F489249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1059 | 341 | 2118 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300026023|Ga0207677_10580578|Ga0207677_105805782 |
| Length | 182 |
| Sequence | MRPSLNRKPAKKPILSHYDKAGEARMVDVSAKSETKRTARAQAFVKMSAAVLAELGNNPKGDPLQVARIAGITAAKKTSELIPMCHPLLLSHIDVKLSVKDDGVQISTSVTTTAPTGVEMEALTAATVAALTVYDMTKALDKGIEIQDIYLIEKTGGKSGTYARKGKTAAAGSRSDSRSDSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 115 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 236 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 237 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 320 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 322 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 338 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 339 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 340 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 341 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.96 |
| Metatranscriptomes | 0.66 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0 |
| Rhizoplane | 4.91 |
| Rhizosphere | 92.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207677_10580578 | 3300026023 | Bacteria | 981 |
| 2 | Ga0055530_10000901 | 3300003791 | Bacteria | 24454 |
| 3 | Ga0055531_10000583 | 3300003794 | Bacteria | 31858 |
| 4 | Ga0065715_10529869 | 3300005293 | Unclassified | 756 |
| 5 | Ga0070658_10088066 | 3300005327 | Bacteria | 2556 |
| 6 | Ga0070658_10112111 | 3300005327 | Bacteria | 2261 |
| 7 | Ga0070658_10995641 | 3300005327 | Unclassified | 729 |
| 8 | Ga0070683_100000051 | 3300005329 | Bacteria | 90543 |
| 9 | Ga0070683_100013688 | 3300005329 | Bacteria | 7081 |
| 10 | Ga0070683_100019789 | 3300005329 | Bacteria | 5983 |
| 11 | Ga0070683_100034270 | 3300005329 | Bacteria | 4636 |
| 12 | Ga0070683_100061409 | 3300005329 | Bacteria | 3495 |
| 13 | Ga0070683_100065764 | 3300005329 | Bacteria | 3376 |
| 14 | Ga0070683_100145819 | 3300005329 | Bacteria | 2243 |
| 15 | Ga0070683_100398021 | 3300005329 | Bacteria | 1313 |
| 16 | Ga0070683_100480833 | 3300005329 | Bacteria | 1186 |
| 17 | Ga0070683_100527741 | 3300005329 | Bacteria | 1128 |
| 18 | Ga0070683_100789692 | 3300005329 | Bacteria | 910 |
| 19 | Ga0070690_100664012 | 3300005330 | Bacteria | 797 |
| 20 | Ga0070670_100204356 | 3300005331 | Bacteria | 1717 |
| 21 | Ga0070670_100995684 | 3300005331 | Bacteria | 762 |
| 22 | Ga0070670_101629465 | 3300005331 | Unclassified | 593 |
| 23 | Ga0070677_10461993 | 3300005333 | Bacteria | 681 |
| 24 | Ga0068869_100010065 | 3300005334 | Bacteria | 6151 |
| 25 | Ga0068869_100170892 | 3300005334 | Bacteria | 1698 |
| 26 | Ga0068869_100300870 | 3300005334 | Bacteria | 1295 |
| 27 | Ga0070666_10133786 | 3300005335 | Bacteria | 1724 |
| 28 | Ga0070680_100009354 | 3300005336 | Bacteria | 7528 |
| 29 | Ga0070680_100143936 | 3300005336 | Bacteria | 1999 |
| 30 | Ga0070680_100952131 | 3300005336 | Unclassified | 741 |
| 31 | Ga0070682_100104446 | 3300005337 | Bacteria | 1876 |
| 32 | Ga0070682_100115730 | 3300005337 | Bacteria | 1793 |
| 33 | Ga0070682_100646689 | 3300005337 | Bacteria | 841 |
| 34 | Ga0068868_100270331 | 3300005338 | Bacteria | 1436 |
| 35 | Ga0068868_100695108 | 3300005338 | Bacteria | 909 |
| 36 | Ga0070660_100036846 | 3300005339 | Bacteria | 3706 |
| 37 | Ga0070660_100221281 | 3300005339 | Bacteria | 1539 |
| 38 | Ga0070660_100349242 | 3300005339 | Bacteria | 1218 |
| 39 | Ga0070689_100637155 | 3300005340 | Bacteria | 926 |
| 40 | Ga0070691_10009177 | 3300005341 | Bacteria | 4521 |
| 41 | Ga0070661_100746171 | 3300005344 | Bacteria | 800 |
| 42 | Ga0070692_10059267 | 3300005345 | Bacteria | 2012 |
| 43 | Ga0070692_10097797 | 3300005345 | Bacteria | 1605 |
| 44 | Ga0070668_100286256 | 3300005347 | Bacteria | 1378 |
| 45 | Ga0070668_100599076 | 3300005347 | Bacteria | 964 |
| 46 | Ga0070671_100110263 | 3300005355 | Bacteria | 2311 |
| 47 | Ga0070671_100962886 | 3300005355 | Bacteria | 747 |
| 48 | Ga0070688_100741580 | 3300005365 | Bacteria | 764 |
| 49 | Ga0070659_100641206 | 3300005366 | Bacteria | 915 |
| 50 | Ga0070667_100126251 | 3300005367 | Bacteria | 2230 |
| 51 | Ga0070667_100201538 | 3300005367 | Bacteria | 1766 |
| 52 | Ga0070667_100296367 | 3300005367 | Bacteria | 1455 |
| 53 | Ga0070667_101124904 | 3300005367 | Bacteria | 734 |
| 54 | Ga0070667_101137263 | 3300005367 | Bacteria | 730 |
| 55 | Ga0070709_10017253 | 3300005434 | Bacteria | 4137 |
| 56 | Ga0070709_10048410 | 3300005434 | Unclassified | 2652 |
| 57 | Ga0070709_10098765 | 3300005434 | Bacteria | 1941 |
| 58 | Ga0070709_10432040 | 3300005434 | Bacteria | 989 |
| 59 | Ga0070709_10736486 | 3300005434 | Unclassified | 769 |
| 60 | Ga0070714_100000386 | 3300005435 | Bacteria | 32917 |
| 61 | Ga0070714_100760365 | 3300005435 | Bacteria | 937 |
| 62 | Ga0070713_100037923 | 3300005436 | Bacteria | 3900 |
| 63 | Ga0070713_100078111 | 3300005436 | Bacteria | 2817 |
| 64 | Ga0070713_100099516 | 3300005436 | Bacteria | 2516 |
| 65 | Ga0070713_100171742 | 3300005436 | Bacteria | 1942 |
| 66 | Ga0070713_100194876 | 3300005436 | Unclassified | 1827 |
| 67 | Ga0070710_10015779 | 3300005437 | Bacteria | 3830 |
| 68 | Ga0070710_10360148 | 3300005437 | Bacteria | 965 |
| 69 | Ga0070710_10452193 | 3300005437 | Bacteria | 871 |
| 70 | Ga0070711_100186534 | 3300005439 | Bacteria | 1591 |
| 71 | Ga0070711_100750712 | 3300005439 | Unclassified | 824 |
| 72 | Ga0070711_100971110 | 3300005439 | Bacteria | 728 |
| 73 | Ga0070694_100647108 | 3300005444 | Unclassified | 855 |
| 74 | Ga0070708_100031899 | 3300005445 | Bacteria | 4565 |
| 75 | Ga0070678_100059833 | 3300005456 | Bacteria | 2801 |
| 76 | Ga0070678_100238520 | 3300005456 | Unclassified | 1519 |
| 77 | Ga0070662_100196739 | 3300005457 | Bacteria | 1597 |
| 78 | Ga0070681_10000605 | 3300005458 | Bacteria | 29575 |
| 79 | Ga0070681_10002652 | 3300005458 | Bacteria | 16431 |
| 80 | Ga0070681_10019182 | 3300005458 | Bacteria | 6844 |
| 81 | Ga0070681_10538907 | 3300005458 | Bacteria | 1081 |
| 82 | Ga0068867_100275770 | 3300005459 | Bacteria | 1377 |
| 83 | Ga0068867_100508755 | 3300005459 | Bacteria | 1036 |
| 84 | Ga0070685_10307602 | 3300005466 | Bacteria | 1070 |
| 85 | Ga0070706_100252976 | 3300005467 | Unclassified | 1645 |
| 86 | Ga0070706_101061849 | 3300005467 | Bacteria | 746 |
| 87 | Ga0070706_101385274 | 3300005467 | Bacteria | 644 |
| 88 | Ga0070707_100556620 | 3300005468 | Bacteria | 1109 |
| 89 | Ga0070707_100642203 | 3300005468 | Bacteria | 1024 |
| 90 | Ga0070707_101804062 | 3300005468 | Bacteria | 579 |
| 91 | Ga0070698_100576842 | 3300005471 | Bacteria | 1065 |
| 92 | Ga0070698_101077900 | 3300005471 | Bacteria | 752 |
| 93 | Ga0070699_100022533 | 3300005518 | Bacteria | 5429 |
| 94 | Ga0070699_100095222 | 3300005518 | Bacteria | 2607 |
| 95 | Ga0070699_100761183 | 3300005518 | Unclassified | 886 |
| 96 | Ga0070679_100000883 | 3300005530 | Bacteria | 26062 |
| 97 | Ga0070679_100017372 | 3300005530 | Bacteria | 6962 |
| 98 | Ga0070684_100000061 | 3300005535 | Bacteria | 70520 |
| 99 | Ga0070684_100002114 | 3300005535 | Bacteria | 14642 |
| 100 | Ga0070684_100028501 | 3300005535 | Bacteria | 4725 |
| 101 | Ga0070684_100072418 | 3300005535 | Bacteria | 3034 |
| 102 | Ga0070684_100210882 | 3300005535 | Bacteria | 1770 |
| 103 | Ga0070684_100706194 | 3300005535 | Bacteria | 940 |
| 104 | Ga0070684_100731726 | 3300005535 | Bacteria | 923 |
| 105 | Ga0070697_100362927 | 3300005536 | Unclassified | 1252 |
| 106 | Ga0070697_100443508 | 3300005536 | Bacteria | 1130 |
| 107 | Ga0070697_100603109 | 3300005536 | Bacteria | 965 |
| 108 | Ga0070697_100630723 | 3300005536 | Bacteria | 943 |
| 109 | Ga0068853_100761029 | 3300005539 | Bacteria | 926 |
| 110 | Ga0070672_100614830 | 3300005543 | Bacteria | 947 |
| 111 | Ga0070693_100208695 | 3300005547 | Bacteria | 1273 |
| 112 | Ga0070693_100399839 | 3300005547 | Bacteria | 952 |
| 113 | Ga0070665_100031655 | 3300005548 | Bacteria | 5323 |
| 114 | Ga0070665_100443090 | 3300005548 | Unclassified | 1308 |
| 115 | Ga0070665_100671817 | 3300005548 | Bacteria | 1049 |
| 116 | Ga0070704_100247052 | 3300005549 | Bacteria | 1463 |
| 117 | Ga0068855_100001633 | 3300005563 | Bacteria | 28123 |
| 118 | Ga0068855_100007832 | 3300005563 | Bacteria | 12909 |
| 119 | Ga0068855_100031981 | 3300005563 | Bacteria | 6282 |
| 120 | Ga0068855_100163150 | 3300005563 | Bacteria | 2528 |
| 121 | Ga0068855_100251190 | 3300005563 | Bacteria | 1973 |
| 122 | Ga0068855_100274674 | 3300005563 | Bacteria | 1873 |
| 123 | Ga0068855_100632267 | 3300005563 | Bacteria | 1151 |
| 124 | Ga0070664_100466001 | 3300005564 | Bacteria | 1161 |
| 125 | Ga0070664_101141143 | 3300005564 | Bacteria | 734 |
| 126 | Ga0068857_100003819 | 3300005577 | Bacteria | 12677 |
| 127 | Ga0068857_100061655 | 3300005577 | Bacteria | 3332 |
| 128 | Ga0068857_100238329 | 3300005577 | Bacteria | 1665 |
| 129 | Ga0068854_100121973 | 3300005578 | Bacteria | 1980 |
| 130 | Ga0068856_100075518 | 3300005614 | Bacteria | 3338 |
| 131 | Ga0068856_100097875 | 3300005614 | Bacteria | 2923 |
| 132 | Ga0068856_100203541 | 3300005614 | Bacteria | 1994 |
| 133 | Ga0068856_100346035 | 3300005614 | Bacteria | 1505 |
| 134 | Ga0068856_100754273 | 3300005614 | Bacteria | 993 |
| 135 | Ga0068856_101111460 | 3300005614 | Unclassified | 808 |
| 136 | Ga0070702_100194209 | 3300005615 | Bacteria | 1338 |
| 137 | Ga0070702_101733148 | 3300005615 | Bacteria | 520 |
| 138 | Ga0068852_100017342 | 3300005616 | Bacteria | 5647 |
| 139 | Ga0068852_100031322 | 3300005616 | Bacteria | 4387 |
| 140 | Ga0068852_100156588 | 3300005616 | Bacteria | 2123 |
| 141 | Ga0068852_100184359 | 3300005616 | Bacteria | 1965 |
| 142 | Ga0068852_100295873 | 3300005616 | Bacteria | 1565 |
| 143 | Ga0068852_100350099 | 3300005616 | Bacteria | 1442 |
| 144 | Ga0068859_100140769 | 3300005617 | Bacteria | 2486 |
| 145 | Ga0068859_100664517 | 3300005617 | Bacteria | 1134 |
| 146 | Ga0068859_101030168 | 3300005617 | Unclassified | 904 |
| 147 | Ga0068859_101293571 | 3300005617 | Bacteria | 803 |
| 148 | Ga0068859_101567583 | 3300005617 | Bacteria | 727 |
| 149 | Ga0068864_100038294 | 3300005618 | Bacteria | 4095 |
| 150 | Ga0068864_100052484 | 3300005618 | Bacteria | 3514 |
| 151 | Ga0068864_100223924 | 3300005618 | Bacteria | 1736 |
| 152 | Ga0068863_100019220 | 3300005841 | Bacteria | 6538 |
| 153 | Ga0068863_100149236 | 3300005841 | Bacteria | 2236 |
| 154 | Ga0068863_100382531 | 3300005841 | Bacteria | 1374 |
| 155 | Ga0068863_100453238 | 3300005841 | Bacteria | 1259 |
| 156 | Ga0068863_100523876 | 3300005841 | Bacteria | 1169 |
| 157 | Ga0068863_100613615 | 3300005841 | Bacteria | 1077 |
| 158 | Ga0068863_100923000 | 3300005841 | Bacteria | 874 |
| 159 | Ga0068863_101864038 | 3300005841 | Bacteria | 611 |
| 160 | Ga0068858_100013721 | 3300005842 | Bacteria | 7647 |
| 161 | Ga0068858_100239136 | 3300005842 | Bacteria | 1723 |
| 162 | Ga0068858_100482312 | 3300005842 | Bacteria | 1197 |
| 163 | Ga0068860_100035691 | 3300005843 | Bacteria | 4768 |
| 164 | Ga0068860_100074306 | 3300005843 | Bacteria | 3232 |
| 165 | Ga0068860_100199313 | 3300005843 | Bacteria | 1939 |
| 166 | Ga0068860_100310755 | 3300005843 | Bacteria | 1545 |
| 167 | Ga0068860_100356335 | 3300005843 | Bacteria | 1441 |
| 168 | Ga0068860_101123432 | 3300005843 | Bacteria | 805 |
| 169 | Ga0068862_100371468 | 3300005844 | Bacteria | 1331 |
| 170 | Ga0081539_10017275 | 3300005985 | Bacteria | 5076 |
| 171 | Ga0070717_10027358 | 3300006028 | Bacteria | 4558 |
| 172 | Ga0070717_10029546 | 3300006028 | Bacteria | 4398 |
| 173 | Ga0070717_10059739 | 3300006028 | Bacteria | 3155 |
| 174 | Ga0070717_10137100 | 3300006028 | Bacteria | 2108 |
| 175 | Ga0070717_10305381 | 3300006028 | Bacteria | 1415 |
| 176 | Ga0070717_10547250 | 3300006028 | Bacteria | 1048 |
| 177 | Ga0070715_10180463 | 3300006163 | Bacteria | 1058 |
| 178 | Ga0070716_100093300 | 3300006173 | Bacteria | 1827 |
| 179 | Ga0070716_100431208 | 3300006173 | Bacteria | 956 |
| 180 | Ga0070716_101171367 | 3300006173 | Bacteria | 616 |
| 181 | Ga0070712_100093528 | 3300006175 | Bacteria | 2207 |
| 182 | Ga0097621_100030891 | 3300006237 | Bacteria | 4244 |
| 183 | Ga0097621_100107956 | 3300006237 | Bacteria | 2349 |
| 184 | Ga0097621_100219441 | 3300006237 | Bacteria | 1656 |
| 185 | Ga0097621_100220992 | 3300006237 | Bacteria | 1651 |
| 186 | Ga0097621_100398349 | 3300006237 | Bacteria | 1232 |
| 187 | Ga0097621_100438368 | 3300006237 | Unclassified | 1175 |
| 188 | Ga0097621_100972286 | 3300006237 | Bacteria | 793 |
| 189 | Ga0068871_100129353 | 3300006358 | Bacteria | 2139 |
| 190 | Ga0068871_100143395 | 3300006358 | Bacteria | 2032 |
| 191 | Ga0068871_100355858 | 3300006358 | Bacteria | 1296 |
| 192 | Ga0068871_100607311 | 3300006358 | Bacteria | 995 |
| 193 | Ga0068871_100620271 | 3300006358 | Bacteria | 985 |
| 194 | Ga0068871_101036766 | 3300006358 | Bacteria | 765 |
| 195 | Ga0068871_101179144 | 3300006358 | Bacteria | 718 |
| 196 | Ga0075428_100350205 | 3300006844 | Bacteria | 1585 |
| 197 | Ga0075430_100036376 | 3300006846 | Bacteria | 4175 |
| 198 | Ga0075430_100055664 | 3300006846 | Unclassified | 3326 |
| 199 | Ga0075431_100022732 | 3300006847 | Bacteria | 6409 |
| 200 | Ga0075433_10004679 | 3300006852 | Bacteria | 10666 |
| 201 | Ga0075433_10381162 | 3300006852 | Bacteria | 1245 |
| 202 | Ga0075433_10937738 | 3300006852 | Bacteria | 755 |
| 203 | Ga0075434_100021744 | 3300006871 | Bacteria | 6238 |
| 204 | Ga0075434_100042803 | 3300006871 | Bacteria | 4491 |
| 205 | Ga0075434_100213825 | 3300006871 | Bacteria | 1948 |
| 206 | Ga0075434_101211643 | 3300006871 | Bacteria | 767 |
| 207 | Ga0075429_101281910 | 3300006880 | Bacteria | 639 |
| 208 | Ga0068865_101363481 | 3300006881 | Bacteria | 632 |
| 209 | Ga0075436_100335292 | 3300006914 | Bacteria | 1088 |
| 210 | Ga0075436_100469306 | 3300006914 | Bacteria | 918 |
| 211 | Ga0097620_100140775 | 3300006931 | Bacteria | 2486 |
| 212 | Ga0097620_100664536 | 3300006931 | Bacteria | 1134 |
| 213 | Ga0097620_100747232 | 3300006931 | Bacteria | 1067 |
| 214 | Ga0097620_101030339 | 3300006931 | Unclassified | 904 |
| 215 | Ga0097620_101293603 | 3300006931 | Bacteria | 803 |
| 216 | Ga0097620_101567370 | 3300006931 | Bacteria | 727 |
| 217 | Ga0075435_100037403 | 3300007076 | Bacteria | 3865 |
| 218 | Ga0075435_100124806 | 3300007076 | Bacteria | 2151 |
| 219 | Ga0099794_10052393 | 3300007265 | Unclassified | 1967 |
| 220 | Ga0099795_10037425 | 3300007788 | Unclassified | 1707 |
| 221 | Ga0099795_10066245 | 3300007788 | Unclassified | 1352 |
| 222 | Ga0099795_10080988 | 3300007788 | Bacteria | 1242 |
| 223 | Ga0099795_10180297 | 3300007788 | Bacteria | 882 |
| 224 | Ga0105244_10324366 | 3300009036 | Bacteria | 711 |
| 225 | Ga0105240_10003450 | 3300009093 | Bacteria | 24537 |
| 226 | Ga0105240_10005756 | 3300009093 | Bacteria | 18388 |
| 227 | Ga0105240_10006166 | 3300009093 | Bacteria | 17670 |
| 228 | Ga0105240_10017854 | 3300009093 | Bacteria | 9546 |
| 229 | Ga0105240_10023379 | 3300009093 | Bacteria | 8175 |
| 230 | Ga0105240_10119293 | 3300009093 | Bacteria | 3178 |
| 231 | Ga0105240_10129063 | 3300009093 | Bacteria | 3034 |
| 232 | Ga0105240_10144007 | 3300009093 | Bacteria | 2846 |
| 233 | Ga0105240_10354356 | 3300009093 | Bacteria | 1664 |
| 234 | Ga0105240_10433926 | 3300009093 | Bacteria | 1473 |
| 235 | Ga0105240_10542221 | 3300009093 | Bacteria | 1288 |
| 236 | Ga0105240_11124324 | 3300009093 | Bacteria | 835 |
| 237 | Ga0105240_11611121 | 3300009093 | Bacteria | 679 |
| 238 | Ga0111539_10883125 | 3300009094 | Bacteria | 1040 |
| 239 | Ga0105245_10005590 | 3300009098 | Bacteria | 11043 |
| 240 | Ga0105245_10011857 | 3300009098 | Bacteria | 7582 |
| 241 | Ga0105245_10028346 | 3300009098 | Bacteria | 4939 |
| 242 | Ga0105245_10042372 | 3300009098 | Bacteria | 4062 |
| 243 | Ga0105245_10155998 | 3300009098 | Bacteria | 2162 |
| 244 | Ga0105245_10184017 | 3300009098 | Unclassified | 1998 |
| 245 | Ga0105245_10543839 | 3300009098 | Bacteria | 1183 |
| 246 | Ga0105245_10626766 | 3300009098 | Bacteria | 1104 |
| 247 | Ga0105245_10632212 | 3300009098 | Unclassified | 1099 |
| 248 | Ga0105245_12094691 | 3300009098 | Bacteria | 619 |
| 249 | Ga0105247_10029848 | 3300009101 | Bacteria | 3306 |
| 250 | Ga0114129_10000566 | 3300009147 | Bacteria | 45463 |
| 251 | Ga0114129_10046469 | 3300009147 | Bacteria | 6101 |
| 252 | Ga0114129_10309270 | 3300009147 | Bacteria | 2104 |
| 253 | Ga0114129_10363515 | 3300009147 | Bacteria | 1914 |
| 254 | Ga0114129_10404112 | 3300009147 | Unclassified | 1799 |
| 255 | Ga0114129_10446276 | 3300009147 | Bacteria | 1697 |
| 256 | Ga0114129_10656859 | 3300009147 | Bacteria | 1353 |
| 257 | Ga0114129_10767338 | 3300009147 | Bacteria | 1233 |
| 258 | Ga0114129_10974250 | 3300009147 | Bacteria | 1070 |
| 259 | Ga0114129_11198739 | 3300009147 | Bacteria | 946 |
| 260 | Ga0114129_11344621 | 3300009147 | Bacteria | 884 |
| 261 | Ga0114129_11794472 | 3300009147 | Unclassified | 746 |
| 262 | Ga0114129_12365488 | 3300009147 | Bacteria | 637 |
| 263 | Ga0105243_10052143 | 3300009148 | Bacteria | 3239 |
| 264 | Ga0105243_10090238 | 3300009148 | Bacteria | 2521 |
| 265 | Ga0105243_10146361 | 3300009148 | Bacteria | 2021 |
| 266 | Ga0105243_10670369 | 3300009148 | Bacteria | 1007 |
| 267 | Ga0105243_10672856 | 3300009148 | Bacteria | 1006 |
| 268 | Ga0105243_11507300 | 3300009148 | Bacteria | 696 |
| 269 | Ga0105243_11877135 | 3300009148 | Bacteria | 631 |
| 270 | Ga0105241_10051974 | 3300009174 | Bacteria | 3127 |
| 271 | Ga0105241_10053332 | 3300009174 | Bacteria | 3092 |
| 272 | Ga0105241_10126772 | 3300009174 | Bacteria | 2062 |
| 273 | Ga0105241_10326102 | 3300009174 | Bacteria | 1326 |
| 274 | Ga0105241_10980062 | 3300009174 | Bacteria | 790 |
| 275 | Ga0105241_11055750 | 3300009174 | Bacteria | 763 |
| 276 | Ga0105242_10027196 | 3300009176 | Bacteria | 4540 |
| 277 | Ga0105242_10058237 | 3300009176 | Bacteria | 3166 |
| 278 | Ga0105242_10115850 | 3300009176 | Bacteria | 2292 |
| 279 | Ga0105242_10349641 | 3300009176 | Bacteria | 1365 |
| 280 | Ga0105242_10423348 | 3300009176 | Bacteria | 1248 |
| 281 | Ga0105242_10543449 | 3300009176 | Bacteria | 1113 |
| 282 | Ga0105248_10023999 | 3300009177 | Bacteria | 6779 |
| 283 | Ga0105248_10026578 | 3300009177 | Bacteria | 6438 |
| 284 | Ga0105248_10031143 | 3300009177 | Bacteria | 5961 |
| 285 | Ga0105248_10070780 | 3300009177 | Bacteria | 3917 |
| 286 | Ga0105248_10261316 | 3300009177 | Bacteria | 1949 |
| 287 | Ga0105248_10482909 | 3300009177 | Unclassified | 1397 |
| 288 | Ga0105248_10483744 | 3300009177 | Bacteria | 1395 |
| 289 | Ga0105248_10517493 | 3300009177 | Bacteria | 1345 |
| 290 | Ga0105248_11101824 | 3300009177 | Unclassified | 897 |
| 291 | Ga0105248_11281469 | 3300009177 | Bacteria | 829 |
| 292 | Ga0105248_11324386 | 3300009177 | Bacteria | 815 |
| 293 | Ga0105248_11496530 | 3300009177 | Bacteria | 764 |
| 294 | Ga0105248_11931346 | 3300009177 | Bacteria | 670 |
| 295 | Ga0105248_12154749 | 3300009177 | Bacteria | 634 |
| 296 | Ga0105237_10012111 | 3300009545 | Bacteria | 9104 |
| 297 | Ga0105237_10040373 | 3300009545 | Bacteria | 4706 |
| 298 | Ga0105237_10167903 | 3300009545 | Bacteria | 2194 |
| 299 | Ga0105237_10171538 | 3300009545 | Bacteria | 2169 |
| 300 | Ga0105237_10383669 | 3300009545 | Bacteria | 1410 |
| 301 | Ga0105237_10419516 | 3300009545 | Unclassified | 1343 |
| 302 | Ga0105237_10545667 | 3300009545 | Bacteria | 1166 |
| 303 | Ga0105237_11529735 | 3300009545 | Unclassified | 674 |
| 304 | Ga0105238_10006344 | 3300009551 | Bacteria | 11761 |
| 305 | Ga0105238_10008033 | 3300009551 | Bacteria | 10557 |
| 306 | Ga0105238_10065643 | 3300009551 | Bacteria | 3631 |
| 307 | Ga0105238_10238950 | 3300009551 | Bacteria | 1794 |
| 308 | Ga0105238_11250008 | 3300009551 | Bacteria | 768 |
| 309 | Ga0105238_11599246 | 3300009551 | Bacteria | 682 |
| 310 | Ga0105249_10017122 | 3300009553 | Bacteria | 6433 |
| 311 | Ga0105249_10038088 | 3300009553 | Bacteria | 4362 |
| 312 | Ga0105249_10192926 | 3300009553 | Bacteria | 1989 |
| 313 | Ga0105249_10213984 | 3300009553 | Bacteria | 1893 |
| 314 | Ga0105249_10766740 | 3300009553 | Bacteria | 1027 |
| 315 | Ga0099796_10040988 | 3300010159 | Bacteria | 1566 |
| 316 | Ga0099796_10172497 | 3300010159 | Bacteria | 864 |
| 317 | Ga0105239_10011863 | 3300010375 | Bacteria | 9723 |
| 318 | Ga0105239_10015915 | 3300010375 | Bacteria | 8326 |
| 319 | Ga0105239_10023725 | 3300010375 | Bacteria | 6754 |
| 320 | Ga0105239_10585977 | 3300010375 | Bacteria | 1272 |
| 321 | Ga0105239_10623751 | 3300010375 | Bacteria | 1230 |
| 322 | Ga0105239_12232423 | 3300010375 | Bacteria | 637 |
| 323 | Ga0105246_10001137 | 3300011119 | Bacteria | 15431 |
| 324 | Ga0105246_10211380 | 3300011119 | Bacteria | 1514 |
| 325 | Ga0105246_10566344 | 3300011119 | Bacteria | 976 |
| 326 | Ga0105246_10671886 | 3300011119 | Bacteria | 904 |
| 327 | Ga0157373_10199304 | 3300013100 | Bacteria | 1411 |
| 328 | Ga0157371_10038416 | 3300013102 | Bacteria | 3425 |
| 329 | Ga0157370_10002104 | 3300013104 | Bacteria | 24327 |
| 330 | Ga0157370_10002904 | 3300013104 | Bacteria | 20437 |
| 331 | Ga0157370_10048458 | 3300013104 | Bacteria | 4070 |
| 332 | Ga0157370_10100651 | 3300013104 | Bacteria | 2708 |
| 333 | Ga0157370_10305475 | 3300013104 | Bacteria | 1468 |
| 334 | Ga0157370_10630246 | 3300013104 | Bacteria | 981 |
| 335 | Ga0157369_10012050 | 3300013105 | Bacteria | 9817 |
| 336 | Ga0157369_10013263 | 3300013105 | Bacteria | 9324 |
| 337 | Ga0157369_10032835 | 3300013105 | Bacteria | 5704 |
| 338 | Ga0157369_10103620 | 3300013105 | Bacteria | 3031 |
| 339 | Ga0157369_10180313 | 3300013105 | Bacteria | 2222 |
| 340 | Ga0157369_10437218 | 3300013105 | Unclassified | 1355 |
| 341 | Ga0157369_10620925 | 3300013105 | Bacteria | 1115 |
| 342 | Ga0157374_10007004 | 3300013296 | Bacteria | 9595 |
| 343 | Ga0157374_10012288 | 3300013296 | Bacteria | 7448 |
| 344 | Ga0157374_10014907 | 3300013296 | Bacteria | 6812 |
| 345 | Ga0157374_10039582 | 3300013296 | Bacteria | 4338 |
| 346 | Ga0157374_10339973 | 3300013296 | Bacteria | 1490 |
| 347 | Ga0157374_10561612 | 3300013296 | Bacteria | 1149 |
| 348 | Ga0157374_10716266 | 3300013296 | Bacteria | 1014 |
| 349 | Ga0157374_10789436 | 3300013296 | Bacteria | 965 |
| 350 | Ga0157378_10003916 | 3300013297 | Bacteria | 13195 |
| 351 | Ga0157378_10024514 | 3300013297 | Bacteria | 5310 |
| 352 | Ga0157378_10068265 | 3300013297 | Bacteria | 3188 |
| 353 | Ga0157378_10073479 | 3300013297 | Unclassified | 3075 |
| 354 | Ga0157378_10118899 | 3300013297 | Bacteria | 2433 |
| 355 | Ga0157378_10307441 | 3300013297 | Bacteria | 1536 |
| 356 | Ga0157378_10314026 | 3300013297 | Bacteria | 1521 |
| 357 | Ga0157378_10641094 | 3300013297 | Bacteria | 1077 |
| 358 | Ga0157378_11075671 | 3300013297 | Bacteria | 841 |
| 359 | Ga0163162_10008346 | 3300013306 | Bacteria | 10099 |
| 360 | Ga0163162_10434440 | 3300013306 | Bacteria | 1445 |
| 361 | Ga0163162_10640471 | 3300013306 | Bacteria | 1187 |
| 362 | Ga0163162_10759428 | 3300013306 | Bacteria | 1089 |
| 363 | Ga0163162_10919549 | 3300013306 | Bacteria | 987 |
| 364 | Ga0163162_11011700 | 3300013306 | Bacteria | 940 |
| 365 | Ga0163162_11074274 | 3300013306 | Bacteria | 911 |
| 366 | Ga0163162_11885102 | 3300013306 | Unclassified | 684 |
| 367 | Ga0163162_13107852 | 3300013306 | Unclassified | 533 |
| 368 | Ga0157372_10003606 | 3300013307 | Bacteria | 16665 |
| 369 | Ga0157372_10007318 | 3300013307 | Bacteria | 11750 |
| 370 | Ga0157372_10050104 | 3300013307 | Unclassified | 4646 |
| 371 | Ga0157372_10064369 | 3300013307 | Bacteria | 4114 |
| 372 | Ga0157372_10066914 | 3300013307 | Bacteria | 4037 |
| 373 | Ga0157372_10231714 | 3300013307 | Bacteria | 2141 |
| 374 | Ga0157372_10382822 | 3300013307 | Bacteria | 1639 |
| 375 | Ga0157372_11981606 | 3300013307 | Bacteria | 669 |
| 376 | Ga0157375_10081896 | 3300013308 | Unclassified | 3268 |
| 377 | Ga0157375_10107742 | 3300013308 | Bacteria | 2880 |
| 378 | Ga0157375_10152200 | 3300013308 | Bacteria | 2450 |
| 379 | Ga0157375_10169992 | 3300013308 | Bacteria | 2327 |
| 380 | Ga0157375_10344453 | 3300013308 | Bacteria | 1656 |
| 381 | Ga0157375_10388744 | 3300013308 | Bacteria | 1562 |
| 382 | Ga0157375_10495081 | 3300013308 | Bacteria | 1387 |
| 383 | Ga0157375_10785054 | 3300013308 | Bacteria | 1102 |
| 384 | Ga0157375_11285747 | 3300013308 | Unclassified | 860 |
| 385 | Ga0163163_10002295 | 3300014325 | Bacteria | 16141 |
| 386 | Ga0163163_10003230 | 3300014325 | Bacteria | 13822 |
| 387 | Ga0163163_10004829 | 3300014325 | Bacteria | 11579 |
| 388 | Ga0163163_10034711 | 3300014325 | Bacteria | 4887 |
| 389 | Ga0163163_10243325 | 3300014325 | Unclassified | 1849 |
| 390 | Ga0163163_10305347 | 3300014325 | Bacteria | 1644 |
| 391 | Ga0157380_10062307 | 3300014326 | Bacteria | 2987 |
| 392 | Ga0157380_11305197 | 3300014326 | Bacteria | 773 |
| 393 | Ga0157379_10016505 | 3300014968 | Bacteria | 6494 |
| 394 | Ga0157379_10157363 | 3300014968 | Bacteria | 2050 |
| 395 | Ga0157379_10323743 | 3300014968 | Bacteria | 1408 |
| 396 | Ga0157379_10462606 | 3300014968 | Bacteria | 1172 |
| 397 | Ga0157379_11149367 | 3300014968 | Bacteria | 745 |
| 398 | Ga0157376_10003293 | 3300014969 | Bacteria | 11123 |
| 399 | Ga0157376_10117350 | 3300014969 | Unclassified | 2353 |
| 400 | Ga0157376_10254880 | 3300014969 | Bacteria | 1641 |
| 401 | Ga0157376_10523703 | 3300014969 | Bacteria | 1169 |
| 402 | Ga0157376_10541897 | 3300014969 | Bacteria | 1150 |
| 403 | Ga0157376_10623391 | 3300014969 | Bacteria | 1076 |
| 404 | Ga0157376_10689816 | 3300014969 | Bacteria | 1025 |
| 405 | Ga0157376_10945103 | 3300014969 | Bacteria | 882 |
| 406 | Ga0163161_10565009 | 3300017792 | Bacteria | 934 |
| 407 | Ga0206353_10992914 | 3300020082 | Bacteria | 919 |
| 408 | Ga0213873_10039413 | 3300021358 | Bacteria | 1210 |
| 409 | Ga0213873_10256813 | 3300021358 | Bacteria | 555 |
| 410 | Ga0213875_10000018 | 3300021388 | Bacteria | 233445 |
| 411 | Ga0224570_100985 | 3300022730 | Bacteria | 2241 |
| 412 | Ga0224569_101568 | 3300022732 | Bacteria | 1908 |
| 413 | Ga0228598_1000659 | 3300024227 | Bacteria | 7253 |
| 414 | Ga0228598_1003820 | 3300024227 | Unclassified | 3214 |
| 415 | Ga0228598_1004693 | 3300024227 | Bacteria | 2886 |
| 416 | Ga0209026_1005779 | 3300025250 | Bacteria | 3218 |
| 417 | Ga0209676_1087506 | 3300025292 | Bacteria | 693 |
| 418 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 419 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 420 | Ga0207692_10151189 | 3300025898 | Bacteria | 1330 |
| 421 | Ga0207710_10029613 | 3300025900 | Bacteria | 2384 |
| 422 | Ga0207680_10452008 | 3300025903 | Bacteria | 912 |
| 423 | Ga0207680_10527558 | 3300025903 | Bacteria | 842 |
| 424 | Ga0207647_10019106 | 3300025904 | Bacteria | 4614 |
| 425 | Ga0207647_10061055 | 3300025904 | Bacteria | 2302 |
| 426 | Ga0207647_10668597 | 3300025904 | Bacteria | 568 |
| 427 | Ga0207685_10189209 | 3300025905 | Bacteria | 959 |
| 428 | Ga0207699_10061227 | 3300025906 | Bacteria | 2264 |
| 429 | Ga0207699_10072937 | 3300025906 | Bacteria | 2104 |
| 430 | Ga0207699_10421337 | 3300025906 | Bacteria | 954 |
| 431 | Ga0207705_10043214 | 3300025909 | Bacteria | 3237 |
| 432 | Ga0207705_10080686 | 3300025909 | Bacteria | 2370 |
| 433 | Ga0207654_10049076 | 3300025911 | Bacteria | 2419 |
| 434 | Ga0207707_10000372 | 3300025912 | Bacteria | 47046 |
| 435 | Ga0207707_10043965 | 3300025912 | Bacteria | 3895 |
| 436 | Ga0207707_10124030 | 3300025912 | Bacteria | 2259 |
| 437 | Ga0207707_10186868 | 3300025912 | Bacteria | 1808 |
| 438 | Ga0207707_10270942 | 3300025912 | Bacteria | 1471 |
| 439 | Ga0207707_11374722 | 3300025912 | Bacteria | 564 |
| 440 | Ga0207695_10000563 | 3300025913 | Bacteria | 76084 |
| 441 | Ga0207695_10002828 | 3300025913 | Bacteria | 25226 |
| 442 | Ga0207695_10004561 | 3300025913 | Bacteria | 18833 |
| 443 | Ga0207695_10005869 | 3300025913 | Bacteria | 16115 |
| 444 | Ga0207695_10029367 | 3300025913 | Bacteria | 6078 |
| 445 | Ga0207695_10092201 | 3300025913 | Unclassified | 3040 |
| 446 | Ga0207695_10163408 | 3300025913 | Bacteria | 2156 |
| 447 | Ga0207695_10169270 | 3300025913 | Bacteria | 2111 |
| 448 | Ga0207695_10404729 | 3300025913 | Bacteria | 1249 |
| 449 | Ga0207671_10025128 | 3300025914 | Bacteria | 4475 |
| 450 | Ga0207671_10333689 | 3300025914 | Bacteria | 1201 |
| 451 | Ga0207671_11099217 | 3300025914 | Bacteria | 624 |
| 452 | Ga0207693_10347722 | 3300025915 | Bacteria | 1160 |
| 453 | Ga0207663_10028977 | 3300025916 | Bacteria | 3247 |
| 454 | Ga0207663_10312894 | 3300025916 | Bacteria | 1177 |
| 455 | Ga0207660_10607649 | 3300025917 | Bacteria | 891 |
| 456 | Ga0207657_10001386 | 3300025919 | Bacteria | 25849 |
| 457 | Ga0207652_10008525 | 3300025921 | Bacteria | 8251 |
| 458 | Ga0207652_10260215 | 3300025921 | Bacteria | 1565 |
| 459 | Ga0207694_10002271 | 3300025924 | Bacteria | 15729 |
| 460 | Ga0207694_10388546 | 3300025924 | Bacteria | 1159 |
| 461 | Ga0207694_10666481 | 3300025924 | Bacteria | 877 |
| 462 | Ga0207694_11235810 | 3300025924 | Unclassified | 632 |
| 463 | Ga0207650_10221852 | 3300025925 | Bacteria | 1522 |
| 464 | Ga0207650_10261490 | 3300025925 | Bacteria | 1404 |
| 465 | Ga0207650_11469098 | 3300025925 | Unclassified | 580 |
| 466 | Ga0207687_10006608 | 3300025927 | Bacteria | 7651 |
| 467 | Ga0207687_10017134 | 3300025927 | Bacteria | 4763 |
| 468 | Ga0207687_10032204 | 3300025927 | Bacteria | 3549 |
| 469 | Ga0207687_10073163 | 3300025927 | Bacteria | 2453 |
| 470 | Ga0207687_10208403 | 3300025927 | Bacteria | 1532 |
| 471 | Ga0207687_10255761 | 3300025927 | Unclassified | 1394 |
| 472 | Ga0207687_10578533 | 3300025927 | Bacteria | 944 |
| 473 | Ga0207700_10001086 | 3300025928 | Bacteria | 15659 |
| 474 | Ga0207700_10140970 | 3300025928 | Bacteria | 1981 |
| 475 | Ga0207700_10282479 | 3300025928 | Bacteria | 1428 |
| 476 | Ga0207700_10394656 | 3300025928 | Bacteria | 1212 |
| 477 | Ga0207700_10728654 | 3300025928 | Bacteria | 886 |
| 478 | Ga0207700_11082883 | 3300025928 | Unclassified | 717 |
| 479 | Ga0207700_11536484 | 3300025928 | Bacteria | 590 |
| 480 | Ga0207664_10000741 | 3300025929 | Bacteria | 22186 |
| 481 | Ga0207664_10140947 | 3300025929 | Bacteria | 2039 |
| 482 | Ga0207644_10382064 | 3300025931 | Bacteria | 1149 |
| 483 | Ga0207690_10503493 | 3300025932 | Bacteria | 980 |
| 484 | Ga0207686_10015151 | 3300025934 | Bacteria | 4306 |
| 485 | Ga0207686_10065427 | 3300025934 | Bacteria | 2318 |
| 486 | Ga0207686_10271205 | 3300025934 | Bacteria | 1248 |
| 487 | Ga0207686_10734616 | 3300025934 | Bacteria | 787 |
| 488 | Ga0207709_10138972 | 3300025935 | Bacteria | 1667 |
| 489 | Ga0207709_10156996 | 3300025935 | Bacteria | 1582 |
| 490 | Ga0207709_10337455 | 3300025935 | Bacteria | 1133 |
| 491 | Ga0207704_10819923 | 3300025938 | Bacteria | 778 |
| 492 | Ga0207704_11642725 | 3300025938 | Bacteria | 552 |
| 493 | Ga0207665_10085002 | 3300025939 | Bacteria | 2184 |
| 494 | Ga0207665_10482390 | 3300025939 | Bacteria | 955 |
| 495 | Ga0207665_10485751 | 3300025939 | Bacteria | 952 |
| 496 | Ga0207665_10848692 | 3300025939 | Bacteria | 723 |
| 497 | Ga0207711_10065883 | 3300025941 | Bacteria | 3132 |
| 498 | Ga0207711_10072807 | 3300025941 | Bacteria | 2985 |
| 499 | Ga0207711_10105464 | 3300025941 | Bacteria | 2500 |
| 500 | Ga0207711_10283370 | 3300025941 | Bacteria | 1526 |
| 501 | Ga0207689_10075607 | 3300025942 | Bacteria | 2768 |
| 502 | Ga0207689_10173908 | 3300025942 | Bacteria | 1776 |
| 503 | Ga0207689_10491664 | 3300025942 | Bacteria | 1028 |
| 504 | Ga0207661_10000046 | 3300025944 | Bacteria | 107171 |
| 505 | Ga0207661_10019082 | 3300025944 | Bacteria | 5104 |
| 506 | Ga0207661_10125524 | 3300025944 | Bacteria | 2191 |
| 507 | Ga0207661_10448291 | 3300025944 | Bacteria | 1175 |
| 508 | Ga0207679_10707655 | 3300025945 | Bacteria | 914 |
| 509 | Ga0207679_10943873 | 3300025945 | Bacteria | 790 |
| 510 | Ga0207679_11146759 | 3300025945 | Bacteria | 713 |
| 511 | Ga0207667_10001186 | 3300025949 | Bacteria | 32742 |
| 512 | Ga0207667_10001746 | 3300025949 | Bacteria | 27378 |
| 513 | Ga0207667_10015440 | 3300025949 | Bacteria | 8674 |
| 514 | Ga0207667_10068619 | 3300025949 | Bacteria | 3691 |
| 515 | Ga0207667_10081919 | 3300025949 | Bacteria | 3343 |
| 516 | Ga0207667_10098288 | 3300025949 | Bacteria | 3021 |
| 517 | Ga0207667_10119246 | 3300025949 | Bacteria | 2719 |
| 518 | Ga0207667_10224153 | 3300025949 | Bacteria | 1926 |
| 519 | Ga0207712_10139261 | 3300025961 | Bacteria | 1860 |
| 520 | Ga0207668_10075779 | 3300025972 | Bacteria | 2420 |
| 521 | Ga0207658_10869976 | 3300025986 | Bacteria | 820 |
| 522 | Ga0207658_11566752 | 3300025986 | Bacteria | 602 |
| 523 | Ga0207677_10995387 | 3300026023 | Bacteria | 760 |
| 524 | Ga0207703_10103455 | 3300026035 | Bacteria | 2418 |
| 525 | Ga0207703_10235098 | 3300026035 | Bacteria | 1645 |
| 526 | Ga0207703_10247184 | 3300026035 | Bacteria | 1606 |
| 527 | Ga0207703_10256979 | 3300026035 | Bacteria | 1577 |
| 528 | Ga0207703_11592464 | 3300026035 | Bacteria | 628 |
| 529 | Ga0207639_10686114 | 3300026041 | Bacteria | 949 |
| 530 | Ga0207678_10281895 | 3300026067 | Bacteria | 1426 |
| 531 | Ga0207702_10003891 | 3300026078 | Bacteria | 13446 |
| 532 | Ga0207702_10099606 | 3300026078 | Bacteria | 2562 |
| 533 | Ga0207702_10192047 | 3300026078 | Bacteria | 1887 |
| 534 | Ga0207702_10402290 | 3300026078 | Unclassified | 1321 |
| 535 | Ga0207641_10117373 | 3300026088 | Bacteria | 2369 |
| 536 | Ga0207641_10133800 | 3300026088 | Bacteria | 2229 |
| 537 | Ga0207641_10380907 | 3300026088 | Bacteria | 1351 |
| 538 | Ga0207641_10396554 | 3300026088 | Bacteria | 1324 |
| 539 | Ga0207641_10407972 | 3300026088 | Bacteria | 1306 |
| 540 | Ga0207641_10886666 | 3300026088 | Bacteria | 885 |
| 541 | Ga0207648_10255398 | 3300026089 | Bacteria | 1563 |
| 542 | Ga0207648_10515084 | 3300026089 | Bacteria | 1096 |
| 543 | Ga0207676_10021890 | 3300026095 | Bacteria | 4695 |
| 544 | Ga0207676_10088982 | 3300026095 | Bacteria | 2529 |
| 545 | Ga0207676_10300111 | 3300026095 | Unclassified | 1466 |
| 546 | Ga0207676_10630469 | 3300026095 | Bacteria | 1032 |
| 547 | Ga0207674_10000503 | 3300026116 | Bacteria | 51625 |
| 548 | Ga0207674_10006231 | 3300026116 | Bacteria | 14062 |
| 549 | Ga0207674_10030990 | 3300026116 | Bacteria | 5621 |
| 550 | Ga0207674_10910809 | 3300026116 | Bacteria | 847 |
| 551 | Ga0207675_100312070 | 3300026118 | Bacteria | 1534 |
| 552 | Ga0207683_10537273 | 3300026121 | Unclassified | 1081 |
| 553 | Ga0207698_10018426 | 3300026142 | Bacteria | 4756 |
| 554 | Ga0207698_10034709 | 3300026142 | Bacteria | 3680 |
| 555 | Ga0207698_10060178 | 3300026142 | Bacteria | 2952 |
| 556 | Ga0207698_10114346 | 3300026142 | Bacteria | 2270 |
| 557 | Ga0207698_10287447 | 3300026142 | Bacteria | 1524 |
| 558 | Ga0207698_10340733 | 3300026142 | Bacteria | 1412 |
| 559 | Ga0207698_11557471 | 3300026142 | Bacteria | 676 |
| 560 | Ga0209179_1014511 | 3300027512 | Unclassified | 1448 |
| 561 | Ga0209588_1100648 | 3300027671 | Unclassified | 930 |
| 562 | Ga0265356_1002962 | 3300028017 | Bacteria | 2180 |
| 563 | Ga0268266_10041127 | 3300028379 | Bacteria | 3942 |
| 564 | Ga0268266_10201693 | 3300028379 | Bacteria | 1821 |
| 565 | Ga0268266_10760196 | 3300028379 | Bacteria | 935 |
| 566 | Ga0268266_10800347 | 3300028379 | Bacteria | 910 |
| 567 | Ga0268265_11332614 | 3300028380 | Bacteria | 718 |
| 568 | Ga0268264_10019401 | 3300028381 | Bacteria | 5557 |
| 569 | Ga0268264_10286867 | 3300028381 | Bacteria | 1544 |
| 570 | Ga0268264_10394757 | 3300028381 | Bacteria | 1328 |
| 571 | Ga0268264_11108183 | 3300028381 | Bacteria | 800 |
| 572 | Ga0268264_11154766 | 3300028381 | Bacteria | 783 |
| 573 | Ga0265319_1011603 | 3300028563 | Bacteria | 3598 |
| 574 | Ga0265334_10051509 | 3300028573 | Bacteria | 1578 |
| 575 | Ga0265318_10000903 | 3300028577 | Bacteria | 19347 |
| 576 | Ga0265318_10019966 | 3300028577 | Bacteria | 2711 |
| 577 | Ga0265338_10001726 | 3300028800 | Bacteria | 34591 |
| 578 | Ga0265338_10134159 | 3300028800 | Bacteria | 1950 |
| 579 | Ga0265338_10144552 | 3300028800 | Bacteria | 1857 |
| 580 | Ga0265338_10151590 | 3300028800 | Bacteria | 1801 |
| 581 | Ga0265338_10303457 | 3300028800 | Bacteria | 1160 |
| 582 | Ga0265338_10844649 | 3300028800 | Bacteria | 626 |
| 583 | Ga0265762_1000400 | 3300030760 | Bacteria | 7461 |
| 584 | Ga0265762_1018852 | 3300030760 | Bacteria | 1261 |
| 585 | Ga0265762_1040157 | 3300030760 | Bacteria | 914 |
| 586 | Ga0265760_10000041 | 3300031090 | Bacteria | 38626 |
| 587 | Ga0265760_10000559 | 3300031090 | Bacteria | 10558 |
| 588 | Ga0265760_10022140 | 3300031090 | Bacteria | 1841 |
| 589 | Ga0265330_10000309 | 3300031235 | Bacteria | 35085 |
| 590 | Ga0265332_10017045 | 3300031238 | Bacteria | 3204 |
| 591 | Ga0265332_10018234 | 3300031238 | Bacteria | 3096 |
| 592 | Ga0265328_10000459 | 3300031239 | Bacteria | 18931 |
| 593 | Ga0265328_10036973 | 3300031239 | Bacteria | 1804 |
| 594 | Ga0265328_10241231 | 3300031239 | Bacteria | 691 |
| 595 | Ga0265320_10000377 | 3300031240 | Bacteria | 36151 |
| 596 | Ga0265325_10001117 | 3300031241 | Bacteria | 19238 |
| 597 | Ga0265325_10001276 | 3300031241 | Bacteria | 17879 |
| 598 | Ga0265325_10001493 | 3300031241 | Bacteria | 16453 |
| 599 | Ga0265325_10010845 | 3300031241 | Bacteria | 5254 |
| 600 | Ga0265329_10004080 | 3300031242 | Bacteria | 6201 |
| 601 | Ga0265329_10007071 | 3300031242 | Bacteria | 4378 |
| 602 | Ga0265340_10002780 | 3300031247 | Bacteria | 9977 |
| 603 | Ga0265340_10003167 | 3300031247 | Bacteria | 9332 |
| 604 | Ga0265340_10005849 | 3300031247 | Bacteria | 6808 |
| 605 | Ga0265340_10072663 | 3300031247 | Bacteria | 1628 |
| 606 | Ga0265339_10002243 | 3300031249 | Bacteria | 13971 |
| 607 | Ga0265339_10311071 | 3300031249 | Bacteria | 749 |
| 608 | Ga0265331_10000172 | 3300031250 | Bacteria | 79901 |
| 609 | Ga0265331_10003170 | 3300031250 | Bacteria | 10739 |
| 610 | Ga0265331_10010058 | 3300031250 | Bacteria | 5258 |
| 611 | Ga0265331_10026789 | 3300031250 | Bacteria | 2895 |
| 612 | Ga0265331_10319498 | 3300031250 | Bacteria | 695 |
| 613 | Ga0265316_10008573 | 3300031344 | Bacteria | 9476 |
| 614 | Ga0265316_10009890 | 3300031344 | Bacteria | 8739 |
| 615 | Ga0265316_10017595 | 3300031344 | Bacteria | 6170 |
| 616 | Ga0265316_10062871 | 3300031344 | Bacteria | 2880 |
| 617 | Ga0265316_10080983 | 3300031344 | Bacteria | 2490 |
| 618 | Ga0265316_10085222 | 3300031344 | Bacteria | 2418 |
| 619 | Ga0265316_10089078 | 3300031344 | Unclassified | 2356 |
| 620 | Ga0265316_10194680 | 3300031344 | Bacteria | 1505 |
| 621 | Ga0265316_10768015 | 3300031344 | Bacteria | 677 |
| 622 | Ga0307408_100084919 | 3300031548 | Bacteria | 2376 |
| 623 | Ga0307408_100175524 | 3300031548 | Bacteria | 1714 |
| 624 | Ga0265313_10001182 | 3300031595 | Bacteria | 24959 |
| 625 | Ga0265313_10002130 | 3300031595 | Bacteria | 17606 |
| 626 | Ga0265313_10011745 | 3300031595 | Bacteria | 5419 |
| 627 | Ga0265313_10015469 | 3300031595 | Bacteria | 4438 |
| 628 | Ga0265313_10044715 | 3300031595 | Bacteria | 2160 |
| 629 | Ga0265313_10064095 | 3300031595 | Unclassified | 1711 |
| 630 | Ga0316579_10001174 | 3300031691 | Bacteria | 9351 |
| 631 | Ga0265314_10068052 | 3300031711 | Bacteria | 2395 |
| 632 | Ga0265314_10209043 | 3300031711 | Bacteria | 1147 |
| 633 | Ga0265342_10000656 | 3300031712 | Bacteria | 36240 |
| 634 | Ga0265342_10003719 | 3300031712 | Bacteria | 12363 |
| 635 | Ga0265342_10033651 | 3300031712 | Bacteria | 3149 |
| 636 | Ga0265342_10358141 | 3300031712 | Bacteria | 759 |
| 637 | Ga0307405_10207501 | 3300031731 | Bacteria | 1428 |
| 638 | Ga0307405_10518736 | 3300031731 | Bacteria | 958 |
| 639 | Ga0307405_11191993 | 3300031731 | Bacteria | 658 |
| 640 | Ga0307405_11878028 | 3300031731 | Bacteria | 534 |
| 641 | Ga0316577_10020360 | 3300031733 | Bacteria | 3677 |
| 642 | Ga0316577_10027058 | 3300031733 | Bacteria | 3197 |
| 643 | Ga0307413_10140699 | 3300031824 | Bacteria | 1667 |
| 644 | Ga0307410_10141951 | 3300031852 | Bacteria | 1778 |
| 645 | Ga0307410_10818173 | 3300031852 | Bacteria | 793 |
| 646 | Ga0307406_10347719 | 3300031901 | Bacteria | 1157 |
| 647 | Ga0307406_10353341 | 3300031901 | Bacteria | 1149 |
| 648 | Ga0307406_10377665 | 3300031901 | Bacteria | 1116 |
| 649 | Ga0307409_100018111 | 3300031995 | Bacteria | 4720 |
| 650 | Ga0307409_100071986 | 3300031995 | Bacteria | 2751 |
| 651 | Ga0307409_102040183 | 3300031995 | Bacteria | 603 |
| 652 | Ga0307416_100007450 | 3300032002 | Bacteria | 6962 |
| 653 | Ga0307416_100196894 | 3300032002 | Bacteria | 1907 |
| 654 | Ga0307416_100841999 | 3300032002 | Bacteria | 1015 |
| 655 | Ga0307414_11050554 | 3300032004 | Bacteria | 751 |
| 656 | Ga0307411_10064166 | 3300032005 | Bacteria | 2458 |
| 657 | Ga0307411_11390963 | 3300032005 | Bacteria | 642 |
| 658 | Ga0307415_100074170 | 3300032126 | Bacteria | 2404 |
| 659 | Ga0307415_100587581 | 3300032126 | Bacteria | 989 |
| 660 | Ga0316214_1009595 | 3300033545 | Bacteria | 1307 |
| 661 | Ga0373926_0076211 | 3300035083 | Bacteria | 1236 |
| 662 | Ga0373926_0124657 | 3300035083 | Bacteria | 973 |
| 663 | Ga0373934_0002250 | 3300035086 | Bacteria | 7092 |
| 664 | Ga0373934_0155418 | 3300035086 | Bacteria | 938 |
| 665 | Ga0373940_0340705 | 3300035088 | Bacteria | 524 |
| 666 | Ga0373944_0049227 | 3300035089 | Bacteria | 1324 |
| 667 | Ga0373923_0008415 | 3300035111 | Bacteria | 3677 |
| 668 | Ga0373923_0031754 | 3300035111 | Bacteria | 2131 |
| 669 | Ga0373936_0110959 | 3300035113 | Bacteria | 1165 |
| 670 | Ga0373936_0565896 | 3300035113 | Unclassified | 532 |
| 671 | Ga0373939_0506748 | 3300035114 | Bacteria | 516 |
| 672 | Ga0373953_0023029 | 3300035117 | Bacteria | 2355 |
| 673 | Ga0373953_0024283 | 3300035117 | Bacteria | 2304 |
| 674 | Ga0373953_0146798 | 3300035117 | Bacteria | 1010 |
| 675 | Ga0373954_0027337 | 3300035118 | Bacteria | 2617 |
| 676 | Ga0373954_0142004 | 3300035118 | Bacteria | 1171 |
| 677 | Ga0373954_0323345 | 3300035118 | Bacteria | 761 |
| 678 | Ga0373954_0328195 | 3300035118 | Bacteria | 755 |
| 679 | Ga0373954_0450630 | 3300035118 | Bacteria | 637 |
| 680 | Ga0373956_0086971 | 3300035119 | Bacteria | 1439 |
| 681 | Ga0373956_0091753 | 3300035119 | Bacteria | 1402 |
| 682 | Ga0373956_0160498 | 3300035119 | Bacteria | 1059 |
| 683 | Ga0373957_0083752 | 3300035120 | Bacteria | 1261 |
| 684 | Ga0373957_0103022 | 3300035120 | Bacteria | 1144 |
| 685 | Ga0373943_0022103 | 3300035170 | Bacteria | 2943 |
| 686 | Ga0373943_0143454 | 3300035170 | Bacteria | 1288 |
| 687 | Ga0373946_0064348 | 3300035171 | Bacteria | 1568 |
| 688 | Ga0373946_0390571 | 3300035171 | Unclassified | 701 |
| 689 | Ga0373955_0011709 | 3300035172 | Bacteria | 4191 |
| 690 | Ga0373955_0055758 | 3300035172 | Bacteria | 2166 |
| 691 | Ga0373955_0889383 | 3300035172 | Bacteria | 548 |
| 692 | Ga0373924_0108121 | 3300035410 | Bacteria | 1200 |
| 693 | Ga0373924_0227672 | 3300035410 | Bacteria | 824 |
| 694 | Ga0373931_1012677 | 3300035691 | Bacteria | 562 |
| 695 | Ga0373935_0003584 | 3300035692 | Bacteria | 9048 |
| 696 | Ga0373935_0008083 | 3300035692 | Bacteria | 6308 |
| 697 | Ga0373935_0283867 | 3300035692 | Bacteria | 1166 |
| 698 | Ga0373927_0037285 | 3300035695 | Bacteria | 3160 |
| 699 | Ga0373927_0060855 | 3300035695 | Bacteria | 2443 |
| 700 | Ga0373927_0106683 | 3300035695 | Bacteria | 1824 |
| 701 | Ga0373927_0108985 | 3300035695 | Bacteria | 1804 |
| 702 | Ga0373927_0144335 | 3300035695 | Bacteria | 1557 |
| 703 | Ga0373927_0595616 | 3300035695 | Bacteria | 731 |
| 704 | Ga0373927_0895256 | 3300035695 | Bacteria | 586 |
| 705 | Ga0373933_0102349 | 3300035724 | Bacteria | 1778 |
| 706 | Ga0373933_0135705 | 3300035724 | Bacteria | 1550 |
| 707 | Ga0373933_0292694 | 3300035724 | Bacteria | 1053 |
| 708 | Ga0373933_0418514 | 3300035724 | Bacteria | 875 |
| 709 | Ga0373933_0810115 | 3300035724 | Bacteria | 616 |
| 710 | Ga0373947_0029255 | 3300035725 | Bacteria | 3232 |
| 711 | Ga0373947_0113154 | 3300035725 | Bacteria | 1717 |
| 712 | Ga0373947_0183384 | 3300035725 | Bacteria | 1363 |
| 713 | Ga0373947_0724997 | 3300035725 | Bacteria | 678 |
| 714 | Ga0373947_1119030 | 3300035725 | Bacteria | 537 |
| 715 | Ga0373937_0007944 | 3300036401 | Bacteria | 9199 |
| 716 | Ga0373937_0009922 | 3300036401 | Bacteria | 8304 |
| 717 | Ga0373937_0037913 | 3300036401 | Bacteria | 4392 |
| 718 | Ga0373937_0228267 | 3300036401 | Bacteria | 1753 |
| 719 | Ga0373937_0230707 | 3300036401 | Bacteria | 1743 |
| 720 | Ga0373937_0285448 | 3300036401 | Bacteria | 1559 |
| 721 | Ga0373937_0395139 | 3300036401 | Bacteria | 1312 |
| 722 | Ga0373937_0524726 | 3300036401 | Bacteria | 1125 |
| 723 | Ga0373937_0535139 | 3300036401 | Bacteria | 1113 |
| 724 | Ga0373937_0612959 | 3300036401 | Bacteria | 1033 |
| 725 | Ga0373937_0792492 | 3300036401 | Bacteria | 895 |
| 726 | Ga0316582_0059782 | 3300036647 | Bacteria | 2442 |
| 727 | Ga0316584_0008958 | 3300036712 | Bacteria | 6921 |
| 728 | Ga0373925_0021124 | 3300037068 | Bacteria | 4742 |
| 729 | Ga0373925_0026119 | 3300037068 | Bacteria | 4271 |
| 730 | Ga0373925_0116921 | 3300037068 | Bacteria | 2066 |
| 731 | Ga0373925_0160186 | 3300037068 | Bacteria | 1772 |
| 732 | Ga0373925_0933010 | 3300037068 | Bacteria | 715 |
| 733 | Ga0373925_1086007 | 3300037068 | Unclassified | 658 |
| 734 | Ga0395905_0784054 | 3300037471 | Bacteria | 856 |
| 735 | Ga0316581_0002385 | 3300037588 | Bacteria | 4481 |
| 736 | Ga0436364_0158068 | 3300037853 | Bacteria | 183638 |
| 737 | Ga0436364_0571688 | 3300037853 | Bacteria | 1209 |
| 738 | Ga0436364_1087871 | 3300037853 | Unclassified | 1246 |
| 739 | Ga0436364_1520900 | 3300037853 | Bacteria | 798 |
| 740 | Ga0395901_0731610 | 3300038443 | Unclassified | 984 |
| 741 | Ga0395901_0972019 | 3300038443 | Bacteria | 827 |
| 742 | Ga0395901_1208229 | 3300038443 | Unclassified | 722 |
| 743 | Ga0237819_00257 | 3300038705 | Bacteria | 19467 |
| 744 | Ga0436365_0186607 | 3300039437 | Bacteria | 3640 |
| 745 | Ga0436365_1352977 | 3300039437 | Bacteria | 1840 |
| 746 | Ga0436365_1526227 | 3300039437 | Bacteria | 678 |
| 747 | Ga0436360_0070677 | 3300039438 | Bacteria | 603 |
| 748 | Ga0436363_0599044 | 3300039450 | Unclassified | 653 |
| 749 | Ga0436362_0687981 | 3300039453 | Bacteria | 1174 |
| 750 | Ga0436362_0856096 | 3300039453 | Bacteria | 607 |
| 751 | Ga0451577_0081828 | 3300042876 | Bacteria | 2880 |
| 752 | Ga0453683_0002862 | 3300044673 | Bacteria | 13075 |
| 753 | Ga0453683_0671371 | 3300044673 | Bacteria | 678 |
| 754 | Ga0466963_0623049 | 3300044694 | Bacteria | 762 |
| 755 | Ga0466963_0888651 | 3300044694 | Bacteria | 628 |
| 756 | Ga0453684_0259977 | 3300044712 | Bacteria | 1989 |
| 757 | Ga0453684_1031754 | 3300044712 | Bacteria | 873 |
| 758 | Ga0453684_1365239 | 3300044712 | Bacteria | 736 |
| 759 | Ga0453684_1708142 | 3300044712 | Bacteria | 643 |
| 760 | Ga0466960_0036131 | 3300044901 | Bacteria | 2313 |
| 761 | Ga0466959_0538338 | 3300045049 | Bacteria | 788 |
| 762 | Ga0451576_0002253 | 3300045051 | Bacteria | 29502 |
| 763 | Ga0451576_0201670 | 3300045051 | Bacteria | 2078 |
| 764 | Ga0451576_0787145 | 3300045051 | Bacteria | 999 |
| 765 | Ga0451576_0869872 | 3300045051 | Bacteria | 946 |
| 766 | Ga0451576_1339674 | 3300045051 | Bacteria | 746 |
| 767 | Ga0466958_0126509 | 3300045836 | Bacteria | 1603 |
| 768 | Ga0466958_0284203 | 3300045836 | Bacteria | 1061 |
| 769 | Ga0495592_0002480 | 3300046454 | Bacteria | 13039 |
| 770 | Ga0495592_0059096 | 3300046454 | Bacteria | 2825 |
| 771 | Ga0495592_0093255 | 3300046454 | Bacteria | 2157 |
| 772 | Ga0495592_0130109 | 3300046454 | Unclassified | 1761 |
| 773 | Ga0495629_0042327 | 3300046459 | Bacteria | 3201 |
| 774 | Ga0495651_0000142 | 3300046462 | Bacteria | 53097 |
| 775 | Ga0495651_0000738 | 3300046462 | Bacteria | 25273 |
| 776 | Ga0495651_0044271 | 3300046462 | Bacteria | 3450 |
| 777 | Ga0495651_0075485 | 3300046462 | Bacteria | 2555 |
| 778 | Ga0495651_0409695 | 3300046462 | Unclassified | 883 |
| 779 | Ga0495651_0680561 | 3300046462 | Bacteria | 643 |
| 780 | Ga0495653_0037395 | 3300046463 | Bacteria | 3814 |
| 781 | Ga0495653_0083279 | 3300046463 | Unclassified | 2359 |
| 782 | Ga0495653_0092896 | 3300046463 | Bacteria | 2202 |
| 783 | Ga0495580_0002963 | 3300046472 | Bacteria | 14577 |
| 784 | Ga0495580_0008407 | 3300046472 | Bacteria | 8211 |
| 785 | Ga0495580_0029238 | 3300046472 | Bacteria | 4000 |
| 786 | Ga0495580_0059801 | 3300046472 | Bacteria | 2678 |
| 787 | Ga0495580_0098411 | 3300046472 | Bacteria | 2034 |
| 788 | Ga0495580_0142311 | 3300046472 | Bacteria | 1662 |
| 789 | Ga0495580_0158267 | 3300046472 | Bacteria | 1568 |
| 790 | Ga0495580_0180459 | 3300046472 | Bacteria | 1458 |
| 791 | Ga0495580_0253995 | 3300046472 | Bacteria | 1203 |
| 792 | Ga0495580_0347322 | 3300046472 | Bacteria | 1005 |
| 793 | Ga0495582_0022635 | 3300046473 | Bacteria | 3439 |
| 794 | Ga0495582_0047345 | 3300046473 | Bacteria | 2368 |
| 795 | Ga0495582_0049298 | 3300046473 | Bacteria | 2318 |
| 796 | Ga0495582_0384322 | 3300046473 | Bacteria | 809 |
| 797 | Ga0495605_0174133 | 3300046474 | Bacteria | 949 |
| 798 | Ga0495639_0018201 | 3300046475 | Bacteria | 3057 |
| 799 | Ga0495639_0357164 | 3300046475 | Bacteria | 734 |
| 800 | Ga0495662_0004202 | 3300046476 | Bacteria | 7250 |
| 801 | Ga0495664_0005176 | 3300046477 | Bacteria | 7156 |
| 802 | Ga0495664_0252071 | 3300046477 | Unclassified | 1067 |
| 803 | Ga0495594_0249716 | 3300046499 | Bacteria | 1011 |
| 804 | Ga0495608_0017477 | 3300046511 | Bacteria | 4961 |
| 805 | Ga0495608_0120537 | 3300046511 | Bacteria | 1682 |
| 806 | Ga0495608_0141550 | 3300046511 | Bacteria | 1535 |
| 807 | Ga0495608_0436851 | 3300046511 | Bacteria | 797 |
| 808 | Ga0495618_0080749 | 3300046514 | Unclassified | 2075 |
| 809 | Ga0495618_0274557 | 3300046514 | Bacteria | 1053 |
| 810 | Ga0495628_0002130 | 3300046516 | Bacteria | 17926 |
| 811 | Ga0495628_0007182 | 3300046516 | Bacteria | 9646 |
| 812 | Ga0495628_0034769 | 3300046516 | Unclassified | 4052 |
| 813 | Ga0495628_0074490 | 3300046516 | Unclassified | 2644 |
| 814 | Ga0495628_0083571 | 3300046516 | Bacteria | 2479 |
| 815 | Ga0495628_0211930 | 3300046516 | Bacteria | 1457 |
| 816 | Ga0495630_0015008 | 3300046517 | Bacteria | 5653 |
| 817 | Ga0495630_0075176 | 3300046517 | Bacteria | 2545 |
| 818 | Ga0495630_0100354 | 3300046517 | Bacteria | 2190 |
| 819 | Ga0495630_0308867 | 3300046517 | Bacteria | 1209 |
| 820 | Ga0495630_0332254 | 3300046517 | Bacteria | 1162 |
| 821 | Ga0495630_0407230 | 3300046517 | Bacteria | 1042 |
| 822 | Ga0495666_0158460 | 3300046526 | Bacteria | 1050 |
| 823 | Ga0495666_0245043 | 3300046526 | Bacteria | 817 |
| 824 | Ga0495652_0012085 | 3300046529 | Bacteria | 7801 |
| 825 | Ga0495652_0024929 | 3300046529 | Bacteria | 5292 |
| 826 | Ga0495652_0100355 | 3300046529 | Bacteria | 2348 |
| 827 | Ga0495652_0280667 | 3300046529 | Bacteria | 1220 |
| 828 | Ga0495652_0291215 | 3300046529 | Bacteria | 1191 |
| 829 | Ga0495665_0006278 | 3300046531 | Bacteria | 6413 |
| 830 | Ga0495665_0037083 | 3300046531 | Bacteria | 2602 |
| 831 | Ga0495665_0124988 | 3300046531 | Bacteria | 1347 |
| 832 | Ga0495665_0133494 | 3300046531 | Bacteria | 1299 |
| 833 | Ga0495665_0234064 | 3300046531 | Bacteria | 948 |
| 834 | Ga0495640_0003218 | 3300046533 | Bacteria | 13145 |
| 835 | Ga0495640_0074856 | 3300046533 | Bacteria | 2262 |
| 836 | Ga0495640_0080645 | 3300046533 | Unclassified | 2164 |
| 837 | Ga0495586_0023205 | 3300046535 | Bacteria | 3312 |
| 838 | Ga0495586_0035594 | 3300046535 | Bacteria | 2675 |
| 839 | Ga0495586_0040405 | 3300046535 | Bacteria | 2509 |
| 840 | Ga0495586_0106240 | 3300046535 | Bacteria | 1561 |
| 841 | Ga0495586_0413981 | 3300046535 | Bacteria | 776 |
| 842 | Ga0495586_0507531 | 3300046535 | Bacteria | 696 |
| 843 | Ga0495587_0000996 | 3300046536 | Bacteria | 18607 |
| 844 | Ga0495587_0003613 | 3300046536 | Bacteria | 10292 |
| 845 | Ga0495587_0091141 | 3300046536 | Bacteria | 1761 |
| 846 | Ga0495587_0129377 | 3300046536 | Bacteria | 1443 |
| 847 | Ga0495587_0400088 | 3300046536 | Bacteria | 763 |
| 848 | Ga0495645_0002230 | 3300046543 | Bacteria | 13177 |
| 849 | Ga0495645_0024408 | 3300046543 | Bacteria | 4387 |
| 850 | Ga0495645_0025394 | 3300046543 | Bacteria | 4299 |
| 851 | Ga0495645_0062331 | 3300046543 | Unclassified | 2701 |
| 852 | Ga0495645_0172413 | 3300046543 | Bacteria | 1488 |
| 853 | Ga0495645_0465551 | 3300046543 | Bacteria | 795 |
| 854 | Ga0495667_0003314 | 3300046559 | Bacteria | 10782 |
| 855 | Ga0495667_0033012 | 3300046559 | Bacteria | 3464 |
| 856 | Ga0495667_0035349 | 3300046559 | Bacteria | 3339 |
| 857 | Ga0495667_0063785 | 3300046559 | Bacteria | 2411 |
| 858 | Ga0495667_0106175 | 3300046559 | Bacteria | 1815 |
| 859 | Ga0495667_0289784 | 3300046559 | Bacteria | 1038 |
| 860 | Ga0495634_0048305 | 3300046642 | Bacteria | 2865 |
| 861 | Ga0495634_0074553 | 3300046642 | Bacteria | 2230 |
| 862 | Ga0495635_0016914 | 3300046663 | Bacteria | 5094 |
| 863 | Ga0495635_0017033 | 3300046663 | Bacteria | 5075 |
| 864 | Ga0495635_0029780 | 3300046663 | Bacteria | 3797 |
| 865 | Ga0495635_0031085 | 3300046663 | Bacteria | 3709 |
| 866 | Ga0495635_0167409 | 3300046663 | Bacteria | 1495 |
| 867 | Ga0495657_0003623 | 3300046675 | Bacteria | 12548 |
| 868 | Ga0495657_0015047 | 3300046675 | Bacteria | 5672 |
| 869 | Ga0495657_0065767 | 3300046675 | Bacteria | 2383 |
| 870 | Ga0495657_0567674 | 3300046675 | Bacteria | 658 |
| 871 | Ga0495599_0002263 | 3300046678 | Bacteria | 11202 |
| 872 | Ga0495599_0046531 | 3300046678 | Unclassified | 2720 |
| 873 | Ga0495599_0109724 | 3300046678 | Bacteria | 1719 |
| 874 | Ga0495599_0180169 | 3300046678 | Bacteria | 1303 |
| 875 | Ga0495623_0021497 | 3300046679 | Bacteria | 4165 |
| 876 | Ga0495623_0091130 | 3300046679 | Bacteria | 1871 |
| 877 | Ga0495623_0159211 | 3300046679 | Unclassified | 1328 |
| 878 | Ga0495623_0161333 | 3300046679 | Bacteria | 1317 |
| 879 | Ga0495646_0017362 | 3300046680 | Bacteria | 4565 |
| 880 | Ga0495646_0025074 | 3300046680 | Bacteria | 3751 |
| 881 | Ga0495646_0258822 | 3300046680 | Bacteria | 930 |
| 882 | Ga0495647_0083096 | 3300046681 | Bacteria | 1301 |
| 883 | Ga0495658_0003568 | 3300046683 | Bacteria | 7702 |
| 884 | Ga0495658_0142275 | 3300046683 | Bacteria | 1468 |
| 885 | Ga0495658_0266131 | 3300046683 | Bacteria | 1080 |
| 886 | Ga0495669_0018609 | 3300046684 | Bacteria | 2988 |
| 887 | Ga0495613_0032585 | 3300046689 | Bacteria | 3872 |
| 888 | Ga0495613_0177300 | 3300046689 | Bacteria | 1510 |
| 889 | Ga0495613_0235283 | 3300046689 | Bacteria | 1282 |
| 890 | Ga0495613_0352533 | 3300046689 | Bacteria | 1010 |
| 891 | Ga0495613_0376786 | 3300046689 | Bacteria | 971 |
| 892 | Ga0495624_0042733 | 3300046690 | Bacteria | 2896 |
| 893 | Ga0495624_0094737 | 3300046690 | Bacteria | 1840 |
| 894 | Ga0495600_0012117 | 3300046809 | Bacteria | 5385 |
| 895 | Ga0495600_0055361 | 3300046809 | Unclassified | 2590 |
| 896 | Ga0495600_0145311 | 3300046809 | Unclassified | 1537 |
| 897 | Ga0495600_0295832 | 3300046809 | Bacteria | 1022 |
| 898 | Ga0495600_0487623 | 3300046809 | Bacteria | 759 |
| 899 | Ga0495581_0081687 | 3300047315 | Bacteria | 1871 |
| 900 | Ga0495581_0196616 | 3300047315 | Bacteria | 1180 |
| 901 | Ga0495581_0283140 | 3300047315 | Bacteria | 969 |
| 902 | Ga0495604_0003773 | 3300047317 | Bacteria | 12062 |
| 903 | Ga0495604_0015747 | 3300047317 | Bacteria | 6035 |
| 904 | Ga0495604_0025833 | 3300047317 | Bacteria | 4677 |
| 905 | Ga0495604_0039876 | 3300047317 | Unclassified | 3690 |
| 906 | Ga0495604_0049716 | 3300047317 | Bacteria | 3256 |
| 907 | Ga0495604_0084045 | 3300047317 | Bacteria | 2378 |
| 908 | Ga0495604_0148503 | 3300047317 | Unclassified | 1668 |
| 909 | Ga0495604_0326320 | 3300047317 | Bacteria | 1025 |
| 910 | Ga0495604_0797201 | 3300047317 | Bacteria | 595 |
| 911 | Ga0495674_0043126 | 3300047319 | Bacteria | 4017 |
| 912 | Ga0495674_0087120 | 3300047319 | Bacteria | 2673 |
| 913 | Ga0495674_0128153 | 3300047319 | Bacteria | 2139 |
| 914 | Ga0495674_0231324 | 3300047319 | Bacteria | 1526 |
| 915 | Ga0495674_0256992 | 3300047319 | Bacteria | 1436 |
| 916 | Ga0495674_0333042 | 3300047319 | Bacteria | 1235 |
| 917 | Ga0495674_0506097 | 3300047319 | Bacteria | 966 |
| 918 | Ga0495676_0195790 | 3300047321 | Bacteria | 1407 |
| 919 | Ga0495680_0001389 | 3300047322 | Bacteria | 26131 |
| 920 | Ga0495680_0006947 | 3300047322 | Bacteria | 10447 |
| 921 | Ga0495680_0063404 | 3300047322 | Bacteria | 2838 |
| 922 | Ga0495680_0299778 | 3300047322 | Unclassified | 1129 |
| 923 | Ga0495680_0312475 | 3300047322 | Bacteria | 1101 |
| 924 | Ga0495680_0569469 | 3300047322 | Bacteria | 761 |
| 925 | Ga0495675_0000027 | 3300047444 | Bacteria | 106917 |
| 926 | Ga0495675_0036543 | 3300047444 | Bacteria | 3132 |
| 927 | Ga0495675_0084867 | 3300047444 | Bacteria | 1992 |
| 928 | Ga0495675_0108337 | 3300047444 | Unclassified | 1735 |
| 929 | Ga0495675_0138227 | 3300047444 | Bacteria | 1511 |
| 930 | Ga0495675_0198097 | 3300047444 | Bacteria | 1223 |
| 931 | Ga0495675_0283664 | 3300047444 | Bacteria | 987 |
| 932 | Ga0495675_0288185 | 3300047444 | Bacteria | 978 |
| 933 | Ga0495684_0001664 | 3300047471 | Bacteria | 17850 |
| 934 | Ga0495684_0027070 | 3300047471 | Bacteria | 4403 |
| 935 | Ga0495684_0032393 | 3300047471 | Bacteria | 4013 |
| 936 | Ga0495684_0048348 | 3300047471 | Bacteria | 3253 |
| 937 | Ga0495684_0061294 | 3300047471 | Bacteria | 2862 |
| 938 | Ga0495684_0215853 | 3300047471 | Bacteria | 1408 |
| 939 | Ga0495684_0298357 | 3300047471 | Bacteria | 1158 |
| 940 | Ga0495684_0361400 | 3300047471 | Bacteria | 1028 |
| 941 | Ga0495684_0497824 | 3300047471 | Unclassified | 838 |
| 942 | Ga0495684_0578425 | 3300047471 | Bacteria | 761 |
| 943 | Ga0495684_0948637 | 3300047471 | Bacteria | 550 |
| 944 | Ga0495593_0029583 | 3300047673 | Bacteria | 3002 |
| 945 | Ga0495602_0016267 | 3300048088 | Bacteria | 7484 |
| 946 | Ga0495602_0117354 | 3300048088 | Bacteria | 2148 |
| 947 | Ga0495602_0205128 | 3300048088 | Bacteria | 1501 |
| 948 | Ga0495602_0571575 | 3300048088 | Bacteria | 781 |
| 949 | Ga0495614_0030737 | 3300048089 | Bacteria | 2312 |
| 950 | Ga0495614_0470925 | 3300048089 | Bacteria | 596 |
| 951 | Ga0496100_0266033 | 3300048903 | Bacteria | 1273 |
| 952 | Ga0496101_0050632 | 3300048904 | Bacteria | 2991 |
| 953 | Ga0496101_0124707 | 3300048904 | Bacteria | 1951 |
| 954 | Ga0496101_0753187 | 3300048904 | Bacteria | 769 |
| 955 | Ga0496102_0001855 | 3300048905 | Bacteria | 18206 |
| 956 | Ga0496102_0015217 | 3300048905 | Bacteria | 6698 |
| 957 | Ga0496102_0789944 | 3300048905 | Unclassified | 872 |
| 958 | Ga0496102_0791297 | 3300048905 | Bacteria | 871 |
| 959 | Ga0496103_0325240 | 3300048906 | Bacteria | 989 |
| 960 | Ga0496104_0048814 | 3300048907 | Bacteria | 3991 |
| 961 | Ga0496104_0096337 | 3300048907 | Bacteria | 2831 |
| 962 | Ga0496104_0242959 | 3300048907 | Unclassified | 1713 |
| 963 | Ga0496104_0257788 | 3300048907 | Bacteria | 1657 |
| 964 | Ga0496104_0377146 | 3300048907 | Bacteria | 1331 |
| 965 | Ga0496104_0573247 | 3300048907 | Bacteria | 1039 |
| 966 | Ga0496104_0794308 | 3300048907 | Bacteria | 853 |
| 967 | Ga0496105_0017445 | 3300048908 | Bacteria | 5757 |
| 968 | Ga0496105_0240473 | 3300048908 | Bacteria | 1469 |
| 969 | Ga0496106_0062226 | 3300048909 | Bacteria | 2833 |
| 970 | Ga0496106_0878594 | 3300048909 | Bacteria | 709 |
| 971 | Ga0496107_0049551 | 3300048910 | Bacteria | 3027 |
| 972 | Ga0496107_0260138 | 3300048910 | Bacteria | 1291 |
| 973 | Ga0496107_1066918 | 3300048910 | Bacteria | 584 |
| 974 | Ga0496108_0000023 | 3300048911 | Bacteria | 186204 |
| 975 | Ga0496108_0064034 | 3300048911 | Bacteria | 3097 |
| 976 | Ga0496109_0007044 | 3300048912 | Bacteria | 9487 |
| 977 | Ga0496109_0020189 | 3300048912 | Bacteria | 5885 |
| 978 | Ga0496109_0039058 | 3300048912 | Bacteria | 4295 |
| 979 | Ga0496109_0563195 | 3300048912 | Bacteria | 1075 |
| 980 | Ga0496109_0900171 | 3300048912 | Unclassified | 823 |
| 981 | Ga0496109_1187295 | 3300048912 | Bacteria | 700 |
| 982 | Ga0496110_0089341 | 3300048913 | Bacteria | 2754 |
| 983 | Ga0496110_0110333 | 3300048913 | Bacteria | 2472 |
| 984 | Ga0496110_0239470 | 3300048913 | Bacteria | 1651 |
| 985 | Ga0496110_0337326 | 3300048913 | Bacteria | 1373 |
| 986 | Ga0496110_0864357 | 3300048913 | Bacteria | 810 |
| 987 | Ga0496111_0039135 | 3300048914 | Bacteria | 3399 |
| 988 | Ga0496111_0948661 | 3300048914 | Bacteria | 618 |
| 989 | Ga0496112_0018511 | 3300048915 | Bacteria | 6558 |
| 990 | Ga0496112_0051649 | 3300048915 | Bacteria | 4032 |
| 991 | Ga0496112_0087811 | 3300048915 | Bacteria | 3077 |
| 992 | Ga0496113_0003630 | 3300048916 | Bacteria | 9273 |
| 993 | Ga0496113_0008760 | 3300048916 | Bacteria | 6607 |
| 994 | Ga0496113_1222332 | 3300048916 | Bacteria | 586 |
| 995 | Ga0496114_0083288 | 3300048917 | Bacteria | 2706 |
| 996 | Ga0496115_0003887 | 3300048918 | Bacteria | 10768 |
| 997 | Ga0496115_0009647 | 3300048918 | Bacteria | 7183 |
| 998 | Ga0496115_0065104 | 3300048918 | Bacteria | 2944 |
| 999 | Ga0496115_0102547 | 3300048918 | Bacteria | 2347 |
| 1000 | Ga0496115_0141122 | 3300048918 | Bacteria | 1988 |
| 1001 | Ga0496115_1468003 | 3300048918 | Unclassified | 501 |
| 1002 | Ga0496119_0083333 | 3300048922 | Bacteria | 1837 |
| 1003 | Ga0496126_0035643 | 3300048929 | Bacteria | 4661 |
| 1004 | Ga0496126_0997129 | 3300048929 | Bacteria | 629 |
| 1005 | Ga0501040_0159936 | 3300049576 | Bacteria | 1592 |
| 1006 | Ga0501040_0623311 | 3300049576 | Bacteria | 779 |
| 1007 | Ga0501041_0092465 | 3300049577 | Bacteria | 1868 |
| 1008 | Ga0501042_0086739 | 3300049578 | Bacteria | 2245 |
| 1009 | Ga0501046_0542766 | 3300049580 | Bacteria | 829 |
| 1010 | Ga0501048_0291263 | 3300049582 | Bacteria | 1161 |
| 1011 | Ga0501070_0904588 | 3300049586 | Bacteria | 688 |
| 1012 | Ga0501071_0006921 | 3300049587 | Bacteria | 7398 |
| 1013 | Ga0501075_0230192 | 3300049591 | Bacteria | 1413 |
| 1014 | Ga0501076_0322278 | 3300049592 | Bacteria | 1267 |
| 1015 | Ga0501209_285722 | 3300049656 | Bacteria | 518 |
| 1016 | Ga0501216_070093 | 3300049660 | Bacteria | 723 |
| 1017 | Ga0501233_256974 | 3300049668 | Unclassified | 527 |
| 1018 | Ga0501253_053429 | 3300049683 | Unclassified | 853 |
| 1019 | Ga0501257_085556 | 3300049686 | Unclassified | 816 |
| 1020 | Ga0501079_0067835 | 3300049741 | Bacteria | 2753 |
| 1021 | Ga0501045_0434668 | 3300049824 | Bacteria | 976 |
| 1022 | nmdc:mga05p37_1761964_c1 | 3300050507 | Bacteria | 600 |
| 1023 | nmdc:mga05p37_2027_c1 | 3300050507 | Bacteria | 23615 |
| 1024 | nmdc:mga05p37_471620_c1 | 3300050507 | Bacteria | 1448 |
| 1025 | nmdc:mga05p37_515768_c1 | 3300050507 | Bacteria | 1368 |
| 1026 | nmdc:mga05p37_607564_c1 | 3300050507 | Bacteria | 1233 |
| 1027 | nmdc:mga05p37_627276_c1 | 3300050507 | Bacteria | 1208 |
| 1028 | nmdc:mga05p37_719617_c1 | 3300050507 | Bacteria | 1106 |
| 1029 | nmdc:mga05p37_814509_c1 | 3300050507 | Bacteria | 1019 |
| 1030 | nmdc:mga0qj67_250611_c1 | 3300050509 | Bacteria | 1437 |
| 1031 | nmdc:mga0qj67_49405_c1 | 3300050509 | Unclassified | 3325 |
| 1032 | nmdc:mga06r32_199346_c1 | 3300050510 | Bacteria | 1989 |
| 1033 | nmdc:mga06r32_208987_c1 | 3300050510 | Bacteria | 1940 |
| 1034 | nmdc:mga06r32_303317_c1 | 3300050510 | Bacteria | 1583 |
| 1035 | nmdc:mga0n895_27838_c1 | 3300050512 | Bacteria | 5372 |
| 1036 | nmdc:mga0n895_533000_c1 | 3300050512 | Bacteria | 1181 |
| 1037 | nmdc:mga0n895_86741_c1 | 3300050512 | Bacteria | 3127 |
| 1038 | nmdc:mga0rr50_120778_c1 | 3300050513 | Bacteria | 2085 |
| 1039 | nmdc:mga0rr50_31205_c1 | 3300050513 | Bacteria | 3782 |
| 1040 | nmdc:mga08x19_950244_c1 | 3300050514 | Bacteria | 611 |
| 1041 | nmdc:mga0a205_11560_c1 | 3300050515 | Bacteria | 8132 |
| 1042 | nmdc:mga0a205_240459_c1 | 3300050515 | Bacteria | 1691 |
| 1043 | nmdc:mga0a205_56593_c1 | 3300050515 | Bacteria | 3786 |
| 1044 | nmdc:mga0a205_795089_c1 | 3300050515 | Bacteria | 794 |
| 1045 | Ga0495601_0486419 | 3300053077 | Unclassified | 797 |
| 1046 | Ga0495612_0032801 | 3300053078 | Bacteria | 2099 |
| 1047 | Ga0495612_0386941 | 3300053078 | Bacteria | 634 |
| 1048 | Ga0495619_0016662 | 3300053085 | Bacteria | 4650 |
| 1049 | Ga0495619_0707732 | 3300053085 | Bacteria | 685 |
| 1050 | Ga0495619_0849292 | 3300053085 | Bacteria | 616 |
| 1051 | Ga0495619_1025648 | 3300053085 | Bacteria | 551 |
| 1052 | Ga0500577_0013890 | 3300053142 | Bacteria | 2474 |
| 1053 | Ga0501084_0023317 | 3300054114 | Bacteria | 5167 |
| 1054 | Ga0501084_1188506 | 3300054114 | Bacteria | 640 |
| 1055 | Ga0530510_0129790 | 3300061734 | Bacteria | 1854 |
| 1056 | 2600226333 | 2599185359 | Bacteria | 4772316 |
| 1057 | 2819712423 | 2818991466 | Bacteria | 4748179 |
| 1058 | 2928526933 | 2928526807 | Bacteria | 4760224 |
| 1059 | 2928969462 | 2928968154 | Bacteria | 4633371 |
| 1060 | Ga0207677_10580578 | |||
| 1061 | Ga0055530_10000901 | |||
| 1062 | Ga0055531_10000583 | |||
| 1063 | Ga0065715_10529869 | |||
| 1064 | Ga0070658_10088066 | |||
| 1065 | Ga0070658_10112111 | |||
| 1066 | Ga0070658_10995641 | |||
| 1067 | Ga0070683_100000051 | |||
| 1068 | Ga0070683_100013688 | |||
| 1069 | Ga0070683_100019789 | |||
| 1070 | Ga0070683_100034270 | |||
| 1071 | Ga0070683_100061409 | |||
| 1072 | Ga0070683_100065764 | |||
| 1073 | Ga0070683_100145819 | |||
| 1074 | Ga0070683_100398021 | |||
| 1075 | Ga0070683_100480833 | |||
| 1076 | Ga0070683_100527741 | |||
| 1077 | Ga0070683_100789692 | |||
| 1078 | Ga0070690_100664012 | |||
| 1079 | Ga0070670_100204356 | |||
| 1080 | Ga0070670_100995684 | |||
| 1081 | Ga0070670_101629465 | |||
| 1082 | Ga0070677_10461993 | |||
| 1083 | Ga0068869_100010065 | |||
| 1084 | Ga0068869_100170892 | |||
| 1085 | Ga0068869_100300870 | |||
| 1086 | Ga0070666_10133786 | |||
| 1087 | Ga0070680_100009354 | |||
| 1088 | Ga0070680_100143936 | |||
| 1089 | Ga0070680_100952131 | |||
| 1090 | Ga0070682_100104446 | |||
| 1091 | Ga0070682_100115730 | |||
| 1092 | Ga0070682_100646689 | |||
| 1093 | Ga0068868_100270331 | |||
| 1094 | Ga0068868_100695108 | |||
| 1095 | Ga0070660_100036846 | |||
| 1096 | Ga0070660_100221281 | |||
| 1097 | Ga0070660_100349242 | |||
| 1098 | Ga0070689_100637155 | |||
| 1099 | Ga0070691_10009177 | |||
| 1100 | Ga0070661_100746171 | |||
| 1101 | Ga0070692_10059267 | |||
| 1102 | Ga0070692_10097797 | |||
| 1103 | Ga0070668_100286256 | |||
| 1104 | Ga0070668_100599076 | |||
| 1105 | Ga0070671_100110263 | |||
| 1106 | Ga0070671_100962886 | |||
| 1107 | Ga0070688_100741580 | |||
| 1108 | Ga0070659_100641206 | |||
| 1109 | Ga0070667_100126251 | |||
| 1110 | Ga0070667_100201538 | |||
| 1111 | Ga0070667_100296367 | |||
| 1112 | Ga0070667_101124904 | |||
| 1113 | Ga0070667_101137263 | |||
| 1114 | Ga0070709_10017253 | |||
| 1115 | Ga0070709_10048410 | |||
| 1116 | Ga0070709_10098765 | |||
| 1117 | Ga0070709_10432040 | |||
| 1118 | Ga0070709_10736486 | |||
| 1119 | Ga0070714_100000386 | |||
| 1120 | Ga0070714_100760365 | |||
| 1121 | Ga0070713_100037923 | |||
| 1122 | Ga0070713_100078111 | |||
| 1123 | Ga0070713_100099516 | |||
| 1124 | Ga0070713_100171742 | |||
| 1125 | Ga0070713_100194876 | |||
| 1126 | Ga0070710_10015779 | |||
| 1127 | Ga0070710_10360148 | |||
| 1128 | Ga0070710_10452193 | |||
| 1129 | Ga0070711_100186534 | |||
| 1130 | Ga0070711_100750712 | |||
| 1131 | Ga0070711_100971110 | |||
| 1132 | Ga0070694_100647108 | |||
| 1133 | Ga0070708_100031899 | |||
| 1134 | Ga0070678_100059833 | |||
| 1135 | Ga0070678_100238520 | |||
| 1136 | Ga0070662_100196739 | |||
| 1137 | Ga0070681_10000605 | |||
| 1138 | Ga0070681_10002652 | |||
| 1139 | Ga0070681_10019182 | |||
| 1140 | Ga0070681_10538907 | |||
| 1141 | Ga0068867_100275770 | |||
| 1142 | Ga0068867_100508755 | |||
| 1143 | Ga0070685_10307602 | |||
| 1144 | Ga0070706_100252976 | |||
| 1145 | Ga0070706_101061849 | |||
| 1146 | Ga0070706_101385274 | |||
| 1147 | Ga0070707_100556620 | |||
| 1148 | Ga0070707_100642203 | |||
| 1149 | Ga0070707_101804062 | |||
| 1150 | Ga0070698_100576842 | |||
| 1151 | Ga0070698_101077900 | |||
| 1152 | Ga0070699_100022533 | |||
| 1153 | Ga0070699_100095222 | |||
| 1154 | Ga0070699_100761183 | |||
| 1155 | Ga0070679_100000883 | |||
| 1156 | Ga0070679_100017372 | |||
| 1157 | Ga0070684_100000061 | |||
| 1158 | Ga0070684_100002114 | |||
| 1159 | Ga0070684_100028501 | |||
| 1160 | Ga0070684_100072418 | |||
| 1161 | Ga0070684_100210882 | |||
| 1162 | Ga0070684_100706194 | |||
| 1163 | Ga0070684_100731726 | |||
| 1164 | Ga0070697_100362927 | |||
| 1165 | Ga0070697_100443508 | |||
| 1166 | Ga0070697_100603109 | |||
| 1167 | Ga0070697_100630723 | |||
| 1168 | Ga0068853_100761029 | |||
| 1169 | Ga0070672_100614830 | |||
| 1170 | Ga0070693_100208695 | |||
| 1171 | Ga0070693_100399839 | |||
| 1172 | Ga0070665_100031655 | |||
| 1173 | Ga0070665_100443090 | |||
| 1174 | Ga0070665_100671817 | |||
| 1175 | Ga0070704_100247052 | |||
| 1176 | Ga0068855_100001633 | |||
| 1177 | Ga0068855_100007832 | |||
| 1178 | Ga0068855_100031981 | |||
| 1179 | Ga0068855_100163150 | |||
| 1180 | Ga0068855_100251190 | |||
| 1181 | Ga0068855_100274674 | |||
| 1182 | Ga0068855_100632267 | |||
| 1183 | Ga0070664_100466001 | |||
| 1184 | Ga0070664_101141143 | |||
| 1185 | Ga0068857_100003819 | |||
| 1186 | Ga0068857_100061655 | |||
| 1187 | Ga0068857_100238329 | |||
| 1188 | Ga0068854_100121973 | |||
| 1189 | Ga0068856_100075518 | |||
| 1190 | Ga0068856_100097875 | |||
| 1191 | Ga0068856_100203541 | |||
| 1192 | Ga0068856_100346035 | |||
| 1193 | Ga0068856_100754273 | |||
| 1194 | Ga0068856_101111460 | |||
| 1195 | Ga0070702_100194209 | |||
| 1196 | Ga0070702_101733148 | |||
| 1197 | Ga0068852_100017342 | |||
| 1198 | Ga0068852_100031322 | |||
| 1199 | Ga0068852_100156588 | |||
| 1200 | Ga0068852_100184359 | |||
| 1201 | Ga0068852_100295873 | |||
| 1202 | Ga0068852_100350099 | |||
| 1203 | Ga0068859_100140769 | |||
| 1204 | Ga0068859_100664517 | |||
| 1205 | Ga0068859_101030168 | |||
| 1206 | Ga0068859_101293571 | |||
| 1207 | Ga0068859_101567583 | |||
| 1208 | Ga0068864_100038294 | |||
| 1209 | Ga0068864_100052484 | |||
| 1210 | Ga0068864_100223924 | |||
| 1211 | Ga0068863_100019220 | |||
| 1212 | Ga0068863_100149236 | |||
| 1213 | Ga0068863_100382531 | |||
| 1214 | Ga0068863_100453238 | |||
| 1215 | Ga0068863_100523876 | |||
| 1216 | Ga0068863_100613615 | |||
| 1217 | Ga0068863_100923000 | |||
| 1218 | Ga0068863_101864038 | |||
| 1219 | Ga0068858_100013721 | |||
| 1220 | Ga0068858_100239136 | |||
| 1221 | Ga0068858_100482312 | |||
| 1222 | Ga0068860_100035691 | |||
| 1223 | Ga0068860_100074306 | |||
| 1224 | Ga0068860_100199313 | |||
| 1225 | Ga0068860_100310755 | |||
| 1226 | Ga0068860_100356335 | |||
| 1227 | Ga0068860_101123432 | |||
| 1228 | Ga0068862_100371468 | |||
| 1229 | Ga0081539_10017275 | |||
| 1230 | Ga0070717_10027358 | |||
| 1231 | Ga0070717_10029546 | |||
| 1232 | Ga0070717_10059739 | |||
| 1233 | Ga0070717_10137100 | |||
| 1234 | Ga0070717_10305381 | |||
| 1235 | Ga0070717_10547250 | |||
| 1236 | Ga0070715_10180463 | |||
| 1237 | Ga0070716_100093300 | |||
| 1238 | Ga0070716_100431208 | |||
| 1239 | Ga0070716_101171367 | |||
| 1240 | Ga0070712_100093528 | |||
| 1241 | Ga0097621_100030891 | |||
| 1242 | Ga0097621_100107956 | |||
| 1243 | Ga0097621_100219441 | |||
| 1244 | Ga0097621_100220992 | |||
| 1245 | Ga0097621_100398349 | |||
| 1246 | Ga0097621_100438368 | |||
| 1247 | Ga0097621_100972286 | |||
| 1248 | Ga0068871_100129353 | |||
| 1249 | Ga0068871_100143395 | |||
| 1250 | Ga0068871_100355858 | |||
| 1251 | Ga0068871_100607311 | |||
| 1252 | Ga0068871_100620271 | |||
| 1253 | Ga0068871_101036766 | |||
| 1254 | Ga0068871_101179144 | |||
| 1255 | Ga0075428_100350205 | |||
| 1256 | Ga0075430_100036376 | |||
| 1257 | Ga0075430_100055664 | |||
| 1258 | Ga0075431_100022732 | |||
| 1259 | Ga0075433_10004679 | |||
| 1260 | Ga0075433_10381162 | |||
| 1261 | Ga0075433_10937738 | |||
| 1262 | Ga0075434_100021744 | |||
| 1263 | Ga0075434_100042803 | |||
| 1264 | Ga0075434_100213825 | |||
| 1265 | Ga0075434_101211643 | |||
| 1266 | Ga0075429_101281910 | |||
| 1267 | Ga0068865_101363481 | |||
| 1268 | Ga0075436_100335292 | |||
| 1269 | Ga0075436_100469306 | |||
| 1270 | Ga0097620_100140775 | |||
| 1271 | Ga0097620_100664536 | |||
| 1272 | Ga0097620_100747232 | |||
| 1273 | Ga0097620_101030339 | |||
| 1274 | Ga0097620_101293603 | |||
| 1275 | Ga0097620_101567370 | |||
| 1276 | Ga0075435_100037403 | |||
| 1277 | Ga0075435_100124806 | |||
| 1278 | Ga0099794_10052393 | |||
| 1279 | Ga0099795_10037425 | |||
| 1280 | Ga0099795_10066245 | |||
| 1281 | Ga0099795_10080988 | |||
| 1282 | Ga0099795_10180297 | |||
| 1283 | Ga0105244_10324366 | |||
| 1284 | Ga0105240_10003450 | |||
| 1285 | Ga0105240_10005756 | |||
| 1286 | Ga0105240_10006166 | |||
| 1287 | Ga0105240_10017854 | |||
| 1288 | Ga0105240_10023379 | |||
| 1289 | Ga0105240_10119293 | |||
| 1290 | Ga0105240_10129063 | |||
| 1291 | Ga0105240_10144007 | |||
| 1292 | Ga0105240_10354356 | |||
| 1293 | Ga0105240_10433926 | |||
| 1294 | Ga0105240_10542221 | |||
| 1295 | Ga0105240_11124324 | |||
| 1296 | Ga0105240_11611121 | |||
| 1297 | Ga0111539_10883125 | |||
| 1298 | Ga0105245_10005590 | |||
| 1299 | Ga0105245_10011857 | |||
| 1300 | Ga0105245_10028346 | |||
| 1301 | Ga0105245_10042372 | |||
| 1302 | Ga0105245_10155998 | |||
| 1303 | Ga0105245_10184017 | |||
| 1304 | Ga0105245_10543839 | |||
| 1305 | Ga0105245_10626766 | |||
| 1306 | Ga0105245_10632212 | |||
| 1307 | Ga0105245_12094691 | |||
| 1308 | Ga0105247_10029848 | |||
| 1309 | Ga0114129_10000566 | |||
| 1310 | Ga0114129_10046469 | |||
| 1311 | Ga0114129_10309270 | |||
| 1312 | Ga0114129_10363515 | |||
| 1313 | Ga0114129_10404112 | |||
| 1314 | Ga0114129_10446276 | |||
| 1315 | Ga0114129_10656859 | |||
| 1316 | Ga0114129_10767338 | |||
| 1317 | Ga0114129_10974250 | |||
| 1318 | Ga0114129_11198739 | |||
| 1319 | Ga0114129_11344621 | |||
| 1320 | Ga0114129_11794472 | |||
| 1321 | Ga0114129_12365488 | |||
| 1322 | Ga0105243_10052143 | |||
| 1323 | Ga0105243_10090238 | |||
| 1324 | Ga0105243_10146361 | |||
| 1325 | Ga0105243_10670369 | |||
| 1326 | Ga0105243_10672856 | |||
| 1327 | Ga0105243_11507300 | |||
| 1328 | Ga0105243_11877135 | |||
| 1329 | Ga0105241_10051974 | |||
| 1330 | Ga0105241_10053332 | |||
| 1331 | Ga0105241_10126772 | |||
| 1332 | Ga0105241_10326102 | |||
| 1333 | Ga0105241_10980062 | |||
| 1334 | Ga0105241_11055750 | |||
| 1335 | Ga0105242_10027196 | |||
| 1336 | Ga0105242_10058237 | |||
| 1337 | Ga0105242_10115850 | |||
| 1338 | Ga0105242_10349641 | |||
| 1339 | Ga0105242_10423348 | |||
| 1340 | Ga0105242_10543449 | |||
| 1341 | Ga0105248_10023999 | |||
| 1342 | Ga0105248_10026578 | |||
| 1343 | Ga0105248_10031143 | |||
| 1344 | Ga0105248_10070780 | |||
| 1345 | Ga0105248_10261316 | |||
| 1346 | Ga0105248_10482909 | |||
| 1347 | Ga0105248_10483744 | |||
| 1348 | Ga0105248_10517493 | |||
| 1349 | Ga0105248_11101824 | |||
| 1350 | Ga0105248_11281469 | |||
| 1351 | Ga0105248_11324386 | |||
| 1352 | Ga0105248_11496530 | |||
| 1353 | Ga0105248_11931346 | |||
| 1354 | Ga0105248_12154749 | |||
| 1355 | Ga0105237_10012111 | |||
| 1356 | Ga0105237_10040373 | |||
| 1357 | Ga0105237_10167903 | |||
| 1358 | Ga0105237_10171538 | |||
| 1359 | Ga0105237_10383669 | |||
| 1360 | Ga0105237_10419516 | |||
| 1361 | Ga0105237_10545667 | |||
| 1362 | Ga0105237_11529735 | |||
| 1363 | Ga0105238_10006344 | |||
| 1364 | Ga0105238_10008033 | |||
| 1365 | Ga0105238_10065643 | |||
| 1366 | Ga0105238_10238950 | |||
| 1367 | Ga0105238_11250008 | |||
| 1368 | Ga0105238_11599246 | |||
| 1369 | Ga0105249_10017122 | |||
| 1370 | Ga0105249_10038088 | |||
| 1371 | Ga0105249_10192926 | |||
| 1372 | Ga0105249_10213984 | |||
| 1373 | Ga0105249_10766740 | |||
| 1374 | Ga0099796_10040988 | |||
| 1375 | Ga0099796_10172497 | |||
| 1376 | Ga0105239_10011863 | |||
| 1377 | Ga0105239_10015915 | |||
| 1378 | Ga0105239_10023725 | |||
| 1379 | Ga0105239_10585977 | |||
| 1380 | Ga0105239_10623751 | |||
| 1381 | Ga0105239_12232423 | |||
| 1382 | Ga0105246_10001137 | |||
| 1383 | Ga0105246_10211380 | |||
| 1384 | Ga0105246_10566344 | |||
| 1385 | Ga0105246_10671886 | |||
| 1386 | Ga0157373_10199304 | |||
| 1387 | Ga0157371_10038416 | |||
| 1388 | Ga0157370_10002104 | |||
| 1389 | Ga0157370_10002904 | |||
| 1390 | Ga0157370_10048458 | |||
| 1391 | Ga0157370_10100651 | |||
| 1392 | Ga0157370_10305475 | |||
| 1393 | Ga0157370_10630246 | |||
| 1394 | Ga0157369_10012050 | |||
| 1395 | Ga0157369_10013263 | |||
| 1396 | Ga0157369_10032835 | |||
| 1397 | Ga0157369_10103620 | |||
| 1398 | Ga0157369_10180313 | |||
| 1399 | Ga0157369_10437218 | |||
| 1400 | Ga0157369_10620925 | |||
| 1401 | Ga0157374_10007004 | |||
| 1402 | Ga0157374_10012288 | |||
| 1403 | Ga0157374_10014907 | |||
| 1404 | Ga0157374_10039582 | |||
| 1405 | Ga0157374_10339973 | |||
| 1406 | Ga0157374_10561612 | |||
| 1407 | Ga0157374_10716266 | |||
| 1408 | Ga0157374_10789436 | |||
| 1409 | Ga0157378_10003916 | |||
| 1410 | Ga0157378_10024514 | |||
| 1411 | Ga0157378_10068265 | |||
| 1412 | Ga0157378_10073479 | |||
| 1413 | Ga0157378_10118899 | |||
| 1414 | Ga0157378_10307441 | |||
| 1415 | Ga0157378_10314026 | |||
| 1416 | Ga0157378_10641094 | |||
| 1417 | Ga0157378_11075671 | |||
| 1418 | Ga0163162_10008346 | |||
| 1419 | Ga0163162_10434440 | |||
| 1420 | Ga0163162_10640471 | |||
| 1421 | Ga0163162_10759428 | |||
| 1422 | Ga0163162_10919549 | |||
| 1423 | Ga0163162_11011700 | |||
| 1424 | Ga0163162_11074274 | |||
| 1425 | Ga0163162_11885102 | |||
| 1426 | Ga0163162_13107852 | |||
| 1427 | Ga0157372_10003606 | |||
| 1428 | Ga0157372_10007318 | |||
| 1429 | Ga0157372_10050104 | |||
| 1430 | Ga0157372_10064369 | |||
| 1431 | Ga0157372_10066914 | |||
| 1432 | Ga0157372_10231714 | |||
| 1433 | Ga0157372_10382822 | |||
| 1434 | Ga0157372_11981606 | |||
| 1435 | Ga0157375_10081896 | |||
| 1436 | Ga0157375_10107742 | |||
| 1437 | Ga0157375_10152200 | |||
| 1438 | Ga0157375_10169992 | |||
| 1439 | Ga0157375_10344453 | |||
| 1440 | Ga0157375_10388744 | |||
| 1441 | Ga0157375_10495081 | |||
| 1442 | Ga0157375_10785054 | |||
| 1443 | Ga0157375_11285747 | |||
| 1444 | Ga0163163_10002295 | |||
| 1445 | Ga0163163_10003230 | |||
| 1446 | Ga0163163_10004829 | |||
| 1447 | Ga0163163_10034711 | |||
| 1448 | Ga0163163_10243325 | |||
| 1449 | Ga0163163_10305347 | |||
| 1450 | Ga0157380_10062307 | |||
| 1451 | Ga0157380_11305197 | |||
| 1452 | Ga0157379_10016505 | |||
| 1453 | Ga0157379_10157363 | |||
| 1454 | Ga0157379_10323743 | |||
| 1455 | Ga0157379_10462606 | |||
| 1456 | Ga0157379_11149367 | |||
| 1457 | Ga0157376_10003293 | |||
| 1458 | Ga0157376_10117350 | |||
| 1459 | Ga0157376_10254880 | |||
| 1460 | Ga0157376_10523703 | |||
| 1461 | Ga0157376_10541897 | |||
| 1462 | Ga0157376_10623391 | |||
| 1463 | Ga0157376_10689816 | |||
| 1464 | Ga0157376_10945103 | |||
| 1465 | Ga0163161_10565009 | |||
| 1466 | Ga0206353_10992914 | |||
| 1467 | Ga0213873_10039413 | |||
| 1468 | Ga0213873_10256813 | |||
| 1469 | Ga0213875_10000018 | |||
| 1470 | Ga0224570_100985 | |||
| 1471 | Ga0224569_101568 | |||
| 1472 | Ga0228598_1000659 | |||
| 1473 | Ga0228598_1003820 | |||
| 1474 | Ga0228598_1004693 | |||
| 1475 | Ga0209026_1005779 | |||
| 1476 | Ga0209676_1087506 | |||
| 1477 | Ga0209050_1000010 | |||
| 1478 | Ga0209257_1000009 | |||
| 1479 | Ga0207692_10151189 | |||
| 1480 | Ga0207710_10029613 | |||
| 1481 | Ga0207680_10452008 | |||
| 1482 | Ga0207680_10527558 | |||
| 1483 | Ga0207647_10019106 | |||
| 1484 | Ga0207647_10061055 | |||
| 1485 | Ga0207647_10668597 | |||
| 1486 | Ga0207685_10189209 | |||
| 1487 | Ga0207699_10061227 | |||
| 1488 | Ga0207699_10072937 | |||
| 1489 | Ga0207699_10421337 | |||
| 1490 | Ga0207705_10043214 | |||
| 1491 | Ga0207705_10080686 | |||
| 1492 | Ga0207654_10049076 | |||
| 1493 | Ga0207707_10000372 | |||
| 1494 | Ga0207707_10043965 | |||
| 1495 | Ga0207707_10124030 | |||
| 1496 | Ga0207707_10186868 | |||
| 1497 | Ga0207707_10270942 | |||
| 1498 | Ga0207707_11374722 | |||
| 1499 | Ga0207695_10000563 | |||
| 1500 | Ga0207695_10002828 | |||
| 1501 | Ga0207695_10004561 | |||
| 1502 | Ga0207695_10005869 | |||
| 1503 | Ga0207695_10029367 | |||
| 1504 | Ga0207695_10092201 | |||
| 1505 | Ga0207695_10163408 | |||
| 1506 | Ga0207695_10169270 | |||
| 1507 | Ga0207695_10404729 | |||
| 1508 | Ga0207671_10025128 | |||
| 1509 | Ga0207671_10333689 | |||
| 1510 | Ga0207671_11099217 | |||
| 1511 | Ga0207693_10347722 | |||
| 1512 | Ga0207663_10028977 | |||
| 1513 | Ga0207663_10312894 | |||
| 1514 | Ga0207660_10607649 | |||
| 1515 | Ga0207657_10001386 | |||
| 1516 | Ga0207652_10008525 | |||
| 1517 | Ga0207652_10260215 | |||
| 1518 | Ga0207694_10002271 | |||
| 1519 | Ga0207694_10388546 | |||
| 1520 | Ga0207694_10666481 | |||
| 1521 | Ga0207694_11235810 | |||
| 1522 | Ga0207650_10221852 | |||
| 1523 | Ga0207650_10261490 | |||
| 1524 | Ga0207650_11469098 | |||
| 1525 | Ga0207687_10006608 | |||
| 1526 | Ga0207687_10017134 | |||
| 1527 | Ga0207687_10032204 | |||
| 1528 | Ga0207687_10073163 | |||
| 1529 | Ga0207687_10208403 | |||
| 1530 | Ga0207687_10255761 | |||
| 1531 | Ga0207687_10578533 | |||
| 1532 | Ga0207700_10001086 | |||
| 1533 | Ga0207700_10140970 | |||
| 1534 | Ga0207700_10282479 | |||
| 1535 | Ga0207700_10394656 | |||
| 1536 | Ga0207700_10728654 | |||
| 1537 | Ga0207700_11082883 | |||
| 1538 | Ga0207700_11536484 | |||
| 1539 | Ga0207664_10000741 | |||
| 1540 | Ga0207664_10140947 | |||
| 1541 | Ga0207644_10382064 | |||
| 1542 | Ga0207690_10503493 | |||
| 1543 | Ga0207686_10015151 | |||
| 1544 | Ga0207686_10065427 | |||
| 1545 | Ga0207686_10271205 | |||
| 1546 | Ga0207686_10734616 | |||
| 1547 | Ga0207709_10138972 | |||
| 1548 | Ga0207709_10156996 | |||
| 1549 | Ga0207709_10337455 | |||
| 1550 | Ga0207704_10819923 | |||
| 1551 | Ga0207704_11642725 | |||
| 1552 | Ga0207665_10085002 | |||
| 1553 | Ga0207665_10482390 | |||
| 1554 | Ga0207665_10485751 | |||
| 1555 | Ga0207665_10848692 | |||
| 1556 | Ga0207711_10065883 | |||
| 1557 | Ga0207711_10072807 | |||
| 1558 | Ga0207711_10105464 | |||
| 1559 | Ga0207711_10283370 | |||
| 1560 | Ga0207689_10075607 | |||
| 1561 | Ga0207689_10173908 | |||
| 1562 | Ga0207689_10491664 | |||
| 1563 | Ga0207661_10000046 | |||
| 1564 | Ga0207661_10019082 | |||
| 1565 | Ga0207661_10125524 | |||
| 1566 | Ga0207661_10448291 | |||
| 1567 | Ga0207679_10707655 | |||
| 1568 | Ga0207679_10943873 | |||
| 1569 | Ga0207679_11146759 | |||
| 1570 | Ga0207667_10001186 | |||
| 1571 | Ga0207667_10001746 | |||
| 1572 | Ga0207667_10015440 | |||
| 1573 | Ga0207667_10068619 | |||
| 1574 | Ga0207667_10081919 | |||
| 1575 | Ga0207667_10098288 | |||
| 1576 | Ga0207667_10119246 | |||
| 1577 | Ga0207667_10224153 | |||
| 1578 | Ga0207712_10139261 | |||
| 1579 | Ga0207668_10075779 | |||
| 1580 | Ga0207658_10869976 | |||
| 1581 | Ga0207658_11566752 | |||
| 1582 | Ga0207677_10995387 | |||
| 1583 | Ga0207703_10103455 | |||
| 1584 | Ga0207703_10235098 | |||
| 1585 | Ga0207703_10247184 | |||
| 1586 | Ga0207703_10256979 | |||
| 1587 | Ga0207703_11592464 | |||
| 1588 | Ga0207639_10686114 | |||
| 1589 | Ga0207678_10281895 | |||
| 1590 | Ga0207702_10003891 | |||
| 1591 | Ga0207702_10099606 | |||
| 1592 | Ga0207702_10192047 | |||
| 1593 | Ga0207702_10402290 | |||
| 1594 | Ga0207641_10117373 | |||
| 1595 | Ga0207641_10133800 | |||
| 1596 | Ga0207641_10380907 | |||
| 1597 | Ga0207641_10396554 | |||
| 1598 | Ga0207641_10407972 | |||
| 1599 | Ga0207641_10886666 | |||
| 1600 | Ga0207648_10255398 | |||
| 1601 | Ga0207648_10515084 | |||
| 1602 | Ga0207676_10021890 | |||
| 1603 | Ga0207676_10088982 | |||
| 1604 | Ga0207676_10300111 | |||
| 1605 | Ga0207676_10630469 | |||
| 1606 | Ga0207674_10000503 | |||
| 1607 | Ga0207674_10006231 | |||
| 1608 | Ga0207674_10030990 | |||
| 1609 | Ga0207674_10910809 | |||
| 1610 | Ga0207675_100312070 | |||
| 1611 | Ga0207683_10537273 | |||
| 1612 | Ga0207698_10018426 | |||
| 1613 | Ga0207698_10034709 | |||
| 1614 | Ga0207698_10060178 | |||
| 1615 | Ga0207698_10114346 | |||
| 1616 | Ga0207698_10287447 | |||
| 1617 | Ga0207698_10340733 | |||
| 1618 | Ga0207698_11557471 | |||
| 1619 | Ga0209179_1014511 | |||
| 1620 | Ga0209588_1100648 | |||
| 1621 | Ga0265356_1002962 | |||
| 1622 | Ga0268266_10041127 | |||
| 1623 | Ga0268266_10201693 | |||
| 1624 | Ga0268266_10760196 | |||
| 1625 | Ga0268266_10800347 | |||
| 1626 | Ga0268265_11332614 | |||
| 1627 | Ga0268264_10019401 | |||
| 1628 | Ga0268264_10286867 | |||
| 1629 | Ga0268264_10394757 | |||
| 1630 | Ga0268264_11108183 | |||
| 1631 | Ga0268264_11154766 | |||
| 1632 | Ga0265319_1011603 | |||
| 1633 | Ga0265334_10051509 | |||
| 1634 | Ga0265318_10000903 | |||
| 1635 | Ga0265318_10019966 | |||
| 1636 | Ga0265338_10001726 | |||
| 1637 | Ga0265338_10134159 | |||
| 1638 | Ga0265338_10144552 | |||
| 1639 | Ga0265338_10151590 | |||
| 1640 | Ga0265338_10303457 | |||
| 1641 | Ga0265338_10844649 | |||
| 1642 | Ga0265762_1000400 | |||
| 1643 | Ga0265762_1018852 | |||
| 1644 | Ga0265762_1040157 | |||
| 1645 | Ga0265760_10000041 | |||
| 1646 | Ga0265760_10000559 | |||
| 1647 | Ga0265760_10022140 | |||
| 1648 | Ga0265330_10000309 | |||
| 1649 | Ga0265332_10017045 | |||
| 1650 | Ga0265332_10018234 | |||
| 1651 | Ga0265328_10000459 | |||
| 1652 | Ga0265328_10036973 | |||
| 1653 | Ga0265328_10241231 | |||
| 1654 | Ga0265320_10000377 | |||
| 1655 | Ga0265325_10001117 | |||
| 1656 | Ga0265325_10001276 | |||
| 1657 | Ga0265325_10001493 | |||
| 1658 | Ga0265325_10010845 | |||
| 1659 | Ga0265329_10004080 | |||
| 1660 | Ga0265329_10007071 | |||
| 1661 | Ga0265340_10002780 | |||
| 1662 | Ga0265340_10003167 | |||
| 1663 | Ga0265340_10005849 | |||
| 1664 | Ga0265340_10072663 | |||
| 1665 | Ga0265339_10002243 | |||
| 1666 | Ga0265339_10311071 | |||
| 1667 | Ga0265331_10000172 | |||
| 1668 | Ga0265331_10003170 | |||
| 1669 | Ga0265331_10010058 | |||
| 1670 | Ga0265331_10026789 | |||
| 1671 | Ga0265331_10319498 | |||
| 1672 | Ga0265316_10008573 | |||
| 1673 | Ga0265316_10009890 | |||
| 1674 | Ga0265316_10017595 | |||
| 1675 | Ga0265316_10062871 | |||
| 1676 | Ga0265316_10080983 | |||
| 1677 | Ga0265316_10085222 | |||
| 1678 | Ga0265316_10089078 | |||
| 1679 | Ga0265316_10194680 | |||
| 1680 | Ga0265316_10768015 | |||
| 1681 | Ga0307408_100084919 | |||
| 1682 | Ga0307408_100175524 | |||
| 1683 | Ga0265313_10001182 | |||
| 1684 | Ga0265313_10002130 | |||
| 1685 | Ga0265313_10011745 | |||
| 1686 | Ga0265313_10015469 | |||
| 1687 | Ga0265313_10044715 | |||
| 1688 | Ga0265313_10064095 | |||
| 1689 | Ga0316579_10001174 | |||
| 1690 | Ga0265314_10068052 | |||
| 1691 | Ga0265314_10209043 | |||
| 1692 | Ga0265342_10000656 | |||
| 1693 | Ga0265342_10003719 | |||
| 1694 | Ga0265342_10033651 | |||
| 1695 | Ga0265342_10358141 | |||
| 1696 | Ga0307405_10207501 | |||
| 1697 | Ga0307405_10518736 | |||
| 1698 | Ga0307405_11191993 | |||
| 1699 | Ga0307405_11878028 | |||
| 1700 | Ga0316577_10020360 | |||
| 1701 | Ga0316577_10027058 | |||
| 1702 | Ga0307413_10140699 | |||
| 1703 | Ga0307410_10141951 | |||
| 1704 | Ga0307410_10818173 | |||
| 1705 | Ga0307406_10347719 | |||
| 1706 | Ga0307406_10353341 | |||
| 1707 | Ga0307406_10377665 | |||
| 1708 | Ga0307409_100018111 | |||
| 1709 | Ga0307409_100071986 | |||
| 1710 | Ga0307409_102040183 | |||
| 1711 | Ga0307416_100007450 | |||
| 1712 | Ga0307416_100196894 | |||
| 1713 | Ga0307416_100841999 | |||
| 1714 | Ga0307414_11050554 | |||
| 1715 | Ga0307411_10064166 | |||
| 1716 | Ga0307411_11390963 | |||
| 1717 | Ga0307415_100074170 | |||
| 1718 | Ga0307415_100587581 | |||
| 1719 | Ga0316214_1009595 | |||
| 1720 | Ga0373926_0076211 | |||
| 1721 | Ga0373926_0124657 | |||
| 1722 | Ga0373934_0002250 | |||
| 1723 | Ga0373934_0155418 | |||
| 1724 | Ga0373940_0340705 | |||
| 1725 | Ga0373944_0049227 | |||
| 1726 | Ga0373923_0008415 | |||
| 1727 | Ga0373923_0031754 | |||
| 1728 | Ga0373936_0110959 | |||
| 1729 | Ga0373936_0565896 | |||
| 1730 | Ga0373939_0506748 | |||
| 1731 | Ga0373953_0023029 | |||
| 1732 | Ga0373953_0024283 | |||
| 1733 | Ga0373953_0146798 | |||
| 1734 | Ga0373954_0027337 | |||
| 1735 | Ga0373954_0142004 | |||
| 1736 | Ga0373954_0323345 | |||
| 1737 | Ga0373954_0328195 | |||
| 1738 | Ga0373954_0450630 | |||
| 1739 | Ga0373956_0086971 | |||
| 1740 | Ga0373956_0091753 | |||
| 1741 | Ga0373956_0160498 | |||
| 1742 | Ga0373957_0083752 | |||
| 1743 | Ga0373957_0103022 | |||
| 1744 | Ga0373943_0022103 | |||
| 1745 | Ga0373943_0143454 | |||
| 1746 | Ga0373946_0064348 | |||
| 1747 | Ga0373946_0390571 | |||
| 1748 | Ga0373955_0011709 | |||
| 1749 | Ga0373955_0055758 | |||
| 1750 | Ga0373955_0889383 | |||
| 1751 | Ga0373924_0108121 | |||
| 1752 | Ga0373924_0227672 | |||
| 1753 | Ga0373931_1012677 | |||
| 1754 | Ga0373935_0003584 | |||
| 1755 | Ga0373935_0008083 | |||
| 1756 | Ga0373935_0283867 | |||
| 1757 | Ga0373927_0037285 | |||
| 1758 | Ga0373927_0060855 | |||
| 1759 | Ga0373927_0106683 | |||
| 1760 | Ga0373927_0108985 | |||
| 1761 | Ga0373927_0144335 | |||
| 1762 | Ga0373927_0595616 | |||
| 1763 | Ga0373927_0895256 | |||
| 1764 | Ga0373933_0102349 | |||
| 1765 | Ga0373933_0135705 | |||
| 1766 | Ga0373933_0292694 | |||
| 1767 | Ga0373933_0418514 | |||
| 1768 | Ga0373933_0810115 | |||
| 1769 | Ga0373947_0029255 | |||
| 1770 | Ga0373947_0113154 | |||
| 1771 | Ga0373947_0183384 | |||
| 1772 | Ga0373947_0724997 | |||
| 1773 | Ga0373947_1119030 | |||
| 1774 | Ga0373937_0007944 | |||
| 1775 | Ga0373937_0009922 | |||
| 1776 | Ga0373937_0037913 | |||
| 1777 | Ga0373937_0228267 | |||
| 1778 | Ga0373937_0230707 | |||
| 1779 | Ga0373937_0285448 | |||
| 1780 | Ga0373937_0395139 | |||
| 1781 | Ga0373937_0524726 | |||
| 1782 | Ga0373937_0535139 | |||
| 1783 | Ga0373937_0612959 | |||
| 1784 | Ga0373937_0792492 | |||
| 1785 | Ga0316582_0059782 | |||
| 1786 | Ga0316584_0008958 | |||
| 1787 | Ga0373925_0021124 | |||
| 1788 | Ga0373925_0026119 | |||
| 1789 | Ga0373925_0116921 | |||
| 1790 | Ga0373925_0160186 | |||
| 1791 | Ga0373925_0933010 | |||
| 1792 | Ga0373925_1086007 | |||
| 1793 | Ga0395905_0784054 | |||
| 1794 | Ga0316581_0002385 | |||
| 1795 | Ga0436364_0158068 | |||
| 1796 | Ga0436364_0571688 | |||
| 1797 | Ga0436364_1087871 | |||
| 1798 | Ga0436364_1520900 | |||
| 1799 | Ga0395901_0731610 | |||
| 1800 | Ga0395901_0972019 | |||
| 1801 | Ga0395901_1208229 | |||
| 1802 | Ga0237819_00257 | |||
| 1803 | Ga0436365_0186607 | |||
| 1804 | Ga0436365_1352977 | |||
| 1805 | Ga0436365_1526227 | |||
| 1806 | Ga0436360_0070677 | |||
| 1807 | Ga0436363_0599044 | |||
| 1808 | Ga0436362_0687981 | |||
| 1809 | Ga0436362_0856096 | |||
| 1810 | Ga0451577_0081828 | |||
| 1811 | Ga0453683_0002862 | |||
| 1812 | Ga0453683_0671371 | |||
| 1813 | Ga0466963_0623049 | |||
| 1814 | Ga0466963_0888651 | |||
| 1815 | Ga0453684_0259977 | |||
| 1816 | Ga0453684_1031754 | |||
| 1817 | Ga0453684_1365239 | |||
| 1818 | Ga0453684_1708142 | |||
| 1819 | Ga0466960_0036131 | |||
| 1820 | Ga0466959_0538338 | |||
| 1821 | Ga0451576_0002253 | |||
| 1822 | Ga0451576_0201670 | |||
| 1823 | Ga0451576_0787145 | |||
| 1824 | Ga0451576_0869872 | |||
| 1825 | Ga0451576_1339674 | |||
| 1826 | Ga0466958_0126509 | |||
| 1827 | Ga0466958_0284203 | |||
| 1828 | Ga0495592_0002480 | |||
| 1829 | Ga0495592_0059096 | |||
| 1830 | Ga0495592_0093255 | |||
| 1831 | Ga0495592_0130109 | |||
| 1832 | Ga0495629_0042327 | |||
| 1833 | Ga0495651_0000142 | |||
| 1834 | Ga0495651_0000738 | |||
| 1835 | Ga0495651_0044271 | |||
| 1836 | Ga0495651_0075485 | |||
| 1837 | Ga0495651_0409695 | |||
| 1838 | Ga0495651_0680561 | |||
| 1839 | Ga0495653_0037395 | |||
| 1840 | Ga0495653_0083279 | |||
| 1841 | Ga0495653_0092896 | |||
| 1842 | Ga0495580_0002963 | |||
| 1843 | Ga0495580_0008407 | |||
| 1844 | Ga0495580_0029238 | |||
| 1845 | Ga0495580_0059801 | |||
| 1846 | Ga0495580_0098411 | |||
| 1847 | Ga0495580_0142311 | |||
| 1848 | Ga0495580_0158267 | |||
| 1849 | Ga0495580_0180459 | |||
| 1850 | Ga0495580_0253995 | |||
| 1851 | Ga0495580_0347322 | |||
| 1852 | Ga0495582_0022635 | |||
| 1853 | Ga0495582_0047345 | |||
| 1854 | Ga0495582_0049298 | |||
| 1855 | Ga0495582_0384322 | |||
| 1856 | Ga0495605_0174133 | |||
| 1857 | Ga0495639_0018201 | |||
| 1858 | Ga0495639_0357164 | |||
| 1859 | Ga0495662_0004202 | |||
| 1860 | Ga0495664_0005176 | |||
| 1861 | Ga0495664_0252071 | |||
| 1862 | Ga0495594_0249716 | |||
| 1863 | Ga0495608_0017477 | |||
| 1864 | Ga0495608_0120537 | |||
| 1865 | Ga0495608_0141550 | |||
| 1866 | Ga0495608_0436851 | |||
| 1867 | Ga0495618_0080749 | |||
| 1868 | Ga0495618_0274557 | |||
| 1869 | Ga0495628_0002130 | |||
| 1870 | Ga0495628_0007182 | |||
| 1871 | Ga0495628_0034769 | |||
| 1872 | Ga0495628_0074490 | |||
| 1873 | Ga0495628_0083571 | |||
| 1874 | Ga0495628_0211930 | |||
| 1875 | Ga0495630_0015008 | |||
| 1876 | Ga0495630_0075176 | |||
| 1877 | Ga0495630_0100354 | |||
| 1878 | Ga0495630_0308867 | |||
| 1879 | Ga0495630_0332254 | |||
| 1880 | Ga0495630_0407230 | |||
| 1881 | Ga0495666_0158460 | |||
| 1882 | Ga0495666_0245043 | |||
| 1883 | Ga0495652_0012085 | |||
| 1884 | Ga0495652_0024929 | |||
| 1885 | Ga0495652_0100355 | |||
| 1886 | Ga0495652_0280667 | |||
| 1887 | Ga0495652_0291215 | |||
| 1888 | Ga0495665_0006278 | |||
| 1889 | Ga0495665_0037083 | |||
| 1890 | Ga0495665_0124988 | |||
| 1891 | Ga0495665_0133494 | |||
| 1892 | Ga0495665_0234064 | |||
| 1893 | Ga0495640_0003218 | |||
| 1894 | Ga0495640_0074856 | |||
| 1895 | Ga0495640_0080645 | |||
| 1896 | Ga0495586_0023205 | |||
| 1897 | Ga0495586_0035594 | |||
| 1898 | Ga0495586_0040405 | |||
| 1899 | Ga0495586_0106240 | |||
| 1900 | Ga0495586_0413981 | |||
| 1901 | Ga0495586_0507531 | |||
| 1902 | Ga0495587_0000996 | |||
| 1903 | Ga0495587_0003613 | |||
| 1904 | Ga0495587_0091141 | |||
| 1905 | Ga0495587_0129377 | |||
| 1906 | Ga0495587_0400088 | |||
| 1907 | Ga0495645_0002230 | |||
| 1908 | Ga0495645_0024408 | |||
| 1909 | Ga0495645_0025394 | |||
| 1910 | Ga0495645_0062331 | |||
| 1911 | Ga0495645_0172413 | |||
| 1912 | Ga0495645_0465551 | |||
| 1913 | Ga0495667_0003314 | |||
| 1914 | Ga0495667_0033012 | |||
| 1915 | Ga0495667_0035349 | |||
| 1916 | Ga0495667_0063785 | |||
| 1917 | Ga0495667_0106175 | |||
| 1918 | Ga0495667_0289784 | |||
| 1919 | Ga0495634_0048305 | |||
| 1920 | Ga0495634_0074553 | |||
| 1921 | Ga0495635_0016914 | |||
| 1922 | Ga0495635_0017033 | |||
| 1923 | Ga0495635_0029780 | |||
| 1924 | Ga0495635_0031085 | |||
| 1925 | Ga0495635_0167409 | |||
| 1926 | Ga0495657_0003623 | |||
| 1927 | Ga0495657_0015047 | |||
| 1928 | Ga0495657_0065767 | |||
| 1929 | Ga0495657_0567674 | |||
| 1930 | Ga0495599_0002263 | |||
| 1931 | Ga0495599_0046531 | |||
| 1932 | Ga0495599_0109724 | |||
| 1933 | Ga0495599_0180169 | |||
| 1934 | Ga0495623_0021497 | |||
| 1935 | Ga0495623_0091130 | |||
| 1936 | Ga0495623_0159211 | |||
| 1937 | Ga0495623_0161333 | |||
| 1938 | Ga0495646_0017362 | |||
| 1939 | Ga0495646_0025074 | |||
| 1940 | Ga0495646_0258822 | |||
| 1941 | Ga0495647_0083096 | |||
| 1942 | Ga0495658_0003568 | |||
| 1943 | Ga0495658_0142275 | |||
| 1944 | Ga0495658_0266131 | |||
| 1945 | Ga0495669_0018609 | |||
| 1946 | Ga0495613_0032585 | |||
| 1947 | Ga0495613_0177300 | |||
| 1948 | Ga0495613_0235283 | |||
| 1949 | Ga0495613_0352533 | |||
| 1950 | Ga0495613_0376786 | |||
| 1951 | Ga0495624_0042733 | |||
| 1952 | Ga0495624_0094737 | |||
| 1953 | Ga0495600_0012117 | |||
| 1954 | Ga0495600_0055361 | |||
| 1955 | Ga0495600_0145311 | |||
| 1956 | Ga0495600_0295832 | |||
| 1957 | Ga0495600_0487623 | |||
| 1958 | Ga0495581_0081687 | |||
| 1959 | Ga0495581_0196616 | |||
| 1960 | Ga0495581_0283140 | |||
| 1961 | Ga0495604_0003773 | |||
| 1962 | Ga0495604_0015747 | |||
| 1963 | Ga0495604_0025833 | |||
| 1964 | Ga0495604_0039876 | |||
| 1965 | Ga0495604_0049716 | |||
| 1966 | Ga0495604_0084045 | |||
| 1967 | Ga0495604_0148503 | |||
| 1968 | Ga0495604_0326320 | |||
| 1969 | Ga0495604_0797201 | |||
| 1970 | Ga0495674_0043126 | |||
| 1971 | Ga0495674_0087120 | |||
| 1972 | Ga0495674_0128153 | |||
| 1973 | Ga0495674_0231324 | |||
| 1974 | Ga0495674_0256992 | |||
| 1975 | Ga0495674_0333042 | |||
| 1976 | Ga0495674_0506097 | |||
| 1977 | Ga0495676_0195790 | |||
| 1978 | Ga0495680_0001389 | |||
| 1979 | Ga0495680_0006947 | |||
| 1980 | Ga0495680_0063404 | |||
| 1981 | Ga0495680_0299778 | |||
| 1982 | Ga0495680_0312475 | |||
| 1983 | Ga0495680_0569469 | |||
| 1984 | Ga0495675_0000027 | |||
| 1985 | Ga0495675_0036543 | |||
| 1986 | Ga0495675_0084867 | |||
| 1987 | Ga0495675_0108337 | |||
| 1988 | Ga0495675_0138227 | |||
| 1989 | Ga0495675_0198097 | |||
| 1990 | Ga0495675_0283664 | |||
| 1991 | Ga0495675_0288185 | |||
| 1992 | Ga0495684_0001664 | |||
| 1993 | Ga0495684_0027070 | |||
| 1994 | Ga0495684_0032393 | |||
| 1995 | Ga0495684_0048348 | |||
| 1996 | Ga0495684_0061294 | |||
| 1997 | Ga0495684_0215853 | |||
| 1998 | Ga0495684_0298357 | |||
| 1999 | Ga0495684_0361400 | |||
| 2000 | Ga0495684_0497824 | |||
| 2001 | Ga0495684_0578425 | |||
| 2002 | Ga0495684_0948637 | |||
| 2003 | Ga0495593_0029583 | |||
| 2004 | Ga0495602_0016267 | |||
| 2005 | Ga0495602_0117354 | |||
| 2006 | Ga0495602_0205128 | |||
| 2007 | Ga0495602_0571575 | |||
| 2008 | Ga0495614_0030737 | |||
| 2009 | Ga0495614_0470925 | |||
| 2010 | Ga0496100_0266033 | |||
| 2011 | Ga0496101_0050632 | |||
| 2012 | Ga0496101_0124707 | |||
| 2013 | Ga0496101_0753187 | |||
| 2014 | Ga0496102_0001855 | |||
| 2015 | Ga0496102_0015217 | |||
| 2016 | Ga0496102_0789944 | |||
| 2017 | Ga0496102_0791297 | |||
| 2018 | Ga0496103_0325240 | |||
| 2019 | Ga0496104_0048814 | |||
| 2020 | Ga0496104_0096337 | |||
| 2021 | Ga0496104_0242959 | |||
| 2022 | Ga0496104_0257788 | |||
| 2023 | Ga0496104_0377146 | |||
| 2024 | Ga0496104_0573247 | |||
| 2025 | Ga0496104_0794308 | |||
| 2026 | Ga0496105_0017445 | |||
| 2027 | Ga0496105_0240473 | |||
| 2028 | Ga0496106_0062226 | |||
| 2029 | Ga0496106_0878594 | |||
| 2030 | Ga0496107_0049551 | |||
| 2031 | Ga0496107_0260138 | |||
| 2032 | Ga0496107_1066918 | |||
| 2033 | Ga0496108_0000023 | |||
| 2034 | Ga0496108_0064034 | |||
| 2035 | Ga0496109_0007044 | |||
| 2036 | Ga0496109_0020189 | |||
| 2037 | Ga0496109_0039058 | |||
| 2038 | Ga0496109_0563195 | |||
| 2039 | Ga0496109_0900171 | |||
| 2040 | Ga0496109_1187295 | |||
| 2041 | Ga0496110_0089341 | |||
| 2042 | Ga0496110_0110333 | |||
| 2043 | Ga0496110_0239470 | |||
| 2044 | Ga0496110_0337326 | |||
| 2045 | Ga0496110_0864357 | |||
| 2046 | Ga0496111_0039135 | |||
| 2047 | Ga0496111_0948661 | |||
| 2048 | Ga0496112_0018511 | |||
| 2049 | Ga0496112_0051649 | |||
| 2050 | Ga0496112_0087811 | |||
| 2051 | Ga0496113_0003630 | |||
| 2052 | Ga0496113_0008760 | |||
| 2053 | Ga0496113_1222332 | |||
| 2054 | Ga0496114_0083288 | |||
| 2055 | Ga0496115_0003887 | |||
| 2056 | Ga0496115_0009647 | |||
| 2057 | Ga0496115_0065104 | |||
| 2058 | Ga0496115_0102547 | |||
| 2059 | Ga0496115_0141122 | |||
| 2060 | Ga0496115_1468003 | |||
| 2061 | Ga0496119_0083333 | |||
| 2062 | Ga0496126_0035643 | |||
| 2063 | Ga0496126_0997129 | |||
| 2064 | Ga0501040_0159936 | |||
| 2065 | Ga0501040_0623311 | |||
| 2066 | Ga0501041_0092465 | |||
| 2067 | Ga0501042_0086739 | |||
| 2068 | Ga0501046_0542766 | |||
| 2069 | Ga0501048_0291263 | |||
| 2070 | Ga0501070_0904588 | |||
| 2071 | Ga0501071_0006921 | |||
| 2072 | Ga0501075_0230192 | |||
| 2073 | Ga0501076_0322278 | |||
| 2074 | Ga0501209_285722 | |||
| 2075 | Ga0501216_070093 | |||
| 2076 | Ga0501233_256974 | |||
| 2077 | Ga0501253_053429 | |||
| 2078 | Ga0501257_085556 | |||
| 2079 | Ga0501079_0067835 | |||
| 2080 | Ga0501045_0434668 | |||
| 2081 | nmdc:mga05p37_1761964_c1 | |||
| 2082 | nmdc:mga05p37_2027_c1 | |||
| 2083 | nmdc:mga05p37_471620_c1 | |||
| 2084 | nmdc:mga05p37_515768_c1 | |||
| 2085 | nmdc:mga05p37_607564_c1 | |||
| 2086 | nmdc:mga05p37_627276_c1 | |||
| 2087 | nmdc:mga05p37_719617_c1 | |||
| 2088 | nmdc:mga05p37_814509_c1 | |||
| 2089 | nmdc:mga0qj67_250611_c1 | |||
| 2090 | nmdc:mga0qj67_49405_c1 | |||
| 2091 | nmdc:mga06r32_199346_c1 | |||
| 2092 | nmdc:mga06r32_208987_c1 | |||
| 2093 | nmdc:mga06r32_303317_c1 | |||
| 2094 | nmdc:mga0n895_27838_c1 | |||
| 2095 | nmdc:mga0n895_533000_c1 | |||
| 2096 | nmdc:mga0n895_86741_c1 | |||
| 2097 | nmdc:mga0rr50_120778_c1 | |||
| 2098 | nmdc:mga0rr50_31205_c1 | |||
| 2099 | nmdc:mga08x19_950244_c1 | |||
| 2100 | nmdc:mga0a205_11560_c1 | |||
| 2101 | nmdc:mga0a205_240459_c1 | |||
| 2102 | nmdc:mga0a205_56593_c1 | |||
| 2103 | nmdc:mga0a205_795089_c1 | |||
| 2104 | Ga0495601_0486419 | |||
| 2105 | Ga0495612_0032801 | |||
| 2106 | Ga0495612_0386941 | |||
| 2107 | Ga0495619_0016662 | |||
| 2108 | Ga0495619_0707732 | |||
| 2109 | Ga0495619_0849292 | |||
| 2110 | Ga0495619_1025648 | |||
| 2111 | Ga0500577_0013890 | |||
| 2112 | Ga0501084_0023317 | |||
| 2113 | Ga0501084_1188506 | |||
| 2114 | Ga0530510_0129790 | |||
| 2115 | 2600226333 | |||
| 2116 | 2819712423 | |||
| 2117 | 2928526933 | |||
| 2118 | 2928969462 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ohd-assembly1.cif.gz_D | crystal structure of hypothetical molybdenum cofactor biosynthesis protein c from sulfolobus tokodaii | 0.9867 | 13 | 143 |
| 4fdf-assembly1.cif.gz_B | structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv | 0.9822 | 12 | 155 |
| 4fdf-assembly1.cif.gz_B | structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv | 0.9753 | 12 | 155 |
| 4fdf-assembly1.cif.gz_A | structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv | 0.9752 | 11 | 145 |
| 2ekn-assembly1.cif.gz_A | structure of ph1811 protein from pyrococcus horikoshii | 0.9751 | 12 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FJH5_64_220_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9868 | 4 | 155 | 3.30.70.640 |
| af_P9WJR7_13_167_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9836 | 3 | 155 | 3.30.70.640 |
| 4fdfA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9752 | 11 | 145 | 3.30.70.640 |
| af_Q20624_440_595_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9742 | 4 | 155 | 3.30.70.640 |
| 2ohdB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9739 | 13 | 143 | 3.30.70.640 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5ZGQ7-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 1.001 | 15 | 155 |
GO:0006777
GO:0061799 |
| AF-A0A0C9N681-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.9998 | 15 | 155 |
GO:0006777
GO:0061799 |
| AF-A0A534PQE0-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.998 | 15 | 155 |
GO:0006777
GO:0061799 |
| AF-A0A7C1Z3Q1-F1-model_v4 | Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) | 0.9978 | 15 | 146 |
GO:0006777
GO:0061798 GO:0061799 |
| AF-A0A6G8PVM2-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.9978 | 15 | 146 |
GO:0006777
GO:0061799 |