F489255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1059 | 487 | 2118 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0043593|Ga0495583_0043593_155_1156 |
| Length | 325 |
| Sequence | MGLLVDGHWQDKWYESSKDGAFQREQAKRRNWVTANGEPGPSGEGGFAAEAGRYHLYVSLACPWAHRTLILRKLKGLESLIDVSVVSWLMLENGWTFDTALGSTGDKLDGFDFMHQRYTADTADYTGRVTVPVLWDKKLKRIVSNESAEIIRMFNSAFDDLTGNDLDFYPAPLRGEIDALNERIYPAVNNGVYRAGFATSQQAYEELDHLEGVLSANRYLSGEYLTEADVRLFTTIIRFDAVYHGHFKCNLQRIADYPNLSNWLRELYQLPGIAETVDFQHIKNHYYGSHKTINPTGVVPKGPEQDFTVAHDRARLAGKGVWLKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 36 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 37 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 60 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 97 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 99 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 100 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 101 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 102 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 115 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 116 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 117 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 118 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 119 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 120 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 121 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 122 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 123 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 124 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 125 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 126 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 127 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 128 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 129 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 130 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 131 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 132 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 133 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 134 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 135 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 136 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 137 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 138 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 139 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 140 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 141 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 142 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 143 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 144 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 145 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 227 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 231 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 232 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 233 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 234 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 247 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 248 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 249 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 250 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 251 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 252 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 253 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 254 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 255 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 256 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 257 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 258 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 259 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 260 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 261 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 262 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 263 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 264 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 265 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 266 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 267 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 268 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 269 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 270 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 271 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 272 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 273 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 274 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 275 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 276 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 277 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 278 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 279 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 280 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 281 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 282 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 283 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 284 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 285 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 286 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 287 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 288 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 289 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 290 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 291 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 292 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 293 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 294 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 295 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 296 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 297 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 298 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 299 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 300 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 301 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 302 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 303 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 304 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 305 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 306 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 307 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 308 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 309 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 310 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 311 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 312 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 313 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 314 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 315 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 316 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 317 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 318 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 319 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 320 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 321 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 322 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 323 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 324 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 325 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 326 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 327 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 328 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 329 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 330 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 331 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 332 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 333 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 334 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 335 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 336 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 337 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 338 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 339 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 340 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 341 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 342 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 343 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 344 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 345 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 346 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 347 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 348 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 349 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 350 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 351 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 352 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 353 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 354 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 355 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 356 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 357 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 358 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 359 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 360 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 361 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 362 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 363 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 364 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 365 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 366 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 367 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 368 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 369 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 370 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 371 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 372 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 373 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 374 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 375 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 376 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 377 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 378 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 379 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 380 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 381 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 382 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 383 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 384 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 385 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 386 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 387 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 388 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 389 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 390 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 391 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 392 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 393 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 394 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 395 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 396 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 397 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 398 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 399 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 400 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 401 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 402 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 403 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 404 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 405 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 406 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 407 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 408 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 409 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 410 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 411 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 412 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 413 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 414 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 415 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 416 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 417 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 418 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 419 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 420 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 421 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 422 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 423 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 424 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 425 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 426 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 427 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 428 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 429 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 430 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 431 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 432 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 433 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 434 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 435 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 436 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 437 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 438 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 439 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 440 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 441 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 442 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 443 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 444 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 445 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 446 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 447 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 448 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 449 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 450 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 451 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 452 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 453 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 454 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 455 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 456 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 457 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 458 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 459 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 460 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 461 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 462 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 463 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 464 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 465 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 466 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 467 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 468 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 469 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 470 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 471 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 472 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 473 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 474 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 475 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 476 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 477 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 478 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 479 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 480 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 481 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 482 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 483 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 484 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 485 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 486 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 487 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.05 |
| Metatranscriptomes | 0.19 |
| Isolates | 22.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.72 |
| Nodule | 2.36 |
| Rhizoplane | 7.37 |
| Rhizosphere | 72.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495583_0043593 | 3300046506 | Bacteria | 2087 |
| 2 | MRS2a_Contig_29 | 2124908027 | Bacteria | 60739 |
| 3 | SwRhRL2b_contig_2231633 | 2162886007 | Bacteria | 4752 |
| 4 | SwRhRL2b_contig_52614 | 2162886007 | Bacteria | 2112 |
| 5 | MRS1b_contig_7358983 | 2162886011 | Bacteria | 2650 |
| 6 | JGI25162J39368_1000127 | 3300002737 | Bacteria | 83866 |
| 7 | JGI25164J39214_1000044 | 3300002772 | Bacteria | 125916 |
| 8 | JGI25165J46597_1000131 | 3300003214 | Bacteria | 125895 |
| 9 | Ga0055538_1000088 | 3300003751 | Bacteria | 78763 |
| 10 | Ga0055539_1000132 | 3300003752 | Bacteria | 78763 |
| 11 | Ga0055533_1000135 | 3300003756 | Bacteria | 78763 |
| 12 | Ga0055532_1000178 | 3300003758 | Bacteria | 54660 |
| 13 | Ga0055525_1000243 | 3300003759 | Bacteria | 55208 |
| 14 | Ga0055536_1000949 | 3300003781 | Bacteria | 18581 |
| 15 | Ga0055530_10000006 | 3300003791 | Bacteria | 198584 |
| 16 | Ga0055530_10000141 | 3300003791 | Bacteria | 64443 |
| 17 | Ga0055530_10000514 | 3300003791 | Bacteria | 33769 |
| 18 | Ga0055540_1000171 | 3300003792 | Bacteria | 64443 |
| 19 | Ga0055540_1000180 | 3300003792 | Bacteria | 61921 |
| 20 | Ga0055540_1000781 | 3300003792 | Bacteria | 21560 |
| 21 | Ga0055531_10000497 | 3300003794 | Bacteria | 36024 |
| 22 | Ga0055541_1000087 | 3300003841 | Bacteria | 78763 |
| 23 | Ga0065714_10004018 | 3300005288 | Bacteria | 6093 |
| 24 | Ga0065714_10065466 | 3300005288 | Bacteria | 9916 |
| 25 | Ga0065714_10066674 | 3300005288 | Bacteria | 6485 |
| 26 | Ga0065714_10073365 | 3300005288 | Bacteria | 3198 |
| 27 | Ga0065714_10095612 | 3300005288 | Bacteria | 1766 |
| 28 | Ga0065704_10002729 | 3300005289 | Bacteria | 5743 |
| 29 | Ga0065704_10003525 | 3300005289 | Bacteria | 7213 |
| 30 | Ga0065704_10083272 | 3300005289 | Bacteria | 3487 |
| 31 | Ga0065704_10109234 | 3300005289 | Bacteria | 2008 |
| 32 | Ga0065704_10130893 | 3300005289 | Bacteria | 1630 |
| 33 | Ga0065712_10067850 | 3300005290 | Bacteria | 25844 |
| 34 | Ga0065712_10086885 | 3300005290 | Bacteria | 2610 |
| 35 | Ga0065715_10007242 | 3300005293 | Bacteria | 6078 |
| 36 | Ga0070670_100003187 | 3300005331 | Bacteria | 13543 |
| 37 | Ga0070670_100028637 | 3300005331 | Bacteria | 4794 |
| 38 | Ga0070661_100000953 | 3300005344 | Bacteria | 20617 |
| 39 | Ga0070661_100068936 | 3300005344 | Bacteria | 2600 |
| 40 | Ga0070669_100013899 | 3300005353 | Bacteria | 5725 |
| 41 | Ga0070669_100029203 | 3300005353 | Bacteria | 3974 |
| 42 | Ga0068853_100365983 | 3300005539 | Bacteria | 1344 |
| 43 | Ga0070665_100047675 | 3300005548 | Bacteria | 4300 |
| 44 | Ga0068855_100119874 | 3300005563 | Bacteria | 3012 |
| 45 | Ga0070664_100000930 | 3300005564 | Bacteria | 22907 |
| 46 | Ga0068854_100232885 | 3300005578 | Bacteria | 1463 |
| 47 | Ga0068852_100006493 | 3300005616 | Bacteria | 8454 |
| 48 | Ga0068851_10000225 | 3300005834 | Bacteria | 27120 |
| 49 | Ga0075364_10021175 | 3300006051 | Bacteria | 4096 |
| 50 | Ga0075364_10032764 | 3300006051 | Bacteria | 3341 |
| 51 | Ga0075364_10062463 | 3300006051 | Bacteria | 2444 |
| 52 | Ga0075364_10144184 | 3300006051 | Bacteria | 1603 |
| 53 | Ga0075432_10001148 | 3300006058 | Bacteria | 8469 |
| 54 | Ga0075432_10006989 | 3300006058 | Bacteria | 3845 |
| 55 | Ga0075432_10023249 | 3300006058 | Bacteria | 2122 |
| 56 | Ga0075432_10024494 | 3300006058 | Bacteria | 2068 |
| 57 | Ga0075432_10049301 | 3300006058 | Bacteria | 1483 |
| 58 | Ga0075362_10039371 | 3300006177 | Bacteria | 2078 |
| 59 | Ga0099823_1000047 | 3300006944 | Bacteria | 58430 |
| 60 | Ga0079104_1001334 | 3300006946 | Bacteria | 16926 |
| 61 | Ga0079104_1014206 | 3300006946 | Bacteria | 2412 |
| 62 | Ga0099826_10028691 | 3300006948 | Bacteria | 4065 |
| 63 | Ga0105251_10000879 | 3300009011 | Bacteria | 26931 |
| 64 | Ga0105251_10007077 | 3300009011 | Bacteria | 6990 |
| 65 | Ga0105251_10009600 | 3300009011 | Bacteria | 5698 |
| 66 | Ga0105251_10011882 | 3300009011 | Bacteria | 4947 |
| 67 | Ga0105251_10012556 | 3300009011 | Bacteria | 4788 |
| 68 | Ga0105251_10030321 | 3300009011 | Bacteria | 2717 |
| 69 | Ga0105251_10047016 | 3300009011 | Bacteria | 2075 |
| 70 | Ga0105244_10001520 | 3300009036 | Bacteria | 18538 |
| 71 | Ga0105244_10001546 | 3300009036 | Bacteria | 18335 |
| 72 | Ga0105244_10001608 | 3300009036 | Bacteria | 17940 |
| 73 | Ga0105244_10001994 | 3300009036 | Bacteria | 15737 |
| 74 | Ga0105244_10002919 | 3300009036 | Bacteria | 12625 |
| 75 | Ga0105244_10008116 | 3300009036 | Bacteria | 6592 |
| 76 | Ga0105244_10034687 | 3300009036 | Bacteria | 2655 |
| 77 | Ga0105244_10035928 | 3300009036 | Bacteria | 2599 |
| 78 | Ga0105244_10036170 | 3300009036 | Bacteria | 2588 |
| 79 | Ga0105244_10057701 | 3300009036 | Bacteria | 1961 |
| 80 | Ga0105250_10000341 | 3300009092 | Bacteria | 35829 |
| 81 | Ga0105250_10001132 | 3300009092 | Bacteria | 15024 |
| 82 | Ga0105250_10004856 | 3300009092 | Bacteria | 6115 |
| 83 | Ga0105250_10019726 | 3300009092 | Bacteria | 2726 |
| 84 | Ga0105250_10033411 | 3300009092 | Bacteria | 2066 |
| 85 | Ga0105250_10061558 | 3300009092 | Bacteria | 1509 |
| 86 | Ga0105240_10159328 | 3300009093 | Bacteria | 2682 |
| 87 | Ga0105243_10000151 | 3300009148 | Bacteria | 79574 |
| 88 | Ga0105243_10001008 | 3300009148 | Bacteria | 26043 |
| 89 | Ga0105243_10157861 | 3300009148 | Bacteria | 1953 |
| 90 | Ga0105241_10054693 | 3300009174 | Bacteria | 3056 |
| 91 | Ga0105242_10004290 | 3300009176 | Bacteria | 11109 |
| 92 | Ga0105237_10001147 | 3300009545 | Bacteria | 35599 |
| 93 | Ga0105246_10000476 | 3300011119 | Bacteria | 21621 |
| 94 | Ga0105246_10018688 | 3300011119 | Bacteria | 4419 |
| 95 | Ga0157373_10004090 | 3300013100 | Bacteria | 10988 |
| 96 | Ga0157373_10011062 | 3300013100 | Bacteria | 6645 |
| 97 | Ga0157373_10025888 | 3300013100 | Bacteria | 4240 |
| 98 | Ga0157373_10038723 | 3300013100 | Bacteria | 3416 |
| 99 | Ga0157373_10050375 | 3300013100 | Bacteria | 2965 |
| 100 | Ga0157371_10000053 | 3300013102 | Bacteria | 176879 |
| 101 | Ga0157371_10001610 | 3300013102 | Bacteria | 23138 |
| 102 | Ga0157371_10006950 | 3300013102 | Bacteria | 9220 |
| 103 | Ga0157371_10013339 | 3300013102 | Bacteria | 6247 |
| 104 | Ga0157371_10019765 | 3300013102 | Bacteria | 4962 |
| 105 | Ga0157371_10332011 | 3300013102 | Bacteria | 1105 |
| 106 | Ga0157370_10002669 | 3300013104 | Bacteria | 21392 |
| 107 | Ga0157370_10050327 | 3300013104 | Bacteria | 3983 |
| 108 | Ga0157370_10074543 | 3300013104 | Bacteria | 3201 |
| 109 | Ga0157370_10113025 | 3300013104 | Bacteria | 2538 |
| 110 | Ga0157370_10291400 | 3300013104 | Bacteria | 1507 |
| 111 | Ga0157369_10001616 | 3300013105 | Bacteria | 27583 |
| 112 | Ga0157369_10017393 | 3300013105 | Bacteria | 8081 |
| 113 | Ga0157369_10019350 | 3300013105 | Bacteria | 7617 |
| 114 | Ga0157369_10125138 | 3300013105 | Bacteria | 2726 |
| 115 | Ga0163162_10019039 | 3300013306 | Bacteria | 6733 |
| 116 | Ga0163162_10133382 | 3300013306 | Bacteria | 2594 |
| 117 | Ga0157372_10000397 | 3300013307 | Bacteria | 48139 |
| 118 | Ga0157372_10014536 | 3300013307 | Bacteria | 8424 |
| 119 | Ga0157372_10034548 | 3300013307 | Bacteria | 5559 |
| 120 | Ga0157375_10016181 | 3300013308 | Bacteria | 6690 |
| 121 | Ga0157375_10064549 | 3300013308 | Bacteria | 3646 |
| 122 | Ga0182008_10002381 | 3300014497 | Bacteria | 11817 |
| 123 | Ga0182008_10018705 | 3300014497 | Bacteria | 3586 |
| 124 | Ga0182008_10020297 | 3300014497 | Bacteria | 3423 |
| 125 | Ga0182008_10028531 | 3300014497 | Bacteria | 2822 |
| 126 | Ga0182008_10041398 | 3300014497 | Bacteria | 2297 |
| 127 | Ga0182008_10052154 | 3300014497 | Bacteria | 2028 |
| 128 | Ga0182006_1009804 | 3300015261 | Bacteria | 4282 |
| 129 | Ga0182006_1010326 | 3300015261 | Bacteria | 4154 |
| 130 | Ga0182006_1018019 | 3300015261 | Bacteria | 2989 |
| 131 | Ga0182006_1028252 | 3300015261 | Bacteria | 2283 |
| 132 | Ga0182006_1030795 | 3300015261 | Bacteria | 2166 |
| 133 | Ga0182006_1033181 | 3300015261 | Bacteria | 2070 |
| 134 | Ga0182007_10000204 | 3300015262 | Bacteria | 40001 |
| 135 | Ga0182007_10026827 | 3300015262 | Bacteria | 1992 |
| 136 | Ga0182005_1000114 | 3300015265 | Bacteria | 57889 |
| 137 | Ga0182005_1005080 | 3300015265 | Bacteria | 4150 |
| 138 | Ga0182005_1010020 | 3300015265 | Bacteria | 2736 |
| 139 | Ga0182005_1020499 | 3300015265 | Bacteria | 1818 |
| 140 | Ga0163161_10012139 | 3300017792 | Bacteria | 5976 |
| 141 | Ga0163161_10023321 | 3300017792 | Bacteria | 4365 |
| 142 | Ga0163161_10028722 | 3300017792 | Bacteria | 3951 |
| 143 | Ga0163161_10116816 | 3300017792 | Bacteria | 2000 |
| 144 | Ga0209435_100552 | 3300025206 | Bacteria | 7092 |
| 145 | Ga0209760_100026 | 3300025207 | Bacteria | 153418 |
| 146 | Ga0209784_100126 | 3300025224 | Bacteria | 78815 |
| 147 | Ga0209566_100152 | 3300025225 | Bacteria | 78864 |
| 148 | Ga0209674_100177 | 3300025226 | Bacteria | 78864 |
| 149 | Ga0209147_100179 | 3300025229 | Bacteria | 78864 |
| 150 | Ga0209563_100142 | 3300025230 | Bacteria | 78864 |
| 151 | Ga0209563_100333 | 3300025230 | Bacteria | 18329 |
| 152 | Ga0207427_100015 | 3300025231 | Bacteria | 542133 |
| 153 | Ga0209437_100027 | 3300025233 | Bacteria | 542133 |
| 154 | Ga0209258_100366 | 3300025242 | Bacteria | 59744 |
| 155 | Ga0209646_1000368 | 3300025246 | Bacteria | 29966 |
| 156 | Ga0209677_100125 | 3300025253 | Bacteria | 78864 |
| 157 | Ga0209759_1002270 | 3300025256 | Bacteria | 8711 |
| 158 | Ga0209233_1000039 | 3300025261 | Bacteria | 542133 |
| 159 | Ga0209675_1010889 | 3300025291 | Bacteria | 3064 |
| 160 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 161 | Ga0209676_1000017 | 3300025292 | Bacteria | 643409 |
| 162 | Ga0209676_1000154 | 3300025292 | Bacteria | 166013 |
| 163 | Ga0209676_1000292 | 3300025292 | Bacteria | 101778 |
| 164 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 165 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 166 | Ga0209050_1000062 | 3300025298 | Bacteria | 316538 |
| 167 | Ga0209050_1000508 | 3300025298 | Bacteria | 65889 |
| 168 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 169 | Ga0209051_1000060 | 3300025303 | Bacteria | 257304 |
| 170 | Ga0209051_1000380 | 3300025303 | Bacteria | 63324 |
| 171 | Ga0209257_1000056 | 3300025304 | Bacteria | 403132 |
| 172 | Ga0207656_10000492 | 3300025321 | Bacteria | 13055 |
| 173 | Ga0207696_1000018 | 3300025711 | Bacteria | 478605 |
| 174 | Ga0207696_1000051 | 3300025711 | Bacteria | 276833 |
| 175 | Ga0207696_1000090 | 3300025711 | Bacteria | 188474 |
| 176 | Ga0207696_1003006 | 3300025711 | Bacteria | 7881 |
| 177 | Ga0207696_1004308 | 3300025711 | Bacteria | 6158 |
| 178 | Ga0207696_1008545 | 3300025711 | Bacteria | 3900 |
| 179 | Ga0207696_1049185 | 3300025711 | Bacteria | 1210 |
| 180 | Ga0207655_1000081 | 3300025728 | Bacteria | 214272 |
| 181 | Ga0207655_1000140 | 3300025728 | Bacteria | 139110 |
| 182 | Ga0207655_1000273 | 3300025728 | Bacteria | 81003 |
| 183 | Ga0207655_1000362 | 3300025728 | Bacteria | 64760 |
| 184 | Ga0207655_1000451 | 3300025728 | Bacteria | 54097 |
| 185 | Ga0207655_1001061 | 3300025728 | Bacteria | 27384 |
| 186 | Ga0207655_1001874 | 3300025728 | Bacteria | 18099 |
| 187 | Ga0207655_1003138 | 3300025728 | Bacteria | 12502 |
| 188 | Ga0207655_1017508 | 3300025728 | Bacteria | 3860 |
| 189 | Ga0207655_1025084 | 3300025728 | Bacteria | 2902 |
| 190 | Ga0207655_1027022 | 3300025728 | Bacteria | 2743 |
| 191 | Ga0207655_1027824 | 3300025728 | Bacteria | 2682 |
| 192 | Ga0207655_1030225 | 3300025728 | Bacteria | 2522 |
| 193 | Ga0207713_1000442 | 3300025735 | Bacteria | 43616 |
| 194 | Ga0207713_1000520 | 3300025735 | Bacteria | 38760 |
| 195 | Ga0207713_1002601 | 3300025735 | Bacteria | 13011 |
| 196 | Ga0207713_1003894 | 3300025735 | Bacteria | 9944 |
| 197 | Ga0207713_1007122 | 3300025735 | Bacteria | 6682 |
| 198 | Ga0207713_1011411 | 3300025735 | Bacteria | 4832 |
| 199 | Ga0207713_1012380 | 3300025735 | Bacteria | 4567 |
| 200 | Ga0207713_1014836 | 3300025735 | Bacteria | 4022 |
| 201 | Ga0207713_1016701 | 3300025735 | Bacteria | 3715 |
| 202 | Ga0207713_1020346 | 3300025735 | Bacteria | 3217 |
| 203 | Ga0207713_1020524 | 3300025735 | Bacteria | 3198 |
| 204 | Ga0207713_1024903 | 3300025735 | Bacteria | 2776 |
| 205 | Ga0207713_1029411 | 3300025735 | Bacteria | 2462 |
| 206 | Ga0207713_1029534 | 3300025735 | Bacteria | 2453 |
| 207 | Ga0207654_10088390 | 3300025911 | Bacteria | 1883 |
| 208 | Ga0207671_10001171 | 3300025914 | Bacteria | 31245 |
| 209 | Ga0207649_10003679 | 3300025920 | Bacteria | 8366 |
| 210 | Ga0207649_10058709 | 3300025920 | Bacteria | 2410 |
| 211 | Ga0207681_10006365 | 3300025923 | Bacteria | 7250 |
| 212 | Ga0207650_10000266 | 3300025925 | Bacteria | 55293 |
| 213 | Ga0207650_10002133 | 3300025925 | Bacteria | 13834 |
| 214 | Ga0207686_10025223 | 3300025934 | Bacteria | 3455 |
| 215 | Ga0207709_10000014 | 3300025935 | Bacteria | 526302 |
| 216 | Ga0207709_10088464 | 3300025935 | Bacteria | 2016 |
| 217 | Ga0207679_10000016 | 3300025945 | Bacteria | 253494 |
| 218 | Ga0207698_10016618 | 3300026142 | Bacteria | 4967 |
| 219 | Ga0209281_1000073 | 3300027111 | Bacteria | 269036 |
| 220 | Ga0209281_1020149 | 3300027111 | Bacteria | 1308 |
| 221 | Ga0209389_1000116 | 3300027296 | Bacteria | 71576 |
| 222 | Ga0209371_1000919 | 3300027312 | Bacteria | 23232 |
| 223 | Ga0207428_10022535 | 3300027907 | Bacteria | 5313 |
| 224 | Ga0207428_10050489 | 3300027907 | Bacteria | 3328 |
| 225 | Ga0207428_10090430 | 3300027907 | Bacteria | 2378 |
| 226 | Ga0207428_10144505 | 3300027907 | Bacteria | 1814 |
| 227 | Ga0268266_10103773 | 3300028379 | Bacteria | 2509 |
| 228 | Ga0307517_10087628 | 3300028786 | Bacteria | 2584 |
| 229 | Ga0307517_10180542 | 3300028786 | Bacteria | 1364 |
| 230 | Ga0268256_1000774 | 3300030500 | Bacteria | 23230 |
| 231 | Ga0314311_1121840 | 3300030733 | Bacteria | 1466 |
| 232 | Ga0316178_1149889 | 3300030735 | Bacteria | 21027 |
| 233 | Ga0316183_1037028 | 3300030742 | Bacteria | 1876 |
| 234 | Ga0316181_1052209 | 3300030744 | Bacteria | 1561 |
| 235 | Ga0265316_10160836 | 3300031344 | Bacteria | 1679 |
| 236 | Ga0307509_10262739 | 3300031507 | Bacteria | 1500 |
| 237 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 238 | Ga0307408_100022902 | 3300031548 | Bacteria | 4250 |
| 239 | Ga0307408_100024126 | 3300031548 | Bacteria | 4149 |
| 240 | Ga0307408_100041624 | 3300031548 | Bacteria | 3257 |
| 241 | Ga0307408_100056905 | 3300031548 | Bacteria | 2837 |
| 242 | Ga0307408_100071953 | 3300031548 | Bacteria | 2558 |
| 243 | Ga0307408_100305406 | 3300031548 | Bacteria | 1334 |
| 244 | Ga0316578_10006850 | 3300031728 | Bacteria | 5660 |
| 245 | Ga0307405_10010414 | 3300031731 | Bacteria | 4816 |
| 246 | Ga0307405_10242730 | 3300031731 | Bacteria | 1335 |
| 247 | Ga0307406_10014090 | 3300031901 | Bacteria | 4594 |
| 248 | Ga0307412_10002010 | 3300031911 | Bacteria | 11283 |
| 249 | Ga0307412_10003617 | 3300031911 | Bacteria | 8589 |
| 250 | Ga0307412_10003816 | 3300031911 | Bacteria | 8382 |
| 251 | Ga0307412_10013257 | 3300031911 | Bacteria | 4826 |
| 252 | Ga0307412_10218827 | 3300031911 | Bacteria | 1458 |
| 253 | Ga0307409_100125787 | 3300031995 | Bacteria | 2180 |
| 254 | Ga0307409_100159543 | 3300031995 | Bacteria | 1970 |
| 255 | Ga0307416_100219326 | 3300032002 | Bacteria | 1822 |
| 256 | Ga0307414_10053773 | 3300032004 | Bacteria | 2810 |
| 257 | Ga0307414_10061692 | 3300032004 | Bacteria | 2656 |
| 258 | Ga0307411_10018221 | 3300032005 | Bacteria | 4021 |
| 259 | Ga0307411_10059252 | 3300032005 | Bacteria | 2537 |
| 260 | Ga0307411_10064062 | 3300032005 | Bacteria | 2459 |
| 261 | Ga0395899_0018205 | 3300037312 | Bacteria | 5343 |
| 262 | Ga0237819_01688 | 3300038705 | Bacteria | 5375 |
| 263 | Ga0439436_0006075 | 3300041404 | Bacteria | 3703 |
| 264 | Ga0439438_001364 | 3300041405 | Bacteria | 10788 |
| 265 | Ga0439438_005498 | 3300041405 | Bacteria | 4643 |
| 266 | Ga0439438_007279 | 3300041405 | Bacteria | 3797 |
| 267 | Ga0439438_007862 | 3300041405 | Bacteria | 3597 |
| 268 | Ga0439438_008602 | 3300041405 | Bacteria | 3369 |
| 269 | Ga0439438_008686 | 3300041405 | Bacteria | 3345 |
| 270 | Ga0439438_010904 | 3300041405 | Bacteria | 2853 |
| 271 | Ga0439438_013256 | 3300041405 | Bacteria | 2494 |
| 272 | Ga0439438_033874 | 3300041405 | Bacteria | 1347 |
| 273 | Ga0439447_001397 | 3300041407 | Bacteria | 8848 |
| 274 | Ga0439447_007683 | 3300041407 | Bacteria | 3396 |
| 275 | Ga0439447_012716 | 3300041407 | Bacteria | 2409 |
| 276 | Ga0439447_021475 | 3300041407 | Bacteria | 1700 |
| 277 | Ga0439466_0000322 | 3300041411 | Bacteria | 18415 |
| 278 | Ga0439466_0003367 | 3300041411 | Bacteria | 6216 |
| 279 | Ga0439466_0010189 | 3300041411 | Bacteria | 3496 |
| 280 | Ga0439466_0013536 | 3300041411 | Bacteria | 2985 |
| 281 | Ga0439466_0018167 | 3300041411 | Bacteria | 2525 |
| 282 | Ga0439466_0020552 | 3300041411 | Bacteria | 2351 |
| 283 | Ga0439466_0025707 | 3300041411 | Bacteria | 2053 |
| 284 | Ga0439466_0043793 | 3300041411 | Bacteria | 1485 |
| 285 | Ga0439466_0046473 | 3300041411 | Bacteria | 1433 |
| 286 | Ga0439431_0006110 | 3300041997 | Bacteria | 2659 |
| 287 | Ga0439432_007236 | 3300042006 | Bacteria | 3942 |
| 288 | Ga0439432_015566 | 3300042006 | Bacteria | 2566 |
| 289 | Ga0439432_041990 | 3300042006 | Bacteria | 1446 |
| 290 | Ga0439432_050543 | 3300042006 | Bacteria | 1297 |
| 291 | Ga0439452_000108 | 3300042010 | Bacteria | 67234 |
| 292 | Ga0439452_000250 | 3300042010 | Bacteria | 36960 |
| 293 | Ga0439452_001476 | 3300042010 | Bacteria | 9578 |
| 294 | Ga0439452_004496 | 3300042010 | Bacteria | 4665 |
| 295 | Ga0439452_007513 | 3300042010 | Bacteria | 3337 |
| 296 | Ga0439452_019227 | 3300042010 | Bacteria | 1809 |
| 297 | Ga0439452_021762 | 3300042010 | Bacteria | 1666 |
| 298 | Ga0439456_000025 | 3300042013 | Bacteria | 55165 |
| 299 | Ga0439456_001009 | 3300042013 | Bacteria | 5596 |
| 300 | Ga0439456_010461 | 3300042013 | Bacteria | 1917 |
| 301 | Ga0439463_006124 | 3300042016 | Bacteria | 2986 |
| 302 | Ga0439463_025682 | 3300042016 | Bacteria | 1478 |
| 303 | Ga0450911_000068 | 3300042115 | Bacteria | 42892 |
| 304 | Ga0450911_003606 | 3300042115 | Bacteria | 2690 |
| 305 | Ga0450911_005321 | 3300042115 | Bacteria | 2013 |
| 306 | Ga0450919_002290 | 3300042121 | Bacteria | 2481 |
| 307 | Ga0450920_002572 | 3300042122 | Bacteria | 3096 |
| 308 | Ga0450922_001179 | 3300042124 | Bacteria | 2583 |
| 309 | Ga0450890_002945 | 3300042127 | Bacteria | 2292 |
| 310 | Ga0450902_002576 | 3300042137 | Bacteria | 2578 |
| 311 | Ga0450902_007402 | 3300042137 | Bacteria | 1699 |
| 312 | Ga0450903_005528 | 3300042138 | Bacteria | 2113 |
| 313 | Ga0450903_007804 | 3300042138 | Bacteria | 1755 |
| 314 | Ga0450904_001506 | 3300042139 | Bacteria | 3216 |
| 315 | Ga0450904_002673 | 3300042139 | Bacteria | 2058 |
| 316 | Ga0450905_002344 | 3300042142 | Bacteria | 2430 |
| 317 | Ga0450905_007100 | 3300042142 | Bacteria | 1522 |
| 318 | Ga0450906_003516 | 3300042145 | Bacteria | 3367 |
| 319 | Ga0450906_003684 | 3300042145 | Bacteria | 3262 |
| 320 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 321 | Ga0450907_000459 | 3300042146 | Bacteria | 11550 |
| 322 | Ga0450907_005607 | 3300042146 | Bacteria | 2115 |
| 323 | Ga0450910_002452 | 3300042147 | Bacteria | 2439 |
| 324 | Ga0439446_0015840 | 3300042156 | Bacteria | 2095 |
| 325 | Ga0450908_002616 | 3300042184 | Bacteria | 3532 |
| 326 | Ga0450908_008865 | 3300042184 | Bacteria | 1878 |
| 327 | Ga0450909_001212 | 3300042185 | Bacteria | 3578 |
| 328 | Ga0450909_008747 | 3300042185 | Bacteria | 1473 |
| 329 | Ga0439434_0001003 | 3300042435 | Bacteria | 8159 |
| 330 | Ga0439434_0019409 | 3300042435 | Bacteria | 2038 |
| 331 | Ga0439464_0054722 | 3300042439 | Bacteria | 1160 |
| 332 | Ga0439460_0005888 | 3300042461 | Bacteria | 3022 |
| 333 | Ga0439460_0007716 | 3300042461 | Bacteria | 2699 |
| 334 | Ga0439460_0017064 | 3300042461 | Bacteria | 1941 |
| 335 | Ga0450916_001193 | 3300042530 | Bacteria | 2562 |
| 336 | Ga0450901_000208 | 3300042533 | Bacteria | 6976 |
| 337 | Ga0439440_0004275 | 3300042993 | Bacteria | 2801 |
| 338 | Ga0495617_003496 | 3300046452 | Bacteria | 5888 |
| 339 | Ga0495617_004485 | 3300046452 | Bacteria | 5078 |
| 340 | Ga0495617_008801 | 3300046452 | Bacteria | 3476 |
| 341 | Ga0495617_018363 | 3300046452 | Bacteria | 2364 |
| 342 | Ga0495617_024161 | 3300046452 | Bacteria | 2051 |
| 343 | Ga0495617_025060 | 3300046452 | Bacteria | 2011 |
| 344 | Ga0495627_002231 | 3300046453 | Bacteria | 9604 |
| 345 | Ga0495627_002694 | 3300046453 | Bacteria | 8321 |
| 346 | Ga0495627_004827 | 3300046453 | Bacteria | 5556 |
| 347 | Ga0495627_010623 | 3300046453 | Bacteria | 3338 |
| 348 | Ga0495592_0121036 | 3300046454 | Bacteria | 1841 |
| 349 | Ga0495603_0110535 | 3300046455 | Bacteria | 1603 |
| 350 | Ga0495590_0002524 | 3300046457 | Bacteria | 7570 |
| 351 | Ga0495590_0004909 | 3300046457 | Bacteria | 5344 |
| 352 | Ga0495590_0009896 | 3300046457 | Bacteria | 3604 |
| 353 | Ga0495590_0013548 | 3300046457 | Bacteria | 2994 |
| 354 | Ga0495590_0018725 | 3300046457 | Bacteria | 2477 |
| 355 | Ga0495590_0029360 | 3300046457 | Bacteria | 1928 |
| 356 | Ga0495590_0088496 | 3300046457 | Bacteria | 1094 |
| 357 | Ga0495591_000253 | 3300046458 | Bacteria | 51314 |
| 358 | Ga0495591_001474 | 3300046458 | Bacteria | 14558 |
| 359 | Ga0495591_001590 | 3300046458 | Bacteria | 13756 |
| 360 | Ga0495591_002238 | 3300046458 | Bacteria | 11010 |
| 361 | Ga0495591_010166 | 3300046458 | Bacteria | 3668 |
| 362 | Ga0495591_020961 | 3300046458 | Bacteria | 2144 |
| 363 | Ga0495591_022001 | 3300046458 | Bacteria | 2068 |
| 364 | Ga0495591_022093 | 3300046458 | Bacteria | 2062 |
| 365 | Ga0495591_025999 | 3300046458 | Bacteria | 1827 |
| 366 | Ga0495638_0005693 | 3300046460 | Bacteria | 9178 |
| 367 | Ga0495638_0022888 | 3300046460 | Bacteria | 4096 |
| 368 | Ga0495638_0030720 | 3300046460 | Bacteria | 3455 |
| 369 | Ga0495638_0053017 | 3300046460 | Bacteria | 2524 |
| 370 | Ga0495638_0125161 | 3300046460 | Bacteria | 1515 |
| 371 | Ga0495638_0126214 | 3300046460 | Bacteria | 1507 |
| 372 | Ga0495638_0214571 | 3300046460 | Bacteria | 1079 |
| 373 | Ga0495653_0003669 | 3300046463 | Bacteria | 12401 |
| 374 | Ga0495653_0015804 | 3300046463 | Bacteria | 6154 |
| 375 | Ga0495653_0025691 | 3300046463 | Bacteria | 4727 |
| 376 | Ga0495653_0101244 | 3300046463 | Bacteria | 2087 |
| 377 | Ga0495653_0116106 | 3300046463 | Bacteria | 1914 |
| 378 | Ga0495653_0162281 | 3300046463 | Bacteria | 1550 |
| 379 | Ga0495650_0000076 | 3300046471 | Bacteria | 250205 |
| 380 | Ga0495650_0003834 | 3300046471 | Bacteria | 10682 |
| 381 | Ga0495650_0017860 | 3300046471 | Bacteria | 3543 |
| 382 | Ga0495650_0026538 | 3300046471 | Bacteria | 2692 |
| 383 | Ga0495650_0033508 | 3300046471 | Bacteria | 2285 |
| 384 | Ga0495650_0040437 | 3300046471 | Bacteria | 2001 |
| 385 | Ga0495650_0041012 | 3300046471 | Bacteria | 1983 |
| 386 | Ga0495650_0046088 | 3300046471 | Bacteria | 1831 |
| 387 | Ga0495582_0052517 | 3300046473 | Bacteria | 2247 |
| 388 | Ga0495605_0000157 | 3300046474 | Bacteria | 86897 |
| 389 | Ga0495605_0000916 | 3300046474 | Bacteria | 20254 |
| 390 | Ga0495605_0007661 | 3300046474 | Bacteria | 6121 |
| 391 | Ga0495605_0014777 | 3300046474 | Bacteria | 4263 |
| 392 | Ga0495605_0020277 | 3300046474 | Bacteria | 3534 |
| 393 | Ga0495605_0047955 | 3300046474 | Bacteria | 2093 |
| 394 | Ga0495605_0076684 | 3300046474 | Bacteria | 1569 |
| 395 | Ga0495605_0086206 | 3300046474 | Bacteria | 1461 |
| 396 | Ga0495605_0099987 | 3300046474 | Bacteria | 1334 |
| 397 | Ga0495639_0000212 | 3300046475 | Bacteria | 30107 |
| 398 | Ga0495639_0025406 | 3300046475 | Bacteria | 2612 |
| 399 | Ga0495584_0000296 | 3300046491 | Bacteria | 35158 |
| 400 | Ga0495584_0000925 | 3300046491 | Bacteria | 18610 |
| 401 | Ga0495584_0006824 | 3300046491 | Bacteria | 5964 |
| 402 | Ga0495584_0008368 | 3300046491 | Bacteria | 5358 |
| 403 | Ga0495584_0010034 | 3300046491 | Bacteria | 4861 |
| 404 | Ga0495584_0017735 | 3300046491 | Bacteria | 3621 |
| 405 | Ga0495584_0019344 | 3300046491 | Bacteria | 3458 |
| 406 | Ga0495584_0044394 | 3300046491 | Bacteria | 2243 |
| 407 | Ga0495585_0001178 | 3300046492 | Bacteria | 21231 |
| 408 | Ga0495585_0001354 | 3300046492 | Bacteria | 19412 |
| 409 | Ga0495585_0002730 | 3300046492 | Bacteria | 12324 |
| 410 | Ga0495585_0021831 | 3300046492 | Bacteria | 3675 |
| 411 | Ga0495585_0028744 | 3300046492 | Bacteria | 3168 |
| 412 | Ga0495585_0036865 | 3300046492 | Bacteria | 2755 |
| 413 | Ga0495585_0041286 | 3300046492 | Bacteria | 2587 |
| 414 | Ga0495585_0048588 | 3300046492 | Bacteria | 2358 |
| 415 | Ga0495585_0090621 | 3300046492 | Bacteria | 1647 |
| 416 | Ga0495594_0044761 | 3300046499 | Bacteria | 2428 |
| 417 | Ga0495594_0046107 | 3300046499 | Bacteria | 2393 |
| 418 | Ga0495596_0000566 | 3300046500 | Bacteria | 23143 |
| 419 | Ga0495596_0067261 | 3300046500 | Bacteria | 1392 |
| 420 | Ga0495607_0000085 | 3300046501 | Bacteria | 96340 |
| 421 | Ga0495607_0000188 | 3300046501 | Bacteria | 66018 |
| 422 | Ga0495607_0000530 | 3300046501 | Bacteria | 37462 |
| 423 | Ga0495607_0003559 | 3300046501 | Bacteria | 11864 |
| 424 | Ga0495607_0004042 | 3300046501 | Bacteria | 10993 |
| 425 | Ga0495607_0004066 | 3300046501 | Bacteria | 10956 |
| 426 | Ga0495607_0004308 | 3300046501 | Bacteria | 10502 |
| 427 | Ga0495607_0022862 | 3300046501 | Bacteria | 3922 |
| 428 | Ga0495607_0030906 | 3300046501 | Bacteria | 3282 |
| 429 | Ga0495607_0049396 | 3300046501 | Bacteria | 2453 |
| 430 | Ga0495607_0051806 | 3300046501 | Bacteria | 2381 |
| 431 | Ga0495607_0065737 | 3300046501 | Bacteria | 2043 |
| 432 | Ga0495583_0000538 | 3300046506 | Bacteria | 53381 |
| 433 | Ga0495583_0002946 | 3300046506 | Bacteria | 13701 |
| 434 | Ga0495583_0003685 | 3300046506 | Bacteria | 11406 |
| 435 | Ga0495583_0005257 | 3300046506 | Bacteria | 8872 |
| 436 | Ga0495583_0022543 | 3300046506 | Bacteria | 3209 |
| 437 | Ga0495583_0037760 | 3300046506 | Bacteria | 2287 |
| 438 | Ga0495583_0055856 | 3300046506 | Bacteria | 1783 |
| 439 | Ga0495606_0000157 | 3300046507 | Bacteria | 118620 |
| 440 | Ga0495606_0000354 | 3300046507 | Bacteria | 78470 |
| 441 | Ga0495606_0001020 | 3300046507 | Bacteria | 40589 |
| 442 | Ga0495606_0001822 | 3300046507 | Bacteria | 27062 |
| 443 | Ga0495606_0003094 | 3300046507 | Bacteria | 18112 |
| 444 | Ga0495606_0003346 | 3300046507 | Bacteria | 17100 |
| 445 | Ga0495606_0005737 | 3300046507 | Bacteria | 11739 |
| 446 | Ga0495606_0006578 | 3300046507 | Bacteria | 10685 |
| 447 | Ga0495606_0007055 | 3300046507 | Bacteria | 10177 |
| 448 | Ga0495606_0129355 | 3300046507 | Bacteria | 1502 |
| 449 | Ga0495606_0141176 | 3300046507 | Bacteria | 1422 |
| 450 | Ga0495610_0003607 | 3300046512 | Bacteria | 11953 |
| 451 | Ga0495610_0006000 | 3300046512 | Bacteria | 8488 |
| 452 | Ga0495610_0007236 | 3300046512 | Bacteria | 7440 |
| 453 | Ga0495610_0015264 | 3300046512 | Bacteria | 4471 |
| 454 | Ga0495610_0019047 | 3300046512 | Bacteria | 3854 |
| 455 | Ga0495610_0020286 | 3300046512 | Bacteria | 3692 |
| 456 | Ga0495610_0023055 | 3300046512 | Bacteria | 3391 |
| 457 | Ga0495610_0044431 | 3300046512 | Bacteria | 2205 |
| 458 | Ga0495610_0048385 | 3300046512 | Bacteria | 2087 |
| 459 | Ga0495616_0003253 | 3300046513 | Bacteria | 10445 |
| 460 | Ga0495616_0005033 | 3300046513 | Bacteria | 8228 |
| 461 | Ga0495616_0023264 | 3300046513 | Bacteria | 3334 |
| 462 | Ga0495616_0037769 | 3300046513 | Bacteria | 2482 |
| 463 | Ga0495620_0000490 | 3300046515 | Bacteria | 25681 |
| 464 | Ga0495620_0001814 | 3300046515 | Bacteria | 12556 |
| 465 | Ga0495620_0003563 | 3300046515 | Bacteria | 8899 |
| 466 | Ga0495620_0004931 | 3300046515 | Bacteria | 7487 |
| 467 | Ga0495620_0005275 | 3300046515 | Bacteria | 7231 |
| 468 | Ga0495620_0036434 | 3300046515 | Bacteria | 2201 |
| 469 | Ga0495620_0054515 | 3300046515 | Bacteria | 1688 |
| 470 | Ga0495628_0089243 | 3300046516 | Bacteria | 2388 |
| 471 | Ga0495630_0048317 | 3300046517 | Bacteria | 3184 |
| 472 | Ga0495630_0096978 | 3300046517 | Bacteria | 2229 |
| 473 | Ga0495630_0128062 | 3300046517 | Bacteria | 1927 |
| 474 | Ga0495631_0005709 | 3300046518 | Bacteria | 6489 |
| 475 | Ga0495631_0016227 | 3300046518 | Bacteria | 3555 |
| 476 | Ga0495631_0018690 | 3300046518 | Bacteria | 3259 |
| 477 | Ga0495631_0036682 | 3300046518 | Bacteria | 2188 |
| 478 | Ga0495631_0041804 | 3300046518 | Bacteria | 2027 |
| 479 | Ga0495631_0055704 | 3300046518 | Bacteria | 1723 |
| 480 | Ga0495632_0000295 | 3300046519 | Bacteria | 48203 |
| 481 | Ga0495632_0000376 | 3300046519 | Bacteria | 42540 |
| 482 | Ga0495632_0001006 | 3300046519 | Bacteria | 24447 |
| 483 | Ga0495632_0006129 | 3300046519 | Bacteria | 7791 |
| 484 | Ga0495632_0014675 | 3300046519 | Bacteria | 4423 |
| 485 | Ga0495632_0025967 | 3300046519 | Bacteria | 3090 |
| 486 | Ga0495632_0026508 | 3300046519 | Bacteria | 3050 |
| 487 | Ga0495632_0031474 | 3300046519 | Bacteria | 2742 |
| 488 | Ga0495632_0035436 | 3300046519 | Bacteria | 2546 |
| 489 | Ga0495632_0040037 | 3300046519 | Bacteria | 2362 |
| 490 | Ga0495632_0109260 | 3300046519 | Bacteria | 1299 |
| 491 | Ga0495632_0117265 | 3300046519 | Bacteria | 1246 |
| 492 | Ga0495637_0000048 | 3300046520 | Bacteria | 106516 |
| 493 | Ga0495637_0002163 | 3300046520 | Bacteria | 10997 |
| 494 | Ga0495637_0005329 | 3300046520 | Bacteria | 6578 |
| 495 | Ga0495637_0015056 | 3300046520 | Bacteria | 3635 |
| 496 | Ga0495637_0021963 | 3300046520 | Bacteria | 2917 |
| 497 | Ga0495637_0025431 | 3300046520 | Bacteria | 2667 |
| 498 | Ga0495637_0026974 | 3300046520 | Bacteria | 2573 |
| 499 | Ga0495637_0036891 | 3300046520 | Bacteria | 2125 |
| 500 | Ga0495637_0037015 | 3300046520 | Bacteria | 2121 |
| 501 | Ga0495637_0040153 | 3300046520 | Bacteria | 2016 |
| 502 | Ga0495637_0050138 | 3300046520 | Bacteria | 1751 |
| 503 | Ga0495637_0060348 | 3300046520 | Bacteria | 1558 |
| 504 | Ga0495643_0001787 | 3300046522 | Bacteria | 18422 |
| 505 | Ga0495643_0001804 | 3300046522 | Bacteria | 18335 |
| 506 | Ga0495643_0003768 | 3300046522 | Bacteria | 10958 |
| 507 | Ga0495643_0004359 | 3300046522 | Bacteria | 9923 |
| 508 | Ga0495643_0006719 | 3300046522 | Bacteria | 7528 |
| 509 | Ga0495643_0009243 | 3300046522 | Bacteria | 6143 |
| 510 | Ga0495643_0028249 | 3300046522 | Bacteria | 3146 |
| 511 | Ga0495643_0038408 | 3300046522 | Bacteria | 2622 |
| 512 | Ga0495643_0046082 | 3300046522 | Bacteria | 2365 |
| 513 | Ga0495643_0051683 | 3300046522 | Bacteria | 2209 |
| 514 | Ga0495644_0007245 | 3300046523 | Bacteria | 4288 |
| 515 | Ga0495644_0010762 | 3300046523 | Bacteria | 3525 |
| 516 | Ga0495648_0003694 | 3300046524 | Bacteria | 13372 |
| 517 | Ga0495648_0003700 | 3300046524 | Bacteria | 13360 |
| 518 | Ga0495648_0005121 | 3300046524 | Bacteria | 10983 |
| 519 | Ga0495648_0015107 | 3300046524 | Bacteria | 5621 |
| 520 | Ga0495648_0016325 | 3300046524 | Bacteria | 5357 |
| 521 | Ga0495648_0016425 | 3300046524 | Bacteria | 5339 |
| 522 | Ga0495648_0084066 | 3300046524 | Bacteria | 1802 |
| 523 | Ga0495648_0094261 | 3300046524 | Bacteria | 1668 |
| 524 | Ga0495666_0008996 | 3300046526 | Bacteria | 4996 |
| 525 | Ga0495666_0020620 | 3300046526 | Bacteria | 3264 |
| 526 | Ga0495666_0023691 | 3300046526 | Bacteria | 3035 |
| 527 | Ga0495666_0059311 | 3300046526 | Bacteria | 1830 |
| 528 | Ga0495642_0000198 | 3300046528 | Bacteria | 35398 |
| 529 | Ga0495642_0000778 | 3300046528 | Bacteria | 15527 |
| 530 | Ga0495642_0024093 | 3300046528 | Bacteria | 2406 |
| 531 | Ga0495654_0001343 | 3300046530 | Bacteria | 17095 |
| 532 | Ga0495654_0002457 | 3300046530 | Bacteria | 11922 |
| 533 | Ga0495654_0009451 | 3300046530 | Bacteria | 5343 |
| 534 | Ga0495654_0012067 | 3300046530 | Bacteria | 4653 |
| 535 | Ga0495654_0016635 | 3300046530 | Bacteria | 3881 |
| 536 | Ga0495654_0017862 | 3300046530 | Bacteria | 3722 |
| 537 | Ga0495654_0026340 | 3300046530 | Bacteria | 2989 |
| 538 | Ga0495654_0030252 | 3300046530 | Bacteria | 2756 |
| 539 | Ga0495654_0036925 | 3300046530 | Bacteria | 2453 |
| 540 | Ga0495654_0038383 | 3300046530 | Bacteria | 2395 |
| 541 | Ga0495654_0057398 | 3300046530 | Bacteria | 1880 |
| 542 | Ga0495654_0057703 | 3300046530 | Bacteria | 1874 |
| 543 | Ga0495654_0073383 | 3300046530 | Bacteria | 1618 |
| 544 | Ga0495587_0046683 | 3300046536 | Bacteria | 2569 |
| 545 | Ga0495587_0110472 | 3300046536 | Bacteria | 1579 |
| 546 | Ga0495609_0000051 | 3300046538 | Bacteria | 153822 |
| 547 | Ga0495609_0000313 | 3300046538 | Bacteria | 43585 |
| 548 | Ga0495609_0002354 | 3300046538 | Bacteria | 11667 |
| 549 | Ga0495609_0010329 | 3300046538 | Bacteria | 4481 |
| 550 | Ga0495609_0015768 | 3300046538 | Bacteria | 3532 |
| 551 | Ga0495597_0002325 | 3300046542 | Bacteria | 12324 |
| 552 | Ga0495597_0022396 | 3300046542 | Bacteria | 2931 |
| 553 | Ga0495597_0029723 | 3300046542 | Bacteria | 2493 |
| 554 | Ga0495645_0032096 | 3300046543 | Bacteria | 3830 |
| 555 | Ga0495622_0006297 | 3300046557 | Bacteria | 5511 |
| 556 | Ga0495622_0009424 | 3300046557 | Bacteria | 4517 |
| 557 | Ga0495622_0027192 | 3300046557 | Bacteria | 2669 |
| 558 | Ga0495622_0029134 | 3300046557 | Bacteria | 2579 |
| 559 | Ga0495633_0021049 | 3300046558 | Bacteria | 3268 |
| 560 | Ga0495656_0029116 | 3300046615 | Bacteria | 2220 |
| 561 | Ga0495668_0013969 | 3300046616 | Bacteria | 4720 |
| 562 | Ga0495668_0022655 | 3300046616 | Bacteria | 3589 |
| 563 | Ga0495668_0024314 | 3300046616 | Bacteria | 3446 |
| 564 | Ga0495668_0044521 | 3300046616 | Bacteria | 2466 |
| 565 | Ga0495668_0067517 | 3300046616 | Bacteria | 1967 |
| 566 | Ga0495668_0103179 | 3300046616 | Bacteria | 1560 |
| 567 | Ga0495634_0037381 | 3300046642 | Bacteria | 3317 |
| 568 | Ga0495634_0173237 | 3300046642 | Bacteria | 1355 |
| 569 | Ga0495611_0000371 | 3300046648 | Bacteria | 28893 |
| 570 | Ga0495611_0017093 | 3300046648 | Bacteria | 3101 |
| 571 | Ga0495611_0025429 | 3300046648 | Bacteria | 2580 |
| 572 | Ga0495611_0070086 | 3300046648 | Bacteria | 1602 |
| 573 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 574 | Ga0495625_0017417 | 3300046660 | Bacteria | 5625 |
| 575 | Ga0495625_0052561 | 3300046660 | Bacteria | 2917 |
| 576 | Ga0495625_0055479 | 3300046660 | Bacteria | 2825 |
| 577 | Ga0495625_0100132 | 3300046660 | Bacteria | 1992 |
| 578 | Ga0495625_0101639 | 3300046660 | Bacteria | 1974 |
| 579 | Ga0495635_0003776 | 3300046663 | Bacteria | 10520 |
| 580 | Ga0495635_0031645 | 3300046663 | Bacteria | 3671 |
| 581 | Ga0495659_0006978 | 3300046664 | Bacteria | 3577 |
| 582 | Ga0495659_0021440 | 3300046664 | Bacteria | 2177 |
| 583 | Ga0495659_0059560 | 3300046664 | Bacteria | 1407 |
| 584 | Ga0495661_0000013 | 3300046665 | Bacteria | 259387 |
| 585 | Ga0495661_0000041 | 3300046665 | Bacteria | 151138 |
| 586 | Ga0495661_0000228 | 3300046665 | Bacteria | 64689 |
| 587 | Ga0495661_0000548 | 3300046665 | Bacteria | 38896 |
| 588 | Ga0495661_0026286 | 3300046665 | Bacteria | 3750 |
| 589 | Ga0495661_0086929 | 3300046665 | Bacteria | 1788 |
| 590 | Ga0495661_0095705 | 3300046665 | Bacteria | 1680 |
| 591 | Ga0495661_0103541 | 3300046665 | Bacteria | 1597 |
| 592 | Ga0495588_0015627 | 3300046674 | Bacteria | 3658 |
| 593 | Ga0495588_0018816 | 3300046674 | Bacteria | 3374 |
| 594 | Ga0495588_0108124 | 3300046674 | Bacteria | 1464 |
| 595 | Ga0495623_0025860 | 3300046679 | Bacteria | 3780 |
| 596 | Ga0495623_0065531 | 3300046679 | Bacteria | 2271 |
| 597 | Ga0495646_0013101 | 3300046680 | Bacteria | 5269 |
| 598 | Ga0495646_0028014 | 3300046680 | Bacteria | 3530 |
| 599 | Ga0495646_0030735 | 3300046680 | Bacteria | 3352 |
| 600 | Ga0495646_0065779 | 3300046680 | Bacteria | 2145 |
| 601 | Ga0495613_0034830 | 3300046689 | Bacteria | 3738 |
| 602 | Ga0495613_0066711 | 3300046689 | Bacteria | 2627 |
| 603 | Ga0495624_0001129 | 3300046690 | Bacteria | 21122 |
| 604 | Ga0495670_0011666 | 3300046691 | Bacteria | 4324 |
| 605 | Ga0495670_0017392 | 3300046691 | Bacteria | 3537 |
| 606 | Ga0495670_0034764 | 3300046691 | Bacteria | 2511 |
| 607 | Ga0495670_0064062 | 3300046691 | Bacteria | 1851 |
| 608 | Ga0495671_0000992 | 3300046692 | Bacteria | 19782 |
| 609 | Ga0495671_0004516 | 3300046692 | Bacteria | 8304 |
| 610 | Ga0495671_0006281 | 3300046692 | Bacteria | 6879 |
| 611 | Ga0495671_0011130 | 3300046692 | Bacteria | 4965 |
| 612 | Ga0495671_0016403 | 3300046692 | Bacteria | 3955 |
| 613 | Ga0495671_0025532 | 3300046692 | Bacteria | 3070 |
| 614 | Ga0495671_0034537 | 3300046692 | Bacteria | 2570 |
| 615 | Ga0495671_0051123 | 3300046692 | Bacteria | 2056 |
| 616 | Ga0495671_0087587 | 3300046692 | Bacteria | 1525 |
| 617 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 618 | Ga0495649_0000817 | 3300046694 | Bacteria | 25070 |
| 619 | Ga0495649_0002301 | 3300046694 | Bacteria | 13561 |
| 620 | Ga0495649_0006415 | 3300046694 | Bacteria | 7323 |
| 621 | Ga0495649_0008425 | 3300046694 | Bacteria | 6204 |
| 622 | Ga0495649_0024422 | 3300046694 | Bacteria | 3371 |
| 623 | Ga0495649_0025982 | 3300046694 | Bacteria | 3259 |
| 624 | Ga0495649_0037370 | 3300046694 | Bacteria | 2665 |
| 625 | Ga0495589_0000703 | 3300046794 | Bacteria | 21795 |
| 626 | Ga0495589_0019690 | 3300046794 | Bacteria | 3455 |
| 627 | Ga0495589_0024538 | 3300046794 | Bacteria | 3064 |
| 628 | Ga0495589_0038679 | 3300046794 | Bacteria | 2386 |
| 629 | Ga0495589_0042317 | 3300046794 | Bacteria | 2270 |
| 630 | Ga0495589_0053176 | 3300046794 | Bacteria | 1999 |
| 631 | Ga0495589_0070532 | 3300046794 | Bacteria | 1708 |
| 632 | Ga0495589_0108684 | 3300046794 | Bacteria | 1339 |
| 633 | Ga0495660_0004420 | 3300046810 | Bacteria | 8508 |
| 634 | Ga0495660_0014965 | 3300046810 | Bacteria | 4485 |
| 635 | Ga0495660_0031081 | 3300046810 | Bacteria | 3004 |
| 636 | Ga0495660_0035306 | 3300046810 | Bacteria | 2794 |
| 637 | Ga0495660_0035420 | 3300046810 | Bacteria | 2788 |
| 638 | Ga0495660_0035431 | 3300046810 | Bacteria | 2788 |
| 639 | Ga0495660_0047659 | 3300046810 | Bacteria | 2345 |
| 640 | Ga0495660_0080735 | 3300046810 | Bacteria | 1706 |
| 641 | Ga0495660_0159250 | 3300046810 | Bacteria | 1108 |
| 642 | Ga0495581_0034463 | 3300047315 | Bacteria | 2929 |
| 643 | Ga0495604_0043501 | 3300047317 | Bacteria | 3515 |
| 644 | Ga0495604_0167699 | 3300047317 | Bacteria | 1547 |
| 645 | Ga0495636_0011735 | 3300047318 | Bacteria | 3471 |
| 646 | Ga0495672_0001732 | 3300047320 | Bacteria | 21096 |
| 647 | Ga0495672_0001845 | 3300047320 | Bacteria | 20212 |
| 648 | Ga0495672_0003005 | 3300047320 | Bacteria | 14830 |
| 649 | Ga0495672_0004324 | 3300047320 | Bacteria | 11699 |
| 650 | Ga0495672_0008012 | 3300047320 | Bacteria | 7860 |
| 651 | Ga0495672_0016139 | 3300047320 | Bacteria | 5046 |
| 652 | Ga0495672_0024705 | 3300047320 | Bacteria | 3865 |
| 653 | Ga0495672_0026001 | 3300047320 | Bacteria | 3740 |
| 654 | Ga0495672_0027386 | 3300047320 | Bacteria | 3622 |
| 655 | Ga0495672_0036816 | 3300047320 | Bacteria | 3001 |
| 656 | Ga0495672_0037314 | 3300047320 | Bacteria | 2974 |
| 657 | Ga0495672_0052444 | 3300047320 | Bacteria | 2395 |
| 658 | Ga0495672_0052738 | 3300047320 | Bacteria | 2387 |
| 659 | Ga0495676_0000023 | 3300047321 | Bacteria | 156478 |
| 660 | Ga0495676_0085128 | 3300047321 | Bacteria | 2382 |
| 661 | Ga0495676_0093945 | 3300047321 | Bacteria | 2235 |
| 662 | Ga0495680_0017577 | 3300047322 | Bacteria | 6098 |
| 663 | Ga0495680_0030879 | 3300047322 | Bacteria | 4366 |
| 664 | Ga0495680_0092867 | 3300047322 | Bacteria | 2259 |
| 665 | Ga0495683_0000090 | 3300047323 | Bacteria | 91954 |
| 666 | Ga0495683_0000291 | 3300047323 | Bacteria | 43274 |
| 667 | Ga0495683_0017904 | 3300047323 | Bacteria | 3667 |
| 668 | Ga0495683_0025884 | 3300047323 | Bacteria | 3004 |
| 669 | Ga0495683_0031372 | 3300047323 | Bacteria | 2708 |
| 670 | Ga0495683_0031864 | 3300047323 | Bacteria | 2685 |
| 671 | Ga0495683_0096134 | 3300047323 | Bacteria | 1429 |
| 672 | Ga0495687_004495 | 3300047443 | Bacteria | 9385 |
| 673 | Ga0495687_015659 | 3300047443 | Bacteria | 3848 |
| 674 | Ga0495687_017207 | 3300047443 | Bacteria | 3614 |
| 675 | Ga0495675_0011097 | 3300047444 | Bacteria | 5648 |
| 676 | Ga0495675_0046453 | 3300047444 | Bacteria | 2764 |
| 677 | Ga0495677_0009840 | 3300047445 | Bacteria | 3522 |
| 678 | Ga0495679_004280 | 3300047446 | Bacteria | 6628 |
| 679 | Ga0495679_005609 | 3300047446 | Bacteria | 5534 |
| 680 | Ga0495679_012174 | 3300047446 | Bacteria | 3285 |
| 681 | Ga0495679_023727 | 3300047446 | Bacteria | 2076 |
| 682 | Ga0495679_029045 | 3300047446 | Bacteria | 1806 |
| 683 | Ga0495685_074921 | 3300047447 | Bacteria | 1131 |
| 684 | Ga0495673_0002422 | 3300047469 | Bacteria | 13140 |
| 685 | Ga0495673_0003368 | 3300047469 | Bacteria | 10578 |
| 686 | Ga0495673_0003921 | 3300047469 | Bacteria | 9544 |
| 687 | Ga0495673_0004741 | 3300047469 | Bacteria | 8433 |
| 688 | Ga0495673_0008751 | 3300047469 | Bacteria | 5655 |
| 689 | Ga0495673_0010435 | 3300047469 | Bacteria | 5049 |
| 690 | Ga0495673_0011971 | 3300047469 | Bacteria | 4631 |
| 691 | Ga0495673_0018012 | 3300047469 | Bacteria | 3572 |
| 692 | Ga0495673_0018391 | 3300047469 | Bacteria | 3524 |
| 693 | Ga0495673_0019454 | 3300047469 | Bacteria | 3401 |
| 694 | Ga0495673_0019933 | 3300047469 | Bacteria | 3349 |
| 695 | Ga0495673_0021846 | 3300047469 | Bacteria | 3149 |
| 696 | Ga0495673_0023899 | 3300047469 | Bacteria | 2963 |
| 697 | Ga0495673_0063935 | 3300047469 | Bacteria | 1567 |
| 698 | Ga0495681_0000397 | 3300047470 | Bacteria | 33833 |
| 699 | Ga0495681_0000553 | 3300047470 | Bacteria | 28652 |
| 700 | Ga0495681_0003804 | 3300047470 | Bacteria | 10455 |
| 701 | Ga0495681_0009482 | 3300047470 | Bacteria | 5992 |
| 702 | Ga0495681_0017922 | 3300047470 | Bacteria | 3917 |
| 703 | Ga0495681_0025689 | 3300047470 | Bacteria | 3077 |
| 704 | Ga0495681_0029207 | 3300047470 | Bacteria | 2825 |
| 705 | Ga0495681_0031131 | 3300047470 | Bacteria | 2706 |
| 706 | Ga0495681_0041125 | 3300047470 | Bacteria | 2245 |
| 707 | Ga0495681_0046440 | 3300047470 | Bacteria | 2070 |
| 708 | Ga0495681_0059794 | 3300047470 | Bacteria | 1760 |
| 709 | Ga0495681_0067500 | 3300047470 | Bacteria | 1629 |
| 710 | Ga0495684_0047979 | 3300047471 | Bacteria | 3265 |
| 711 | Ga0495684_0083632 | 3300047471 | Bacteria | 2421 |
| 712 | Ga0495686_0009181 | 3300047472 | Bacteria | 7157 |
| 713 | Ga0495686_0027993 | 3300047472 | Bacteria | 3674 |
| 714 | Ga0495686_0041006 | 3300047472 | Bacteria | 2949 |
| 715 | Ga0495686_0073832 | 3300047472 | Bacteria | 2094 |
| 716 | Ga0495593_0053022 | 3300047673 | Bacteria | 2141 |
| 717 | Ga0495593_0055880 | 3300047673 | Bacteria | 2076 |
| 718 | Ga0495626_0000095 | 3300048091 | Bacteria | 114682 |
| 719 | Ga0495626_0001931 | 3300048091 | Bacteria | 15407 |
| 720 | Ga0495626_0003156 | 3300048091 | Bacteria | 10754 |
| 721 | Ga0495626_0011559 | 3300048091 | Bacteria | 4666 |
| 722 | Ga0495626_0025619 | 3300048091 | Bacteria | 2882 |
| 723 | Ga0495626_0029125 | 3300048091 | Bacteria | 2674 |
| 724 | Ga0495626_0051114 | 3300048091 | Bacteria | 1907 |
| 725 | Ga0495626_0087340 | 3300048091 | Bacteria | 1376 |
| 726 | Ga0496102_0003905 | 3300048905 | Bacteria | 12625 |
| 727 | Ga0496103_0027414 | 3300048906 | Bacteria | 3452 |
| 728 | Ga0496105_0140468 | 3300048908 | Bacteria | 1988 |
| 729 | Ga0496110_0040025 | 3300048913 | Bacteria | 4084 |
| 730 | Ga0496110_0106681 | 3300048913 | Bacteria | 2514 |
| 731 | Ga0496110_0316104 | 3300048913 | Bacteria | 1422 |
| 732 | Ga0496111_0246155 | 3300048914 | Bacteria | 1327 |
| 733 | Ga0496114_0011778 | 3300048917 | Bacteria | 6998 |
| 734 | Ga0496114_0020368 | 3300048917 | Bacteria | 5384 |
| 735 | Ga0496115_0089079 | 3300048918 | Bacteria | 2520 |
| 736 | Ga0496116_0000525 | 3300048919 | Bacteria | 51688 |
| 737 | Ga0496116_0004751 | 3300048919 | Bacteria | 12829 |
| 738 | Ga0496116_0006674 | 3300048919 | Bacteria | 10410 |
| 739 | Ga0496116_0008553 | 3300048919 | Bacteria | 8865 |
| 740 | Ga0496116_0029341 | 3300048919 | Bacteria | 3967 |
| 741 | Ga0496117_0000363 | 3300048920 | Bacteria | 78883 |
| 742 | Ga0496117_0000681 | 3300048920 | Bacteria | 54266 |
| 743 | Ga0496117_0002402 | 3300048920 | Bacteria | 23807 |
| 744 | Ga0496117_0002810 | 3300048920 | Bacteria | 21199 |
| 745 | Ga0496117_0010506 | 3300048920 | Bacteria | 8422 |
| 746 | Ga0496117_0034292 | 3300048920 | Bacteria | 3825 |
| 747 | Ga0496117_0038624 | 3300048920 | Bacteria | 3535 |
| 748 | Ga0496118_0004038 | 3300048921 | Bacteria | 17832 |
| 749 | Ga0496118_0006685 | 3300048921 | Bacteria | 12570 |
| 750 | Ga0496118_0094595 | 3300048921 | Bacteria | 2043 |
| 751 | Ga0496118_0105637 | 3300048921 | Bacteria | 1887 |
| 752 | Ga0496118_0129442 | 3300048921 | Bacteria | 1624 |
| 753 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 754 | Ga0496119_0021468 | 3300048922 | Bacteria | 4668 |
| 755 | Ga0496119_0111214 | 3300048922 | Bacteria | 1520 |
| 756 | Ga0496120_0000329 | 3300048923 | Bacteria | 78994 |
| 757 | Ga0496120_0000939 | 3300048923 | Bacteria | 40080 |
| 758 | Ga0496120_0086228 | 3300048923 | Bacteria | 1688 |
| 759 | Ga0496121_0000622 | 3300048924 | Bacteria | 65992 |
| 760 | Ga0496121_0008733 | 3300048924 | Bacteria | 11821 |
| 761 | Ga0496121_0052263 | 3300048924 | Bacteria | 3433 |
| 762 | Ga0496121_0075845 | 3300048924 | Bacteria | 2684 |
| 763 | Ga0496121_0193348 | 3300048924 | Bacteria | 1457 |
| 764 | Ga0496122_0011434 | 3300048925 | Bacteria | 8984 |
| 765 | Ga0496122_0012002 | 3300048925 | Bacteria | 8688 |
| 766 | Ga0496122_0046829 | 3300048925 | Bacteria | 3344 |
| 767 | Ga0496122_0082554 | 3300048925 | Bacteria | 2231 |
| 768 | Ga0496123_0003157 | 3300048926 | Bacteria | 18829 |
| 769 | Ga0496123_0008511 | 3300048926 | Bacteria | 9407 |
| 770 | Ga0496123_0020315 | 3300048926 | Bacteria | 5199 |
| 771 | Ga0496123_0051809 | 3300048926 | Bacteria | 2730 |
| 772 | Ga0496123_0063307 | 3300048926 | Bacteria | 2364 |
| 773 | Ga0496123_0085028 | 3300048926 | Bacteria | 1905 |
| 774 | Ga0496124_0000573 | 3300048927 | Bacteria | 62338 |
| 775 | Ga0496124_0004787 | 3300048927 | Bacteria | 15585 |
| 776 | Ga0496124_0008291 | 3300048927 | Bacteria | 10884 |
| 777 | Ga0496124_0011100 | 3300048927 | Bacteria | 9037 |
| 778 | Ga0496124_0012479 | 3300048927 | Bacteria | 8385 |
| 779 | Ga0496124_0024013 | 3300048927 | Bacteria | 5550 |
| 780 | Ga0496124_0075114 | 3300048927 | Bacteria | 2792 |
| 781 | Ga0496124_0133031 | 3300048927 | Bacteria | 1973 |
| 782 | Ga0496124_0138336 | 3300048927 | Bacteria | 1925 |
| 783 | Ga0496124_0141608 | 3300048927 | Bacteria | 1897 |
| 784 | Ga0496124_0200861 | 3300048927 | Bacteria | 1516 |
| 785 | Ga0496125_0000536 | 3300048928 | Bacteria | 65389 |
| 786 | Ga0496125_0000541 | 3300048928 | Bacteria | 65102 |
| 787 | Ga0496125_0005682 | 3300048928 | Bacteria | 13751 |
| 788 | Ga0496125_0014901 | 3300048928 | Bacteria | 7550 |
| 789 | Ga0496125_0112718 | 3300048928 | Bacteria | 1964 |
| 790 | Ga0496125_0126758 | 3300048928 | Bacteria | 1807 |
| 791 | Ga0496126_0017191 | 3300048929 | Bacteria | 7212 |
| 792 | Ga0496126_0025692 | 3300048929 | Bacteria | 5660 |
| 793 | Ga0496126_0077763 | 3300048929 | Bacteria | 2941 |
| 794 | Ga0496126_0145557 | 3300048929 | Bacteria | 2035 |
| 795 | Ga0501307_005353 | 3300049162 | Bacteria | 1350 |
| 796 | Ga0495678_002220 | 3300049459 | Bacteria | 13595 |
| 797 | Ga0495678_005089 | 3300049459 | Bacteria | 7388 |
| 798 | Ga0495678_012221 | 3300049459 | Bacteria | 4076 |
| 799 | Ga0495678_012625 | 3300049459 | Bacteria | 3998 |
| 800 | Ga0495678_017043 | 3300049459 | Bacteria | 3303 |
| 801 | Ga0495678_026684 | 3300049459 | Bacteria | 2460 |
| 802 | Ga0495678_029605 | 3300049459 | Bacteria | 2298 |
| 803 | Ga0495678_032743 | 3300049459 | Bacteria | 2151 |
| 804 | Ga0495678_041584 | 3300049459 | Bacteria | 1838 |
| 805 | Ga0495678_067950 | 3300049459 | Bacteria | 1315 |
| 806 | Ga0495682_0000079 | 3300049460 | Bacteria | 85081 |
| 807 | Ga0495682_0001742 | 3300049460 | Bacteria | 11020 |
| 808 | Ga0495682_0011207 | 3300049460 | Bacteria | 3454 |
| 809 | Ga0495682_0018427 | 3300049460 | Bacteria | 2628 |
| 810 | Ga0495682_0038118 | 3300049460 | Bacteria | 1766 |
| 811 | Ga0495682_0052438 | 3300049460 | Bacteria | 1482 |
| 812 | Ga0501314_002837 | 3300049530 | Bacteria | 1364 |
| 813 | Ga0501034_0000145 | 3300049571 | Bacteria | 133121 |
| 814 | Ga0501241_000614 | 3300049758 | Bacteria | 7650 |
| 815 | Ga0501226_000015 | 3300049853 | Bacteria | 164151 |
| 816 | nmdc:mga00v17_195921_c1 | 3300050491 | Bacteria | 1305 |
| 817 | Ga0500618_005235 | 3300053125 | Bacteria | 3984 |
| 818 | Ga0500659_0000943 | 3300053135 | Bacteria | 18702 |
| 819 | 2511257153 | 2511231004 | Bacteria | 6669789 |
| 820 | 2511267326 | 2511231006 | Bacteria | 6794709 |
| 821 | 2511274028 | 2511231007 | Bacteria | 6306603 |
| 822 | 2511279304 | 2511231008 | Bacteria | 6624100 |
| 823 | 2511291995 | 2511231010 | Bacteria | 6373152 |
| 824 | 2511296980 | 2511231011 | Bacteria | 6149768 |
| 825 | 2511303163 | 2511231012 | Bacteria | 6738011 |
| 826 | 2511313988 | 2511231014 | Bacteria | 6462302 |
| 827 | 2511321528 | 2511231015 | Bacteria | 6598026 |
| 828 | 2511325598 | 2511231016 | Bacteria | 6704427 |
| 829 | 2511338614 | 2511231018 | Bacteria | 6436256 |
| 830 | 2511346896 | 2511231019 | Bacteria | 6520662 |
| 831 | 2511350007 | 2511231020 | Bacteria | 6115223 |
| 832 | 2511361126 | 2511231022 | Bacteria | 6719296 |
| 833 | 2511371594 | 2511231023 | Bacteria | 6808468 |
| 834 | 2511376797 | 2511231024 | Bacteria | 5835885 |
| 835 | 2511410605 | 2511231031 | Bacteria | 6558529 |
| 836 | 2511824174 | 2511231156 | Bacteria | 6845832 |
| 837 | 2512325488 | 2512047018 | Bacteria | 6663241 |
| 838 | 2555247643 | 2554235231 | Bacteria | 5215788 |
| 839 | 2555670875 | 2554235341 | Bacteria | 6867980 |
| 840 | 2583793164 | 2582580891 | Bacteria | 6800976 |
| 841 | 2597858890 | 2597489887 | Bacteria | 6666321 |
| 842 | 2597864520 | 2597489888 | Bacteria | 6179543 |
| 843 | 2597870327 | 2597489889 | Bacteria | 6297495 |
| 844 | 2599329162 | 2599185155 | Bacteria | 5827168 |
| 845 | 2599357564 | 2599185160 | Bacteria | 6844013 |
| 846 | 2599364354 | 2599185161 | Bacteria | 6960462 |
| 847 | 2599370675 | 2599185162 | Bacteria | 6957254 |
| 848 | 2599377132 | 2599185163 | Bacteria | 6995158 |
| 849 | 2599382719 | 2599185164 | Bacteria | 6841688 |
| 850 | 2599389167 | 2599185165 | Bacteria | 6843250 |
| 851 | 2599395900 | 2599185166 | Bacteria | 6959206 |
| 852 | 2599397645 | 2599185167 | Bacteria | 6353609 |
| 853 | 2599408290 | 2599185168 | Bacteria | 6997636 |
| 854 | 2599452091 | 2599185179 | Bacteria | 6611171 |
| 855 | 2599463947 | 2599185181 | Bacteria | 6844519 |
| 856 | 2599470974 | 2599185182 | Bacteria | 6883168 |
| 857 | 2599487672 | 2599185185 | Bacteria | 6652270 |
| 858 | 2599492966 | 2599185186 | Bacteria | 6831633 |
| 859 | 2599502026 | 2599185188 | Bacteria | 6164180 |
| 860 | 2599506732 | 2599185189 | Bacteria | 5862825 |
| 861 | 2599513526 | 2599185190 | Bacteria | 6285678 |
| 862 | 2599517971 | 2599185191 | Bacteria | 6297582 |
| 863 | 2599611233 | 2599185212 | Bacteria | 6765997 |
| 864 | 2599769915 | 2599185248 | Bacteria | 6696816 |
| 865 | 2599806002 | 2599185257 | Bacteria | 6492581 |
| 866 | 2599880836 | 2599185288 | Bacteria | 6666191 |
| 867 | 2599887239 | 2599185289 | Bacteria | 6778765 |
| 868 | 2599892203 | 2599185290 | Bacteria | 6289611 |
| 869 | 2599898596 | 2599185291 | Bacteria | 6775623 |
| 870 | 2599932914 | 2599185300 | Bacteria | 6062622 |
| 871 | 2599942672 | 2599185302 | Bacteria | 5954930 |
| 872 | 2599949819 | 2599185303 | Bacteria | 6512725 |
| 873 | 2599953421 | 2599185304 | Bacteria | 5951361 |
| 874 | 2599959055 | 2599185305 | Bacteria | 6748700 |
| 875 | 2599964324 | 2599185306 | Bacteria | 6637356 |
| 876 | 2599970690 | 2599185307 | Bacteria | 6194719 |
| 877 | 2599975805 | 2599185308 | Bacteria | 6621546 |
| 878 | 2599982396 | 2599185309 | Bacteria | 5969593 |
| 879 | 2599989179 | 2599185310 | Bacteria | 6014457 |
| 880 | 2599994555 | 2599185311 | Bacteria | 6354990 |
| 881 | 2599999413 | 2599185312 | Bacteria | 5912071 |
| 882 | 2600005964 | 2599185313 | Bacteria | 6658188 |
| 883 | 2600009558 | 2599185314 | Bacteria | 6621749 |
| 884 | 2600017101 | 2599185315 | Bacteria | 6771107 |
| 885 | 2600023506 | 2599185316 | Bacteria | 6320029 |
| 886 | 2600029151 | 2599185317 | Bacteria | 6435722 |
| 887 | 2600035600 | 2599185318 | Bacteria | 6961590 |
| 888 | 2600042118 | 2599185319 | Bacteria | 6637840 |
| 889 | 2600047077 | 2599185320 | Bacteria | 5963263 |
| 890 | 2600051924 | 2599185321 | Bacteria | 6764560 |
| 891 | 2600057177 | 2599185322 | Bacteria | 6763055 |
| 892 | 2600064924 | 2599185323 | Bacteria | 6688755 |
| 893 | 2600069845 | 2599185324 | Bacteria | 6590677 |
| 894 | 2600077337 | 2599185325 | Bacteria | 6324919 |
| 895 | 2600217088 | 2599185356 | Bacteria | 6843884 |
| 896 | 2600358525 | 2600254930 | Bacteria | 6431253 |
| 897 | 2600366707 | 2600254931 | Bacteria | 6734225 |
| 898 | 2600444780 | 2600254954 | Bacteria | 5100516 |
| 899 | 2601627841 | 2600255283 | Bacteria | 6061572 |
| 900 | 2601690177 | 2600255296 | Bacteria | 5784754 |
| 901 | 2601777259 | 2600255313 | Bacteria | 6842543 |
| 902 | 2601797194 | 2600255318 | Bacteria | 6383414 |
| 903 | 2602011916 | 2600255389 | Bacteria | 5275336 |
| 904 | 2606076075 | 2603880185 | Bacteria | 6379190 |
| 905 | 2606130985 | 2603880199 | Bacteria | 6377649 |
| 906 | 2621298969 | 2619619299 | Bacteria | 6649820 |
| 907 | 2624481470 | 2623620443 | Bacteria | 6427864 |
| 908 | 2624493022 | 2623620446 | Bacteria | 6500345 |
| 909 | 2643843572 | 2643221565 | Bacteria | 6216018 |
| 910 | 2643871227 | 2643221571 | Bacteria | 6228673 |
| 911 | 2643953827 | 2643221589 | Bacteria | 6250934 |
| 912 | 2644021761 | 2643221602 | Bacteria | 6249926 |
| 913 | 2644188505 | 2643221633 | Bacteria | 6733554 |
| 914 | 2644282534 | 2643221650 | Bacteria | 7029547 |
| 915 | 2644620480 | 2643221713 | Bacteria | 6554480 |
| 916 | 2652548524 | 2651869719 | Bacteria | 6047974 |
| 917 | 2671091088 | 2667528170 | Bacteria | 6786960 |
| 918 | 2671100518 | 2667528171 | Bacteria | 6900659 |
| 919 | 2671124618 | 2667528176 | Bacteria | 6724917 |
| 920 | 2671772932 | 2671180172 | Bacteria | 6495783 |
| 921 | 2677899481 | 2675903420 | Bacteria | 6247433 |
| 922 | 2678264078 | 2675903515 | Bacteria | 6580491 |
| 923 | 2715752773 | 2713897148 | Bacteria | 5883533 |
| 924 | 2715755988 | 2713897149 | Bacteria | 6506249 |
| 925 | 2718634723 | 2718217725 | Bacteria | 5758958 |
| 926 | 2723249305 | 2721755607 | Bacteria | 5841722 |
| 927 | 2738672214 | 2738541265 | Bacteria | 6594665 |
| 928 | 2738750607 | 2738541282 | Bacteria | 6593925 |
| 929 | 2738806110 | 2738541294 | Bacteria | 6925949 |
| 930 | 2738859648 | 2738541303 | Bacteria | 6591772 |
| 931 | 2738893470 | 2738541309 | Bacteria | 6926455 |
| 932 | 2739199902 | 2738543004 | Bacteria | 6381073 |
| 933 | 2739260224 | 2738543015 | Bacteria | 6750701 |
| 934 | 2739285272 | 2738543020 | Bacteria | 5718238 |
| 935 | 2739290586 | 2738543021 | Bacteria | 5718241 |
| 936 | 2739313741 | 2738543025 | Bacteria | 6600348 |
| 937 | 2743738410 | 2740892503 | Bacteria | 6855563 |
| 938 | 2745004534 | 2744054620 | Bacteria | 6551379 |
| 939 | 2765584895 | 2765235841 | Bacteria | 6137024 |
| 940 | 2774119068 | 2773857670 | Bacteria | 6407454 |
| 941 | 2774135052 | 2773857673 | Bacteria | 6513460 |
| 942 | 2784265123 | 2784132063 | Bacteria | 6262788 |
| 943 | 2784312707 | 2784132072 | Bacteria | 6596533 |
| 944 | 2794596851 | 2791355520 | Bacteria | 5948615 |
| 945 | 2807407782 | 2806310737 | Bacteria | 5751088 |
| 946 | 2807456098 | 2806310745 | Bacteria | 5742165 |
| 947 | 2808858523 | 2808606361 | Bacteria | 6136259 |
| 948 | 2808925633 | 2808606376 | Bacteria | 6248667 |
| 949 | 2808931770 | 2808606377 | Bacteria | 6646337 |
| 950 | 2808938712 | 2808606378 | Bacteria | 6177535 |
| 951 | 2808947683 | 2808606380 | Bacteria | 6248705 |
| 952 | 2808953890 | 2808606381 | Bacteria | 6646461 |
| 953 | 2808967008 | 2808606383 | Bacteria | 6138645 |
| 954 | 2808978949 | 2808606385 | Bacteria | 6711065 |
| 955 | 2808994736 | 2808606388 | Bacteria | 6706662 |
| 956 | 2809001838 | 2808606389 | Bacteria | 6138126 |
| 957 | 2809214346 | 2808606445 | Bacteria | 6057339 |
| 958 | 2812367369 | 2811994881 | Bacteria | 6298475 |
| 959 | 2817491868 | 2816332298 | Bacteria | 6852809 |
| 960 | 2819657758 | 2818991456 | Bacteria | 6123676 |
| 961 | 2819706180 | 2818991464 | Bacteria | 6907494 |
| 962 | 2823423787 | 2823421272 | Bacteria | 5372474 |
| 963 | 2825657099 | 2825651385 | Bacteria | 6715909 |
| 964 | 2826582280 | 2826581358 | Bacteria | 5963467 |
| 965 | 2834032660 | 2834028612 | Bacteria | 6354979 |
| 966 | 2842807013 | 2842805378 | Bacteria | 5385175 |
| 967 | 2842816624 | 2842815866 | Bacteria | 5947510 |
| 968 | 2842828339 | 2842826826 | Bacteria | 5974129 |
| 969 | 2842836307 | 2842832357 | Bacteria | 5959113 |
| 970 | 2842847093 | 2842843487 | Bacteria | 6004777 |
| 971 | 2842854030 | 2842849001 | Bacteria | 5924277 |
| 972 | 2842855071 | 2842854478 | Bacteria | 6143501 |
| 973 | 2852613829 | 2852612431 | Bacteria | 6885235 |
| 974 | 2852659437 | 2852657418 | Bacteria | 6472974 |
| 975 | 2852668435 | 2852667396 | Bacteria | 6885555 |
| 976 | 2860344256 | 2860339153 | Bacteria | 6846989 |
| 977 | 2860871020 | 2860867994 | Bacteria | 5645326 |
| 978 | 2878033445 | 2878029506 | Bacteria | 6418441 |
| 979 | 2880232840 | 2880230671 | Bacteria | 6140320 |
| 980 | 2904520421 | 2904518522 | Bacteria | 6068986 |
| 981 | 2904553635 | 2904550169 | Bacteria | 6221258 |
| 982 | 2908449117 | 2908446538 | Bacteria | 6829095 |
| 983 | 2912965714 | 2912963787 | Bacteria | 5646108 |
| 984 | 2913040465 | 2913036834 | Bacteria | 6704877 |
| 985 | 2917074734 | 2917070673 | Bacteria | 6868303 |
| 986 | 2919066856 | 2919063839 | Bacteria | 6302690 |
| 987 | 2919157150 | 2919155634 | Bacteria | 4860545 |
| 988 | 2919387604 | 2919385768 | Bacteria | 5897293 |
| 989 | 2919461286 | 2919456309 | Bacteria | 6586567 |
| 990 | 2919482365 | 2919481497 | Bacteria | 6907839 |
| 991 | 2919492449 | 2919487758 | Bacteria | 5929766 |
| 992 | 2919503529 | 2919501602 | Bacteria | 5286340 |
| 993 | 2919699702 | 2919697872 | Bacteria | 6553725 |
| 994 | 2923157466 | 2923153595 | Bacteria | 6870622 |
| 995 | 2923521417 | 2923519811 | Bacteria | 6298479 |
| 996 | 2923587932 | 2923586266 | Bacteria | 6565975 |
| 997 | 2926065899 | 2926063275 | Bacteria | 5285848 |
| 998 | 2929146362 | 2929144301 | Bacteria | 6622272 |
| 999 | 2929193086 | 2929189879 | Bacteria | 5930554 |
| 1000 | 2931374620 | 2931369376 | Bacteria | 6847892 |
| 1001 | 2931393404 | 2931390751 | Bacteria | 6273349 |
| 1002 | 2931402987 | 2931396565 | Bacteria | 7251677 |
| 1003 | 2935355279 | 2935353572 | Unclassified | 6955622 |
| 1004 | 2939640280 | 2939636861 | Bacteria | 6297853 |
| 1005 | 2939653824 | 2939651529 | Bacteria | 5895393 |
| 1006 | 2945932907 | 2945928738 | Bacteria | 6053221 |
| 1007 | 2945964529 | 2945961074 | Bacteria | 7342064 |
| 1008 | 2946009180 | 2946006987 | Bacteria | 6705746 |
| 1009 | 2946031363 | 2946027586 | Bacteria | 6049274 |
| 1010 | 2947238335 | 2947233263 | Bacteria | 6439278 |
| 1011 | 2969308202 | 2969304461 | Bacteria | 6601805 |
| 1012 | 2974290321 | 2974289157 | Bacteria | 6080362 |
| 1013 | 2984288676 | 2984286254 | Bacteria | 6702062 |
| 1014 | 2988729669 | 2988728565 | Bacteria | 6124362 |
| 1015 | 2998143532 | 2998139840 | Bacteria | 6073514 |
| 1016 | 3007252897 | 3007252601 | Bacteria | 4559114 |
| 1017 | 3007318432 | 3007315729 | Bacteria | 5076637 |
| 1018 | 3007396788 | 3007395558 | Bacteria | 6755444 |
| 1019 | 3007424003 | 3007419365 | Bacteria | 7026924 |
| 1020 | 3007515168 | 3007511990 | Bacteria | 6481491 |
| 1021 | 3007616689 | 3007614139 | Bacteria | 6053559 |
| 1022 | 3007625114 | 3007619802 | Bacteria | 6411688 |
| 1023 | 3007720843 | 3007718800 | Bacteria | 5971527 |
| 1024 | 3007804783 | 3007803356 | Bacteria | 5931491 |
| 1025 | 3007859048 | 3007855910 | Bacteria | 5637581 |
| 1026 | 3007861487 | 3007861166 | Bacteria | 6045338 |
| 1027 | 3007868543 | 3007866637 | Bacteria | 5899198 |
| 1028 | 3007873764 | 3007872151 | Bacteria | 5268868 |
| 1029 | 637321211 | 637000220 | Bacteria | 7074893 |
| 1030 | 640487934 | 640427133 | Bacteria | 4567418 |
| 1031 | 651175880 | 651053060 | Bacteria | 4689946 |
| 1032 | 8005658882 | 8005658619 | Bacteria | 4500593 |
| 1033 | 8015691629 | 8015687852 | Bacteria | 6613826 |
| 1034 | 8019772178 | 8019769354 | Bacteria | 6924660 |
| 1035 | 8019776027 | 8019775933 | Bacteria | 6858656 |
| 1036 | 8029997293 | 8029995093 | Bacteria | 5990776 |
| 1037 | 8034964713 | 8034962539 | Bacteria | 4884839 |
| 1038 | 8052498108 | 8052494512 | Bacteria | 5765634 |
| 1039 | 8054287721 | 8054285046 | Bacteria | 6919322 |
| 1040 | 8054347812 | 8054347763 | Bacteria | 5901107 |
| 1041 | 8054506861 | 8054503363 | Bacteria | 6101651 |
| 1042 | 8054932143 | 8054929484 | Bacteria | 5599761 |
| 1043 | 8055774818 | 8055770955 | Bacteria | 6827675 |
| 1044 | 8055821653 | 8055817908 | Bacteria | 6609162 |
| 1045 | 8055880891 | 8055878733 | Bacteria | 5907058 |
| 1046 | 8056118311 | 8056115690 | Bacteria | 5527654 |
| 1047 | 8056122819 | 8056120720 | Bacteria | 5758328 |
| 1048 | 8056129716 | 8056125926 | Bacteria | 6228218 |
| 1049 | 8056135320 | 8056131705 | Bacteria | 6107031 |
| 1050 | 8056139691 | 8056137416 | Bacteria | 6147080 |
| 1051 | 8056146914 | 8056143049 | Bacteria | 6307666 |
| 1052 | 8056154299 | 8056148874 | Bacteria | 6479865 |
| 1053 | 8056160256 | 8056155041 | Bacteria | 6486948 |
| 1054 | 8056165466 | 8056161164 | Bacteria | 6106669 |
| 1055 | 8056167679 | 8056166840 | Bacteria | 5820959 |
| 1056 | 8056173693 | 8056172158 | Bacteria | 6133900 |
| 1057 | 8056183898 | 8056177738 | Bacteria | 6748268 |
| 1058 | 8056573631 | 8056569372 | Bacteria | 5997322 |
| 1059 | 8057801352 | 8057798959 | Bacteria | 6713499 |
| 1060 | Ga0495583_0043593 | |||
| 1061 | MRS2a_Contig_29 | |||
| 1062 | SwRhRL2b_contig_2231633 | |||
| 1063 | SwRhRL2b_contig_52614 | |||
| 1064 | MRS1b_contig_7358983 | |||
| 1065 | JGI25162J39368_1000127 | |||
| 1066 | JGI25164J39214_1000044 | |||
| 1067 | JGI25165J46597_1000131 | |||
| 1068 | Ga0055538_1000088 | |||
| 1069 | Ga0055539_1000132 | |||
| 1070 | Ga0055533_1000135 | |||
| 1071 | Ga0055532_1000178 | |||
| 1072 | Ga0055525_1000243 | |||
| 1073 | Ga0055536_1000949 | |||
| 1074 | Ga0055530_10000006 | |||
| 1075 | Ga0055530_10000141 | |||
| 1076 | Ga0055530_10000514 | |||
| 1077 | Ga0055540_1000171 | |||
| 1078 | Ga0055540_1000180 | |||
| 1079 | Ga0055540_1000781 | |||
| 1080 | Ga0055531_10000497 | |||
| 1081 | Ga0055541_1000087 | |||
| 1082 | Ga0065714_10004018 | |||
| 1083 | Ga0065714_10065466 | |||
| 1084 | Ga0065714_10066674 | |||
| 1085 | Ga0065714_10073365 | |||
| 1086 | Ga0065714_10095612 | |||
| 1087 | Ga0065704_10002729 | |||
| 1088 | Ga0065704_10003525 | |||
| 1089 | Ga0065704_10083272 | |||
| 1090 | Ga0065704_10109234 | |||
| 1091 | Ga0065704_10130893 | |||
| 1092 | Ga0065712_10067850 | |||
| 1093 | Ga0065712_10086885 | |||
| 1094 | Ga0065715_10007242 | |||
| 1095 | Ga0070670_100003187 | |||
| 1096 | Ga0070670_100028637 | |||
| 1097 | Ga0070661_100000953 | |||
| 1098 | Ga0070661_100068936 | |||
| 1099 | Ga0070669_100013899 | |||
| 1100 | Ga0070669_100029203 | |||
| 1101 | Ga0068853_100365983 | |||
| 1102 | Ga0070665_100047675 | |||
| 1103 | Ga0068855_100119874 | |||
| 1104 | Ga0070664_100000930 | |||
| 1105 | Ga0068854_100232885 | |||
| 1106 | Ga0068852_100006493 | |||
| 1107 | Ga0068851_10000225 | |||
| 1108 | Ga0075364_10021175 | |||
| 1109 | Ga0075364_10032764 | |||
| 1110 | Ga0075364_10062463 | |||
| 1111 | Ga0075364_10144184 | |||
| 1112 | Ga0075432_10001148 | |||
| 1113 | Ga0075432_10006989 | |||
| 1114 | Ga0075432_10023249 | |||
| 1115 | Ga0075432_10024494 | |||
| 1116 | Ga0075432_10049301 | |||
| 1117 | Ga0075362_10039371 | |||
| 1118 | Ga0099823_1000047 | |||
| 1119 | Ga0079104_1001334 | |||
| 1120 | Ga0079104_1014206 | |||
| 1121 | Ga0099826_10028691 | |||
| 1122 | Ga0105251_10000879 | |||
| 1123 | Ga0105251_10007077 | |||
| 1124 | Ga0105251_10009600 | |||
| 1125 | Ga0105251_10011882 | |||
| 1126 | Ga0105251_10012556 | |||
| 1127 | Ga0105251_10030321 | |||
| 1128 | Ga0105251_10047016 | |||
| 1129 | Ga0105244_10001520 | |||
| 1130 | Ga0105244_10001546 | |||
| 1131 | Ga0105244_10001608 | |||
| 1132 | Ga0105244_10001994 | |||
| 1133 | Ga0105244_10002919 | |||
| 1134 | Ga0105244_10008116 | |||
| 1135 | Ga0105244_10034687 | |||
| 1136 | Ga0105244_10035928 | |||
| 1137 | Ga0105244_10036170 | |||
| 1138 | Ga0105244_10057701 | |||
| 1139 | Ga0105250_10000341 | |||
| 1140 | Ga0105250_10001132 | |||
| 1141 | Ga0105250_10004856 | |||
| 1142 | Ga0105250_10019726 | |||
| 1143 | Ga0105250_10033411 | |||
| 1144 | Ga0105250_10061558 | |||
| 1145 | Ga0105240_10159328 | |||
| 1146 | Ga0105243_10000151 | |||
| 1147 | Ga0105243_10001008 | |||
| 1148 | Ga0105243_10157861 | |||
| 1149 | Ga0105241_10054693 | |||
| 1150 | Ga0105242_10004290 | |||
| 1151 | Ga0105237_10001147 | |||
| 1152 | Ga0105246_10000476 | |||
| 1153 | Ga0105246_10018688 | |||
| 1154 | Ga0157373_10004090 | |||
| 1155 | Ga0157373_10011062 | |||
| 1156 | Ga0157373_10025888 | |||
| 1157 | Ga0157373_10038723 | |||
| 1158 | Ga0157373_10050375 | |||
| 1159 | Ga0157371_10000053 | |||
| 1160 | Ga0157371_10001610 | |||
| 1161 | Ga0157371_10006950 | |||
| 1162 | Ga0157371_10013339 | |||
| 1163 | Ga0157371_10019765 | |||
| 1164 | Ga0157371_10332011 | |||
| 1165 | Ga0157370_10002669 | |||
| 1166 | Ga0157370_10050327 | |||
| 1167 | Ga0157370_10074543 | |||
| 1168 | Ga0157370_10113025 | |||
| 1169 | Ga0157370_10291400 | |||
| 1170 | Ga0157369_10001616 | |||
| 1171 | Ga0157369_10017393 | |||
| 1172 | Ga0157369_10019350 | |||
| 1173 | Ga0157369_10125138 | |||
| 1174 | Ga0163162_10019039 | |||
| 1175 | Ga0163162_10133382 | |||
| 1176 | Ga0157372_10000397 | |||
| 1177 | Ga0157372_10014536 | |||
| 1178 | Ga0157372_10034548 | |||
| 1179 | Ga0157375_10016181 | |||
| 1180 | Ga0157375_10064549 | |||
| 1181 | Ga0182008_10002381 | |||
| 1182 | Ga0182008_10018705 | |||
| 1183 | Ga0182008_10020297 | |||
| 1184 | Ga0182008_10028531 | |||
| 1185 | Ga0182008_10041398 | |||
| 1186 | Ga0182008_10052154 | |||
| 1187 | Ga0182006_1009804 | |||
| 1188 | Ga0182006_1010326 | |||
| 1189 | Ga0182006_1018019 | |||
| 1190 | Ga0182006_1028252 | |||
| 1191 | Ga0182006_1030795 | |||
| 1192 | Ga0182006_1033181 | |||
| 1193 | Ga0182007_10000204 | |||
| 1194 | Ga0182007_10026827 | |||
| 1195 | Ga0182005_1000114 | |||
| 1196 | Ga0182005_1005080 | |||
| 1197 | Ga0182005_1010020 | |||
| 1198 | Ga0182005_1020499 | |||
| 1199 | Ga0163161_10012139 | |||
| 1200 | Ga0163161_10023321 | |||
| 1201 | Ga0163161_10028722 | |||
| 1202 | Ga0163161_10116816 | |||
| 1203 | Ga0209435_100552 | |||
| 1204 | Ga0209760_100026 | |||
| 1205 | Ga0209784_100126 | |||
| 1206 | Ga0209566_100152 | |||
| 1207 | Ga0209674_100177 | |||
| 1208 | Ga0209147_100179 | |||
| 1209 | Ga0209563_100142 | |||
| 1210 | Ga0209563_100333 | |||
| 1211 | Ga0207427_100015 | |||
| 1212 | Ga0209437_100027 | |||
| 1213 | Ga0209258_100366 | |||
| 1214 | Ga0209646_1000368 | |||
| 1215 | Ga0209677_100125 | |||
| 1216 | Ga0209759_1002270 | |||
| 1217 | Ga0209233_1000039 | |||
| 1218 | Ga0209675_1010889 | |||
| 1219 | Ga0209676_1000002 | |||
| 1220 | Ga0209676_1000017 | |||
| 1221 | Ga0209676_1000154 | |||
| 1222 | Ga0209676_1000292 | |||
| 1223 | Ga0209050_1000006 | |||
| 1224 | Ga0209050_1000037 | |||
| 1225 | Ga0209050_1000062 | |||
| 1226 | Ga0209050_1000508 | |||
| 1227 | Ga0209051_1000001 | |||
| 1228 | Ga0209051_1000060 | |||
| 1229 | Ga0209051_1000380 | |||
| 1230 | Ga0209257_1000056 | |||
| 1231 | Ga0207656_10000492 | |||
| 1232 | Ga0207696_1000018 | |||
| 1233 | Ga0207696_1000051 | |||
| 1234 | Ga0207696_1000090 | |||
| 1235 | Ga0207696_1003006 | |||
| 1236 | Ga0207696_1004308 | |||
| 1237 | Ga0207696_1008545 | |||
| 1238 | Ga0207696_1049185 | |||
| 1239 | Ga0207655_1000081 | |||
| 1240 | Ga0207655_1000140 | |||
| 1241 | Ga0207655_1000273 | |||
| 1242 | Ga0207655_1000362 | |||
| 1243 | Ga0207655_1000451 | |||
| 1244 | Ga0207655_1001061 | |||
| 1245 | Ga0207655_1001874 | |||
| 1246 | Ga0207655_1003138 | |||
| 1247 | Ga0207655_1017508 | |||
| 1248 | Ga0207655_1025084 | |||
| 1249 | Ga0207655_1027022 | |||
| 1250 | Ga0207655_1027824 | |||
| 1251 | Ga0207655_1030225 | |||
| 1252 | Ga0207713_1000442 | |||
| 1253 | Ga0207713_1000520 | |||
| 1254 | Ga0207713_1002601 | |||
| 1255 | Ga0207713_1003894 | |||
| 1256 | Ga0207713_1007122 | |||
| 1257 | Ga0207713_1011411 | |||
| 1258 | Ga0207713_1012380 | |||
| 1259 | Ga0207713_1014836 | |||
| 1260 | Ga0207713_1016701 | |||
| 1261 | Ga0207713_1020346 | |||
| 1262 | Ga0207713_1020524 | |||
| 1263 | Ga0207713_1024903 | |||
| 1264 | Ga0207713_1029411 | |||
| 1265 | Ga0207713_1029534 | |||
| 1266 | Ga0207654_10088390 | |||
| 1267 | Ga0207671_10001171 | |||
| 1268 | Ga0207649_10003679 | |||
| 1269 | Ga0207649_10058709 | |||
| 1270 | Ga0207681_10006365 | |||
| 1271 | Ga0207650_10000266 | |||
| 1272 | Ga0207650_10002133 | |||
| 1273 | Ga0207686_10025223 | |||
| 1274 | Ga0207709_10000014 | |||
| 1275 | Ga0207709_10088464 | |||
| 1276 | Ga0207679_10000016 | |||
| 1277 | Ga0207698_10016618 | |||
| 1278 | Ga0209281_1000073 | |||
| 1279 | Ga0209281_1020149 | |||
| 1280 | Ga0209389_1000116 | |||
| 1281 | Ga0209371_1000919 | |||
| 1282 | Ga0207428_10022535 | |||
| 1283 | Ga0207428_10050489 | |||
| 1284 | Ga0207428_10090430 | |||
| 1285 | Ga0207428_10144505 | |||
| 1286 | Ga0268266_10103773 | |||
| 1287 | Ga0307517_10087628 | |||
| 1288 | Ga0307517_10180542 | |||
| 1289 | Ga0268256_1000774 | |||
| 1290 | Ga0314311_1121840 | |||
| 1291 | Ga0316178_1149889 | |||
| 1292 | Ga0316183_1037028 | |||
| 1293 | Ga0316181_1052209 | |||
| 1294 | Ga0265316_10160836 | |||
| 1295 | Ga0307509_10262739 | |||
| 1296 | Ga0307408_100000004 | |||
| 1297 | Ga0307408_100022902 | |||
| 1298 | Ga0307408_100024126 | |||
| 1299 | Ga0307408_100041624 | |||
| 1300 | Ga0307408_100056905 | |||
| 1301 | Ga0307408_100071953 | |||
| 1302 | Ga0307408_100305406 | |||
| 1303 | Ga0316578_10006850 | |||
| 1304 | Ga0307405_10010414 | |||
| 1305 | Ga0307405_10242730 | |||
| 1306 | Ga0307406_10014090 | |||
| 1307 | Ga0307412_10002010 | |||
| 1308 | Ga0307412_10003617 | |||
| 1309 | Ga0307412_10003816 | |||
| 1310 | Ga0307412_10013257 | |||
| 1311 | Ga0307412_10218827 | |||
| 1312 | Ga0307409_100125787 | |||
| 1313 | Ga0307409_100159543 | |||
| 1314 | Ga0307416_100219326 | |||
| 1315 | Ga0307414_10053773 | |||
| 1316 | Ga0307414_10061692 | |||
| 1317 | Ga0307411_10018221 | |||
| 1318 | Ga0307411_10059252 | |||
| 1319 | Ga0307411_10064062 | |||
| 1320 | Ga0395899_0018205 | |||
| 1321 | Ga0237819_01688 | |||
| 1322 | Ga0439436_0006075 | |||
| 1323 | Ga0439438_001364 | |||
| 1324 | Ga0439438_005498 | |||
| 1325 | Ga0439438_007279 | |||
| 1326 | Ga0439438_007862 | |||
| 1327 | Ga0439438_008602 | |||
| 1328 | Ga0439438_008686 | |||
| 1329 | Ga0439438_010904 | |||
| 1330 | Ga0439438_013256 | |||
| 1331 | Ga0439438_033874 | |||
| 1332 | Ga0439447_001397 | |||
| 1333 | Ga0439447_007683 | |||
| 1334 | Ga0439447_012716 | |||
| 1335 | Ga0439447_021475 | |||
| 1336 | Ga0439466_0000322 | |||
| 1337 | Ga0439466_0003367 | |||
| 1338 | Ga0439466_0010189 | |||
| 1339 | Ga0439466_0013536 | |||
| 1340 | Ga0439466_0018167 | |||
| 1341 | Ga0439466_0020552 | |||
| 1342 | Ga0439466_0025707 | |||
| 1343 | Ga0439466_0043793 | |||
| 1344 | Ga0439466_0046473 | |||
| 1345 | Ga0439431_0006110 | |||
| 1346 | Ga0439432_007236 | |||
| 1347 | Ga0439432_015566 | |||
| 1348 | Ga0439432_041990 | |||
| 1349 | Ga0439432_050543 | |||
| 1350 | Ga0439452_000108 | |||
| 1351 | Ga0439452_000250 | |||
| 1352 | Ga0439452_001476 | |||
| 1353 | Ga0439452_004496 | |||
| 1354 | Ga0439452_007513 | |||
| 1355 | Ga0439452_019227 | |||
| 1356 | Ga0439452_021762 | |||
| 1357 | Ga0439456_000025 | |||
| 1358 | Ga0439456_001009 | |||
| 1359 | Ga0439456_010461 | |||
| 1360 | Ga0439463_006124 | |||
| 1361 | Ga0439463_025682 | |||
| 1362 | Ga0450911_000068 | |||
| 1363 | Ga0450911_003606 | |||
| 1364 | Ga0450911_005321 | |||
| 1365 | Ga0450919_002290 | |||
| 1366 | Ga0450920_002572 | |||
| 1367 | Ga0450922_001179 | |||
| 1368 | Ga0450890_002945 | |||
| 1369 | Ga0450902_002576 | |||
| 1370 | Ga0450902_007402 | |||
| 1371 | Ga0450903_005528 | |||
| 1372 | Ga0450903_007804 | |||
| 1373 | Ga0450904_001506 | |||
| 1374 | Ga0450904_002673 | |||
| 1375 | Ga0450905_002344 | |||
| 1376 | Ga0450905_007100 | |||
| 1377 | Ga0450906_003516 | |||
| 1378 | Ga0450906_003684 | |||
| 1379 | Ga0450907_000001 | |||
| 1380 | Ga0450907_000459 | |||
| 1381 | Ga0450907_005607 | |||
| 1382 | Ga0450910_002452 | |||
| 1383 | Ga0439446_0015840 | |||
| 1384 | Ga0450908_002616 | |||
| 1385 | Ga0450908_008865 | |||
| 1386 | Ga0450909_001212 | |||
| 1387 | Ga0450909_008747 | |||
| 1388 | Ga0439434_0001003 | |||
| 1389 | Ga0439434_0019409 | |||
| 1390 | Ga0439464_0054722 | |||
| 1391 | Ga0439460_0005888 | |||
| 1392 | Ga0439460_0007716 | |||
| 1393 | Ga0439460_0017064 | |||
| 1394 | Ga0450916_001193 | |||
| 1395 | Ga0450901_000208 | |||
| 1396 | Ga0439440_0004275 | |||
| 1397 | Ga0495617_003496 | |||
| 1398 | Ga0495617_004485 | |||
| 1399 | Ga0495617_008801 | |||
| 1400 | Ga0495617_018363 | |||
| 1401 | Ga0495617_024161 | |||
| 1402 | Ga0495617_025060 | |||
| 1403 | Ga0495627_002231 | |||
| 1404 | Ga0495627_002694 | |||
| 1405 | Ga0495627_004827 | |||
| 1406 | Ga0495627_010623 | |||
| 1407 | Ga0495592_0121036 | |||
| 1408 | Ga0495603_0110535 | |||
| 1409 | Ga0495590_0002524 | |||
| 1410 | Ga0495590_0004909 | |||
| 1411 | Ga0495590_0009896 | |||
| 1412 | Ga0495590_0013548 | |||
| 1413 | Ga0495590_0018725 | |||
| 1414 | Ga0495590_0029360 | |||
| 1415 | Ga0495590_0088496 | |||
| 1416 | Ga0495591_000253 | |||
| 1417 | Ga0495591_001474 | |||
| 1418 | Ga0495591_001590 | |||
| 1419 | Ga0495591_002238 | |||
| 1420 | Ga0495591_010166 | |||
| 1421 | Ga0495591_020961 | |||
| 1422 | Ga0495591_022001 | |||
| 1423 | Ga0495591_022093 | |||
| 1424 | Ga0495591_025999 | |||
| 1425 | Ga0495638_0005693 | |||
| 1426 | Ga0495638_0022888 | |||
| 1427 | Ga0495638_0030720 | |||
| 1428 | Ga0495638_0053017 | |||
| 1429 | Ga0495638_0125161 | |||
| 1430 | Ga0495638_0126214 | |||
| 1431 | Ga0495638_0214571 | |||
| 1432 | Ga0495653_0003669 | |||
| 1433 | Ga0495653_0015804 | |||
| 1434 | Ga0495653_0025691 | |||
| 1435 | Ga0495653_0101244 | |||
| 1436 | Ga0495653_0116106 | |||
| 1437 | Ga0495653_0162281 | |||
| 1438 | Ga0495650_0000076 | |||
| 1439 | Ga0495650_0003834 | |||
| 1440 | Ga0495650_0017860 | |||
| 1441 | Ga0495650_0026538 | |||
| 1442 | Ga0495650_0033508 | |||
| 1443 | Ga0495650_0040437 | |||
| 1444 | Ga0495650_0041012 | |||
| 1445 | Ga0495650_0046088 | |||
| 1446 | Ga0495582_0052517 | |||
| 1447 | Ga0495605_0000157 | |||
| 1448 | Ga0495605_0000916 | |||
| 1449 | Ga0495605_0007661 | |||
| 1450 | Ga0495605_0014777 | |||
| 1451 | Ga0495605_0020277 | |||
| 1452 | Ga0495605_0047955 | |||
| 1453 | Ga0495605_0076684 | |||
| 1454 | Ga0495605_0086206 | |||
| 1455 | Ga0495605_0099987 | |||
| 1456 | Ga0495639_0000212 | |||
| 1457 | Ga0495639_0025406 | |||
| 1458 | Ga0495584_0000296 | |||
| 1459 | Ga0495584_0000925 | |||
| 1460 | Ga0495584_0006824 | |||
| 1461 | Ga0495584_0008368 | |||
| 1462 | Ga0495584_0010034 | |||
| 1463 | Ga0495584_0017735 | |||
| 1464 | Ga0495584_0019344 | |||
| 1465 | Ga0495584_0044394 | |||
| 1466 | Ga0495585_0001178 | |||
| 1467 | Ga0495585_0001354 | |||
| 1468 | Ga0495585_0002730 | |||
| 1469 | Ga0495585_0021831 | |||
| 1470 | Ga0495585_0028744 | |||
| 1471 | Ga0495585_0036865 | |||
| 1472 | Ga0495585_0041286 | |||
| 1473 | Ga0495585_0048588 | |||
| 1474 | Ga0495585_0090621 | |||
| 1475 | Ga0495594_0044761 | |||
| 1476 | Ga0495594_0046107 | |||
| 1477 | Ga0495596_0000566 | |||
| 1478 | Ga0495596_0067261 | |||
| 1479 | Ga0495607_0000085 | |||
| 1480 | Ga0495607_0000188 | |||
| 1481 | Ga0495607_0000530 | |||
| 1482 | Ga0495607_0003559 | |||
| 1483 | Ga0495607_0004042 | |||
| 1484 | Ga0495607_0004066 | |||
| 1485 | Ga0495607_0004308 | |||
| 1486 | Ga0495607_0022862 | |||
| 1487 | Ga0495607_0030906 | |||
| 1488 | Ga0495607_0049396 | |||
| 1489 | Ga0495607_0051806 | |||
| 1490 | Ga0495607_0065737 | |||
| 1491 | Ga0495583_0000538 | |||
| 1492 | Ga0495583_0002946 | |||
| 1493 | Ga0495583_0003685 | |||
| 1494 | Ga0495583_0005257 | |||
| 1495 | Ga0495583_0022543 | |||
| 1496 | Ga0495583_0037760 | |||
| 1497 | Ga0495583_0055856 | |||
| 1498 | Ga0495606_0000157 | |||
| 1499 | Ga0495606_0000354 | |||
| 1500 | Ga0495606_0001020 | |||
| 1501 | Ga0495606_0001822 | |||
| 1502 | Ga0495606_0003094 | |||
| 1503 | Ga0495606_0003346 | |||
| 1504 | Ga0495606_0005737 | |||
| 1505 | Ga0495606_0006578 | |||
| 1506 | Ga0495606_0007055 | |||
| 1507 | Ga0495606_0129355 | |||
| 1508 | Ga0495606_0141176 | |||
| 1509 | Ga0495610_0003607 | |||
| 1510 | Ga0495610_0006000 | |||
| 1511 | Ga0495610_0007236 | |||
| 1512 | Ga0495610_0015264 | |||
| 1513 | Ga0495610_0019047 | |||
| 1514 | Ga0495610_0020286 | |||
| 1515 | Ga0495610_0023055 | |||
| 1516 | Ga0495610_0044431 | |||
| 1517 | Ga0495610_0048385 | |||
| 1518 | Ga0495616_0003253 | |||
| 1519 | Ga0495616_0005033 | |||
| 1520 | Ga0495616_0023264 | |||
| 1521 | Ga0495616_0037769 | |||
| 1522 | Ga0495620_0000490 | |||
| 1523 | Ga0495620_0001814 | |||
| 1524 | Ga0495620_0003563 | |||
| 1525 | Ga0495620_0004931 | |||
| 1526 | Ga0495620_0005275 | |||
| 1527 | Ga0495620_0036434 | |||
| 1528 | Ga0495620_0054515 | |||
| 1529 | Ga0495628_0089243 | |||
| 1530 | Ga0495630_0048317 | |||
| 1531 | Ga0495630_0096978 | |||
| 1532 | Ga0495630_0128062 | |||
| 1533 | Ga0495631_0005709 | |||
| 1534 | Ga0495631_0016227 | |||
| 1535 | Ga0495631_0018690 | |||
| 1536 | Ga0495631_0036682 | |||
| 1537 | Ga0495631_0041804 | |||
| 1538 | Ga0495631_0055704 | |||
| 1539 | Ga0495632_0000295 | |||
| 1540 | Ga0495632_0000376 | |||
| 1541 | Ga0495632_0001006 | |||
| 1542 | Ga0495632_0006129 | |||
| 1543 | Ga0495632_0014675 | |||
| 1544 | Ga0495632_0025967 | |||
| 1545 | Ga0495632_0026508 | |||
| 1546 | Ga0495632_0031474 | |||
| 1547 | Ga0495632_0035436 | |||
| 1548 | Ga0495632_0040037 | |||
| 1549 | Ga0495632_0109260 | |||
| 1550 | Ga0495632_0117265 | |||
| 1551 | Ga0495637_0000048 | |||
| 1552 | Ga0495637_0002163 | |||
| 1553 | Ga0495637_0005329 | |||
| 1554 | Ga0495637_0015056 | |||
| 1555 | Ga0495637_0021963 | |||
| 1556 | Ga0495637_0025431 | |||
| 1557 | Ga0495637_0026974 | |||
| 1558 | Ga0495637_0036891 | |||
| 1559 | Ga0495637_0037015 | |||
| 1560 | Ga0495637_0040153 | |||
| 1561 | Ga0495637_0050138 | |||
| 1562 | Ga0495637_0060348 | |||
| 1563 | Ga0495643_0001787 | |||
| 1564 | Ga0495643_0001804 | |||
| 1565 | Ga0495643_0003768 | |||
| 1566 | Ga0495643_0004359 | |||
| 1567 | Ga0495643_0006719 | |||
| 1568 | Ga0495643_0009243 | |||
| 1569 | Ga0495643_0028249 | |||
| 1570 | Ga0495643_0038408 | |||
| 1571 | Ga0495643_0046082 | |||
| 1572 | Ga0495643_0051683 | |||
| 1573 | Ga0495644_0007245 | |||
| 1574 | Ga0495644_0010762 | |||
| 1575 | Ga0495648_0003694 | |||
| 1576 | Ga0495648_0003700 | |||
| 1577 | Ga0495648_0005121 | |||
| 1578 | Ga0495648_0015107 | |||
| 1579 | Ga0495648_0016325 | |||
| 1580 | Ga0495648_0016425 | |||
| 1581 | Ga0495648_0084066 | |||
| 1582 | Ga0495648_0094261 | |||
| 1583 | Ga0495666_0008996 | |||
| 1584 | Ga0495666_0020620 | |||
| 1585 | Ga0495666_0023691 | |||
| 1586 | Ga0495666_0059311 | |||
| 1587 | Ga0495642_0000198 | |||
| 1588 | Ga0495642_0000778 | |||
| 1589 | Ga0495642_0024093 | |||
| 1590 | Ga0495654_0001343 | |||
| 1591 | Ga0495654_0002457 | |||
| 1592 | Ga0495654_0009451 | |||
| 1593 | Ga0495654_0012067 | |||
| 1594 | Ga0495654_0016635 | |||
| 1595 | Ga0495654_0017862 | |||
| 1596 | Ga0495654_0026340 | |||
| 1597 | Ga0495654_0030252 | |||
| 1598 | Ga0495654_0036925 | |||
| 1599 | Ga0495654_0038383 | |||
| 1600 | Ga0495654_0057398 | |||
| 1601 | Ga0495654_0057703 | |||
| 1602 | Ga0495654_0073383 | |||
| 1603 | Ga0495587_0046683 | |||
| 1604 | Ga0495587_0110472 | |||
| 1605 | Ga0495609_0000051 | |||
| 1606 | Ga0495609_0000313 | |||
| 1607 | Ga0495609_0002354 | |||
| 1608 | Ga0495609_0010329 | |||
| 1609 | Ga0495609_0015768 | |||
| 1610 | Ga0495597_0002325 | |||
| 1611 | Ga0495597_0022396 | |||
| 1612 | Ga0495597_0029723 | |||
| 1613 | Ga0495645_0032096 | |||
| 1614 | Ga0495622_0006297 | |||
| 1615 | Ga0495622_0009424 | |||
| 1616 | Ga0495622_0027192 | |||
| 1617 | Ga0495622_0029134 | |||
| 1618 | Ga0495633_0021049 | |||
| 1619 | Ga0495656_0029116 | |||
| 1620 | Ga0495668_0013969 | |||
| 1621 | Ga0495668_0022655 | |||
| 1622 | Ga0495668_0024314 | |||
| 1623 | Ga0495668_0044521 | |||
| 1624 | Ga0495668_0067517 | |||
| 1625 | Ga0495668_0103179 | |||
| 1626 | Ga0495634_0037381 | |||
| 1627 | Ga0495634_0173237 | |||
| 1628 | Ga0495611_0000371 | |||
| 1629 | Ga0495611_0017093 | |||
| 1630 | Ga0495611_0025429 | |||
| 1631 | Ga0495611_0070086 | |||
| 1632 | Ga0495625_0000004 | |||
| 1633 | Ga0495625_0017417 | |||
| 1634 | Ga0495625_0052561 | |||
| 1635 | Ga0495625_0055479 | |||
| 1636 | Ga0495625_0100132 | |||
| 1637 | Ga0495625_0101639 | |||
| 1638 | Ga0495635_0003776 | |||
| 1639 | Ga0495635_0031645 | |||
| 1640 | Ga0495659_0006978 | |||
| 1641 | Ga0495659_0021440 | |||
| 1642 | Ga0495659_0059560 | |||
| 1643 | Ga0495661_0000013 | |||
| 1644 | Ga0495661_0000041 | |||
| 1645 | Ga0495661_0000228 | |||
| 1646 | Ga0495661_0000548 | |||
| 1647 | Ga0495661_0026286 | |||
| 1648 | Ga0495661_0086929 | |||
| 1649 | Ga0495661_0095705 | |||
| 1650 | Ga0495661_0103541 | |||
| 1651 | Ga0495588_0015627 | |||
| 1652 | Ga0495588_0018816 | |||
| 1653 | Ga0495588_0108124 | |||
| 1654 | Ga0495623_0025860 | |||
| 1655 | Ga0495623_0065531 | |||
| 1656 | Ga0495646_0013101 | |||
| 1657 | Ga0495646_0028014 | |||
| 1658 | Ga0495646_0030735 | |||
| 1659 | Ga0495646_0065779 | |||
| 1660 | Ga0495613_0034830 | |||
| 1661 | Ga0495613_0066711 | |||
| 1662 | Ga0495624_0001129 | |||
| 1663 | Ga0495670_0011666 | |||
| 1664 | Ga0495670_0017392 | |||
| 1665 | Ga0495670_0034764 | |||
| 1666 | Ga0495670_0064062 | |||
| 1667 | Ga0495671_0000992 | |||
| 1668 | Ga0495671_0004516 | |||
| 1669 | Ga0495671_0006281 | |||
| 1670 | Ga0495671_0011130 | |||
| 1671 | Ga0495671_0016403 | |||
| 1672 | Ga0495671_0025532 | |||
| 1673 | Ga0495671_0034537 | |||
| 1674 | Ga0495671_0051123 | |||
| 1675 | Ga0495671_0087587 | |||
| 1676 | Ga0495649_0000013 | |||
| 1677 | Ga0495649_0000817 | |||
| 1678 | Ga0495649_0002301 | |||
| 1679 | Ga0495649_0006415 | |||
| 1680 | Ga0495649_0008425 | |||
| 1681 | Ga0495649_0024422 | |||
| 1682 | Ga0495649_0025982 | |||
| 1683 | Ga0495649_0037370 | |||
| 1684 | Ga0495589_0000703 | |||
| 1685 | Ga0495589_0019690 | |||
| 1686 | Ga0495589_0024538 | |||
| 1687 | Ga0495589_0038679 | |||
| 1688 | Ga0495589_0042317 | |||
| 1689 | Ga0495589_0053176 | |||
| 1690 | Ga0495589_0070532 | |||
| 1691 | Ga0495589_0108684 | |||
| 1692 | Ga0495660_0004420 | |||
| 1693 | Ga0495660_0014965 | |||
| 1694 | Ga0495660_0031081 | |||
| 1695 | Ga0495660_0035306 | |||
| 1696 | Ga0495660_0035420 | |||
| 1697 | Ga0495660_0035431 | |||
| 1698 | Ga0495660_0047659 | |||
| 1699 | Ga0495660_0080735 | |||
| 1700 | Ga0495660_0159250 | |||
| 1701 | Ga0495581_0034463 | |||
| 1702 | Ga0495604_0043501 | |||
| 1703 | Ga0495604_0167699 | |||
| 1704 | Ga0495636_0011735 | |||
| 1705 | Ga0495672_0001732 | |||
| 1706 | Ga0495672_0001845 | |||
| 1707 | Ga0495672_0003005 | |||
| 1708 | Ga0495672_0004324 | |||
| 1709 | Ga0495672_0008012 | |||
| 1710 | Ga0495672_0016139 | |||
| 1711 | Ga0495672_0024705 | |||
| 1712 | Ga0495672_0026001 | |||
| 1713 | Ga0495672_0027386 | |||
| 1714 | Ga0495672_0036816 | |||
| 1715 | Ga0495672_0037314 | |||
| 1716 | Ga0495672_0052444 | |||
| 1717 | Ga0495672_0052738 | |||
| 1718 | Ga0495676_0000023 | |||
| 1719 | Ga0495676_0085128 | |||
| 1720 | Ga0495676_0093945 | |||
| 1721 | Ga0495680_0017577 | |||
| 1722 | Ga0495680_0030879 | |||
| 1723 | Ga0495680_0092867 | |||
| 1724 | Ga0495683_0000090 | |||
| 1725 | Ga0495683_0000291 | |||
| 1726 | Ga0495683_0017904 | |||
| 1727 | Ga0495683_0025884 | |||
| 1728 | Ga0495683_0031372 | |||
| 1729 | Ga0495683_0031864 | |||
| 1730 | Ga0495683_0096134 | |||
| 1731 | Ga0495687_004495 | |||
| 1732 | Ga0495687_015659 | |||
| 1733 | Ga0495687_017207 | |||
| 1734 | Ga0495675_0011097 | |||
| 1735 | Ga0495675_0046453 | |||
| 1736 | Ga0495677_0009840 | |||
| 1737 | Ga0495679_004280 | |||
| 1738 | Ga0495679_005609 | |||
| 1739 | Ga0495679_012174 | |||
| 1740 | Ga0495679_023727 | |||
| 1741 | Ga0495679_029045 | |||
| 1742 | Ga0495685_074921 | |||
| 1743 | Ga0495673_0002422 | |||
| 1744 | Ga0495673_0003368 | |||
| 1745 | Ga0495673_0003921 | |||
| 1746 | Ga0495673_0004741 | |||
| 1747 | Ga0495673_0008751 | |||
| 1748 | Ga0495673_0010435 | |||
| 1749 | Ga0495673_0011971 | |||
| 1750 | Ga0495673_0018012 | |||
| 1751 | Ga0495673_0018391 | |||
| 1752 | Ga0495673_0019454 | |||
| 1753 | Ga0495673_0019933 | |||
| 1754 | Ga0495673_0021846 | |||
| 1755 | Ga0495673_0023899 | |||
| 1756 | Ga0495673_0063935 | |||
| 1757 | Ga0495681_0000397 | |||
| 1758 | Ga0495681_0000553 | |||
| 1759 | Ga0495681_0003804 | |||
| 1760 | Ga0495681_0009482 | |||
| 1761 | Ga0495681_0017922 | |||
| 1762 | Ga0495681_0025689 | |||
| 1763 | Ga0495681_0029207 | |||
| 1764 | Ga0495681_0031131 | |||
| 1765 | Ga0495681_0041125 | |||
| 1766 | Ga0495681_0046440 | |||
| 1767 | Ga0495681_0059794 | |||
| 1768 | Ga0495681_0067500 | |||
| 1769 | Ga0495684_0047979 | |||
| 1770 | Ga0495684_0083632 | |||
| 1771 | Ga0495686_0009181 | |||
| 1772 | Ga0495686_0027993 | |||
| 1773 | Ga0495686_0041006 | |||
| 1774 | Ga0495686_0073832 | |||
| 1775 | Ga0495593_0053022 | |||
| 1776 | Ga0495593_0055880 | |||
| 1777 | Ga0495626_0000095 | |||
| 1778 | Ga0495626_0001931 | |||
| 1779 | Ga0495626_0003156 | |||
| 1780 | Ga0495626_0011559 | |||
| 1781 | Ga0495626_0025619 | |||
| 1782 | Ga0495626_0029125 | |||
| 1783 | Ga0495626_0051114 | |||
| 1784 | Ga0495626_0087340 | |||
| 1785 | Ga0496102_0003905 | |||
| 1786 | Ga0496103_0027414 | |||
| 1787 | Ga0496105_0140468 | |||
| 1788 | Ga0496110_0040025 | |||
| 1789 | Ga0496110_0106681 | |||
| 1790 | Ga0496110_0316104 | |||
| 1791 | Ga0496111_0246155 | |||
| 1792 | Ga0496114_0011778 | |||
| 1793 | Ga0496114_0020368 | |||
| 1794 | Ga0496115_0089079 | |||
| 1795 | Ga0496116_0000525 | |||
| 1796 | Ga0496116_0004751 | |||
| 1797 | Ga0496116_0006674 | |||
| 1798 | Ga0496116_0008553 | |||
| 1799 | Ga0496116_0029341 | |||
| 1800 | Ga0496117_0000363 | |||
| 1801 | Ga0496117_0000681 | |||
| 1802 | Ga0496117_0002402 | |||
| 1803 | Ga0496117_0002810 | |||
| 1804 | Ga0496117_0010506 | |||
| 1805 | Ga0496117_0034292 | |||
| 1806 | Ga0496117_0038624 | |||
| 1807 | Ga0496118_0004038 | |||
| 1808 | Ga0496118_0006685 | |||
| 1809 | Ga0496118_0094595 | |||
| 1810 | Ga0496118_0105637 | |||
| 1811 | Ga0496118_0129442 | |||
| 1812 | Ga0496119_0000011 | |||
| 1813 | Ga0496119_0021468 | |||
| 1814 | Ga0496119_0111214 | |||
| 1815 | Ga0496120_0000329 | |||
| 1816 | Ga0496120_0000939 | |||
| 1817 | Ga0496120_0086228 | |||
| 1818 | Ga0496121_0000622 | |||
| 1819 | Ga0496121_0008733 | |||
| 1820 | Ga0496121_0052263 | |||
| 1821 | Ga0496121_0075845 | |||
| 1822 | Ga0496121_0193348 | |||
| 1823 | Ga0496122_0011434 | |||
| 1824 | Ga0496122_0012002 | |||
| 1825 | Ga0496122_0046829 | |||
| 1826 | Ga0496122_0082554 | |||
| 1827 | Ga0496123_0003157 | |||
| 1828 | Ga0496123_0008511 | |||
| 1829 | Ga0496123_0020315 | |||
| 1830 | Ga0496123_0051809 | |||
| 1831 | Ga0496123_0063307 | |||
| 1832 | Ga0496123_0085028 | |||
| 1833 | Ga0496124_0000573 | |||
| 1834 | Ga0496124_0004787 | |||
| 1835 | Ga0496124_0008291 | |||
| 1836 | Ga0496124_0011100 | |||
| 1837 | Ga0496124_0012479 | |||
| 1838 | Ga0496124_0024013 | |||
| 1839 | Ga0496124_0075114 | |||
| 1840 | Ga0496124_0133031 | |||
| 1841 | Ga0496124_0138336 | |||
| 1842 | Ga0496124_0141608 | |||
| 1843 | Ga0496124_0200861 | |||
| 1844 | Ga0496125_0000536 | |||
| 1845 | Ga0496125_0000541 | |||
| 1846 | Ga0496125_0005682 | |||
| 1847 | Ga0496125_0014901 | |||
| 1848 | Ga0496125_0112718 | |||
| 1849 | Ga0496125_0126758 | |||
| 1850 | Ga0496126_0017191 | |||
| 1851 | Ga0496126_0025692 | |||
| 1852 | Ga0496126_0077763 | |||
| 1853 | Ga0496126_0145557 | |||
| 1854 | Ga0501307_005353 | |||
| 1855 | Ga0495678_002220 | |||
| 1856 | Ga0495678_005089 | |||
| 1857 | Ga0495678_012221 | |||
| 1858 | Ga0495678_012625 | |||
| 1859 | Ga0495678_017043 | |||
| 1860 | Ga0495678_026684 | |||
| 1861 | Ga0495678_029605 | |||
| 1862 | Ga0495678_032743 | |||
| 1863 | Ga0495678_041584 | |||
| 1864 | Ga0495678_067950 | |||
| 1865 | Ga0495682_0000079 | |||
| 1866 | Ga0495682_0001742 | |||
| 1867 | Ga0495682_0011207 | |||
| 1868 | Ga0495682_0018427 | |||
| 1869 | Ga0495682_0038118 | |||
| 1870 | Ga0495682_0052438 | |||
| 1871 | Ga0501314_002837 | |||
| 1872 | Ga0501034_0000145 | |||
| 1873 | Ga0501241_000614 | |||
| 1874 | Ga0501226_000015 | |||
| 1875 | nmdc:mga00v17_195921_c1 | |||
| 1876 | Ga0500618_005235 | |||
| 1877 | Ga0500659_0000943 | |||
| 1878 | 2511257153 | |||
| 1879 | 2511267326 | |||
| 1880 | 2511274028 | |||
| 1881 | 2511279304 | |||
| 1882 | 2511291995 | |||
| 1883 | 2511296980 | |||
| 1884 | 2511303163 | |||
| 1885 | 2511313988 | |||
| 1886 | 2511321528 | |||
| 1887 | 2511325598 | |||
| 1888 | 2511338614 | |||
| 1889 | 2511346896 | |||
| 1890 | 2511350007 | |||
| 1891 | 2511361126 | |||
| 1892 | 2511371594 | |||
| 1893 | 2511376797 | |||
| 1894 | 2511410605 | |||
| 1895 | 2511824174 | |||
| 1896 | 2512325488 | |||
| 1897 | 2555247643 | |||
| 1898 | 2555670875 | |||
| 1899 | 2583793164 | |||
| 1900 | 2597858890 | |||
| 1901 | 2597864520 | |||
| 1902 | 2597870327 | |||
| 1903 | 2599329162 | |||
| 1904 | 2599357564 | |||
| 1905 | 2599364354 | |||
| 1906 | 2599370675 | |||
| 1907 | 2599377132 | |||
| 1908 | 2599382719 | |||
| 1909 | 2599389167 | |||
| 1910 | 2599395900 | |||
| 1911 | 2599397645 | |||
| 1912 | 2599408290 | |||
| 1913 | 2599452091 | |||
| 1914 | 2599463947 | |||
| 1915 | 2599470974 | |||
| 1916 | 2599487672 | |||
| 1917 | 2599492966 | |||
| 1918 | 2599502026 | |||
| 1919 | 2599506732 | |||
| 1920 | 2599513526 | |||
| 1921 | 2599517971 | |||
| 1922 | 2599611233 | |||
| 1923 | 2599769915 | |||
| 1924 | 2599806002 | |||
| 1925 | 2599880836 | |||
| 1926 | 2599887239 | |||
| 1927 | 2599892203 | |||
| 1928 | 2599898596 | |||
| 1929 | 2599932914 | |||
| 1930 | 2599942672 | |||
| 1931 | 2599949819 | |||
| 1932 | 2599953421 | |||
| 1933 | 2599959055 | |||
| 1934 | 2599964324 | |||
| 1935 | 2599970690 | |||
| 1936 | 2599975805 | |||
| 1937 | 2599982396 | |||
| 1938 | 2599989179 | |||
| 1939 | 2599994555 | |||
| 1940 | 2599999413 | |||
| 1941 | 2600005964 | |||
| 1942 | 2600009558 | |||
| 1943 | 2600017101 | |||
| 1944 | 2600023506 | |||
| 1945 | 2600029151 | |||
| 1946 | 2600035600 | |||
| 1947 | 2600042118 | |||
| 1948 | 2600047077 | |||
| 1949 | 2600051924 | |||
| 1950 | 2600057177 | |||
| 1951 | 2600064924 | |||
| 1952 | 2600069845 | |||
| 1953 | 2600077337 | |||
| 1954 | 2600217088 | |||
| 1955 | 2600358525 | |||
| 1956 | 2600366707 | |||
| 1957 | 2600444780 | |||
| 1958 | 2601627841 | |||
| 1959 | 2601690177 | |||
| 1960 | 2601777259 | |||
| 1961 | 2601797194 | |||
| 1962 | 2602011916 | |||
| 1963 | 2606076075 | |||
| 1964 | 2606130985 | |||
| 1965 | 2621298969 | |||
| 1966 | 2624481470 | |||
| 1967 | 2624493022 | |||
| 1968 | 2643843572 | |||
| 1969 | 2643871227 | |||
| 1970 | 2643953827 | |||
| 1971 | 2644021761 | |||
| 1972 | 2644188505 | |||
| 1973 | 2644282534 | |||
| 1974 | 2644620480 | |||
| 1975 | 2652548524 | |||
| 1976 | 2671091088 | |||
| 1977 | 2671100518 | |||
| 1978 | 2671124618 | |||
| 1979 | 2671772932 | |||
| 1980 | 2677899481 | |||
| 1981 | 2678264078 | |||
| 1982 | 2715752773 | |||
| 1983 | 2715755988 | |||
| 1984 | 2718634723 | |||
| 1985 | 2723249305 | |||
| 1986 | 2738672214 | |||
| 1987 | 2738750607 | |||
| 1988 | 2738806110 | |||
| 1989 | 2738859648 | |||
| 1990 | 2738893470 | |||
| 1991 | 2739199902 | |||
| 1992 | 2739260224 | |||
| 1993 | 2739285272 | |||
| 1994 | 2739290586 | |||
| 1995 | 2739313741 | |||
| 1996 | 2743738410 | |||
| 1997 | 2745004534 | |||
| 1998 | 2765584895 | |||
| 1999 | 2774119068 | |||
| 2000 | 2774135052 | |||
| 2001 | 2784265123 | |||
| 2002 | 2784312707 | |||
| 2003 | 2794596851 | |||
| 2004 | 2807407782 | |||
| 2005 | 2807456098 | |||
| 2006 | 2808858523 | |||
| 2007 | 2808925633 | |||
| 2008 | 2808931770 | |||
| 2009 | 2808938712 | |||
| 2010 | 2808947683 | |||
| 2011 | 2808953890 | |||
| 2012 | 2808967008 | |||
| 2013 | 2808978949 | |||
| 2014 | 2808994736 | |||
| 2015 | 2809001838 | |||
| 2016 | 2809214346 | |||
| 2017 | 2812367369 | |||
| 2018 | 2817491868 | |||
| 2019 | 2819657758 | |||
| 2020 | 2819706180 | |||
| 2021 | 2823423787 | |||
| 2022 | 2825657099 | |||
| 2023 | 2826582280 | |||
| 2024 | 2834032660 | |||
| 2025 | 2842807013 | |||
| 2026 | 2842816624 | |||
| 2027 | 2842828339 | |||
| 2028 | 2842836307 | |||
| 2029 | 2842847093 | |||
| 2030 | 2842854030 | |||
| 2031 | 2842855071 | |||
| 2032 | 2852613829 | |||
| 2033 | 2852659437 | |||
| 2034 | 2852668435 | |||
| 2035 | 2860344256 | |||
| 2036 | 2860871020 | |||
| 2037 | 2878033445 | |||
| 2038 | 2880232840 | |||
| 2039 | 2904520421 | |||
| 2040 | 2904553635 | |||
| 2041 | 2908449117 | |||
| 2042 | 2912965714 | |||
| 2043 | 2913040465 | |||
| 2044 | 2917074734 | |||
| 2045 | 2919066856 | |||
| 2046 | 2919157150 | |||
| 2047 | 2919387604 | |||
| 2048 | 2919461286 | |||
| 2049 | 2919482365 | |||
| 2050 | 2919492449 | |||
| 2051 | 2919503529 | |||
| 2052 | 2919699702 | |||
| 2053 | 2923157466 | |||
| 2054 | 2923521417 | |||
| 2055 | 2923587932 | |||
| 2056 | 2926065899 | |||
| 2057 | 2929146362 | |||
| 2058 | 2929193086 | |||
| 2059 | 2931374620 | |||
| 2060 | 2931393404 | |||
| 2061 | 2931402987 | |||
| 2062 | 2935355279 | |||
| 2063 | 2939640280 | |||
| 2064 | 2939653824 | |||
| 2065 | 2945932907 | |||
| 2066 | 2945964529 | |||
| 2067 | 2946009180 | |||
| 2068 | 2946031363 | |||
| 2069 | 2947238335 | |||
| 2070 | 2969308202 | |||
| 2071 | 2974290321 | |||
| 2072 | 2984288676 | |||
| 2073 | 2988729669 | |||
| 2074 | 2998143532 | |||
| 2075 | 3007252897 | |||
| 2076 | 3007318432 | |||
| 2077 | 3007396788 | |||
| 2078 | 3007424003 | |||
| 2079 | 3007515168 | |||
| 2080 | 3007616689 | |||
| 2081 | 3007625114 | |||
| 2082 | 3007720843 | |||
| 2083 | 3007804783 | |||
| 2084 | 3007859048 | |||
| 2085 | 3007861487 | |||
| 2086 | 3007868543 | |||
| 2087 | 3007873764 | |||
| 2088 | 637321211 | |||
| 2089 | 640487934 | |||
| 2090 | 651175880 | |||
| 2091 | 8005658882 | |||
| 2092 | 8015691629 | |||
| 2093 | 8019772178 | |||
| 2094 | 8019776027 | |||
| 2095 | 8029997293 | |||
| 2096 | 8034964713 | |||
| 2097 | 8052498108 | |||
| 2098 | 8054287721 | |||
| 2099 | 8054347812 | |||
| 2100 | 8054506861 | |||
| 2101 | 8054932143 | |||
| 2102 | 8055774818 | |||
| 2103 | 8055821653 | |||
| 2104 | 8055880891 | |||
| 2105 | 8056118311 | |||
| 2106 | 8056122819 | |||
| 2107 | 8056129716 | |||
| 2108 | 8056135320 | |||
| 2109 | 8056139691 | |||
| 2110 | 8056146914 | |||
| 2111 | 8056154299 | |||
| 2112 | 8056160256 | |||
| 2113 | 8056165466 | |||
| 2114 | 8056167679 | |||
| 2115 | 8056173693 | |||
| 2116 | 8056183898 | |||
| 2117 | 8056573631 | |||
| 2118 | 8057801352 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r3e-assembly1.cif.gz_A | the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 | 0.9612 | 2 | 316 |
| 3r3e-assembly1.cif.gz_B | the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 | 0.9573 | 4 | 316 |
| 3r3e-assembly1.cif.gz_A | the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 | 0.9368 | 2 | 316 |
| 4pts-assembly1.cif.gz_A | crystal structure of a glutathione transferase from gordonia bronchialis dsm 43247, target efi-507405 | 0.936 | 29 | 310 |
| 4g0l-assembly1.cif.gz_B | glutathionyl-hydroquinone reductase, yqjg, of e.coli complexed with gsh | 0.9322 | 4 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r3eB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9985 | 166 | 276 | 1.20.1050.10 |
| af_Q9FL98_173_337_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9903 | 177 | 314 | 1.20.1050.10 |
| 3r3eB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9896 | 166 | 276 | 1.20.1050.10 |
| 4ptsB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9785 | 177 | 310 | 1.20.1050.10 |
| 3m1gC02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9774 | 181 | 312 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F8ZVP9-F1-model_v4 | GST C-terminal domain-containing protein | 0.9968 | 184 | 316 |
GO:0004364
GO:0005737 |
| AF-A0A7C1M7Q3-F1-model_v4 | Glutathione S-transferase family protein | 0.9961 | 179 | 316 |
GO:0004364
GO:0005737 |
| AF-A0A527G522-F1-model_v4 | Glutathione S-transferase family protein | 0.9959 | 184 | 315 |
GO:0004364
GO:0005737 |
| AF-A0A3D5JEB3-F1-model_v4 | Glutathione-dependent reductase | 0.9956 | 187 | 316 |
GO:0004364
GO:0005737 |
| AF-A0A6L7CC96-F1-model_v4 | Glutathione S-transferase family protein | 0.9947 | 165 | 316 |
GO:0004364
GO:0005737 |