
1704 Ga0495617_000086
1705 Ga0495617_078298
1706 Ga0495592_0009580
1707 Ga0495592_0202365
1708 Ga0495603_0002780
1709 Ga0495603_0013453
1710 Ga0495603_0326769
1711 Ga0495590_0000017
1712 Ga0495590_0000313
1713 Ga0495590_0027555
1714 Ga0495590_0042277
1715 Ga0495590_0112897
1716 Ga0495591_000099
1717 Ga0495591_003399
1718 Ga0495591_010525
1719 Ga0495629_0079790
1720 Ga0495638_0026219
1721 Ga0495653_0135177
1722 Ga0495653_0226347
1723 Ga0495653_0306845
1724 Ga0495653_0340745
1725 Ga0495650_0000015
1726 Ga0495650_0013587
1727 Ga0495650_0038566
1728 Ga0495580_0001658
1729 Ga0495580_0003991
1730 Ga0495580_0004314
1731 Ga0495580_0006790
1732 Ga0495580_0007817
1733 Ga0495580_0277580
1734 Ga0495580_0278877
1735 Ga0495582_0029504
1736 Ga0495582_0084210
1737 Ga0495605_0001241
1738 Ga0495605_0011473
1739 Ga0495605_0175575
1740 Ga0495662_0084964
1741 Ga0495664_0006370
1742 Ga0495664_0054029
1743 Ga0495664_0062569
1744 Ga0495584_0000043
1745 Ga0495584_0000304
1746 Ga0495584_0000321
1747 Ga0495584_0001042
1748 Ga0495584_0002286
1749 Ga0495584_0033749
1750 Ga0495584_0067276
1751 Ga0495585_0001199
1752 Ga0495585_0006971
1753 Ga0495585_0012689
1754 Ga0495585_0015432
1755 Ga0495585_0030744
1756 Ga0495585_0368071
1757 Ga0495594_0007213
1758 Ga0495594_0306623
1759 Ga0495596_0006572
1760 Ga0495596_0012491
1761 Ga0495596_0019524
1762 Ga0495596_0019766
1763 Ga0495596_0060737
1764 Ga0495596_0061621
1765 Ga0495596_0064085
1766 Ga0495607_0000892
1767 Ga0495607_0001281
1768 Ga0495607_0004475
1769 Ga0495607_0026604
1770 Ga0495607_0137627
1771 Ga0495607_0152079
1772 Ga0495607_0278106
1773 Ga0495583_0001132
1774 Ga0495583_0001553
1775 Ga0495583_0005103
1776 Ga0495583_0005285
1777 Ga0495583_0009451
1778 Ga0495606_0003768
1779 Ga0495606_0033616
1780 Ga0495606_0151145
1781 Ga0495606_0230712
1782 Ga0495606_0542686
1783 Ga0495610_0001471
1784 Ga0495616_0013633
1785 Ga0495616_0026336
1786 Ga0495616_0063197
1787 Ga0495618_0001931
1788 Ga0495618_0046153
1789 Ga0495620_0040908
1790 Ga0495628_0040523
1791 Ga0495628_0104192
1792 Ga0495628_0191751
1793 Ga0495628_0230789
1794 Ga0495628_0300415
1795 Ga0495630_0018650
1796 Ga0495630_0045828
1797 Ga0495630_0117643
1798 Ga0495630_0249048
1799 Ga0495631_0005556
1800 Ga0495631_0006423
1801 Ga0495631_0030600
1802 Ga0495632_0000139
1803 Ga0495632_0001117
1804 Ga0495632_0028718
1805 Ga0495637_0000026
1806 Ga0495637_0029807
1807 Ga0495637_0071775
1808 Ga0495643_0000435
1809 Ga0495643_0012063
1810 Ga0495643_0018297
1811 Ga0495644_0010160
1812 Ga0495644_0110357
1813 Ga0495648_0000839
1814 Ga0495648_0049487
1815 Ga0495648_0087024
1816 Ga0495648_0115739
1817 Ga0495666_0012950
1818 Ga0495666_0027659
1819 Ga0495642_0007863
1820 Ga0495642_0013195
1821 Ga0495642_0025668
1822 Ga0495642_0052486
1823 Ga0495642_0071276
1824 Ga0495652_0145973
1825 Ga0495652_0340563
1826 Ga0495654_0102933
1827 Ga0495665_0013876
1828 Ga0495665_0059668
1829 Ga0495665_0068309
1830 Ga0495665_0216069
1831 Ga0495640_0057329
1832 Ga0495586_0010988
1833 Ga0495587_0008224
1834 Ga0495587_0126287
1835 Ga0495598_0033960
1836 Ga0495609_0000262
1837 Ga0495609_0000385
1838 Ga0495609_0063615
1839 Ga0495609_0107677
1840 Ga0495621_0011231
1841 Ga0495597_0015276
1842 Ga0495597_0018863
1843 Ga0495645_0025086
1844 Ga0495645_0226210
1845 Ga0495622_0042602
1846 Ga0495622_0108988
1847 Ga0495633_0000649
1848 Ga0495633_0004247
1849 Ga0495633_0328090
1850 Ga0495667_0106515
1851 Ga0495667_0175077
1852 Ga0495656_0296006
1853 Ga0495668_0029786
1854 Ga0495668_0040547
1855 Ga0495668_0127258
1856 Ga0495668_0196871
1857 Ga0495634_0305674
1858 Ga0495611_0000185
1859 Ga0495611_0000341
1860 Ga0495611_0022375
1861 Ga0495611_0111971
1862 Ga0495611_0124837
1863 Ga0495625_0019023
1864 Ga0495625_0171136
1865 Ga0495635_0079173
1866 Ga0495635_0270524
1867 Ga0495661_0000190
1868 Ga0495661_0000610
1869 Ga0495661_0002382
1870 Ga0495661_0003409
1871 Ga0495661_0003497
1872 Ga0495661_0028623
1873 Ga0495661_0049201
1874 Ga0495661_0072142
1875 Ga0495661_0072472
1876 Ga0495661_0087065
1877 Ga0495661_0106889
1878 Ga0495588_0322351
1879 Ga0495657_0105102
1880 Ga0495657_0134261
1881 Ga0495599_0043361
1882 Ga0495599_0081335
1883 Ga0495623_0034925
1884 Ga0495623_0040233
1885 Ga0495646_0017836
1886 Ga0495646_0101192
1887 Ga0495646_0120598
1888 Ga0495669_0021066
1889 Ga0495669_0042404
1890 Ga0495669_0092685
1891 Ga0495613_0006974
1892 Ga0495613_0113860
1893 Ga0495624_0005502
1894 Ga0495624_0053938
1895 Ga0495624_0068489
1896 Ga0495670_0035407
1897 Ga0495670_0215967
1898 Ga0495671_0000388
1899 Ga0495671_0001051
1900 Ga0495671_0065839
1901 Ga0495649_0000463
1902 Ga0495649_0002276
1903 Ga0495649_0008473
1904 Ga0495649_0081178
1905 Ga0495649_0229646
1906 Ga0495649_0355283
1907 Ga0495589_0002567
1908 Ga0495589_0014338
1909 Ga0495589_0027399
1910 Ga0495589_0045998
1911 Ga0495589_0067885
1912 Ga0495589_0076639
1913 Ga0495589_0212526
1914 Ga0495600_0000982
1915 Ga0495660_0004921
1916 Ga0495660_0011842
1917 Ga0495660_0024088
1918 Ga0495660_0043377
1919 Ga0495660_0151094
1920 Ga0495581_0062062
1921 Ga0495581_0067607
1922 Ga0495604_0003076
1923 Ga0495604_0162934
1924 Ga0495604_0211021
1925 Ga0495604_0246909
1926 Ga0495636_0006493
1927 Ga0495674_0028018
1928 Ga0495674_0039429
1929 Ga0495674_0096950
1930 Ga0495674_0140669
1931 Ga0495674_0143624
1932 Ga0495672_0000186
1933 Ga0495672_0000649
1934 Ga0495672_0181486
1935 Ga0495676_0000037
1936 Ga0495676_0012523
1937 Ga0495676_0092176
1938 Ga0495676_0155587
1939 Ga0495680_0011582
1940 Ga0495683_0001297
1941 Ga0495683_0024273
1942 Ga0495683_0029031
1943 Ga0495683_0056039
1944 Ga0495687_000425
1945 Ga0495687_059549
1946 Ga0495675_0012706
1947 Ga0495675_0080046
1948 Ga0495677_0000276
1949 Ga0495677_0004922
1950 Ga0495677_0012036
1951 Ga0495677_0114481
1952 Ga0495677_0139451
1953 Ga0495679_000062
1954 Ga0495679_000326
1955 Ga0495679_000552
1956 Ga0495679_002011
1957 Ga0495679_020772
1958 Ga0495673_0017319
1959 Ga0495681_0006426
1960 Ga0495681_0021361
1961 Ga0495681_0064699
1962 Ga0495684_0174601
1963 Ga0495684_0240071
1964 Ga0495686_0012926
1965 Ga0495686_0027160
1966 Ga0495686_0039853
1967 Ga0495593_0001237
1968 Ga0495593_0020488
1969 Ga0495593_0102804
1970 Ga0495602_0020770
1971 Ga0495602_0100794
1972 Ga0495614_0008933
1973 Ga0495614_0019082
1974 Ga0495614_0446895
1975 Ga0495626_0000003
1976 Ga0495626_0000906
1977 Ga0495626_0001683
1978 Ga0495626_0003415
1979 Ga0495626_0003978
1980 Ga0495626_0006103
1981 Ga0495626_0039823
1982 Ga0495626_0045740
1983 Ga0495626_0169579
1984 Ga0496100_0085559
1985 Ga0496100_0207202
1986 Ga0496101_0017498
1987 Ga0496101_0048938
1988 Ga0496101_0051760
1989 Ga0496101_0069132
1990 Ga0496102_0026169
1991 Ga0496102_0033317
1992 Ga0496102_0135675
1993 Ga0496102_0469738
1994 Ga0496102_0754792
1995 Ga0496103_0094697
1996 Ga0496103_0197867
1997 Ga0496104_0004559
1998 Ga0496104_0149528
1999 Ga0496105_0010155
2000 Ga0496105_0141356
2001 Ga0496105_0184633
2002 Ga0496106_0001203
2003 Ga0496106_0018942
2004 Ga0496106_0472021
2005 Ga0496107_0078157
2006 Ga0496108_0265054
2007 Ga0496110_0000262
2008 Ga0496110_0270665
2009 Ga0496111_0637599
2010 Ga0496112_0003465
2011 Ga0496112_0062528
2012 Ga0496112_0348801
2013 Ga0496112_0428893
2014 Ga0496113_0173090
2015 Ga0496114_0017203
2016 Ga0496116_0003752
2017 Ga0496116_0129961
2018 Ga0496117_0055350
2019 Ga0496117_0083648
2020 Ga0496117_0321185
2021 Ga0496118_0027201
2022 Ga0496118_0034654
2023 Ga0496118_0112077
2024 Ga0496121_0004302
2025 Ga0496121_0018688
2026 Ga0496121_0049842
2027 Ga0496121_0139200
2028 Ga0496121_0237395
2029 Ga0496122_0000248
2030 Ga0496122_0009508
2031 Ga0496122_0044196
2032 Ga0496123_0000122
2033 Ga0496123_0004343
2034 Ga0496123_0127768
2035 Ga0496124_0101368
2036 Ga0496124_0149523
2037 Ga0496124_0241106
2038 Ga0496124_0556712
2039 Ga0496125_0009189
2040 Ga0496125_0021547
2041 Ga0496125_0459558
2042 Ga0496126_0472208
2043 Ga0496126_0574425
2044 Ga0495678_000196
2045 Ga0495678_000487
2046 Ga0495678_001145
2047 Ga0495678_076916
2048 Ga0495682_0000080
2049 Ga0495682_0034323
2050 Ga0495682_0041407
2051 Ga0495682_0066514
2052 Ga0495682_0066659
2053 Ga0501067_0294999
2054 Ga0501069_0499227
2055 Ga0501072_0186237
2056 Ga0501035_0002771
2057 Ga0501045_0193725
2058 nmdc:mga0k408_167074_c1
2059 nmdc:mga0qj67_90304_c1
2060 nmdc:mga06r32_512193_c1
2061 nmdc:mga08y16_26196_c1
2062 nmdc:mga0n895_297787_c1
2063 nmdc:mga08x19_318906_c1
2064 nmdc:mga0a205_444181_c1
2065 Ga0495601_0652944
2066 Ga0500636_0326636
2067 Ga0587093_032409
2068 Ga0587083_0000272
2069 Ga0587083_0021676
2070 Ga0587088_005302
2071 Ga0466962_0005072
2072 2509127427
2073 2512347647
2074 2513555951
2075 2515679310
2076 2515688523
2077 2516017123
2078 2519457998
2079 2527080287
2080 2597030152
2081 2599739301
2082 2643798220
2083 2644475223
2084 2719639247
2085 2753565956
2086 2809144670
2087 2819621011
2088 2819632684
2089 2842457930
2090 2856290338
2091 2857362637
2092 2870068984
2093 2885277195
2094 2900636099
2095 2904438279
2096 2904565859
2097 2904572902
2098 2904620847
2099 2919530049
2100 2921644683
2101 2928109814
2102 2928136733
2103 2928159728
2104 2928173206
2105 2928510466
2106 2928538573
2107 2981994171
2108 640486038
2109 642422951
2110 642594108
2111 642620441
2112 8021122574
2113 8021126695
2114 8039099225
2115 8040171716
2116 8055266571

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

25

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9836 1 183
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9816 3 176
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9812 1 183
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9785 2 183
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9783 1 183
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9743 1 183 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9691 1 183 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9622 4 178 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9616 3 183 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.952 4 178 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0F8Z5C9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 1.001 45 183 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7C8XNS0-F1-model_v4 deleted 0.9996 45 169
AF-A0A124RDG4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9978 1 183 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3N8CQX4-F1-model_v4 deleted 0.9975 1 183
AF-Q2SYI2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9972 1 183 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map