F489252

General Info

Members Datasets Scaffolds Average Seq Length
1059 432 2119 348

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000033|Ga0395899_0000033_33867_35015
Length 382
Sequence MSLRGGTTKQPHRVQYQSDEIATLSLEMTQSTNETMFSINNIIRKNIANLTPYSSARDEFQGEASVYLDANENAFGSPLEQQYNRYPDPLQYKVKKRLSEIKGVPPRNIFLGNGSDEAIDILFRSFCNPGVDNVILVPPTYGMYEVSANINDIQIKKVKLTEEYQLNLEGIAEAIDEHTKMIFVCSPNNPTGNSINRDDIETLLANFNGLIVIDEAYINFSRQKSFIQELTEYANLVVLQTLSKAWGLAGLRVGMAFASEEIIEVMNKVKPPYNINEASQDLALKALENVDQVNQWIREILNQRDRLVLTLKNFDFVQDIYPSDANFILVKTTAPKDIYNFLVDKGIIVRDRSKVDLCEGCLRITVGTPAENDVLLEALGKF

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
208 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
209 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
243 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
287 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
320 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
321 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
322 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
323 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
326 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
327 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
328 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
329 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
332 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
343 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
344 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
350 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
351 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
352 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
358 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
359 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
360 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
361 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
362 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
363 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
364 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
365 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
366 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
367 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
368 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
369 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
370 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
371 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
372 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
373 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
374 2738541283 Pedobacter sp. OK701 Isolate Unclassified
375 2738541284 Pedobacter sp. YR016 Isolate Unclassified
376 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
377 2738541302 Pedobacter sp. CF074 Isolate Unclassified
378 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
379 2738543023 Pedobacter sp. OK628 Isolate Unclassified
380 2739367651 Pedobacter sp. OK291 Isolate Unclassified
381 2739367656 Pedobacter sp. CF523 Isolate Unclassified
382 2739367663 Pedobacter sp. YR510 Isolate Unclassified
383 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
384 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
385 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
386 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
387 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
388 2818991437 Pedobacter terrae 518 Isolate Unclassified
389 2818991444 Filimonas endophytica 3197 Isolate Unclassified
390 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
391 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
392 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
393 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
394 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
395 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
396 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
397 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
398 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
399 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
400 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
401 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
402 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
403 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
404 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
405 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
406 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
407 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
408 2914759650 Rhizosphaericola mali Isolate Rhizosphere
409 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
410 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
411 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
412 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
413 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
414 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
415 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
416 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
417 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
418 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
419 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
420 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
421 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
422 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
423 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
424 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
425 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
426 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
427 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
428 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
429 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
430 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
431 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
432 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 0.09
Isolates 6.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.04
Nodule 0.38
Rhizoplane 0.57
Rhizosphere 84.04
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000033 3300037312 Bacteria 306589
2 SwRhRL2b_contig_787417 2162886007 Bacteria 8367
3 JGI24736J21556_1003139 3300001904 Bacteria 2878
4 JGI24740J21852_10020774 3300001979 Bacteria 2284
5 JGI24737J22298_10007120 3300001990 Bacteria 3790
6 JGI24735J21928_10000004 3300002067 Bacteria 381713
7 JGI25162J39368_1000011 3300002737 Bacteria 379156
8 JGI25162J39368_1000614 3300002737 Bacteria 25616
9 JGI25154J39366_1000040 3300002738 Bacteria 147410
10 JGI25157J39369_1003731 3300002741 Bacteria 3001
11 JGI25157J39369_1004254 3300002741 Bacteria 2655
12 JGI25164J39214_1003371 3300002772 Bacteria 2048
13 JGI25152J39213_1000143 3300002773 Bacteria 48715
14 JGI25150J39212_1000001 3300002774 Bacteria 1318726
15 JGI25151J46595_10000001 3300003187 Bacteria 887211
16 JGI25165J46597_1000985 3300003214 Bacteria 19074
17 JGI25153J46596_10000001 3300003215 Bacteria 748985
18 JGI25153J46596_10003346 3300003215 Bacteria 9003
19 rootH1_10024829 3300003316 Bacteria 25564
20 rootH1_10063239 3300003316 Bacteria 6361
21 rootH1_10140822 3300003316 Bacteria 2510
22 rootH2_10001891 3300003320 Bacteria 464318
23 rootH2_10003679 3300003320 Bacteria 27278
24 rootH2_10013742 3300003320 Bacteria 11980
25 rootH2_10053227 3300003320 Bacteria 9083
26 rootH2_10090920 3300003320 Bacteria 6366
27 rootH2_10184838 3300003320 Bacteria 1249
28 rootL2_10017790 3300003322 Bacteria 3190
29 rootL2_10028141 3300003322 Bacteria 3723
30 rootL2_10030620 3300003322 Bacteria 1870
31 rootL2_10058669 3300003322 Bacteria 5201
32 rootL2_10107720 3300003322 Bacteria 5516
33 rootL2_10223865 3300003322 Bacteria 3144
34 rootL2_10315621 3300003322 Bacteria 2427
35 rootH1_10000019 3300003316 Bacteria 18606
36 rootH1_10000019 3300003323 Bacteria 34919
37 rootH1_10008801 3300003323 Bacteria 13652
38 rootH1_10035284 3300003323 Bacteria 47456
39 rootH1_10054491 3300003323 Bacteria 2542
40 rootH1_10163486 3300003323 Bacteria 2011
41 rootH1_10178453 3300003323 Bacteria 2808
42 rootH1_10298335 3300003323 Unclassified 3330
43 JGI25160J50197_1006644 3300003354 Bacteria 4654
44 Ga0006562J51391_1016454 3300003578 Bacteria 2028
45 Ga0055536_1000001 3300003781 Bacteria 630663
46 Ga0055530_10004772 3300003791 Bacteria 6816
47 Ga0055531_10000131 3300003794 Bacteria 85257
48 Ga0065165_1000300 3300005262 Bacteria 83016
49 Ga0065714_10003545 3300005288 Bacteria 7328
50 Ga0065714_10004089 3300005288 Bacteria 9774
51 Ga0065714_10010706 3300005288 Bacteria 2645
52 Ga0065714_10064863 3300005288 Bacteria 16719
53 Ga0065714_10067358 3300005288 Bacteria 5607
54 Ga0065714_10099861 3300005288 Bacteria 1665
55 Ga0065714_10107284 3300005288 Bacteria 1534
56 Ga0065714_10109461 3300005288 Bacteria 1500
57 Ga0065704_10000210 3300005289 Bacteria 93612
58 Ga0065704_10083999 3300005289 Bacteria 3388
59 Ga0065712_10008583 3300005290 Bacteria 3168
60 Ga0065712_10124654 3300005290 Bacteria 1616
61 Ga0065715_10004221 3300005293 Bacteria 4062
62 Ga0070658_10000049 3300005327 Bacteria 119985
63 Ga0070658_10031135 3300005327 Bacteria 4284
64 Ga0070658_10101229 3300005327 Bacteria 2382
65 Ga0070676_10000336 3300005328 Bacteria 21357
66 Ga0070676_10026339 3300005328 Bacteria 3292
67 Ga0070683_100030965 3300005329 Bacteria 4862
68 Ga0070683_100032467 3300005329 Bacteria 4755
69 Ga0070683_100067205 3300005329 Bacteria 3339
70 Ga0070690_100012862 3300005330 Bacteria 4931
71 Ga0070670_100033933 3300005331 Bacteria 4393
72 Ga0070670_100034230 3300005331 Bacteria 4372
73 Ga0070670_100086541 3300005331 Bacteria 2693
74 Ga0070670_100181544 3300005331 Bacteria 1827
75 Ga0070670_100435816 3300005331 Unclassified 1160
76 Ga0070677_10014143 3300005333 Bacteria 2803
77 Ga0068869_100039400 3300005334 Bacteria 3373
78 Ga0070666_10002847 3300005335 Bacteria 10454
79 Ga0070666_10056865 3300005335 Unclassified 2643
80 Ga0070680_100015517 3300005336 Bacteria 5975
81 Ga0070680_100171020 3300005336 Unclassified 1828
82 Ga0070682_100001275 3300005337 Bacteria 14290
83 Ga0070682_100119478 3300005337 Unclassified 1767
84 Ga0070682_100241275 3300005337 Bacteria 1297
85 Ga0068868_100004138 3300005338 Bacteria 10140
86 Ga0068868_100008530 3300005338 Bacteria 7338
87 Ga0068868_100011418 3300005338 Bacteria 6469
88 Ga0068868_100015143 3300005338 Bacteria 5698
89 Ga0068868_100020344 3300005338 Bacteria 4985
90 Ga0070660_100027944 3300005339 Bacteria 4216
91 Ga0070660_100043577 3300005339 Bacteria 3430
92 Ga0070660_100171259 3300005339 Bacteria 1754
93 Ga0070691_10004326 3300005341 Bacteria 6456
94 Ga0070661_100023944 3300005344 Bacteria 4380
95 Ga0070661_100043909 3300005344 Unclassified 3265
96 Ga0070668_100004446 3300005347 Bacteria 10401
97 Ga0070669_100018155 3300005353 Bacteria 5025
98 Ga0070675_100015326 3300005354 Bacteria 6059
99 Ga0070675_100016332 3300005354 Bacteria 5890
100 Ga0070675_100027340 3300005354 Bacteria 4582
101 Ga0070675_100044109 3300005354 Bacteria 3647
102 Ga0070675_100268887 3300005354 Bacteria 1495
103 Ga0070671_100046891 3300005355 Bacteria 3594
104 Ga0070671_100159729 3300005355 Unclassified 1905
105 Ga0070673_100004993 3300005364 Bacteria 8460
106 Ga0070673_100016856 3300005364 Bacteria 5179
107 Ga0070673_100026479 3300005364 Bacteria 4283
108 Ga0070673_100035251 3300005364 Bacteria 3793
109 Ga0070688_100001700 3300005365 Bacteria 10987
110 Ga0070659_100006699 3300005366 Bacteria 8329
111 Ga0070659_100047474 3300005366 Bacteria 3368
112 Ga0070659_100069713 3300005366 Bacteria 2791
113 Ga0070659_100244848 3300005366 Unclassified 1485
114 Ga0070667_100000492 3300005367 Bacteria 40164
115 Ga0070667_100001349 3300005367 Bacteria 22023
116 Ga0070667_100048526 3300005367 Bacteria 3574
117 Ga0070663_100001195 3300005455 Bacteria 14271
118 Ga0070663_100081084 3300005455 Unclassified 2384
119 Ga0070663_100271155 3300005455 Bacteria 1349
120 Ga0070678_100001813 3300005456 Bacteria 11512
121 Ga0070678_100107493 3300005456 Unclassified 2176
122 Ga0070662_100000045 3300005457 Bacteria 67900
123 Ga0070662_100025109 3300005457 Bacteria 4112
124 Ga0070662_100096983 3300005457 Bacteria 2225
125 Ga0070681_10018316 3300005458 Bacteria 6999
126 Ga0070681_10029313 3300005458 Bacteria 5526
127 Ga0070681_10040763 3300005458 Bacteria 4652
128 Ga0068867_100004573 3300005459 Bacteria 9730
129 Ga0068867_100036004 3300005459 Bacteria 3591
130 Ga0068867_100060265 3300005459 Unclassified 2815
131 Ga0068867_100333504 3300005459 Unclassified 1260
132 Ga0070685_10002206 3300005466 Bacteria 10050
133 Ga0070685_10005910 3300005466 Bacteria 6227
134 Ga0070685_10027809 3300005466 Bacteria 3129
135 Ga0070685_10077516 3300005466 Bacteria 1984
136 Ga0070679_100004536 3300005530 Bacteria 12825
137 Ga0070679_100006277 3300005530 Bacteria 11066
138 Ga0070679_100008873 3300005530 Bacteria 9490
139 Ga0070679_100127028 3300005530 Bacteria 2532
140 Ga0070684_100035368 3300005535 Bacteria 4275
141 Ga0070684_100042359 3300005535 Bacteria 3930
142 Ga0070684_100127303 3300005535 Bacteria 2295
143 Ga0070684_100132672 3300005535 Unclassified 2247
144 Ga0068853_100003018 3300005539 Bacteria 12852
145 Ga0068853_100008065 3300005539 Bacteria 8446
146 Ga0068853_100008667 3300005539 Bacteria 8178
147 Ga0068853_100013120 3300005539 Bacteria 6761
148 Ga0068853_100022472 3300005539 Bacteria 5268
149 Ga0068853_100057348 3300005539 Bacteria 3361
150 Ga0068853_100139186 3300005539 Bacteria 2178
151 Ga0068853_100301937 3300005539 Bacteria 1480
152 Ga0070672_100001489 3300005543 Bacteria 14544
153 Ga0070672_100055232 3300005543 Bacteria 3111
154 Ga0070672_100083317 3300005543 Bacteria 2566
155 Ga0070672_100090358 3300005543 Unclassified 2469
156 Ga0070672_100156349 3300005543 Bacteria 1889
157 Ga0070686_100032891 3300005544 Bacteria 3183
158 Ga0070686_100073191 3300005544 Unclassified 2249
159 Ga0070686_100280374 3300005544 Bacteria 1229
160 Ga0070693_100003483 3300005547 Bacteria 7347
161 Ga0070693_100179055 3300005547 Bacteria 1364
162 Ga0070665_100000020 3300005548 Bacteria 389687
163 Ga0070665_100016967 3300005548 Bacteria 7300
164 Ga0070665_100043231 3300005548 Bacteria 4528
165 Ga0068855_100000240 3300005563 Bacteria 69408
166 Ga0068855_100000346 3300005563 Bacteria 57719
167 Ga0068855_100005837 3300005563 Bacteria 15028
168 Ga0068855_100008169 3300005563 Bacteria 12653
169 Ga0068855_100022866 3300005563 Bacteria 7493
170 Ga0068855_100024060 3300005563 Bacteria 7292
171 Ga0068855_100026080 3300005563 Bacteria 6991
172 Ga0068855_100032308 3300005563 Bacteria 6251
173 Ga0068855_100035811 3300005563 Bacteria 5911
174 Ga0068855_100047040 3300005563 Bacteria 5098
175 Ga0068855_100062842 3300005563 Bacteria 4334
176 Ga0068855_100070659 3300005563 Bacteria 4061
177 Ga0068855_100071810 3300005563 Bacteria 4024
178 Ga0070664_100192898 3300005564 Unclassified 1815
179 Ga0070664_100244621 3300005564 Unclassified 1611
180 Ga0068857_100007822 3300005577 Bacteria 9217
181 Ga0068857_100008143 3300005577 Bacteria 9051
182 Ga0068857_100019055 3300005577 Bacteria 6022
183 Ga0068857_100037750 3300005577 Bacteria 4280
184 Ga0068857_100209964 3300005577 Bacteria 1776
185 Ga0068854_100036735 3300005578 Bacteria 3436
186 Ga0068854_100051761 3300005578 Bacteria 2943
187 Ga0068854_100184752 3300005578 Unclassified 1630
188 Ga0068856_100000835 3300005614 Bacteria 33215
189 Ga0068856_100010959 3300005614 Bacteria 8800
190 Ga0068856_100017673 3300005614 Bacteria 6914
191 Ga0068856_100041561 3300005614 Bacteria 4519
192 Ga0068856_100050057 3300005614 Bacteria 4118
193 Ga0068856_100072662 3300005614 Bacteria 3405
194 Ga0068856_100207105 3300005614 Bacteria 1976
195 Ga0068852_100001345 3300005616 Bacteria 16491
196 Ga0068852_100003445 3300005616 Bacteria 11058
197 Ga0068852_100083617 3300005616 Bacteria 2838
198 Ga0068852_100151779 3300005616 Bacteria 2155
199 Ga0068852_100227662 3300005616 Unclassified 1776
200 Ga0068852_100362436 3300005616 Bacteria 1418
201 Ga0068859_100019039 3300005617 Bacteria 6894
202 Ga0068859_100222016 3300005617 Unclassified 1977
203 Ga0068864_100005800 3300005618 Bacteria 10131
204 Ga0068866_10011575 3300005718 Bacteria 3821
205 Ga0068861_100276800 3300005719 Bacteria 1443
206 Ga0068851_10015604 3300005834 Bacteria 3621
207 Ga0068851_10047333 3300005834 Unclassified 2178
208 Ga0068870_10028107 3300005840 Bacteria 2820
209 Ga0068870_10142332 3300005840 Bacteria 1404
210 Ga0068863_100000412 3300005841 Bacteria 43521
211 Ga0068863_100032411 3300005841 Bacteria 4981
212 Ga0068863_100077889 3300005841 Bacteria 3138
213 Ga0068863_100089741 3300005841 Bacteria 2915
214 Ga0068858_100342504 3300005842 Bacteria 1431
215 Ga0068860_100000916 3300005843 Bacteria 32698
216 Ga0068860_100081090 3300005843 Bacteria 3085
217 Ga0068860_100186633 3300005843 Bacteria 2005
218 Ga0068862_100155708 3300005844 Bacteria 2037
219 Ga0068862_100377924 3300005844 Bacteria 1321
220 Ga0081540_1037226 3300005983 Bacteria 2582
221 Ga0075366_10005218 3300006195 Bacteria 7031
222 Ga0075366_10006027 3300006195 Bacteria 6604
223 Ga0075366_10019255 3300006195 Bacteria 3946
224 Ga0075366_10020069 3300006195 Bacteria 3875
225 Ga0075366_10074534 3300006195 Bacteria 2024
226 Ga0097621_100002086 3300006237 Bacteria 13691
227 Ga0097621_100018421 3300006237 Bacteria 5333
228 Ga0097621_100022179 3300006237 Bacteria 4926
229 Ga0097621_100051361 3300006237 Unclassified 3355
230 Ga0097621_100093559 3300006237 Unclassified 2519
231 Ga0097621_100164744 3300006237 Unclassified 1908
232 Ga0068871_100000100 3300006358 Bacteria 51253
233 Ga0068871_100312735 3300006358 Bacteria 1381
234 Ga0075428_100017721 3300006844 Bacteria 7870
235 Ga0075428_100050469 3300006844 Bacteria 4562
236 Ga0075431_100030371 3300006847 Bacteria 5566
237 Ga0075431_100118749 3300006847 Unclassified 2729
238 Ga0075434_100105830 3300006871 Bacteria 2823
239 Ga0075429_100018092 3300006880 Bacteria 6097
240 Ga0068865_100000174 3300006881 Bacteria 35630
241 Ga0068865_100003461 3300006881 Bacteria 9457
242 Ga0068865_100028117 3300006881 Bacteria 3721
243 Ga0068865_100077970 3300006881 Bacteria 2369
244 Ga0068865_100103533 3300006881 Unclassified 2088
245 Ga0097620_100019038 3300006931 Bacteria 6894
246 Ga0097620_100222010 3300006931 Unclassified 1977
247 Ga0079104_1000005 3300006946 Bacteria 407099
248 Ga0099826_10126639 3300006948 Bacteria 1496
249 Ga0105251_10086058 3300009011 Unclassified 1448
250 Ga0105244_10000063 3300009036 Bacteria 122746
251 Ga0105244_10098006 3300009036 Bacteria 1436
252 Ga0105250_10040141 3300009092 Bacteria 1877
253 Ga0105240_10000074 3300009093 Bacteria 199611
254 Ga0105240_10000237 3300009093 Bacteria 109895
255 Ga0105240_10000598 3300009093 Bacteria 67006
256 Ga0105240_10000626 3300009093 Bacteria 65179
257 Ga0105240_10001351 3300009093 Bacteria 42091
258 Ga0105240_10001595 3300009093 Bacteria 38516
259 Ga0105240_10007062 3300009093 Bacteria 16373
260 Ga0105240_10008151 3300009093 Bacteria 15026
261 Ga0105240_10022028 3300009093 Bacteria 8460
262 Ga0105240_10045715 3300009093 Bacteria 5553
263 Ga0105240_10066229 3300009093 Bacteria 4482
264 Ga0105240_10084727 3300009093 Bacteria 3886
265 Ga0105240_10096537 3300009093 Bacteria 3602
266 Ga0105240_10108377 3300009093 Bacteria 3365
267 Ga0105240_10126815 3300009093 Bacteria 3066
268 Ga0105240_10261192 3300009093 Bacteria 1997
269 Ga0105240_10349622 3300009093 Unclassified 1677
270 Ga0111539_10034093 3300009094 Bacteria 6176
271 Ga0105245_10114265 3300009098 Bacteria 2514
272 Ga0114129_10033962 3300009147 Bacteria 7205
273 Ga0105241_10000086 3300009174 Bacteria 69935
274 Ga0105241_10000659 3300009174 Bacteria 25872
275 Ga0105241_10005221 3300009174 Bacteria 9592
276 Ga0105241_10042948 3300009174 Bacteria 3423
277 Ga0105241_10057228 3300009174 Bacteria 2990
278 Ga0105241_10170979 3300009174 Bacteria 1795
279 Ga0105241_10284031 3300009174 Bacteria 1414
280 Ga0105242_10009407 3300009176 Bacteria 7494
281 Ga0105242_10015906 3300009176 Bacteria 5846
282 Ga0105242_10066597 3300009176 Bacteria 2975
283 Ga0105248_10570485 3300009177 Unclassified 1277
284 Ga0105237_10000224 3300009545 Bacteria 79854
285 Ga0105237_10001565 3300009545 Bacteria 29826
286 Ga0105237_10003647 3300009545 Bacteria 18154
287 Ga0105237_10004072 3300009545 Bacteria 17045
288 Ga0105237_10009395 3300009545 Bacteria 10472
289 Ga0105237_10018293 3300009545 Bacteria 7252
290 Ga0105237_10028286 3300009545 Bacteria 5712
291 Ga0105237_10036976 3300009545 Bacteria 4937
292 Ga0105237_10057618 3300009545 Bacteria 3887
293 Ga0105237_10059488 3300009545 Bacteria 3822
294 Ga0105237_10067260 3300009545 Bacteria 3577
295 Ga0105237_10140408 3300009545 Bacteria 2410
296 Ga0105237_10193118 3300009545 Bacteria 2036
297 Ga0105237_10196753 3300009545 Bacteria 2016
298 Ga0105237_10264291 3300009545 Bacteria 1724
299 Ga0105237_10285413 3300009545 Unclassified 1653
300 Ga0105237_10397595 3300009545 Bacteria 1383
301 Ga0105238_10001132 3300009551 Bacteria 26885
302 Ga0105238_10052663 3300009551 Bacteria 4091
303 Ga0105238_10097033 3300009551 Bacteria 2934
304 Ga0105249_10005103 3300009553 Bacteria 11318
305 Ga0105249_10005252 3300009553 Bacteria 11181
306 Ga0105249_10008737 3300009553 Bacteria 8837
307 Ga0105249_10055248 3300009553 Unclassified 3632
308 Ga0105249_10079798 3300009553 Bacteria 3039
309 Ga0105249_10148121 3300009553 Bacteria 2257
310 Ga0105249_10203305 3300009553 Bacteria 1939
311 Ga0105249_10461435 3300009553 Bacteria 1310
312 Ga0105239_10000002 3300010375 Bacteria 610298
313 Ga0105239_10000048 3300010375 Bacteria 177855
314 Ga0105239_10000758 3300010375 Bacteria 45640
315 Ga0105239_10001789 3300010375 Bacteria 28284
316 Ga0105239_10001948 3300010375 Bacteria 26930
317 Ga0105239_10002090 3300010375 Bacteria 25893
318 Ga0105239_10002752 3300010375 Bacteria 22079
319 Ga0105239_10005094 3300010375 Bacteria 15518
320 Ga0105239_10008918 3300010375 Bacteria 11347
321 Ga0105239_10016195 3300010375 Bacteria 8248
322 Ga0105239_10024710 3300010375 Bacteria 6618
323 Ga0105239_10039298 3300010375 Bacteria 5184
324 Ga0105239_10045406 3300010375 Bacteria 4815
325 Ga0105239_10078015 3300010375 Bacteria 3645
326 Ga0105239_10087796 3300010375 Bacteria 3429
327 Ga0105239_10121599 3300010375 Unclassified 2900
328 Ga0105239_10166914 3300010375 Unclassified 2462
329 Ga0105246_10028028 3300011119 Bacteria 3697
330 Ga0105246_10053815 3300011119 Bacteria 2771
331 Ga0105246_10249830 3300011119 Bacteria 1407
332 Ga0157373_10000002 3300013100 Bacteria 750094
333 Ga0157373_10000821 3300013100 Bacteria 24074
334 Ga0157373_10002581 3300013100 Bacteria 13752
335 Ga0157373_10019401 3300013100 Bacteria 4948
336 Ga0157373_10020933 3300013100 Bacteria 4749
337 Ga0157373_10092748 3300013100 Bacteria 2127
338 Ga0157373_10097891 3300013100 Bacteria 2065
339 Ga0157371_10000016 3300013102 Bacteria 330495
340 Ga0157371_10000135 3300013102 Bacteria 107607
341 Ga0157371_10000563 3300013102 Bacteria 43940
342 Ga0157371_10001161 3300013102 Bacteria 28350
343 Ga0157371_10001915 3300013102 Bacteria 20795
344 Ga0157371_10003683 3300013102 Bacteria 13759
345 Ga0157371_10005312 3300013102 Bacteria 10902
346 Ga0157371_10009984 3300013102 Bacteria 7430
347 Ga0157371_10018424 3300013102 Bacteria 5163
348 Ga0157371_10034813 3300013102 Bacteria 3611
349 Ga0157371_10077958 3300013102 Bacteria 2347
350 Ga0157370_10000500 3300013104 Bacteria 48866
351 Ga0157370_10001022 3300013104 Bacteria 35238
352 Ga0157370_10001166 3300013104 Bacteria 32718
353 Ga0157370_10005338 3300013104 Bacteria 14435
354 Ga0157370_10006435 3300013104 Bacteria 12959
355 Ga0157370_10007484 3300013104 Bacteria 11861
356 Ga0157370_10010727 3300013104 Bacteria 9634
357 Ga0157370_10014206 3300013104 Bacteria 8159
358 Ga0157370_10014665 3300013104 Bacteria 8007
359 Ga0157370_10017596 3300013104 Bacteria 7210
360 Ga0157370_10031451 3300013104 Bacteria 5191
361 Ga0157370_10036413 3300013104 Bacteria 4774
362 Ga0157370_10039822 3300013104 Bacteria 4539
363 Ga0157370_10262108 3300013104 Bacteria 1597
364 Ga0157369_10000475 3300013105 Bacteria 53219
365 Ga0157369_10001138 3300013105 Bacteria 33208
366 Ga0157369_10046098 3300013105 Bacteria 4739
367 Ga0157369_10051032 3300013105 Bacteria 4478
368 Ga0157369_10057127 3300013105 Bacteria 4211
369 Ga0157369_10081875 3300013105 Bacteria 3454
370 Ga0157369_10086419 3300013105 Bacteria 3349
371 Ga0157369_10117845 3300013105 Bacteria 2818
372 Ga0157369_10159155 3300013105 Bacteria 2384
373 Ga0157369_10231674 3300013105 Bacteria 1931
374 Ga0157374_10000001 3300013296 Bacteria 1077351
375 Ga0157374_10000128 3300013296 Bacteria 69753
376 Ga0157374_10000202 3300013296 Bacteria 54739
377 Ga0157374_10004614 3300013296 Bacteria 11557
378 Ga0157374_10028575 3300013296 Bacteria 5039
379 Ga0157374_10034089 3300013296 Bacteria 4648
380 Ga0157374_10051367 3300013296 Bacteria 3836
381 Ga0157374_10054818 3300013296 Bacteria 3720
382 Ga0157374_10099620 3300013296 Bacteria 2784
383 Ga0157374_10297505 3300013296 Bacteria 1596
384 Ga0157374_10492119 3300013296 Bacteria 1230
385 Ga0157378_10005717 3300013297 Bacteria 10884
386 Ga0157378_10005849 3300013297 Bacteria 10778
387 Ga0157378_10010586 3300013297 Bacteria 8059
388 Ga0157378_10043948 3300013297 Bacteria 3966
389 Ga0157378_10107269 3300013297 Bacteria 2556
390 Ga0157378_10260343 3300013297 Bacteria 1664
391 Ga0157378_10290658 3300013297 Bacteria 1579
392 Ga0163162_10000032 3300013306 Bacteria 156609
393 Ga0163162_10000152 3300013306 Bacteria 64273
394 Ga0163162_10009046 3300013306 Bacteria 9683
395 Ga0163162_10011763 3300013306 Bacteria 8536
396 Ga0163162_10015657 3300013306 Bacteria 7411
397 Ga0163162_10016026 3300013306 Bacteria 7325
398 Ga0163162_10029333 3300013306 Bacteria 5444
399 Ga0163162_10052936 3300013306 Bacteria 4079
400 Ga0163162_10054110 3300013306 Bacteria 4036
401 Ga0163162_10095248 3300013306 Unclassified 3063
402 Ga0163162_10295516 3300013306 Bacteria 1752
403 Ga0163162_10459650 3300013306 Bacteria 1404
404 Ga0157372_10000017 3300013307 Bacteria 219543
405 Ga0157372_10000061 3300013307 Bacteria 119814
406 Ga0157372_10000921 3300013307 Bacteria 32008
407 Ga0157372_10003385 3300013307 Bacteria 17204
408 Ga0157372_10004228 3300013307 Bacteria 15351
409 Ga0157372_10018588 3300013307 Bacteria 7477
410 Ga0157372_10020418 3300013307 Bacteria 7146
411 Ga0157372_10142889 3300013307 Bacteria 2759
412 Ga0157372_10151540 3300013307 Bacteria 2677
413 Ga0157372_10166690 3300013307 Bacteria 2548
414 Ga0157372_10207727 3300013307 Bacteria 2269
415 Ga0157375_10037080 3300013308 Bacteria 4668
416 Ga0157375_10040512 3300013308 Bacteria 4490
417 Ga0157375_10045096 3300013308 Unclassified 4290
418 Ga0157375_10045413 3300013308 Bacteria 4275
419 Ga0157375_10123056 3300013308 Unclassified 2706
420 Ga0157375_10174141 3300013308 Bacteria 2301
421 Ga0157375_10202478 3300013308 Bacteria 2141
422 Ga0157375_10205722 3300013308 Bacteria 2124
423 Ga0157375_10480579 3300013308 Bacteria 1407
424 Ga0157375_10578419 3300013308 Bacteria 1283
425 Ga0163163_10000653 3300014325 Bacteria 29691
426 Ga0163163_10195869 3300014325 Bacteria 2069
427 Ga0163163_10403595 3300014325 Unclassified 1425
428 Ga0157380_10162904 3300014326 Bacteria 1940
429 Ga0157380_10168749 3300014326 Bacteria 1909
430 Ga0157380_10234046 3300014326 Bacteria 1652
431 Ga0182008_10000006 3300014497 Bacteria 378521
432 Ga0182008_10000818 3300014497 Bacteria 21712
433 Ga0182008_10001192 3300014497 Bacteria 17914
434 Ga0157379_10001301 3300014968 Bacteria 20316
435 Ga0157379_10180015 3300014968 Unclassified 1910
436 Ga0157379_10206039 3300014968 Unclassified 1779
437 Ga0157376_10000721 3300014969 Bacteria 21396
438 Ga0157376_10001279 3300014969 Bacteria 16546
439 Ga0157376_10008360 3300014969 Bacteria 7464
440 Ga0157376_10025181 3300014969 Bacteria 4683
441 Ga0157376_10037767 3300014969 Bacteria 3925
442 Ga0157376_10055030 3300014969 Bacteria 3319
443 Ga0157376_10067496 3300014969 Unclassified 3025
444 Ga0182006_1000011 3300015261 Bacteria 408647
445 Ga0182006_1000068 3300015261 Bacteria 144823
446 Ga0182006_1000869 3300015261 Bacteria 20275
447 Ga0182006_1001882 3300015261 Bacteria 11983
448 Ga0182006_1003367 3300015261 Bacteria 8215
449 Ga0182007_10000003 3300015262 Bacteria 548244
450 Ga0183373_1001 3300015682 Bacteria 1410374
451 Ga0163161_10000012 3300017792 Bacteria 264639
452 Ga0163161_10000074 3300017792 Bacteria 101784
453 Ga0163161_10015370 3300017792 Bacteria 5336
454 Ga0163161_10016813 3300017792 Bacteria 5115
455 Ga0163161_10020644 3300017792 Bacteria 4625
456 Ga0163161_10067138 3300017792 Unclassified 2619
457 Ga0163161_10171589 3300017792 Bacteria 1659
458 Ga0213872_10009314 3300021361 Bacteria 4715
459 Ga0209436_103157 3300025208 Bacteria 4514
460 Ga0207427_100103 3300025231 Bacteria 119618
461 Ga0209437_100017 3300025233 Bacteria 694471
462 Ga0209437_100101 3300025233 Bacteria 226668
463 Ga0207425_1000002 3300025245 Bacteria 1362590
464 Ga0209646_1000002 3300025246 Bacteria 1425781
465 Ga0209646_1000745 3300025246 Bacteria 11381
466 Ga0209026_1000434 3300025250 Bacteria 34861
467 Ga0209026_1006913 3300025250 Bacteria 2666
468 Ga0209129_1000002 3300025258 Bacteria 1359086
469 Ga0209233_1000124 3300025261 Bacteria 226743
470 Ga0209130_1005416 3300025284 Bacteria 4431
471 Ga0209675_1000033 3300025291 Bacteria 271576
472 Ga0209676_1000008 3300025292 Bacteria 991778
473 Ga0209676_1000425 3300025292 Bacteria 74151
474 Ga0209025_1000004 3300025294 Bacteria 1361782
475 Ga0209758_1000006 3300025297 Bacteria 1359562
476 Ga0209758_1003065 3300025297 Bacteria 15894
477 Ga0209050_1000045 3300025298 Bacteria 388022
478 Ga0207426_1000002 3300025302 Bacteria 1249660
479 Ga0207426_1000051 3300025302 Bacteria 391700
480 Ga0207426_1000497 3300025302 Bacteria 58506
481 Ga0209257_1000001 3300025304 Bacteria 2274655
482 Ga0207656_10017547 3300025321 Unclassified 2806
483 Ga0207682_10010357 3300025893 Bacteria 3654
484 Ga0207710_10008558 3300025900 Bacteria 4313
485 Ga0207688_10009386 3300025901 Bacteria 5328
486 Ga0207680_10015585 3300025903 Bacteria 3970
487 Ga0207680_10023544 3300025903 Bacteria 3365
488 Ga0207680_10052159 3300025903 Bacteria 2449
489 Ga0207647_10000105 3300025904 Bacteria 65502
490 Ga0207647_10000511 3300025904 Bacteria 30935
491 Ga0207647_10007406 3300025904 Bacteria 7930
492 Ga0207647_10016870 3300025904 Bacteria 4974
493 Ga0207647_10022172 3300025904 Unclassified 4224
494 Ga0207647_10098536 3300025904 Unclassified 1737
495 Ga0207645_10000622 3300025907 Bacteria 29378
496 Ga0207645_10001210 3300025907 Bacteria 21312
497 Ga0207645_10003591 3300025907 Bacteria 11736
498 Ga0207645_10004714 3300025907 Bacteria 10031
499 Ga0207643_10023368 3300025908 Bacteria 3408
500 Ga0207643_10126218 3300025908 Bacteria 1519
501 Ga0207705_10000079 3300025909 Bacteria 119999
502 Ga0207705_10017692 3300025909 Bacteria 5099
503 Ga0207705_10045764 3300025909 Bacteria 3144
504 Ga0207705_10189042 3300025909 Bacteria 1556
505 Ga0207654_10016294 3300025911 Bacteria 3868
506 Ga0207654_10047242 3300025911 Bacteria 2459
507 Ga0207707_10000051 3300025912 Bacteria 117204
508 Ga0207707_10021406 3300025912 Bacteria 5653
509 Ga0207707_10193606 3300025912 Unclassified 1773
510 Ga0207695_10000013 3300025913 Bacteria 821265
511 Ga0207695_10000084 3300025913 Bacteria 282392
512 Ga0207695_10000323 3300025913 Bacteria 114265
513 Ga0207695_10001232 3300025913 Bacteria 43800
514 Ga0207695_10004447 3300025913 Bacteria 19105
515 Ga0207695_10007846 3300025913 Bacteria 13492
516 Ga0207695_10009118 3300025913 Bacteria 12316
517 Ga0207695_10015643 3300025913 Bacteria 8923
518 Ga0207695_10122675 3300025913 Bacteria 2564
519 Ga0207695_10189847 3300025913 Unclassified 1972
520 Ga0207695_10234174 3300025913 Bacteria 1740
521 Ga0207671_10000272 3300025914 Bacteria 77080
522 Ga0207671_10001497 3300025914 Bacteria 26937
523 Ga0207671_10002907 3300025914 Bacteria 17690
524 Ga0207671_10005889 3300025914 Bacteria 11125
525 Ga0207671_10009491 3300025914 Bacteria 8127
526 Ga0207671_10012189 3300025914 Bacteria 6935
527 Ga0207671_10014622 3300025914 Bacteria 6192
528 Ga0207671_10036318 3300025914 Bacteria 3654
529 Ga0207671_10042678 3300025914 Bacteria 3356
530 Ga0207671_10103071 3300025914 Bacteria 2163
531 Ga0207671_10121560 3300025914 Bacteria 1996
532 Ga0207671_10220780 3300025914 Bacteria 1485
533 Ga0207671_10335001 3300025914 Bacteria 1198
534 Ga0207660_10009778 3300025917 Bacteria 6208
535 Ga0207662_10016297 3300025918 Bacteria 4192
536 Ga0207662_10019350 3300025918 Bacteria 3873
537 Ga0207657_10059750 3300025919 Bacteria 3273
538 Ga0207657_10082590 3300025919 Bacteria 2697
539 Ga0207657_10350426 3300025919 Unclassified 1164
540 Ga0207649_10017077 3300025920 Bacteria 4108
541 Ga0207652_10000384 3300025921 Bacteria 46082
542 Ga0207652_10001696 3300025921 Bacteria 19285
543 Ga0207652_10014179 3300025921 Bacteria 6454
544 Ga0207652_10015091 3300025921 Bacteria 6268
545 Ga0207694_10077795 3300025924 Bacteria 2600
546 Ga0207694_10094692 3300025924 Bacteria 2360
547 Ga0207694_10195493 3300025924 Bacteria 1644
548 Ga0207694_10247457 3300025924 Unclassified 1458
549 Ga0207650_10019073 3300025925 Bacteria 4820
550 Ga0207650_10042343 3300025925 Bacteria 3341
551 Ga0207650_10070695 3300025925 Bacteria 2624
552 Ga0207659_10008155 3300025926 Bacteria 6484
553 Ga0207659_10037371 3300025926 Unclassified 3371
554 Ga0207659_10053334 3300025926 Bacteria 2884
555 Ga0207659_10163272 3300025926 Unclassified 1751
556 Ga0207687_10106215 3300025927 Bacteria 2075
557 Ga0207644_10120271 3300025931 Unclassified 1999
558 Ga0207644_10168342 3300025931 Bacteria 1709
559 Ga0207690_10000318 3300025932 Bacteria 32496
560 Ga0207690_10013661 3300025932 Bacteria 4885
561 Ga0207690_10160203 3300025932 Bacteria 1677
562 Ga0207706_10000120 3300025933 Bacteria 84222
563 Ga0207706_10029817 3300025933 Bacteria 4869
564 Ga0207706_10049670 3300025933 Bacteria 3706
565 Ga0207706_10099200 3300025933 Unclassified 2562
566 Ga0207706_10211759 3300025933 Bacteria 1699
567 Ga0207686_10024502 3300025934 Bacteria 3498
568 Ga0207670_10107261 3300025936 Bacteria 2005
569 Ga0207670_10126200 3300025936 Bacteria 1868
570 Ga0207704_10000099 3300025938 Bacteria 48088
571 Ga0207704_10028986 3300025938 Bacteria 3080
572 Ga0207704_10073370 3300025938 Bacteria 2179
573 Ga0207704_10212037 3300025938 Unclassified 1426
574 Ga0207691_10002527 3300025940 Bacteria 17886
575 Ga0207691_10023686 3300025940 Bacteria 5780
576 Ga0207691_10027226 3300025940 Bacteria 5363
577 Ga0207691_10042760 3300025940 Unclassified 4175
578 Ga0207691_10052586 3300025940 Bacteria 3720
579 Ga0207691_10066643 3300025940 Bacteria 3257
580 Ga0207691_10194754 3300025940 Unclassified 1766
581 Ga0207689_10003051 3300025942 Bacteria 15431
582 Ga0207689_10008841 3300025942 Bacteria 8746
583 Ga0207689_10077529 3300025942 Bacteria 2731
584 Ga0207689_10107260 3300025942 Unclassified 2295
585 Ga0207689_10125004 3300025942 Bacteria 2116
586 Ga0207689_10157763 3300025942 Bacteria 1870
587 Ga0207689_10234984 3300025942 Bacteria 1515
588 Ga0207661_10033412 3300025944 Unclassified 3992
589 Ga0207661_10055683 3300025944 Bacteria 3173
590 Ga0207661_10119674 3300025944 Bacteria 2240
591 Ga0207661_10250394 3300025944 Unclassified 1574
592 Ga0207679_10007258 3300025945 Bacteria 7021
593 Ga0207679_10026046 3300025945 Bacteria 4029
594 Ga0207667_10000037 3300025949 Bacteria 297252
595 Ga0207667_10000135 3300025949 Bacteria 111565
596 Ga0207667_10007957 3300025949 Bacteria 12648
597 Ga0207667_10011669 3300025949 Bacteria 10195
598 Ga0207667_10017914 3300025949 Bacteria 7961
599 Ga0207667_10028059 3300025949 Bacteria 6116
600 Ga0207667_10028127 3300025949 Bacteria 6107
601 Ga0207667_10038231 3300025949 Bacteria 5127
602 Ga0207667_10048612 3300025949 Bacteria 4485
603 Ga0207667_10164208 3300025949 Bacteria 2283
604 Ga0207667_10209178 3300025949 Bacteria 2000
605 Ga0207667_10345220 3300025949 Bacteria 1518
606 Ga0207667_10533199 3300025949 Unclassified 1188
607 Ga0207651_10005116 3300025960 Bacteria 6696
608 Ga0207651_10124360 3300025960 Bacteria 1962
609 Ga0207651_10144307 3300025960 Bacteria 1843
610 Ga0207651_10156626 3300025960 Unclassified 1780
611 Ga0207712_10007103 3300025961 Bacteria 7062
612 Ga0207712_10355651 3300025961 Unclassified 1219
613 Ga0207668_10000540 3300025972 Bacteria 23750
614 Ga0207668_10118577 3300025972 Bacteria 2000
615 Ga0207668_10250364 3300025972 Bacteria 1438
616 Ga0207640_10052155 3300025981 Bacteria 2663
617 Ga0207658_10039183 3300025986 Bacteria 3418
618 Ga0207658_10049171 3300025986 Bacteria 3097
619 Ga0207658_10181257 3300025986 Bacteria 1743
620 Ga0207677_10004313 3300026023 Bacteria 7617
621 Ga0207677_10014691 3300026023 Bacteria 4581
622 Ga0207677_10019806 3300026023 Bacteria 4072
623 Ga0207677_10059201 3300026023 Bacteria 2641
624 Ga0207677_10074545 3300026023 Bacteria 2408
625 Ga0207677_10253314 3300026023 Unclassified 1431
626 Ga0207703_10001644 3300026035 Bacteria 20118
627 Ga0207703_10201182 3300026035 Unclassified 1770
628 Ga0207639_10001126 3300026041 Bacteria 18166
629 Ga0207639_10016182 3300026041 Bacteria 5271
630 Ga0207639_10119624 3300026041 Bacteria 2162
631 Ga0207639_10140418 3300026041 Bacteria 2012
632 Ga0207639_10149561 3300026041 Unclassified 1954
633 Ga0207639_10210951 3300026041 Bacteria 1672
634 Ga0207639_10285933 3300026041 Bacteria 1452
635 Ga0207678_10038074 3300026067 Bacteria 4181
636 Ga0207678_10068160 3300026067 Bacteria 3053
637 Ga0207678_10224546 3300026067 Bacteria 1608
638 Ga0207708_10160493 3300026075 Bacteria 1775
639 Ga0207702_10000196 3300026078 Bacteria 71703
640 Ga0207702_10057179 3300026078 Bacteria 3315
641 Ga0207702_10074879 3300026078 Bacteria 2923
642 Ga0207702_10093576 3300026078 Bacteria 2636
643 Ga0207702_10104078 3300026078 Bacteria 2511
644 Ga0207702_10447303 3300026078 Bacteria 1253
645 Ga0207641_10000253 3300026088 Bacteria 67848
646 Ga0207641_10018015 3300026088 Bacteria 5787
647 Ga0207641_10052914 3300026088 Bacteria 3440
648 Ga0207641_10111008 3300026088 Bacteria 2431
649 Ga0207641_10153753 3300026088 Unclassified 2086
650 Ga0207648_10002506 3300026089 Bacteria 19710
651 Ga0207648_10004019 3300026089 Bacteria 15269
652 Ga0207648_10018210 3300026089 Bacteria 6362
653 Ga0207648_10034323 3300026089 Bacteria 4472
654 Ga0207648_10036449 3300026089 Unclassified 4332
655 Ga0207648_10042309 3300026089 Bacteria 3999
656 Ga0207676_10063266 3300026095 Bacteria 2938
657 Ga0207676_10223176 3300026095 Bacteria 1679
658 Ga0207676_10348413 3300026095 Bacteria 1369
659 Ga0207676_10355882 3300026095 Unclassified 1355
660 Ga0207674_10000672 3300026116 Bacteria 44419
661 Ga0207674_10006740 3300026116 Bacteria 13484
662 Ga0207674_10114299 3300026116 Bacteria 2672
663 Ga0207674_10160935 3300026116 Bacteria 2199
664 Ga0207674_10178043 3300026116 Bacteria 2078
665 Ga0207675_100014435 3300026118 Bacteria 7364
666 Ga0207675_100066138 3300026118 Bacteria 3378
667 Ga0207675_100134293 3300026118 Bacteria 2347
668 Ga0207683_10003712 3300026121 Bacteria 13255
669 Ga0207683_10005010 3300026121 Bacteria 11378
670 Ga0207683_10057036 3300026121 Bacteria 3428
671 Ga0207683_10065629 3300026121 Unclassified 3200
672 Ga0207683_10117716 3300026121 Bacteria 2382
673 Ga0207698_10001082 3300026142 Bacteria 15843
674 Ga0207698_10011290 3300026142 Bacteria 5783
675 Ga0207698_10055732 3300026142 Bacteria 3049
676 Ga0209281_1000094 3300027111 Bacteria 238155
677 Ga0209995_1001337 3300027471 Bacteria 3795
678 Ga0209968_1002355 3300027526 Bacteria 2857
679 Ga0210002_1001420 3300027617 Bacteria 3370
680 Ga0209282_1106414 3300027666 Bacteria 1433
681 Ga0209974_10017789 3300027876 Bacteria 2356
682 Ga0268266_10000018 3300028379 Bacteria 569141
683 Ga0268266_10085801 3300028379 Unclassified 2751
684 Ga0268266_10090778 3300028379 Unclassified 2678
685 Ga0268265_10014622 3300028380 Bacteria 5351
686 Ga0268265_10099403 3300028380 Bacteria 2346
687 Ga0268264_10001720 3300028381 Bacteria 20153
688 Ga0268264_10009362 3300028381 Bacteria 8107
689 Ga0268264_10047708 3300028381 Bacteria 3561
690 Ga0307517_10002048 3300028786 Bacteria 32795
691 Ga0307517_10004683 3300028786 Bacteria 20955
692 Ga0307515_10000681 3300028794 Bacteria 78150
693 Ga0307515_10001752 3300028794 Bacteria 48338
694 Ga0307515_10002910 3300028794 Bacteria 36374
695 Ga0307515_10014453 3300028794 Bacteria 14631
696 Ga0307515_10081729 3300028794 Bacteria 4192
697 Ga0307515_10093645 3300028794 Bacteria 3722
698 Ga0307515_10229784 3300028794 Bacteria 1651
699 Ga0265338_10001687 3300028800 Bacteria 35089
700 Ga0316177_1198244 3300030731 Bacteria 7343
701 Ga0316176_1050137 3300030732 Bacteria 14004
702 Ga0316183_1065995 3300030742 Bacteria 27909
703 Ga0316181_1148726 3300030744 Bacteria 7875
704 Ga0265327_10000010 3300031251 Bacteria 566817
705 Ga0307513_10156292 3300031456 Bacteria 2180
706 Ga0307509_10048545 3300031507 Bacteria 4557
707 Ga0307408_100002250 3300031548 Bacteria 13771
708 Ga0307508_10002100 3300031616 Bacteria 21430
709 Ga0316576_10075969 3300031727 Bacteria 2485
710 Ga0316578_10057826 3300031728 Bacteria 2279
711 Ga0307516_10003117 3300031730 Bacteria 21573
712 Ga0307405_10000003 3300031731 Bacteria 569064
713 Ga0307405_10014179 3300031731 Bacteria 4277
714 Ga0307405_10059446 3300031731 Bacteria 2409
715 Ga0307413_10115686 3300031824 Bacteria 1805
716 Ga0307413_10143113 3300031824 Bacteria 1655
717 Ga0307413_10178076 3300031824 Unclassified 1513
718 Ga0307410_10000067 3300031852 Bacteria 37092
719 Ga0307410_10194020 3300031852 Bacteria 1546
720 Ga0307406_10000035 3300031901 Bacteria 82953
721 Ga0307406_10117919 3300031901 Bacteria 1840
722 Ga0307407_10000008 3300031903 Bacteria 191228
723 Ga0307407_10063361 3300031903 Bacteria 2168
724 Ga0307412_10000427 3300031911 Bacteria 25500
725 Ga0307412_10037619 3300031911 Bacteria 3111
726 Ga0307409_100008566 3300031995 Bacteria 6218
727 Ga0307416_100000009 3300032002 Bacteria 374271
728 Ga0307416_100000639 3300032002 Bacteria 18075
729 Ga0307416_100113426 3300032002 Bacteria 2395
730 Ga0307414_10000009 3300032004 Bacteria 359782
731 Ga0307414_10000038 3300032004 Bacteria 150774
732 Ga0307414_10000063 3300032004 Bacteria 107710
733 Ga0307414_10002879 3300032004 Bacteria 9086
734 Ga0307414_10004631 3300032004 Bacteria 7486
735 Ga0307414_10008231 3300032004 Bacteria 5899
736 Ga0307414_10012334 3300032004 Bacteria 5049
737 Ga0307414_10034651 3300032004 Bacteria 3350
738 Ga0307414_10105314 3300032004 Bacteria 2132
739 Ga0307414_10242776 3300032004 Unclassified 1492
740 Ga0307411_10000001 3300032005 Bacteria 931810
741 Ga0307507_10000064 3300033179 Bacteria 161226
742 Ga0307510_10002860 3300033180 Bacteria 19841
743 Ga0307510_10041880 3300033180 Bacteria 4999
744 Ga0373927_0005849 3300035695 Bacteria 8433
745 Ga0373927_0037163 3300035695 Bacteria 3166
746 Ga0373937_0023482 3300036401 Bacteria 5553
747 Ga0373937_0152899 3300036401 Bacteria 2162
748 Ga0373937_0250410 3300036401 Bacteria 1670
749 Ga0316582_0060474 3300036647 Bacteria 2429
750 Ga0316584_0027245 3300036712 Bacteria 4205
751 Ga0316584_0122674 3300036712 Bacteria 1941
752 Ga0373925_0104333 3300037068 Bacteria 2183
753 Ga0395899_0000025 3300037312 Bacteria 350927
754 Ga0395899_0000493 3300037312 Bacteria 44066
755 Ga0395899_0000629 3300037312 Bacteria 36706
756 Ga0395899_0001884 3300037312 Bacteria 17312
757 Ga0395899_0029186 3300037312 Bacteria 4149
758 Ga0395899_0029721 3300037312 Bacteria 4111
759 Ga0395899_0041383 3300037312 Bacteria 3443
760 Ga0395899_0066951 3300037312 Bacteria 2636
761 Ga0395899_0133975 3300037312 Unclassified 1767
762 Ga0395900_0000480 3300037418 Bacteria 56578
763 Ga0395900_0000506 3300037418 Bacteria 54890
764 Ga0395900_0006601 3300037418 Bacteria 12073
765 Ga0395900_0009920 3300037418 Bacteria 9750
766 Ga0395900_0012177 3300037418 Bacteria 8793
767 Ga0395900_0108003 3300037418 Bacteria 2859
768 Ga0395900_0175354 3300037418 Unclassified 2180
769 Ga0395900_0179537 3300037418 Unclassified 2152
770 Ga0395898_0001651 3300037466 Bacteria 30118
771 Ga0395898_0032624 3300037466 Bacteria 5199
772 Ga0395898_0041094 3300037466 Bacteria 4569
773 Ga0395898_0056108 3300037466 Bacteria 3841
774 Ga0395905_0000254 3300037471 Bacteria 79953
775 Ga0395905_0000738 3300037471 Bacteria 43061
776 Ga0395905_0001166 3300037471 Bacteria 32800
777 Ga0395905_0006569 3300037471 Bacteria 11683
778 Ga0395901_0000853 3300038443 Bacteria 33521
779 Ga0395901_0004350 3300038443 Bacteria 14289
780 Ga0395901_0010578 3300038443 Bacteria 9348
781 Ga0395901_0059253 3300038443 Bacteria 3983
782 Ga0395901_0067844 3300038443 Bacteria 3715
783 Ga0395901_0081109 3300038443 Bacteria 3388
784 Ga0395901_0119295 3300038443 Bacteria 2772
785 Ga0436361_0021149 3300039447 Bacteria 8615
786 Ga0439447_011193 3300041407 Bacteria 2629
787 Ga0439466_0001850 3300041411 Bacteria 8310
788 Ga0439448_0022307 3300042005 Bacteria 1967
789 Ga0439449_0000697 3300042007 Bacteria 12827
790 Ga0451577_0000010 3300042876 Bacteria 616686
791 Ga0451577_0011492 3300042876 Bacteria 8368
792 Ga0451577_0068138 3300042876 Bacteria 3174
793 Ga0451577_0097018 3300042876 Bacteria 2632
794 Ga0451577_0214216 3300042876 Bacteria 1740
795 Ga0451577_0370719 3300042876 Bacteria 1299
796 Ga0466969_0000912 3300044656 Bacteria 15928
797 Ga0466969_0053439 3300044656 Bacteria 1982
798 Ga0466969_0098395 3300044656 Bacteria 1379
799 Ga0466972_0000013 3300044658 Bacteria 229345
800 Ga0466972_0005607 3300044658 Bacteria 6290
801 Ga0453683_0000031 3300044673 Bacteria 241998
802 Ga0453683_0001482 3300044673 Bacteria 20102
803 Ga0453683_0085783 3300044673 Bacteria 1973
804 Ga0466966_0000045 3300044684 Bacteria 92504
805 Ga0466966_0053935 3300044684 Bacteria 2549
806 Ga0466961_0066482 3300044693 Bacteria 2290
807 Ga0466961_0088177 3300044693 Bacteria 1960
808 Ga0453684_0000191 3300044712 Bacteria 267816
809 Ga0453684_0009766 3300044712 Bacteria 16663
810 Ga0453684_0072910 3300044712 Bacteria 4332
811 Ga0453684_0097891 3300044712 Bacteria 3599
812 Ga0453684_0178992 3300044712 Bacteria 2491
813 Ga0453684_0192947 3300044712 Bacteria 2381
814 Ga0453684_0311331 3300044712 Bacteria 1786
815 Ga0453684_0442253 3300044712 Bacteria 1449
816 Ga0466968_0089549 3300044735 Bacteria 1362
817 Ga0466970_0018485 3300044765 Bacteria 3609
818 Ga0466970_0069434 3300044765 Bacteria 1894
819 Ga0466957_0003333 3300044842 Bacteria 8805
820 Ga0466957_0152139 3300044842 Bacteria 1497
821 Ga0466959_0000023 3300045049 Bacteria 124545
822 Ga0466959_0083862 3300045049 Bacteria 2294
823 Ga0451576_0000088 3300045051 Bacteria 234139
824 Ga0451576_0007064 3300045051 Bacteria 13567
825 Ga0451576_0027120 3300045051 Bacteria 6156
826 Ga0451576_0040329 3300045051 Bacteria 4943
827 Ga0451576_0204986 3300045051 Bacteria 2059
828 Ga0495629_0035357 3300046459 Bacteria 3531
829 Ga0495638_0049677 3300046460 Bacteria 2622
830 Ga0495651_0090903 3300046462 Bacteria 2289
831 Ga0495650_0000087 3300046471 Bacteria 234870
832 Ga0495585_0000286 3300046492 Bacteria 50524
833 Ga0495585_0001651 3300046492 Bacteria 17060
834 Ga0495583_0094765 3300046506 Bacteria 1281
835 Ga0495606_0000052 3300046507 Bacteria 201529
836 Ga0495606_0014847 3300046507 Bacteria 6048
837 Ga0495610_0000001 3300046512 Bacteria 1620061
838 Ga0495610_0000903 3300046512 Bacteria 27607
839 Ga0495610_0006770 3300046512 Bacteria 7778
840 Ga0495610_0010020 3300046512 Bacteria 5922
841 Ga0495616_0005196 3300046513 Bacteria 8053
842 Ga0495618_0007268 3300046514 Bacteria 6701
843 Ga0495628_0017891 3300046516 Bacteria 5883
844 Ga0495630_0049633 3300046517 Bacteria 3140
845 Ga0495630_0116104 3300046517 Bacteria 2029
846 Ga0495631_0027708 3300046518 Bacteria 2590
847 Ga0495644_0007188 3300046523 Bacteria 4303
848 Ga0495648_0077885 3300046524 Bacteria 1898
849 Ga0495640_0061455 3300046533 Unclassified 2552
850 Ga0495598_0027721 3300046537 Bacteria 1565
851 Ga0495633_0000080 3300046558 Bacteria 127703
852 Ga0495633_0000081 3300046558 Bacteria 125903
853 Ga0495633_0072173 3300046558 Bacteria 1610
854 Ga0495668_0000012 3300046616 Bacteria 458817
855 Ga0495634_0069334 3300046642 Bacteria 2327
856 Ga0495625_0000036 3300046660 Bacteria 221680
857 Ga0495625_0002289 3300046660 Bacteria 20991
858 Ga0495625_0010136 3300046660 Bacteria 7829
859 Ga0495625_0014574 3300046660 Bacteria 6267
860 Ga0495625_0021139 3300046660 Bacteria 5014
861 Ga0495625_0043637 3300046660 Bacteria 3251
862 Ga0495625_0091239 3300046660 Bacteria 2106
863 Ga0495625_0233913 3300046660 Bacteria 1199
864 Ga0495661_0003611 3300046665 Bacteria 11391
865 Ga0495661_0092978 3300046665 Bacteria 1712
866 Ga0495646_0058441 3300046680 Bacteria 2306
867 Ga0495658_0017216 3300046683 Bacteria 3731
868 Ga0495658_0020389 3300046683 Unclassified 3477
869 Ga0495669_0058397 3300046684 Bacteria 1741
870 Ga0495613_0161327 3300046689 Unclassified 1595
871 Ga0495649_0000017 3300046694 Bacteria 221685
872 Ga0495589_0123181 3300046794 Bacteria 1248
873 Ga0495660_0013731 3300046810 Bacteria 4694
874 Ga0495674_0018467 3300047319 Bacteria 6490
875 Ga0495683_0023732 3300047323 Bacteria 3152
876 Ga0495687_055425 3300047443 Bacteria 1657
877 Ga0495673_0068477 3300047469 Bacteria 1500
878 Ga0495684_0161177 3300047471 Bacteria 1673
879 Ga0495686_0000004 3300047472 Bacteria 869019
880 Ga0495686_0000582 3300047472 Bacteria 51799
881 Ga0495686_0005494 3300047472 Bacteria 9975
882 Ga0495686_0020028 3300047472 Bacteria 4464
883 Ga0496109_0054915 3300048912 Bacteria 3633
884 Ga0496114_0000594 3300048917 Bacteria 26726
885 Ga0496114_0369263 3300048917 Unclassified 1270
886 Ga0496115_0007421 3300048918 Bacteria 8067
887 Ga0496115_0045415 3300048918 Bacteria 3507
888 Ga0496116_0000032 3300048919 Bacteria 419997
889 Ga0496121_0091005 3300048924 Bacteria 2383
890 Ga0496122_0001208 3300048925 Bacteria 43998
891 Ga0496123_0008537 3300048926 Bacteria 9392
892 Ga0496124_0111474 3300048927 Bacteria 2201
893 Ga0496124_0126449 3300048927 Bacteria 2035
894 Ga0496125_0000059 3300048928 Bacteria 264149
895 Ga0496125_0011341 3300048928 Bacteria 8925
896 Ga0496126_0008790 3300048929 Bacteria 10843
897 Ga0496126_0022457 3300048929 Bacteria 6139
898 Ga0496126_0212279 3300048929 Bacteria 1629
899 Ga0495678_014851 3300049459 Bacteria 3607
900 Ga0501031_0003605 3300049568 Bacteria 9955
901 Ga0501032_0091050 3300049569 Bacteria 2024
902 Ga0501033_0010675 3300049570 Bacteria 7038
903 Ga0501034_0004012 3300049571 Bacteria 16517
904 Ga0501034_0016530 3300049571 Bacteria 7567
905 Ga0501034_0025459 3300049571 Bacteria 6024
906 Ga0501034_0027052 3300049571 Bacteria 5835
907 Ga0501034_0146271 3300049571 Bacteria 2340
908 Ga0501034_0330791 3300049571 Unclassified 1455
909 Ga0501036_0041913 3300049572 Bacteria 3874
910 Ga0501037_0039086 3300049573 Bacteria 3494
911 Ga0501038_0012291 3300049574 Bacteria 7820
912 Ga0501039_0022501 3300049575 Bacteria 4838
913 Ga0501043_0009607 3300049579 Bacteria 7578
914 Ga0501043_0024314 3300049579 Bacteria 4754
915 Ga0501043_0028424 3300049579 Bacteria 4390
916 Ga0501046_0024666 3300049580 Bacteria 4928
917 Ga0501046_0045170 3300049580 Bacteria 3501
918 Ga0501046_0239907 3300049580 Bacteria 1337
919 Ga0501047_0021075 3300049581 Bacteria 6258
920 Ga0501047_0027231 3300049581 Bacteria 5506
921 Ga0501047_0066956 3300049581 Bacteria 3462
922 Ga0501047_0072959 3300049581 Bacteria 3304
923 Ga0501047_0332711 3300049581 Unclassified 1357
924 Ga0501048_0043141 3300049582 Bacteria 3229
925 Ga0501067_0095409 3300049583 Bacteria 1651
926 Ga0501068_0153904 3300049584 Unclassified 1446
927 Ga0501069_0081356 3300049585 Unclassified 1824
928 Ga0501073_0019693 3300049589 Bacteria 4870
929 Ga0501074_0062516 3300049590 Bacteria 2681
930 Ga0501198_002157 3300049649 Unclassified 2629
931 Ga0501202_002208 3300049652 Unclassified 3247
932 Ga0501217_000620 3300049661 Bacteria 5983
933 Ga0501217_022688 3300049661 Bacteria 1491
934 Ga0501233_010478 3300049668 Unclassified 1827
935 Ga0501243_008416 3300049675 Bacteria 1589
936 Ga0501249_000037 3300049679 Bacteria 63492
937 Ga0501249_008390 3300049679 Bacteria 2145
938 Ga0501249_008602 3300049679 Bacteria 2118
939 Ga0501249_009305 3300049679 Bacteria 2044
940 Ga0501257_016312 3300049686 Bacteria 1722
941 Ga0501219_000052 3300049703 Bacteria 18661
942 Ga0501221_000044 3300049704 Bacteria 12905
943 Ga0501225_0001739 3300049705 Bacteria 6824
944 Ga0501225_0013111 3300049705 Unclassified 2321
945 Ga0501245_002249 3300049708 Unclassified 2571
946 Ga0501080_0057861 3300049742 Bacteria 3608
947 Ga0501080_0123580 3300049742 Bacteria 2398
948 Ga0501241_000031 3300049758 Bacteria 52001
949 Ga0501266_000011 3300049763 Bacteria 197280
950 Ga0501035_0015438 3300049822 Bacteria 7045
951 Ga0501035_0027505 3300049822 Bacteria 5198
952 Ga0501044_0009636 3300049823 Bacteria 10510
953 Ga0501044_0017840 3300049823 Bacteria 7614
954 Ga0501044_0028924 3300049823 Bacteria 5845
955 Ga0501044_0052694 3300049823 Bacteria 4191
956 Ga0501284_00029 3300050005 Bacteria 74818
957 nmdc:mga0k408_3518_c1 3300050493 Bacteria 8279
958 nmdc:mga0k408_41458_c1 3300050493 Bacteria 2232
959 nmdc:mga0k408_749_c1 3300050493 Bacteria 17824
960 nmdc:mga0k408_821_c1 3300050493 Bacteria 17147
961 nmdc:mga05p37_13616_c1 3300050507 Bacteria 9747
962 nmdc:mga09592_983_c1 3300050508 Bacteria 22557
963 nmdc:mga0qj67_97741_c1 3300050509 Bacteria 2365
964 Ga0500635_0002671 3300053080 Bacteria 4424
965 Ga0495619_0170484 3300053085 Bacteria 1505
966 Ga0500578_0004418 3300053086 Bacteria 9905
967 Ga0500646_0001428 3300053090 Bacteria 6341
968 Ga0500646_0004317 3300053090 Bacteria 3602
969 Ga0500583_0000108 3300053092 Bacteria 41760
970 Ga0500651_0000084 3300053093 Bacteria 60127
971 Ga0500651_0064350 3300053093 Bacteria 2287
972 Ga0500641_0000017 3300053096 Bacteria 132678
973 Ga0500641_0002621 3300053096 Bacteria 6345
974 Ga0500594_0003311 3300053118 Bacteria 3528
975 Ga0500608_016279 3300053122 Bacteria 3356
976 Ga0500618_000002 3300053125 Bacteria 370822
977 Ga0500652_037526 3300053131 Bacteria 1934
978 Ga0500658_0000003 3300053134 Bacteria 512506
979 Ga0500589_003337 3300053147 Bacteria 5739
980 Ga0500616_0145895 3300053153 Bacteria 1101
981 Ga0500622_0000777 3300053156 Bacteria 27709
982 Ga0500622_0004557 3300053156 Bacteria 8641
983 Ga0500624_000271 3300053157 Bacteria 17926
984 Ga0500636_0044658 3300053177 Bacteria 2613
985 Ga0500584_014924 3300053726 Bacteria 3565
986 Ga0500611_000022 3300053727 Bacteria 102349
987 Ga0466962_0023524 3300061719 Bacteria 2961
988 2511234750 2511231000 Bacteria 4488346
989 2513235060 2513020052 Bacteria 5120511
990 2520879408 2519899754 Bacteria 5336938
991 2522551056 2522125168 Bacteria 7376607
992 2524004500 2523533629 Bacteria 2982326
993 2585158508 2582581281 Bacteria 4487904
994 2585162854 2582581282 Bacteria 4495830
995 2586210050 2585427687 Bacteria 5544917
996 2599478340 2599185184 Bacteria 6430550
997 2644013061 2643221600 Bacteria 5530138
998 2644372379 2643221667 Bacteria 5627472
999 2644642605 2643221716 Bacteria 4986332
1000 2644684851 2643221725 Bacteria 5087956
1001 2738732463 2738541279 Bacteria 6149495
1002 2738757065 2738541283 Bacteria 7222293
1003 2738760402 2738541284 Bacteria 5199923
1004 2738765028 2738541285 Bacteria 6150075
1005 2738851781 2738541302 Bacteria 5944758
1006 2739214043 2738543007 Bacteria 6149845
1007 2739302549 2738543023 Bacteria 6767879
1008 2739590671 2739367651 Bacteria 6359826
1009 2739617093 2739367656 Bacteria 5152243
1010 2739647398 2739367663 Bacteria 5040914
1011 2740001323 2739367857 Bacteria 5433684
1012 2740006139 2739367858 Bacteria 5432813
1013 2776612453 2775506987 Bacteria 5373360
1014 2802653773 2802428842 Bacteria 4926114
1015 2817416276 2816332280 Bacteria 5109718
1016 2819546345 2818991437 Bacteria 5805520
1017 2819588775 2818991444 Bacteria 6968812
1018 2833643626 2833640130 Bacteria 4858325
1019 2842725022 2842722452 Bacteria 6263924
1020 2842908876 2842903701 Bacteria 6986368
1021 2842914186 2842909656 Bacteria 6185908
1022 2849286580 2849281842 Bacteria 6065644
1023 2852623164 2852623160 Bacteria 4376875
1024 2852630368 2852627209 Bacteria 5896285
1025 2857614954 2857613821 Bacteria 4917088
1026 2857618658 2857618242 Bacteria 5635925
1027 2857630290 2857627736 Bacteria 5625397
1028 2881363107 2881359912 Bacteria 4935907
1029 2884635381 2884634485 Bacteria 3928637
1030 2884795632 2884791551 Bacteria 8511252
1031 2884937971 2884933994 Bacteria 4535041
1032 2903896890 2903895155 Bacteria 5258610
1033 2904422793 2904419702 Bacteria 5166287
1034 2904448666 2904445276 Bacteria 5310396
1035 2904557071 2904555929 Bacteria 5218588
1036 2914759720 2914759650 Bacteria 4701441
1037 2919189655 2919186247 Bacteria 6244071
1038 2919195305 2919191525 Bacteria 5765973
1039 2919440792 2919437846 Bacteria 6199444
1040 2919685973 2919683626 Bacteria 5534354
1041 2919695677 2919692658 Bacteria 5943958
1042 2928080610 2928078545 Bacteria 6534839
1043 2928150835 2928147474 Bacteria 6512076
1044 2929153564 2929150217 Bacteria 5462483
1045 2929178797 2929177148 Bacteria 7883697
1046 2932083005 2932082852 Bacteria 6563563
1047 2939667881 2939664404 Bacteria 6364494
1048 2945981199 2945977869 Bacteria 7777518
1049 2946001964 2945997725 Bacteria 6404843
1050 2946019399 2946013367 Bacteria 7766675
1051 2954018848 2954016120 Bacteria 6446024
1052 2958461118 2958458903 Bacteria 5301041
1053 2977232530 2977232053 Bacteria 5485925
1054 2977270228 2977268062 Bacteria 5243061
1055 8003153679 8003151029 Bacteria 8187759
1056 8054310082 8054307821 Bacteria 5212224
1057 8055421935 8055419101 Bacteria 5289643
1058 8055589911 8055588893 Bacteria 3619545
1059 8055593425 8055592153 Bacteria 5961247
1060 8056443836 8056440228 Bacteria 4946504
1061 Ga0395899_0000033
1062 SwRhRL2b_contig_787417
1063 JGI24736J21556_1003139
1064 JGI24740J21852_10020774
1065 JGI24737J22298_10007120
1066 JGI24735J21928_10000004
1067 JGI25162J39368_1000011
1068 JGI25162J39368_1000614
1069 JGI25154J39366_1000040
1070 JGI25157J39369_1003731
1071 JGI25157J39369_1004254
1072 JGI25164J39214_1003371
1073 JGI25152J39213_1000143
1074 JGI25150J39212_1000001
1075 JGI25151J46595_10000001
1076 JGI25165J46597_1000985
1077 JGI25153J46596_10000001
1078 JGI25153J46596_10003346
1079 rootH1_10024829
1080 rootH1_10063239
1081 rootH1_10140822
1082 rootH2_10001891
1083 rootH2_10003679
1084 rootH2_10013742
1085 rootH2_10053227
1086 rootH2_10090920
1087 rootH2_10184838
1088 rootL2_10017790
1089 rootL2_10028141
1090 rootL2_10030620
1091 rootL2_10058669
1092 rootL2_10107720
1093 rootL2_10223865
1094 rootL2_10315621
1095 rootH1_10000019
1096 rootH1_10008801
1097 rootH1_10035284
1098 rootH1_10054491
1099 rootH1_10163486
1100 rootH1_10178453
1101 rootH1_10298335
1102 JGI25160J50197_1006644
1103 Ga0006562J51391_1016454
1104 Ga0055536_1000001
1105 Ga0055530_10004772
1106 Ga0055531_10000131
1107 Ga0065165_1000300
1108 Ga0065714_10003545
1109 Ga0065714_10004089
1110 Ga0065714_10010706
1111 Ga0065714_10064863
1112 Ga0065714_10067358
1113 Ga0065714_10099861
1114 Ga0065714_10107284
1115 Ga0065714_10109461
1116 Ga0065704_10000210
1117 Ga0065704_10083999
1118 Ga0065712_10008583
1119 Ga0065712_10124654
1120 Ga0065715_10004221
1121 Ga0070658_10000049
1122 Ga0070658_10031135
1123 Ga0070658_10101229
1124 Ga0070676_10000336
1125 Ga0070676_10026339
1126 Ga0070683_100030965
1127 Ga0070683_100032467
1128 Ga0070683_100067205
1129 Ga0070690_100012862
1130 Ga0070670_100033933
1131 Ga0070670_100034230
1132 Ga0070670_100086541
1133 Ga0070670_100181544
1134 Ga0070670_100435816
1135 Ga0070677_10014143
1136 Ga0068869_100039400
1137 Ga0070666_10002847
1138 Ga0070666_10056865
1139 Ga0070680_100015517
1140 Ga0070680_100171020
1141 Ga0070682_100001275
1142 Ga0070682_100119478
1143 Ga0070682_100241275
1144 Ga0068868_100004138
1145 Ga0068868_100008530
1146 Ga0068868_100011418
1147 Ga0068868_100015143
1148 Ga0068868_100020344
1149 Ga0070660_100027944
1150 Ga0070660_100043577
1151 Ga0070660_100171259
1152 Ga0070691_10004326
1153 Ga0070661_100023944
1154 Ga0070661_100043909
1155 Ga0070668_100004446
1156 Ga0070669_100018155
1157 Ga0070675_100015326
1158 Ga0070675_100016332
1159 Ga0070675_100027340
1160 Ga0070675_100044109
1161 Ga0070675_100268887
1162 Ga0070671_100046891
1163 Ga0070671_100159729
1164 Ga0070673_100004993
1165 Ga0070673_100016856
1166 Ga0070673_100026479
1167 Ga0070673_100035251
1168 Ga0070688_100001700
1169 Ga0070659_100006699
1170 Ga0070659_100047474
1171 Ga0070659_100069713
1172 Ga0070659_100244848
1173 Ga0070667_100000492
1174 Ga0070667_100001349
1175 Ga0070667_100048526
1176 Ga0070663_100001195
1177 Ga0070663_100081084
1178 Ga0070663_100271155
1179 Ga0070678_100001813
1180 Ga0070678_100107493
1181 Ga0070662_100000045
1182 Ga0070662_100025109
1183 Ga0070662_100096983
1184 Ga0070681_10018316
1185 Ga0070681_10029313
1186 Ga0070681_10040763
1187 Ga0068867_100004573
1188 Ga0068867_100036004
1189 Ga0068867_100060265
1190 Ga0068867_100333504
1191 Ga0070685_10002206
1192 Ga0070685_10005910
1193 Ga0070685_10027809
1194 Ga0070685_10077516
1195 Ga0070679_100004536
1196 Ga0070679_100006277
1197 Ga0070679_100008873
1198 Ga0070679_100127028
1199 Ga0070684_100035368
1200 Ga0070684_100042359
1201 Ga0070684_100127303
1202 Ga0070684_100132672
1203 Ga0068853_100003018
1204 Ga0068853_100008065
1205 Ga0068853_100008667
1206 Ga0068853_100013120
1207 Ga0068853_100022472
1208 Ga0068853_100057348
1209 Ga0068853_100139186
1210 Ga0068853_100301937
1211 Ga0070672_100001489
1212 Ga0070672_100055232
1213 Ga0070672_100083317
1214 Ga0070672_100090358
1215 Ga0070672_100156349
1216 Ga0070686_100032891
1217 Ga0070686_100073191
1218 Ga0070686_100280374
1219 Ga0070693_100003483
1220 Ga0070693_100179055
1221 Ga0070665_100000020
1222 Ga0070665_100016967
1223 Ga0070665_100043231
1224 Ga0068855_100000240
1225 Ga0068855_100000346
1226 Ga0068855_100005837
1227 Ga0068855_100008169
1228 Ga0068855_100022866
1229 Ga0068855_100024060
1230 Ga0068855_100026080
1231 Ga0068855_100032308
1232 Ga0068855_100035811
1233 Ga0068855_100047040
1234 Ga0068855_100062842
1235 Ga0068855_100070659
1236 Ga0068855_100071810
1237 Ga0070664_100192898
1238 Ga0070664_100244621
1239 Ga0068857_100007822
1240 Ga0068857_100008143
1241 Ga0068857_100019055
1242 Ga0068857_100037750
1243 Ga0068857_100209964
1244 Ga0068854_100036735
1245 Ga0068854_100051761
1246 Ga0068854_100184752
1247 Ga0068856_100000835
1248 Ga0068856_100010959
1249 Ga0068856_100017673
1250 Ga0068856_100041561
1251 Ga0068856_100050057
1252 Ga0068856_100072662
1253 Ga0068856_100207105
1254 Ga0068852_100001345
1255 Ga0068852_100003445
1256 Ga0068852_100083617
1257 Ga0068852_100151779
1258 Ga0068852_100227662
1259 Ga0068852_100362436
1260 Ga0068859_100019039
1261 Ga0068859_100222016
1262 Ga0068864_100005800
1263 Ga0068866_10011575
1264 Ga0068861_100276800
1265 Ga0068851_10015604
1266 Ga0068851_10047333
1267 Ga0068870_10028107
1268 Ga0068870_10142332
1269 Ga0068863_100000412
1270 Ga0068863_100032411
1271 Ga0068863_100077889
1272 Ga0068863_100089741
1273 Ga0068858_100342504
1274 Ga0068860_100000916
1275 Ga0068860_100081090
1276 Ga0068860_100186633
1277 Ga0068862_100155708
1278 Ga0068862_100377924
1279 Ga0081540_1037226
1280 Ga0075366_10005218
1281 Ga0075366_10006027
1282 Ga0075366_10019255
1283 Ga0075366_10020069
1284 Ga0075366_10074534
1285 Ga0097621_100002086
1286 Ga0097621_100018421
1287 Ga0097621_100022179
1288 Ga0097621_100051361
1289 Ga0097621_100093559
1290 Ga0097621_100164744
1291 Ga0068871_100000100
1292 Ga0068871_100312735
1293 Ga0075428_100017721
1294 Ga0075428_100050469
1295 Ga0075431_100030371
1296 Ga0075431_100118749
1297 Ga0075434_100105830
1298 Ga0075429_100018092
1299 Ga0068865_100000174
1300 Ga0068865_100003461
1301 Ga0068865_100028117
1302 Ga0068865_100077970
1303 Ga0068865_100103533
1304 Ga0097620_100019038
1305 Ga0097620_100222010
1306 Ga0079104_1000005
1307 Ga0099826_10126639
1308 Ga0105251_10086058
1309 Ga0105244_10000063
1310 Ga0105244_10098006
1311 Ga0105250_10040141
1312 Ga0105240_10000074
1313 Ga0105240_10000237
1314 Ga0105240_10000598
1315 Ga0105240_10000626
1316 Ga0105240_10001351
1317 Ga0105240_10001595
1318 Ga0105240_10007062
1319 Ga0105240_10008151
1320 Ga0105240_10022028
1321 Ga0105240_10045715
1322 Ga0105240_10066229
1323 Ga0105240_10084727
1324 Ga0105240_10096537
1325 Ga0105240_10108377
1326 Ga0105240_10126815
1327 Ga0105240_10261192
1328 Ga0105240_10349622
1329 Ga0111539_10034093
1330 Ga0105245_10114265
1331 Ga0114129_10033962
1332 Ga0105241_10000086
1333 Ga0105241_10000659
1334 Ga0105241_10005221
1335 Ga0105241_10042948
1336 Ga0105241_10057228
1337 Ga0105241_10170979
1338 Ga0105241_10284031
1339 Ga0105242_10009407
1340 Ga0105242_10015906
1341 Ga0105242_10066597
1342 Ga0105248_10570485
1343 Ga0105237_10000224
1344 Ga0105237_10001565
1345 Ga0105237_10003647
1346 Ga0105237_10004072
1347 Ga0105237_10009395
1348 Ga0105237_10018293
1349 Ga0105237_10028286
1350 Ga0105237_10036976
1351 Ga0105237_10057618
1352 Ga0105237_10059488
1353 Ga0105237_10067260
1354 Ga0105237_10140408
1355 Ga0105237_10193118
1356 Ga0105237_10196753
1357 Ga0105237_10264291
1358 Ga0105237_10285413
1359 Ga0105237_10397595
1360 Ga0105238_10001132
1361 Ga0105238_10052663
1362 Ga0105238_10097033
1363 Ga0105249_10005103
1364 Ga0105249_10005252
1365 Ga0105249_10008737
1366 Ga0105249_10055248
1367 Ga0105249_10079798
1368 Ga0105249_10148121
1369 Ga0105249_10203305
1370 Ga0105249_10461435
1371 Ga0105239_10000002
1372 Ga0105239_10000048
1373 Ga0105239_10000758
1374 Ga0105239_10001789
1375 Ga0105239_10001948
1376 Ga0105239_10002090
1377 Ga0105239_10002752
1378 Ga0105239_10005094
1379 Ga0105239_10008918
1380 Ga0105239_10016195
1381 Ga0105239_10024710
1382 Ga0105239_10039298
1383 Ga0105239_10045406
1384 Ga0105239_10078015
1385 Ga0105239_10087796
1386 Ga0105239_10121599
1387 Ga0105239_10166914
1388 Ga0105246_10028028
1389 Ga0105246_10053815
1390 Ga0105246_10249830
1391 Ga0157373_10000002
1392 Ga0157373_10000821
1393 Ga0157373_10002581
1394 Ga0157373_10019401
1395 Ga0157373_10020933
1396 Ga0157373_10092748
1397 Ga0157373_10097891
1398 Ga0157371_10000016
1399 Ga0157371_10000135
1400 Ga0157371_10000563
1401 Ga0157371_10001161
1402 Ga0157371_10001915
1403 Ga0157371_10003683
1404 Ga0157371_10005312
1405 Ga0157371_10009984
1406 Ga0157371_10018424
1407 Ga0157371_10034813
1408 Ga0157371_10077958
1409 Ga0157370_10000500
1410 Ga0157370_10001022
1411 Ga0157370_10001166
1412 Ga0157370_10005338
1413 Ga0157370_10006435
1414 Ga0157370_10007484
1415 Ga0157370_10010727
1416 Ga0157370_10014206
1417 Ga0157370_10014665
1418 Ga0157370_10017596
1419 Ga0157370_10031451
1420 Ga0157370_10036413
1421 Ga0157370_10039822
1422 Ga0157370_10262108
1423 Ga0157369_10000475
1424 Ga0157369_10001138
1425 Ga0157369_10046098
1426 Ga0157369_10051032
1427 Ga0157369_10057127
1428 Ga0157369_10081875
1429 Ga0157369_10086419
1430 Ga0157369_10117845
1431 Ga0157369_10159155
1432 Ga0157369_10231674
1433 Ga0157374_10000001
1434 Ga0157374_10000128
1435 Ga0157374_10000202
1436 Ga0157374_10004614
1437 Ga0157374_10028575
1438 Ga0157374_10034089
1439 Ga0157374_10051367
1440 Ga0157374_10054818
1441 Ga0157374_10099620
1442 Ga0157374_10297505
1443 Ga0157374_10492119
1444 Ga0157378_10005717
1445 Ga0157378_10005849
1446 Ga0157378_10010586
1447 Ga0157378_10043948
1448 Ga0157378_10107269
1449 Ga0157378_10260343
1450 Ga0157378_10290658
1451 Ga0163162_10000032
1452 Ga0163162_10000152
1453 Ga0163162_10009046
1454 Ga0163162_10011763
1455 Ga0163162_10015657
1456 Ga0163162_10016026
1457 Ga0163162_10029333
1458 Ga0163162_10052936
1459 Ga0163162_10054110
1460 Ga0163162_10095248
1461 Ga0163162_10295516
1462 Ga0163162_10459650
1463 Ga0157372_10000017
1464 Ga0157372_10000061
1465 Ga0157372_10000921
1466 Ga0157372_10003385
1467 Ga0157372_10004228
1468 Ga0157372_10018588
1469 Ga0157372_10020418
1470 Ga0157372_10142889
1471 Ga0157372_10151540
1472 Ga0157372_10166690
1473 Ga0157372_10207727
1474 Ga0157375_10037080
1475 Ga0157375_10040512
1476 Ga0157375_10045096
1477 Ga0157375_10045413
1478 Ga0157375_10123056
1479 Ga0157375_10174141
1480 Ga0157375_10202478
1481 Ga0157375_10205722
1482 Ga0157375_10480579
1483 Ga0157375_10578419
1484 Ga0163163_10000653
1485 Ga0163163_10195869
1486 Ga0163163_10403595
1487 Ga0157380_10162904
1488 Ga0157380_10168749
1489 Ga0157380_10234046
1490 Ga0182008_10000006
1491 Ga0182008_10000818
1492 Ga0182008_10001192
1493 Ga0157379_10001301
1494 Ga0157379_10180015
1495 Ga0157379_10206039
1496 Ga0157376_10000721
1497 Ga0157376_10001279
1498 Ga0157376_10008360
1499 Ga0157376_10025181
1500 Ga0157376_10037767
1501 Ga0157376_10055030
1502 Ga0157376_10067496
1503 Ga0182006_1000011
1504 Ga0182006_1000068
1505 Ga0182006_1000869
1506 Ga0182006_1001882
1507 Ga0182006_1003367
1508 Ga0182007_10000003
1509 Ga0183373_1001
1510 Ga0163161_10000012
1511 Ga0163161_10000074
1512 Ga0163161_10015370
1513 Ga0163161_10016813
1514 Ga0163161_10020644
1515 Ga0163161_10067138
1516 Ga0163161_10171589
1517 Ga0213872_10009314
1518 Ga0209436_103157
1519 Ga0207427_100103
1520 Ga0209437_100017
1521 Ga0209437_100101
1522 Ga0207425_1000002
1523 Ga0209646_1000002
1524 Ga0209646_1000745
1525 Ga0209026_1000434
1526 Ga0209026_1006913
1527 Ga0209129_1000002
1528 Ga0209233_1000124
1529 Ga0209130_1005416
1530 Ga0209675_1000033
1531 Ga0209676_1000008
1532 Ga0209676_1000425
1533 Ga0209025_1000004
1534 Ga0209758_1000006
1535 Ga0209758_1003065
1536 Ga0209050_1000045
1537 Ga0207426_1000002
1538 Ga0207426_1000051
1539 Ga0207426_1000497
1540 Ga0209257_1000001
1541 Ga0207656_10017547
1542 Ga0207682_10010357
1543 Ga0207710_10008558
1544 Ga0207688_10009386
1545 Ga0207680_10015585
1546 Ga0207680_10023544
1547 Ga0207680_10052159
1548 Ga0207647_10000105
1549 Ga0207647_10000511
1550 Ga0207647_10007406
1551 Ga0207647_10016870
1552 Ga0207647_10022172
1553 Ga0207647_10098536
1554 Ga0207645_10000622
1555 Ga0207645_10001210
1556 Ga0207645_10003591
1557 Ga0207645_10004714
1558 Ga0207643_10023368
1559 Ga0207643_10126218
1560 Ga0207705_10000079
1561 Ga0207705_10017692
1562 Ga0207705_10045764
1563 Ga0207705_10189042
1564 Ga0207654_10016294
1565 Ga0207654_10047242
1566 Ga0207707_10000051
1567 Ga0207707_10021406
1568 Ga0207707_10193606
1569 Ga0207695_10000013
1570 Ga0207695_10000084
1571 Ga0207695_10000323
1572 Ga0207695_10001232
1573 Ga0207695_10004447
1574 Ga0207695_10007846
1575 Ga0207695_10009118
1576 Ga0207695_10015643
1577 Ga0207695_10122675
1578 Ga0207695_10189847
1579 Ga0207695_10234174
1580 Ga0207671_10000272
1581 Ga0207671_10001497
1582 Ga0207671_10002907
1583 Ga0207671_10005889
1584 Ga0207671_10009491
1585 Ga0207671_10012189
1586 Ga0207671_10014622
1587 Ga0207671_10036318
1588 Ga0207671_10042678
1589 Ga0207671_10103071
1590 Ga0207671_10121560
1591 Ga0207671_10220780
1592 Ga0207671_10335001
1593 Ga0207660_10009778
1594 Ga0207662_10016297
1595 Ga0207662_10019350
1596 Ga0207657_10059750
1597 Ga0207657_10082590
1598 Ga0207657_10350426
1599 Ga0207649_10017077
1600 Ga0207652_10000384
1601 Ga0207652_10001696
1602 Ga0207652_10014179
1603 Ga0207652_10015091
1604 Ga0207694_10077795
1605 Ga0207694_10094692
1606 Ga0207694_10195493
1607 Ga0207694_10247457
1608 Ga0207650_10019073
1609 Ga0207650_10042343
1610 Ga0207650_10070695
1611 Ga0207659_10008155
1612 Ga0207659_10037371
1613 Ga0207659_10053334
1614 Ga0207659_10163272
1615 Ga0207687_10106215
1616 Ga0207644_10120271
1617 Ga0207644_10168342
1618 Ga0207690_10000318
1619 Ga0207690_10013661
1620 Ga0207690_10160203
1621 Ga0207706_10000120
1622 Ga0207706_10029817
1623 Ga0207706_10049670
1624 Ga0207706_10099200
1625 Ga0207706_10211759
1626 Ga0207686_10024502
1627 Ga0207670_10107261
1628 Ga0207670_10126200
1629 Ga0207704_10000099
1630 Ga0207704_10028986
1631 Ga0207704_10073370
1632 Ga0207704_10212037
1633 Ga0207691_10002527
1634 Ga0207691_10023686
1635 Ga0207691_10027226
1636 Ga0207691_10042760
1637 Ga0207691_10052586
1638 Ga0207691_10066643
1639 Ga0207691_10194754
1640 Ga0207689_10003051
1641 Ga0207689_10008841
1642 Ga0207689_10077529
1643 Ga0207689_10107260
1644 Ga0207689_10125004
1645 Ga0207689_10157763
1646 Ga0207689_10234984
1647 Ga0207661_10033412
1648 Ga0207661_10055683
1649 Ga0207661_10119674
1650 Ga0207661_10250394
1651 Ga0207679_10007258
1652 Ga0207679_10026046
1653 Ga0207667_10000037
1654 Ga0207667_10000135
1655 Ga0207667_10007957
1656 Ga0207667_10011669
1657 Ga0207667_10017914
1658 Ga0207667_10028059
1659 Ga0207667_10028127
1660 Ga0207667_10038231
1661 Ga0207667_10048612
1662 Ga0207667_10164208
1663 Ga0207667_10209178
1664 Ga0207667_10345220
1665 Ga0207667_10533199
1666 Ga0207651_10005116
1667 Ga0207651_10124360
1668 Ga0207651_10144307
1669 Ga0207651_10156626
1670 Ga0207712_10007103
1671 Ga0207712_10355651
1672 Ga0207668_10000540
1673 Ga0207668_10118577
1674 Ga0207668_10250364
1675 Ga0207640_10052155
1676 Ga0207658_10039183
1677 Ga0207658_10049171
1678 Ga0207658_10181257
1679 Ga0207677_10004313
1680 Ga0207677_10014691
1681 Ga0207677_10019806
1682 Ga0207677_10059201
1683 Ga0207677_10074545
1684 Ga0207677_10253314
1685 Ga0207703_10001644
1686 Ga0207703_10201182
1687 Ga0207639_10001126
1688 Ga0207639_10016182
1689 Ga0207639_10119624
1690 Ga0207639_10140418
1691 Ga0207639_10149561
1692 Ga0207639_10210951
1693 Ga0207639_10285933
1694 Ga0207678_10038074
1695 Ga0207678_10068160
1696 Ga0207678_10224546
1697 Ga0207708_10160493
1698 Ga0207702_10000196
1699 Ga0207702_10057179
1700 Ga0207702_10074879
1701 Ga0207702_10093576
1702 Ga0207702_10104078
1703 Ga0207702_10447303
1704 Ga0207641_10000253
1705 Ga0207641_10018015
1706 Ga0207641_10052914
1707 Ga0207641_10111008
1708 Ga0207641_10153753
1709 Ga0207648_10002506
1710 Ga0207648_10004019
1711 Ga0207648_10018210
1712 Ga0207648_10034323
1713 Ga0207648_10036449
1714 Ga0207648_10042309
1715 Ga0207676_10063266
1716 Ga0207676_10223176
1717 Ga0207676_10348413
1718 Ga0207676_10355882
1719 Ga0207674_10000672
1720 Ga0207674_10006740
1721 Ga0207674_10114299
1722 Ga0207674_10160935
1723 Ga0207674_10178043
1724 Ga0207675_100014435
1725 Ga0207675_100066138
1726 Ga0207675_100134293
1727 Ga0207683_10003712
1728 Ga0207683_10005010
1729 Ga0207683_10057036
1730 Ga0207683_10065629
1731 Ga0207683_10117716
1732 Ga0207698_10001082
1733 Ga0207698_10011290
1734 Ga0207698_10055732
1735 Ga0209281_1000094
1736 Ga0209995_1001337
1737 Ga0209968_1002355
1738 Ga0210002_1001420
1739 Ga0209282_1106414
1740 Ga0209974_10017789
1741 Ga0268266_10000018
1742 Ga0268266_10085801
1743 Ga0268266_10090778
1744 Ga0268265_10014622
1745 Ga0268265_10099403
1746 Ga0268264_10001720
1747 Ga0268264_10009362
1748 Ga0268264_10047708
1749 Ga0307517_10002048
1750 Ga0307517_10004683
1751 Ga0307515_10000681
1752 Ga0307515_10001752
1753 Ga0307515_10002910
1754 Ga0307515_10014453
1755 Ga0307515_10081729
1756 Ga0307515_10093645
1757 Ga0307515_10229784
1758 Ga0265338_10001687
1759 Ga0316177_1198244
1760 Ga0316176_1050137
1761 Ga0316183_1065995
1762 Ga0316181_1148726
1763 Ga0265327_10000010
1764 Ga0307513_10156292
1765 Ga0307509_10048545
1766 Ga0307408_100002250
1767 Ga0307508_10002100
1768 Ga0316576_10075969
1769 Ga0316578_10057826
1770 Ga0307516_10003117
1771 Ga0307405_10000003
1772 Ga0307405_10014179
1773 Ga0307405_10059446
1774 Ga0307413_10115686
1775 Ga0307413_10143113
1776 Ga0307413_10178076
1777 Ga0307410_10000067
1778 Ga0307410_10194020
1779 Ga0307406_10000035
1780 Ga0307406_10117919
1781 Ga0307407_10000008
1782 Ga0307407_10063361
1783 Ga0307412_10000427
1784 Ga0307412_10037619
1785 Ga0307409_100008566
1786 Ga0307416_100000009
1787 Ga0307416_100000639
1788 Ga0307416_100113426
1789 Ga0307414_10000009
1790 Ga0307414_10000038
1791 Ga0307414_10000063
1792 Ga0307414_10002879
1793 Ga0307414_10004631
1794 Ga0307414_10008231
1795 Ga0307414_10012334
1796 Ga0307414_10034651
1797 Ga0307414_10105314
1798 Ga0307414_10242776
1799 Ga0307411_10000001
1800 Ga0307507_10000064
1801 Ga0307510_10002860
1802 Ga0307510_10041880
1803 Ga0373927_0005849
1804 Ga0373927_0037163
1805 Ga0373937_0023482
1806 Ga0373937_0152899
1807 Ga0373937_0250410
1808 Ga0316582_0060474
1809 Ga0316584_0027245
1810 Ga0316584_0122674
1811 Ga0373925_0104333
1812 Ga0395899_0000025
1813 Ga0395899_0000493
1814 Ga0395899_0000629
1815 Ga0395899_0001884
1816 Ga0395899_0029186
1817 Ga0395899_0029721
1818 Ga0395899_0041383
1819 Ga0395899_0066951
1820 Ga0395899_0133975
1821 Ga0395900_0000480
1822 Ga0395900_0000506
1823 Ga0395900_0006601
1824 Ga0395900_0009920
1825 Ga0395900_0012177
1826 Ga0395900_0108003
1827 Ga0395900_0175354
1828 Ga0395900_0179537
1829 Ga0395898_0001651
1830 Ga0395898_0032624
1831 Ga0395898_0041094
1832 Ga0395898_0056108
1833 Ga0395905_0000254
1834 Ga0395905_0000738
1835 Ga0395905_0001166
1836 Ga0395905_0006569
1837 Ga0395901_0000853
1838 Ga0395901_0004350
1839 Ga0395901_0010578
1840 Ga0395901_0059253
1841 Ga0395901_0067844
1842 Ga0395901_0081109
1843 Ga0395901_0119295
1844 Ga0436361_0021149
1845 Ga0439447_011193
1846 Ga0439466_0001850
1847 Ga0439448_0022307
1848 Ga0439449_0000697
1849 Ga0451577_0000010
1850 Ga0451577_0011492
1851 Ga0451577_0068138
1852 Ga0451577_0097018
1853 Ga0451577_0214216
1854 Ga0451577_0370719
1855 Ga0466969_0000912
1856 Ga0466969_0053439
1857 Ga0466969_0098395
1858 Ga0466972_0000013
1859 Ga0466972_0005607
1860 Ga0453683_0000031
1861 Ga0453683_0001482
1862 Ga0453683_0085783
1863 Ga0466966_0000045
1864 Ga0466966_0053935
1865 Ga0466961_0066482
1866 Ga0466961_0088177
1867 Ga0453684_0000191
1868 Ga0453684_0009766
1869 Ga0453684_0072910
1870 Ga0453684_0097891
1871 Ga0453684_0178992
1872 Ga0453684_0192947
1873 Ga0453684_0311331
1874 Ga0453684_0442253
1875 Ga0466968_0089549
1876 Ga0466970_0018485
1877 Ga0466970_0069434
1878 Ga0466957_0003333
1879 Ga0466957_0152139
1880 Ga0466959_0000023
1881 Ga0466959_0083862
1882 Ga0451576_0000088
1883 Ga0451576_0007064
1884 Ga0451576_0027120
1885 Ga0451576_0040329
1886 Ga0451576_0204986
1887 Ga0495629_0035357
1888 Ga0495638_0049677
1889 Ga0495651_0090903
1890 Ga0495650_0000087
1891 Ga0495585_0000286
1892 Ga0495585_0001651
1893 Ga0495583_0094765
1894 Ga0495606_0000052
1895 Ga0495606_0014847
1896 Ga0495610_0000001
1897 Ga0495610_0000903
1898 Ga0495610_0006770
1899 Ga0495610_0010020
1900 Ga0495616_0005196
1901 Ga0495618_0007268
1902 Ga0495628_0017891
1903 Ga0495630_0049633
1904 Ga0495630_0116104
1905 Ga0495631_0027708
1906 Ga0495644_0007188
1907 Ga0495648_0077885
1908 Ga0495640_0061455
1909 Ga0495598_0027721
1910 Ga0495633_0000080
1911 Ga0495633_0000081
1912 Ga0495633_0072173
1913 Ga0495668_0000012
1914 Ga0495634_0069334
1915 Ga0495625_0000036
1916 Ga0495625_0002289
1917 Ga0495625_0010136
1918 Ga0495625_0014574
1919 Ga0495625_0021139
1920 Ga0495625_0043637
1921 Ga0495625_0091239
1922 Ga0495625_0233913
1923 Ga0495661_0003611
1924 Ga0495661_0092978
1925 Ga0495646_0058441
1926 Ga0495658_0017216
1927 Ga0495658_0020389
1928 Ga0495669_0058397
1929 Ga0495613_0161327
1930 Ga0495649_0000017
1931 Ga0495589_0123181
1932 Ga0495660_0013731
1933 Ga0495674_0018467
1934 Ga0495683_0023732
1935 Ga0495687_055425
1936 Ga0495673_0068477
1937 Ga0495684_0161177
1938 Ga0495686_0000004
1939 Ga0495686_0000582
1940 Ga0495686_0005494
1941 Ga0495686_0020028
1942 Ga0496109_0054915
1943 Ga0496114_0000594
1944 Ga0496114_0369263
1945 Ga0496115_0007421
1946 Ga0496115_0045415
1947 Ga0496116_0000032
1948 Ga0496121_0091005
1949 Ga0496122_0001208
1950 Ga0496123_0008537
1951 Ga0496124_0111474
1952 Ga0496124_0126449
1953 Ga0496125_0000059
1954 Ga0496125_0011341
1955 Ga0496126_0008790
1956 Ga0496126_0022457
1957 Ga0496126_0212279
1958 Ga0495678_014851
1959 Ga0501031_0003605
1960 Ga0501032_0091050
1961 Ga0501033_0010675
1962 Ga0501034_0004012
1963 Ga0501034_0016530
1964 Ga0501034_0025459
1965 Ga0501034_0027052
1966 Ga0501034_0146271
1967 Ga0501034_0330791
1968 Ga0501036_0041913
1969 Ga0501037_0039086
1970 Ga0501038_0012291
1971 Ga0501039_0022501
1972 Ga0501043_0009607
1973 Ga0501043_0024314
1974 Ga0501043_0028424
1975 Ga0501046_0024666
1976 Ga0501046_0045170
1977 Ga0501046_0239907
1978 Ga0501047_0021075
1979 Ga0501047_0027231
1980 Ga0501047_0066956
1981 Ga0501047_0072959
1982 Ga0501047_0332711
1983 Ga0501048_0043141
1984 Ga0501067_0095409
1985 Ga0501068_0153904
1986 Ga0501069_0081356
1987 Ga0501073_0019693
1988 Ga0501074_0062516
1989 Ga0501198_002157
1990 Ga0501202_002208
1991 Ga0501217_000620
1992 Ga0501217_022688
1993 Ga0501233_010478
1994 Ga0501243_008416
1995 Ga0501249_000037
1996 Ga0501249_008390
1997 Ga0501249_008602
1998 Ga0501249_009305
1999 Ga0501257_016312
2000 Ga0501219_000052
2001 Ga0501221_000044
2002 Ga0501225_0001739
2003 Ga0501225_0013111
2004 Ga0501245_002249
2005 Ga0501080_0057861
2006 Ga0501080_0123580
2007 Ga0501241_000031
2008 Ga0501266_000011
2009 Ga0501035_0015438
2010 Ga0501035_0027505
2011 Ga0501044_0009636
2012 Ga0501044_0017840
2013 Ga0501044_0028924
2014 Ga0501044_0052694
2015 Ga0501284_00029
2016 nmdc:mga0k408_3518_c1
2017 nmdc:mga0k408_41458_c1
2018 nmdc:mga0k408_749_c1
2019 nmdc:mga0k408_821_c1
2020 nmdc:mga05p37_13616_c1
2021 nmdc:mga09592_983_c1
2022 nmdc:mga0qj67_97741_c1
2023 Ga0500635_0002671
2024 Ga0495619_0170484
2025 Ga0500578_0004418
2026 Ga0500646_0001428
2027 Ga0500646_0004317
2028 Ga0500583_0000108
2029 Ga0500651_0000084
2030 Ga0500651_0064350
2031 Ga0500641_0000017
2032 Ga0500641_0002621
2033 Ga0500594_0003311
2034 Ga0500608_016279
2035 Ga0500618_000002
2036 Ga0500652_037526
2037 Ga0500658_0000003
2038 Ga0500589_003337
2039 Ga0500616_0145895
2040 Ga0500622_0000777
2041 Ga0500622_0004557
2042 Ga0500624_000271
2043 Ga0500636_0044658
2044 Ga0500584_014924
2045 Ga0500611_000022
2046 Ga0466962_0023524
2047 2511234750
2048 2513235060
2049 2520879408
2050 2522551056
2051 2524004500
2052 2585158508
2053 2585162854
2054 2586210050
2055 2599478340
2056 2644013061
2057 2644372379
2058 2644642605
2059 2644684851
2060 2738732463
2061 2738757065
2062 2738760402
2063 2738765028
2064 2738851781
2065 2739214043
2066 2739302549
2067 2739590671
2068 2739617093
2069 2739647398
2070 2740001323
2071 2740006139
2072 2776612453
2073 2802653773
2074 2817416276
2075 2819546345
2076 2819588775
2077 2833643626
2078 2842725022
2079 2842908876
2080 2842914186
2081 2849286580
2082 2852623164
2083 2852630368
2084 2857614954
2085 2857618658
2086 2857630290
2087 2881363107
2088 2884635381
2089 2884795632
2090 2884937971
2091 2903896890
2092 2904422793
2093 2904448666
2094 2904557071
2095 2914759720
2096 2919189655
2097 2919195305
2098 2919440792
2099 2919685973
2100 2919695677
2101 2928080610
2102 2928150835
2103 2929153564
2104 2929178797
2105 2932083005
2106 2939667881
2107 2945981199
2108 2946001964
2109 2946019399
2110 2954018848
2111 2958461118
2112 2977232530
2113 2977270228
2114 8003153679
2115 8054310082
2116 8055421935
2117 8055589911
2118 8055593425
2119 8056443836

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

64

379

0.94

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

55

233

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbt-assembly1.cif.gz_C-2 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9043 43 332
3ly1-assembly1.cif.gz_B crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution 0.9022 43 332
3ftb-assembly2.cif.gz_E the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.9018 35 332
4r5z-assembly2.cif.gz_D crystal structure of rv3772 encoded aminotransferase 0.8977 35 332
3ftb-assembly2.cif.gz_D the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.8947 35 332
ID Description Score Start End Superfamily
af_P06986_261_350_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9944 240 328 3.90.1150.10
af_P36605_51_267_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9746 44 238 3.40.640.10
af_P06986_261_350_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9726 240 328 3.90.1150.10
af_P07172_76_273_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.969 55 237 3.40.640.10
1fg7A01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9622 41 238 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A376W9F3-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) 0.9944 249 333 GO:0004400
GO:0008652
GO:0030170
AF-A0A645C0K0-F1-model_v4 Histidine biosynthesis bifunctional protein HisB 0.9889 251 332 GO:0000105
GO:0004424
GO:0030170
AF-A0A7S2TT69-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.988 45 332 GO:0000105
GO:0004400
GO:0030170
AF-A0A1F3N601-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9812 191 333 GO:0000105
GO:0008483
GO:0030170
AF-A0A705R659-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.9798 60 333 GO:0000105
GO:0004400
GO:0030170

Map