F489267

General Info

Members Datasets Scaffolds Average Seq Length
1060 716 2120 330

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10024353|Ga0157373_100243532
Length 358
Sequence MLPRRSAHQGLLVELSKGRNNKMALNTKAAPEFDIDEEVLLMEPDIDLDEADDKAATAKVATRSKAKQPNGSKQHKYIDYTRALDATQLYLNEIGFSPLLTPEEEVFFARLAQKGDPAGRKRMIESNLRLVVKIARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARELTQKLDHEPSPEEIANLLEKPVGEVKRMLGLNERVSSVDVSLGPDSDKTLLDTLTDDRPTDPCELLQDDDLSQSIDQWLSDPTEKQREVVVRRFGLRGHESCTLEEVGQEIGLTRERVRQIQVEALKRLREILEKNGLSADSLFQ

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
83 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
143 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
154 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
161 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
171 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
172 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
173 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
174 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
175 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
176 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
177 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
178 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
267 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
278 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
279 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
280 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
282 2506520008 Serratia plymuthica AS12 Isolate Unclassified
283 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
284 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
285 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
286 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
287 2511231004 Pseudomonas sp. GM102 Isolate Nodule
288 2511231006 Pseudomonas sp. GM17 Isolate Nodule
289 2511231007 Pseudomonas sp. GM18 Isolate Nodule
290 2511231008 Pseudomonas sp. GM21 Isolate Nodule
291 2511231010 Pseudomonas sp. GM25 Isolate Nodule
292 2511231011 Pseudomonas sp. GM30 Isolate Nodule
293 2511231012 Pseudomonas sp. GM33 Isolate Nodule
294 2511231014 Pseudomonas sp. GM48 Isolate Nodule
295 2511231015 Pseudomonas sp. GM49 Isolate Nodule
296 2511231016 Pseudomonas sp. GM50 Isolate Nodule
297 2511231017 Pseudomonas sp. GM55 Isolate Nodule
298 2511231018 Pseudomonas sp. GM60 Isolate Nodule
299 2511231019 Pseudomonas sp. GM67 Isolate Nodule
300 2511231020 Pseudomonas sp. GM74 Isolate Nodule
301 2511231021 Pseudomonas sp. GM78 Isolate Nodule
302 2511231022 Pseudomonas sp. GM79 Isolate Nodule
303 2511231023 Pseudomonas sp. GM80 Isolate Nodule
304 2511231024 Pseudomonas sp. GM84 Isolate Nodule
305 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
306 2511231031 Pseudomonas sp. GM16 Isolate Nodule
307 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
308 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
309 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
310 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
311 2547132181 Kosakonia sacchari SP1 Isolate Stem
312 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
313 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
314 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
315 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
316 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
317 2561511199 Enterobacter sp. R4-368 Isolate Nodule
318 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
319 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
320 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
321 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
322 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
323 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
324 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
325 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
326 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
327 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
328 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
329 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
330 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
331 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
332 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
333 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
334 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
335 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
336 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
337 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
338 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
339 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
340 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
341 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
342 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
343 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
344 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
345 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
346 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
347 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
348 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
349 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
350 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
351 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
352 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
353 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
354 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
355 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
356 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
357 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
358 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
359 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
360 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
361 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
362 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
363 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
364 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
365 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
366 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
367 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
368 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
369 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
370 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
371 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
372 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
373 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
374 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
375 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
376 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
377 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
378 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
379 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
380 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
381 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
382 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
383 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
384 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
385 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
386 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
387 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
388 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
389 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
390 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
391 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
392 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
393 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
394 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
395 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
396 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
397 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
398 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
399 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
400 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
401 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
402 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
403 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
404 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
405 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
406 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
407 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
408 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
409 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
410 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
411 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
412 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
413 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
414 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
415 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
416 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
417 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
418 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
419 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
420 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
421 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
422 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
423 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
424 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
425 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
426 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
427 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
428 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
429 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
430 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
431 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
432 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
433 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
434 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
435 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
436 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
437 2636415599 Klebsiella variicola DX120E Isolate Unclassified
438 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
439 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
440 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
441 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
442 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
443 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
444 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
445 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
446 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
447 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
448 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
449 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
450 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
451 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
452 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
453 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
454 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
455 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
456 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
457 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
458 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
459 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
460 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
461 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
462 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
463 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
464 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
465 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
466 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
467 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
468 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
469 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
470 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
471 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
472 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
473 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
474 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
475 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
476 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
477 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
478 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
479 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
480 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
481 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
482 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
483 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
484 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
485 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
486 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
487 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
488 2751185917 Enterobacter sp. HK169 Isolate Unclassified
489 2765235841 Pseudomonas putida AA7 Isolate Unclassified
490 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
491 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
492 2773857670 Pseudomonas sp. 478 Isolate Unclassified
493 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
494 2773857673 Pseudomonas sp. 443 Isolate Unclassified
495 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
496 2775507074 Klebsiella sp. D5A Isolate Unclassified
497 2784132063 Pseudomonas sp. 424 Isolate Unclassified
498 2784132072 Pseudomonas sp. 460 Isolate Unclassified
499 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
500 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
501 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
502 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
503 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
504 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
505 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
506 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
507 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
508 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
509 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
510 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
511 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
512 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
513 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
514 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
515 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
516 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
517 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
518 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
519 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
520 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
521 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
522 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
523 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
524 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
525 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
526 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
527 2821118458 Enterobacter asburiae 609 Isolate Unclassified
528 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
529 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
530 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
531 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
532 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
533 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
534 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
535 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
536 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
537 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
538 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
539 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
540 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
541 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
542 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
543 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
544 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
545 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
546 2847085930 Erwinia persicina B64 Isolate Bulb
547 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
548 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
549 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
550 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
551 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
552 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
553 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
554 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
555 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
556 2865014394 Pantoea sp. R-71966 Isolate Unclassified
557 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
558 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
559 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
560 2876601092 Pantoea endophytica 596 Isolate Unclassified
561 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
562 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
563 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
564 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
565 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
566 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
567 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
568 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
569 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
570 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
571 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
572 2904504865 Serratia marcescens 1822 Isolate Unclassified
573 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
574 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
575 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
576 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
577 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
578 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
579 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
580 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
581 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
582 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
583 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
584 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
585 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
586 2919150387 Rahnella aceris 1817 Isolate Unclassified
587 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
588 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
589 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
590 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
591 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
592 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
593 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
594 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
595 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
596 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
597 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
598 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
599 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
600 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
601 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
602 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
603 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
604 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
605 2927143783 Rahnella sp. 2050 Isolate Unclassified
606 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
607 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
608 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
609 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
610 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
611 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
612 2932406140 Serratia sp. 2723 Isolate Rhizosphere
613 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
614 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
615 2937539931 Pantoea sp. LS15 Isolate Unclassified
616 2937967321 Serratia sp. YC16 Isolate Unclassified
617 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
618 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
619 2939577877 Serratia sp. 509 Isolate Rhizosphere
620 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
621 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
622 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
623 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
624 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
625 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
626 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
627 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
628 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
629 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
630 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
631 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
632 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
633 2952252522 Salinicola sp. DM10 Isolate Unclassified
634 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
635 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
636 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
637 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
638 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
639 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
640 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
641 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
642 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
643 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
644 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
645 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
646 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
647 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
648 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
649 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
650 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
651 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
652 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
653 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
654 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
655 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
656 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
657 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
658 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
659 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
660 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
661 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
662 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
663 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
664 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
665 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
666 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
667 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
668 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
669 640753048 Serratia proteamaculans 568 Isolate Endosphere
670 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
671 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
672 8004592986 Serratia sp. S119 Isolate Unclassified
673 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
674 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
675 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
676 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
677 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
678 8018221730 Enterobacter sp. CM29 Isolate Unclassified
679 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
680 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
681 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
682 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
683 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
684 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
685 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
686 8052494512 Pseudomonas putida LD6 Isolate Unclassified
687 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
688 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
689 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
690 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
691 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
692 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
693 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
694 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
695 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
696 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
697 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
698 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
699 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
700 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
701 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
702 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
703 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
704 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
705 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
706 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
707 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
708 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
709 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
710 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
711 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
712 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
713 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
714 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
715 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
716 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 58.3
Metatranscriptomes 0.57
Isolates 41.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0.09
Endosphere 7.45
Nodule 2.83
Rhizoplane 12.17
Rhizosphere 59.34
Stem 0.09
Stem Tuber 0.57
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10024353 3300013100 Bacteria 4386
2 MRS2a_Contig_5 2124908027 Bacteria 78295
3 SwRhRL2b_contig_195785 2162886007 Bacteria 2174
4 JGI25162J39368_1000314 3300002737 Bacteria 42959
5 JGI25162J39368_1000320 3300002737 Bacteria 42271
6 JGI25154J39366_1002279 3300002738 Bacteria 5188
7 JGI25163J39215_1003232 3300002771 Bacteria 1371
8 JGI25163J39215_1003241 3300002771 Bacteria 1366
9 JGI25164J39214_1000233 3300002772 Bacteria 42959
10 JGI25164J39214_1000237 3300002772 Bacteria 42271
11 JGI25165J46597_1000429 3300003214 Bacteria 42959
12 JGI25165J46597_1000437 3300003214 Bacteria 42271
13 Ga0006758J48902_1023556 3300003300 Bacteria 1446
14 rootH1_10069926 3300003316 Bacteria 3973
15 rootL2_10048495 3300003322 Bacteria 5584
16 rootH1_10014691 3300003323 Bacteria 26302
17 rootH1_10130777 3300003323 Bacteria 9742
18 Ga0007410J51695_1042200 3300003574 Bacteria 1438
19 Ga0007409J51694_1037896 3300003575 Bacteria 1449
20 Ga0055538_1000096 3300003751 Bacteria 73286
21 Ga0055539_1000142 3300003752 Bacteria 73286
22 Ga0055533_1000146 3300003756 Bacteria 73286
23 Ga0055532_1000132 3300003758 Bacteria 73282
24 Ga0055525_1000226 3300003759 Bacteria 61151
25 Ga0055536_1000217 3300003781 Bacteria 47045
26 Ga0055536_1014192 3300003781 Bacteria 2816
27 Ga0055536_1014380 3300003781 Bacteria 2784
28 Ga0055530_10001975 3300003791 Bacteria 13943
29 Ga0055530_10003100 3300003791 Bacteria 9849
30 Ga0055530_10016500 3300003791 Bacteria 2357
31 Ga0055530_10017736 3300003791 Bacteria 2217
32 Ga0055540_1001484 3300003792 Bacteria 13943
33 Ga0055540_1002192 3300003792 Bacteria 10618
34 Ga0055540_1002238 3300003792 Bacteria 10474
35 Ga0055531_10000642 3300003794 Bacteria 30171
36 Ga0055541_1000096 3300003841 Bacteria 73286
37 Ga0065714_10001187 3300005288 Bacteria 1507
38 Ga0065714_10012277 3300005288 Bacteria 1824
39 Ga0065714_10012898 3300005288 Bacteria 1877
40 Ga0065714_10067066 3300005288 Bacteria 5934
41 Ga0065714_10069591 3300005288 Bacteria 4167
42 Ga0065714_10093548 3300005288 Bacteria 1842
43 Ga0065714_10093894 3300005288 Bacteria 1833
44 Ga0065704_10000775 3300005289 Bacteria 13484
45 Ga0065704_10071509 3300005289 Bacteria 10859
46 Ga0065704_10095265 3300005289 Bacteria 2496
47 Ga0065704_10203247 3300005289 Bacteria 1137
48 Ga0065712_10000443 3300005290 Bacteria 14297
49 Ga0065712_10074620 3300005290 Bacteria 4050
50 Ga0065715_10092878 3300005293 Bacteria 4894
51 Ga0070670_100000015 3300005331 Bacteria 228819
52 Ga0070670_100123128 3300005331 Bacteria 2237
53 Ga0070670_100339935 3300005331 Bacteria 1317
54 Ga0070687_100012310 3300005343 Bacteria 3774
55 Ga0070661_100000306 3300005344 Bacteria 39537
56 Ga0070669_100002434 3300005353 Bacteria 13479
57 Ga0070669_100026832 3300005353 Bacteria 4145
58 Ga0070669_100140820 3300005353 Bacteria 1859
59 Ga0070671_100000240 3300005355 Bacteria 36919
60 Ga0070671_100027037 3300005355 Bacteria 4720
61 Ga0070688_100019396 3300005365 Bacteria 3939
62 Ga0070659_100555513 3300005366 Bacteria 983
63 Ga0070667_100000015 3300005367 Bacteria 238203
64 Ga0070662_100000360 3300005457 Bacteria 27248
65 Ga0070685_10000004 3300005466 Bacteria 246215
66 Ga0068853_100028026 3300005539 Bacteria 4737
67 Ga0070665_100012700 3300005548 Bacteria 8481
68 Ga0070664_100000741 3300005564 Bacteria 25147
69 Ga0068854_100028524 3300005578 Bacteria 3858
70 Ga0068859_100008057 3300005617 Bacteria 10682
71 Ga0068864_100000072 3300005618 Bacteria 110066
72 Ga0068851_10000019 3300005834 Bacteria 135877
73 Ga0068858_100052905 3300005842 Bacteria 3757
74 Ga0068860_100000271 3300005843 Bacteria 75530
75 Ga0068862_100003971 3300005844 Bacteria 12558
76 Ga0075365_10000215 3300006038 Bacteria 19419
77 Ga0075368_10008663 3300006042 Bacteria 3632
78 Ga0075363_100020069 3300006048 Bacteria 3348
79 Ga0075364_10000013 3300006051 Bacteria 58691
80 Ga0075364_10006085 3300006051 Bacteria 7070
81 Ga0075364_10062654 3300006051 Bacteria 2440
82 Ga0075432_10009154 3300006058 Bacteria 3374
83 Ga0075432_10024776 3300006058 Bacteria 2057
84 Ga0075432_10033157 3300006058 Bacteria 1790
85 Ga0075432_10056460 3300006058 Bacteria 1392
86 Ga0075369_10001215 3300006186 Bacteria 8729
87 Ga0075369_10058267 3300006186 Bacteria 1682
88 Ga0075370_10000352 3300006353 Bacteria 16746
89 Ga0075429_100086097 3300006880 Bacteria 2739
90 Ga0097620_100008057 3300006931 Bacteria 10682
91 Ga0099823_1000119 3300006944 Bacteria 39691
92 Ga0079104_1001155 3300006946 Bacteria 19100
93 Ga0079104_1005472 3300006946 Bacteria 5063
94 Ga0099826_10000860 3300006948 Bacteria 16486
95 Ga0105251_10000444 3300009011 Bacteria 40000
96 Ga0105251_10000619 3300009011 Bacteria 32604
97 Ga0105251_10001959 3300009011 Bacteria 16837
98 Ga0105251_10003015 3300009011 Bacteria 12560
99 Ga0105251_10036856 3300009011 Bacteria 2403
100 Ga0105251_10054942 3300009011 Bacteria 1889
101 Ga0105251_10083711 3300009011 Bacteria 1472
102 Ga0105251_10093823 3300009011 Bacteria 1377
103 Ga0105251_10096447 3300009011 Bacteria 1354
104 Ga0105251_10099770 3300009011 Bacteria 1327
105 Ga0105244_10005246 3300009036 Bacteria 8651
106 Ga0105244_10006585 3300009036 Bacteria 7491
107 Ga0105244_10011745 3300009036 Bacteria 5225
108 Ga0105244_10024956 3300009036 Bacteria 3256
109 Ga0105244_10026994 3300009036 Bacteria 3100
110 Ga0105244_10045749 3300009036 Bacteria 2250
111 Ga0105244_10079052 3300009036 Bacteria 1630
112 Ga0105250_10000959 3300009092 Bacteria 16902
113 Ga0105250_10034463 3300009092 Bacteria 2032
114 Ga0105250_10039494 3300009092 Bacteria 1892
115 Ga0105250_10041579 3300009092 Bacteria 1843
116 Ga0105250_10071275 3300009092 Bacteria 1403
117 Ga0105250_10079982 3300009092 Bacteria 1324
118 Ga0105243_10003511 3300009148 Bacteria 12664
119 Ga0105243_10087600 3300009148 Bacteria 2556
120 Ga0105243_10096687 3300009148 Bacteria 2443
121 Ga0105243_10117689 3300009148 Bacteria 2234
122 Ga0105242_10001061 3300009176 Bacteria 21612
123 Ga0105242_10079122 3300009176 Bacteria 2745
124 Ga0105237_10002041 3300009545 Bacteria 25677
125 Ga0105249_10053921 3300009553 Bacteria 3676
126 Ga0105249_10097866 3300009553 Bacteria 2755
127 Ga0105246_10001083 3300011119 Bacteria 15751
128 Ga0105246_10001761 3300011119 Bacteria 12951
129 Ga0105246_10094363 3300011119 Bacteria 2164
130 Ga0157345_1000607 3300012498 Bacteria 3052
131 Ga0157373_10029248 3300013100 Bacteria 3970
132 Ga0157371_10005548 3300013102 Bacteria 10613
133 Ga0157371_10006276 3300013102 Bacteria 9843
134 Ga0157371_10012444 3300013102 Bacteria 6503
135 Ga0157371_10016653 3300013102 Bacteria 5479
136 Ga0157370_10001690 3300013104 Bacteria 27178
137 Ga0157370_10125089 3300013104 Bacteria 2400
138 Ga0157378_10026399 3300013297 Bacteria 5120
139 Ga0163162_10289801 3300013306 Bacteria 1769
140 Ga0157372_10000663 3300013307 Bacteria 37808
141 Ga0157372_10033882 3300013307 Bacteria 5613
142 Ga0163163_10000118 3300014325 Bacteria 84379
143 Ga0182008_10002900 3300014497 Bacteria 10613
144 Ga0182008_10051446 3300014497 Bacteria 2043
145 Ga0182008_10088693 3300014497 Bacteria 1524
146 Ga0157376_10457540 3300014969 Bacteria 1246
147 Ga0182006_1003483 3300015261 Bacteria 8034
148 Ga0182006_1040520 3300015261 Bacteria 1833
149 Ga0182006_1055610 3300015261 Bacteria 1510
150 Ga0182007_10001511 3300015262 Bacteria 12420
151 Ga0182005_1019757 3300015265 Bacteria 1855
152 Ga0213872_10002808 3300021361 Bacteria 9962
153 Ga0213872_10003010 3300021361 Bacteria 9526
154 Ga0213872_10003822 3300021361 Bacteria 8203
155 Ga0213872_10004946 3300021361 Bacteria 6930
156 Ga0209435_100393 3300025206 Bacteria 9481
157 Ga0209760_100021 3300025207 Bacteria 163688
158 Ga0209760_100046 3300025207 Bacteria 107840
159 Ga0209784_100015 3300025224 Bacteria 482117
160 Ga0209566_100012 3300025225 Bacteria 482281
161 Ga0209674_100027 3300025226 Bacteria 482281
162 Ga0209147_100019 3300025229 Bacteria 482139
163 Ga0209563_100031 3300025230 Bacteria 482281
164 Ga0209563_101829 3300025230 Bacteria 5242
165 Ga0207427_100001 3300025231 Bacteria 1410763
166 Ga0207427_100029 3300025231 Bacteria 376678
167 Ga0209437_100003 3300025233 Bacteria 1517827
168 Ga0209437_100009 3300025233 Bacteria 915954
169 Ga0209437_102448 3300025233 Bacteria 3601
170 Ga0209258_100824 3300025242 Bacteria 17348
171 Ga0209646_1000220 3300025246 Bacteria 61752
172 Ga0209677_100016 3300025253 Bacteria 482117
173 Ga0209759_1004898 3300025256 Bacteria 4848
174 Ga0209759_1005930 3300025256 Bacteria 4175
175 Ga0209233_1000007 3300025261 Bacteria 1411234
176 Ga0209233_1000032 3300025261 Bacteria 623596
177 Ga0209675_1001096 3300025291 Bacteria 16643
178 Ga0209676_1000016 3300025292 Bacteria 655561
179 Ga0209676_1000080 3300025292 Bacteria 287400
180 Ga0209676_1000397 3300025292 Bacteria 79463
181 Ga0209676_1015743 3300025292 Bacteria 2768
182 Ga0209050_1000208 3300025298 Bacteria 131310
183 Ga0209050_1001191 3300025298 Bacteria 30589
184 Ga0209050_1001235 3300025298 Bacteria 29568
185 Ga0209050_1002753 3300025298 Bacteria 14150
186 Ga0209051_1000219 3300025303 Bacteria 96484
187 Ga0209051_1000498 3300025303 Bacteria 50496
188 Ga0209051_1000879 3300025303 Bacteria 30297
189 Ga0209257_1000342 3300025304 Bacteria 97045
190 Ga0209257_1008743 3300025304 Bacteria 5638
191 Ga0207656_10000042 3300025321 Bacteria 53832
192 Ga0207696_1000032 3300025711 Bacteria 380071
193 Ga0207696_1000141 3300025711 Bacteria 127091
194 Ga0207696_1000164 3300025711 Bacteria 106057
195 Ga0207696_1000604 3300025711 Bacteria 27037
196 Ga0207696_1001566 3300025711 Bacteria 12170
197 Ga0207696_1006225 3300025711 Bacteria 4836
198 Ga0207696_1014133 3300025711 Bacteria 2749
199 Ga0207696_1021239 3300025711 Bacteria 2082
200 Ga0207655_1000005 3300025728 Bacteria 917277
201 Ga0207655_1000015 3300025728 Bacteria 600662
202 Ga0207655_1000488 3300025728 Bacteria 51094
203 Ga0207655_1001023 3300025728 Bacteria 28252
204 Ga0207655_1001253 3300025728 Bacteria 24224
205 Ga0207655_1002739 3300025728 Bacteria 13759
206 Ga0207655_1009566 3300025728 Bacteria 6005
207 Ga0207655_1012134 3300025728 Bacteria 5064
208 Ga0207655_1017526 3300025728 Bacteria 3858
209 Ga0207655_1017992 3300025728 Bacteria 3778
210 Ga0207655_1021544 3300025728 Bacteria 3267
211 Ga0207655_1033900 3300025728 Bacteria 2305
212 Ga0207655_1035374 3300025728 Bacteria 2231
213 Ga0207655_1038488 3300025728 Bacteria 2090
214 Ga0207713_1000085 3300025735 Bacteria 160800
215 Ga0207713_1000098 3300025735 Bacteria 143900
216 Ga0207713_1000338 3300025735 Bacteria 51882
217 Ga0207713_1000751 3300025735 Bacteria 30209
218 Ga0207713_1000843 3300025735 Bacteria 28206
219 Ga0207713_1002039 3300025735 Bacteria 15121
220 Ga0207713_1005190 3300025735 Bacteria 8224
221 Ga0207713_1006982 3300025735 Bacteria 6768
222 Ga0207713_1008734 3300025735 Bacteria 5783
223 Ga0207713_1032973 3300025735 Bacteria 2268
224 Ga0207713_1059199 3300025735 Bacteria 1471
225 Ga0207713_1063976 3300025735 Bacteria 1387
226 Ga0207710_10058597 3300025900 Bacteria 1742
227 Ga0207671_10000420 3300025914 Bacteria 58883
228 Ga0207662_10067998 3300025918 Bacteria 2150
229 Ga0207649_10000002 3300025920 Bacteria 498633
230 Ga0207681_10002129 3300025923 Bacteria 12641
231 Ga0207681_10402761 3300025923 Bacteria 1105
232 Ga0207650_10000013 3300025925 Bacteria 409471
233 Ga0207650_10000606 3300025925 Bacteria 28719
234 Ga0207650_10045152 3300025925 Bacteria 3241
235 Ga0207644_10000015 3300025931 Bacteria 179880
236 Ga0207706_10007522 3300025933 Bacteria 10079
237 Ga0207709_10000228 3300025935 Bacteria 70988
238 Ga0207709_10000510 3300025935 Bacteria 34223
239 Ga0207709_10034056 3300025935 Bacteria 2998
240 Ga0207711_10000103 3300025941 Bacteria 90172
241 Ga0207711_10000277 3300025941 Bacteria 55359
242 Ga0207679_10000006 3300025945 Bacteria 498868
243 Ga0207712_10029560 3300025961 Bacteria 3677
244 Ga0207658_10000005 3300025986 Bacteria 408341
245 Ga0207703_10027118 3300026035 Bacteria 4511
246 Ga0207639_10013206 3300026041 Bacteria 5774
247 Ga0207641_10034212 3300026088 Bacteria 4225
248 Ga0207641_10037311 3300026088 Bacteria 4057
249 Ga0207676_10000010 3300026095 Bacteria 519402
250 Ga0207674_10391280 3300026116 Bacteria 1344
251 Ga0209281_1000013 3300027111 Bacteria 653449
252 Ga0209281_1000015 3300027111 Bacteria 590084
253 Ga0209281_1003287 3300027111 Bacteria 5470
254 Ga0209389_1000205 3300027296 Bacteria 42388
255 Ga0209371_1000165 3300027312 Bacteria 100598
256 Ga0209371_1000584 3300027312 Bacteria 32775
257 Ga0209371_1024188 3300027312 Bacteria 1417
258 Ga0209981_1005160 3300027378 Bacteria 1728
259 Ga0209996_1003171 3300027395 Bacteria 2058
260 Ga0209984_1001385 3300027424 Bacteria 2624
261 Ga0209995_1002255 3300027471 Bacteria 3037
262 Ga0209968_1007756 3300027526 Bacteria 1627
263 Ga0210002_1001652 3300027617 Bacteria 3177
264 Ga0209983_1000260 3300027665 Bacteria 10898
265 Ga0209282_1017939 3300027666 Bacteria 4497
266 Ga0209971_1000463 3300027682 Bacteria 10788
267 Ga0209813_10006508 3300027866 Bacteria 2889
268 Ga0207428_10137455 3300027907 Bacteria 1868
269 Ga0207428_10176571 3300027907 Bacteria 1615
270 Ga0207428_10254512 3300027907 Bacteria 1309
271 Ga0207428_10318293 3300027907 Bacteria 1149
272 Ga0268266_10011036 3300028379 Bacteria 7864
273 Ga0268266_10262646 3300028379 Bacteria 1600
274 Ga0268265_10002237 3300028380 Bacteria 14847
275 Ga0268264_10000036 3300028381 Bacteria 392994
276 Ga0307517_10175495 3300028786 Bacteria 1397
277 Ga0268256_1000112 3300030500 Bacteria 118510
278 Ga0268256_1000436 3300030500 Bacteria 37153
279 Ga0268256_1027483 3300030500 Bacteria 1417
280 Ga0316179_1077882 3300030734 Bacteria 2571
281 Ga0316178_1009525 3300030735 Bacteria 55280
282 Ga0316181_1106926 3300030744 Bacteria 3102
283 Ga0265331_10019849 3300031250 Bacteria 3462
284 Ga0265327_10000014 3300031251 Bacteria 506288
285 Ga0265327_10000170 3300031251 Bacteria 140044
286 Ga0307408_100000042 3300031548 Bacteria 172505
287 Ga0307408_100002417 3300031548 Bacteria 13144
288 Ga0307408_100002567 3300031548 Bacteria 12662
289 Ga0316576_10025351 3300031727 Bacteria 4150
290 Ga0316578_10126639 3300031728 Bacteria 1536
291 Ga0316577_10095962 3300031733 Bacteria 1661
292 Ga0316577_10145087 3300031733 Bacteria 1337
293 Ga0307406_10001355 3300031901 Bacteria 13719
294 Ga0307406_10086930 3300031901 Bacteria 2095
295 Ga0307414_10008646 3300032004 Bacteria 5792
296 Ga0316585_10018592 3300032137 Bacteria 2111
297 Ga0316587_1008417 3300033529 Bacteria 1620
298 Ga0316587_1010941 3300033529 Bacteria 1458
299 Ga0373960_0005597 3300035121 Bacteria 2919
300 Ga0316574_0017625 3300035398 Bacteria 4183
301 Ga0316574_0136801 3300035398 Bacteria 1577
302 Ga0316582_0004214 3300036647 Bacteria 7216
303 Ga0316582_0293491 3300036647 Bacteria 1117
304 Ga0316584_0024150 3300036712 Bacteria 4447
305 Ga0316584_0077921 3300036712 Bacteria 2482
306 Ga0395900_0029706 3300037418 Bacteria 5609
307 Ga0400483_022490 3300039062 Bacteria 18816
308 Ga0400483_026308 3300039062 Bacteria 223136
309 Ga0400483_077384 3300039062 Bacteria 6478
310 Ga0400483_116699 3300039062 Bacteria 1333
311 Ga0400483_235996 3300039062 Bacteria 4512
312 Ga0400483_249072 3300039062 Bacteria 19418
313 Ga0400483_250036 3300039062 Bacteria 396353
314 Ga0400487_52686 3300039110 Bacteria 5081
315 Ga0436361_0052642 3300039447 Bacteria 25463
316 Ga0436361_0777562 3300039447 Bacteria 10245
317 Ga0436361_0891393 3300039447 Bacteria 99242
318 Ga0439436_0000093 3300041404 Bacteria 21035
319 Ga0439436_0000606 3300041404 Bacteria 9491
320 Ga0439438_002379 3300041405 Bacteria 8020
321 Ga0439438_002924 3300041405 Bacteria 7092
322 Ga0439438_003070 3300041405 Bacteria 6866
323 Ga0439438_006968 3300041405 Bacteria 3919
324 Ga0439447_000651 3300041407 Bacteria 12896
325 Ga0439447_005171 3300041407 Bacteria 4370
326 Ga0439447_026562 3300041407 Bacteria 1484
327 Ga0439466_0000870 3300041411 Bacteria 11526
328 Ga0439466_0012474 3300041411 Bacteria 3129
329 Ga0439466_0030953 3300041411 Bacteria 1832
330 Ga0451807_1403825 3300041486 Bacteria 1196
331 Ga0439437_000719 3300042000 Bacteria 3342
332 Ga0439432_013881 3300042006 Bacteria 2731
333 Ga0439432_039883 3300042006 Bacteria 1491
334 Ga0439451_001040 3300042009 Bacteria 5400
335 Ga0439451_015030 3300042009 Bacteria 1560
336 Ga0439452_002393 3300042010 Bacteria 6953
337 Ga0439452_002554 3300042010 Bacteria 6688
338 Ga0439452_015295 3300042010 Bacteria 2110
339 Ga0439456_000224 3300042013 Bacteria 15438
340 Ga0439463_000713 3300042016 Bacteria 9201
341 Ga0439463_014393 3300042016 Bacteria 1949
342 Ga0450911_000005 3300042115 Bacteria 233469
343 Ga0450900_003653 3300042136 Bacteria 1720
344 Ga0450904_000002 3300042139 Bacteria 82376
345 Ga0450905_000063 3300042142 Bacteria 9811
346 Ga0450907_001644 3300042146 Bacteria 4680
347 Ga0439446_0001114 3300042156 Bacteria 5947
348 Ga0439446_0001152 3300042156 Bacteria 5867
349 Ga0439446_0006551 3300042156 Bacteria 3042
350 Ga0450908_001752 3300042184 Bacteria 4231
351 Ga0439434_0001359 3300042435 Bacteria 7046
352 Ga0439464_0000031 3300042439 Bacteria 17710
353 Ga0439464_0012859 3300042439 Bacteria 2234
354 Ga0439460_0002293 3300042461 Bacteria 4602
355 Ga0439460_0004649 3300042461 Bacteria 3349
356 Ga0450901_000289 3300042533 Bacteria 6122
357 Ga0451577_0168843 3300042876 Bacteria 1971
358 Ga0466969_0001528 3300044656 Bacteria 12438
359 Ga0466965_0002201 3300044683 Bacteria 8204
360 Ga0466966_0003088 3300044684 Bacteria 10973
361 Ga0466961_0001154 3300044693 Bacteria 16232
362 Ga0453684_0000211 3300044712 Bacteria 254993
363 Ga0453684_0568292 3300044712 Bacteria 1247
364 Ga0466959_0088268 3300045049 Bacteria 2229
365 Ga0451576_0000234 3300045051 Bacteria 135387
366 Ga0495627_001316 3300046453 Bacteria 15137
367 Ga0495627_029273 3300046453 Bacteria 1753
368 Ga0495591_000212 3300046458 Bacteria 58623
369 Ga0495591_000849 3300046458 Bacteria 21493
370 Ga0495591_001650 3300046458 Bacteria 13441
371 Ga0495591_002049 3300046458 Bacteria 11685
372 Ga0495591_002381 3300046458 Bacteria 10546
373 Ga0495591_006498 3300046458 Bacteria 5161
374 Ga0495591_009341 3300046458 Bacteria 3906
375 Ga0495591_020376 3300046458 Bacteria 2192
376 Ga0495638_0019589 3300046460 Bacteria 4475
377 Ga0495638_0085174 3300046460 Bacteria 1912
378 Ga0495638_0115396 3300046460 Bacteria 1591
379 Ga0495653_0005238 3300046463 Bacteria 10546
380 Ga0495650_0000008 3300046471 Bacteria 688246
381 Ga0495650_0000515 3300046471 Bacteria 57432
382 Ga0495650_0001154 3300046471 Bacteria 28448
383 Ga0495650_0007032 3300046471 Bacteria 6852
384 Ga0495650_0089352 3300046471 Bacteria 1174
385 Ga0495605_0000323 3300046474 Bacteria 49229
386 Ga0495605_0000449 3300046474 Bacteria 36901
387 Ga0495605_0000461 3300046474 Bacteria 36449
388 Ga0495605_0001257 3300046474 Bacteria 16803
389 Ga0495605_0001417 3300046474 Bacteria 15714
390 Ga0495605_0050379 3300046474 Bacteria 2031
391 Ga0495605_0057136 3300046474 Bacteria 1879
392 Ga0495605_0089006 3300046474 Bacteria 1433
393 Ga0495584_0013435 3300046491 Bacteria 4181
394 Ga0495584_0022750 3300046491 Bacteria 3179
395 Ga0495585_0003113 3300046492 Bacteria 11385
396 Ga0495585_0009384 3300046492 Bacteria 5868
397 Ga0495585_0039267 3300046492 Bacteria 2661
398 Ga0495596_0000148 3300046500 Bacteria 48823
399 Ga0495596_0030807 3300046500 Bacteria 2145
400 Ga0495607_0000276 3300046501 Bacteria 55274
401 Ga0495607_0000490 3300046501 Bacteria 39577
402 Ga0495607_0000544 3300046501 Bacteria 36921
403 Ga0495607_0000841 3300046501 Bacteria 29029
404 Ga0495607_0005018 3300046501 Bacteria 9600
405 Ga0495607_0020434 3300046501 Bacteria 4186
406 Ga0495607_0063674 3300046501 Bacteria 2085
407 Ga0495607_0077091 3300046501 Bacteria 1842
408 Ga0495607_0098794 3300046501 Bacteria 1567
409 Ga0495607_0122764 3300046501 Bacteria 1361
410 Ga0495583_0000861 3300046506 Bacteria 36885
411 Ga0495583_0000884 3300046506 Bacteria 36045
412 Ga0495583_0002615 3300046506 Bacteria 15053
413 Ga0495583_0004142 3300046506 Bacteria 10609
414 Ga0495583_0004417 3300046506 Bacteria 10076
415 Ga0495606_0000126 3300046507 Bacteria 129862
416 Ga0495606_0001121 3300046507 Bacteria 38297
417 Ga0495606_0001804 3300046507 Bacteria 27243
418 Ga0495606_0002489 3300046507 Bacteria 21308
419 Ga0495606_0006268 3300046507 Bacteria 11034
420 Ga0495606_0012166 3300046507 Bacteria 6937
421 Ga0495606_0016744 3300046507 Bacteria 5574
422 Ga0495606_0023582 3300046507 Bacteria 4452
423 Ga0495610_0003557 3300046512 Bacteria 12062
424 Ga0495610_0013190 3300046512 Bacteria 4922
425 Ga0495616_0035062 3300046513 Bacteria 2599
426 Ga0495616_0096084 3300046513 Bacteria 1395
427 Ga0495620_0000003 3300046515 Bacteria 345923
428 Ga0495620_0001260 3300046515 Bacteria 15445
429 Ga0495620_0003107 3300046515 Bacteria 9537
430 Ga0495620_0006420 3300046515 Bacteria 6463
431 Ga0495620_0012230 3300046515 Bacteria 4444
432 Ga0495620_0016101 3300046515 Bacteria 3763
433 Ga0495620_0019997 3300046515 Bacteria 3279
434 Ga0495631_0009673 3300046518 Bacteria 4807
435 Ga0495631_0023789 3300046518 Bacteria 2835
436 Ga0495631_0040393 3300046518 Bacteria 2067
437 Ga0495632_0001207 3300046519 Bacteria 21937
438 Ga0495632_0003927 3300046519 Bacteria 10327
439 Ga0495632_0005427 3300046519 Bacteria 8431
440 Ga0495632_0059256 3300046519 Bacteria 1863
441 Ga0495637_0001766 3300046520 Bacteria 12380
442 Ga0495637_0002014 3300046520 Bacteria 11466
443 Ga0495637_0011318 3300046520 Bacteria 4290
444 Ga0495637_0014996 3300046520 Bacteria 3645
445 Ga0495637_0038282 3300046520 Bacteria 2077
446 Ga0495637_0040424 3300046520 Bacteria 2008
447 Ga0495643_0000917 3300046522 Bacteria 30970
448 Ga0495643_0001861 3300046522 Bacteria 17902
449 Ga0495643_0003034 3300046522 Bacteria 12623
450 Ga0495643_0006177 3300046522 Bacteria 7950
451 Ga0495644_0001824 3300046523 Bacteria 8583
452 Ga0495644_0009791 3300046523 Bacteria 3690
453 Ga0495648_0003241 3300046524 Bacteria 14432
454 Ga0495648_0003639 3300046524 Bacteria 13473
455 Ga0495648_0003944 3300046524 Bacteria 12851
456 Ga0495648_0011116 3300046524 Bacteria 6810
457 Ga0495648_0015115 3300046524 Bacteria 5620
458 Ga0495648_0017142 3300046524 Bacteria 5189
459 Ga0495648_0045951 3300046524 Bacteria 2711
460 Ga0495642_0000739 3300046528 Bacteria 16193
461 Ga0495654_0000375 3300046530 Bacteria 38551
462 Ga0495654_0003257 3300046530 Bacteria 10013
463 Ga0495654_0003974 3300046530 Bacteria 8905
464 Ga0495654_0016324 3300046530 Bacteria 3928
465 Ga0495654_0020728 3300046530 Bacteria 3424
466 Ga0495654_0029037 3300046530 Bacteria 2823
467 Ga0495609_0000153 3300046538 Bacteria 71744
468 Ga0495609_0000210 3300046538 Bacteria 58516
469 Ga0495609_0000371 3300046538 Bacteria 38670
470 Ga0495609_0055439 3300046538 Bacteria 1759
471 Ga0495597_0000098 3300046542 Bacteria 77976
472 Ga0495597_0012842 3300046542 Bacteria 4031
473 Ga0495622_0003943 3300046557 Bacteria 6933
474 Ga0495622_0009647 3300046557 Bacteria 4464
475 Ga0495622_0044005 3300046557 Bacteria 2075
476 Ga0495633_0000300 3300046558 Bacteria 56356
477 Ga0495668_0017621 3300046616 Bacteria 4138
478 Ga0495668_0066726 3300046616 Bacteria 1979
479 Ga0495611_0000872 3300046648 Bacteria 16411
480 Ga0495611_0003885 3300046648 Bacteria 6509
481 Ga0495625_0002792 3300046660 Bacteria 18413
482 Ga0495625_0017915 3300046660 Bacteria 5535
483 Ga0495625_0019844 3300046660 Bacteria 5201
484 Ga0495661_0000337 3300046665 Bacteria 51165
485 Ga0495661_0000538 3300046665 Bacteria 39127
486 Ga0495661_0001311 3300046665 Bacteria 21132
487 Ga0495661_0002290 3300046665 Bacteria 14778
488 Ga0495661_0016967 3300046665 Bacteria 4811
489 Ga0495661_0045241 3300046665 Bacteria 2693
490 Ga0495670_0003681 3300046691 Bacteria 7537
491 Ga0495671_0001322 3300046692 Bacteria 16818
492 Ga0495671_0002986 3300046692 Bacteria 10508
493 Ga0495671_0004634 3300046692 Bacteria 8152
494 Ga0495671_0006387 3300046692 Bacteria 6812
495 Ga0495671_0035909 3300046692 Bacteria 2514
496 Ga0495671_0163335 3300046692 Bacteria 1083
497 Ga0495649_0006756 3300046694 Bacteria 7107
498 Ga0495649_0009022 3300046694 Bacteria 5955
499 Ga0495649_0009084 3300046694 Bacteria 5931
500 Ga0495589_0003579 3300046794 Bacteria 8398
501 Ga0495589_0060461 3300046794 Bacteria 1861
502 Ga0495660_0000019 3300046810 Bacteria 311047
503 Ga0495660_0000879 3300046810 Bacteria 22220
504 Ga0495660_0000911 3300046810 Bacteria 21797
505 Ga0495660_0006749 3300046810 Bacteria 6773
506 Ga0495660_0046791 3300046810 Bacteria 2371
507 Ga0495660_0056203 3300046810 Bacteria 2127
508 Ga0495672_0000003 3300047320 Bacteria 728845
509 Ga0495672_0004648 3300047320 Bacteria 11142
510 Ga0495672_0009343 3300047320 Bacteria 7117
511 Ga0495672_0009796 3300047320 Bacteria 6897
512 Ga0495672_0014719 3300047320 Bacteria 5340
513 Ga0495672_0015889 3300047320 Bacteria 5096
514 Ga0495676_0000126 3300047321 Bacteria 58187
515 Ga0495680_0019915 3300047322 Bacteria 5655
516 Ga0495683_0000223 3300047323 Bacteria 53222
517 Ga0495683_0000371 3300047323 Bacteria 36984
518 Ga0495683_0003228 3300047323 Bacteria 9526
519 Ga0495683_0013430 3300047323 Bacteria 4282
520 Ga0495683_0024834 3300047323 Bacteria 3073
521 Ga0495675_0070126 3300047444 Bacteria 2212
522 Ga0495679_001295 3300047446 Bacteria 14582
523 Ga0495679_001695 3300047446 Bacteria 12223
524 Ga0495673_0000011 3300047469 Bacteria 674140
525 Ga0495673_0001897 3300047469 Bacteria 15655
526 Ga0495673_0005418 3300047469 Bacteria 7714
527 Ga0495673_0008585 3300047469 Bacteria 5724
528 Ga0495673_0014761 3300047469 Bacteria 4051
529 Ga0495673_0046063 3300047469 Bacteria 1934
530 Ga0495681_0016053 3300047470 Bacteria 4218
531 Ga0495681_0016475 3300047470 Bacteria 4139
532 Ga0495681_0038268 3300047470 Bacteria 2352
533 Ga0495681_0067105 3300047470 Bacteria 1635
534 Ga0495686_0020807 3300047472 Bacteria 4371
535 Ga0495626_0000471 3300048091 Bacteria 41011
536 Ga0495626_0003765 3300048091 Bacteria 9540
537 Ga0495626_0007765 3300048091 Bacteria 5943
538 Ga0495626_0012177 3300048091 Bacteria 4521
539 Ga0495626_0048033 3300048091 Bacteria 1981
540 Ga0496102_0484666 3300048905 Bacteria 1158
541 Ga0496110_0009253 3300048913 Bacteria 7962
542 Ga0496112_0127866 3300048915 Bacteria 2512
543 Ga0496114_0028572 3300048917 Bacteria 4577
544 Ga0496116_0000663 3300048919 Bacteria 44852
545 Ga0496116_0016264 3300048919 Bacteria 5831
546 Ga0496116_0119954 3300048919 Bacteria 1525
547 Ga0496117_0000088 3300048920 Bacteria 211093
548 Ga0496117_0001425 3300048920 Bacteria 34584
549 Ga0496117_0006004 3300048920 Bacteria 12502
550 Ga0496117_0007449 3300048920 Bacteria 10690
551 Ga0496117_0057179 3300048920 Bacteria 2711
552 Ga0496118_0003619 3300048921 Bacteria 19184
553 Ga0496118_0005722 3300048921 Bacteria 13986
554 Ga0496118_0051348 3300048921 Bacteria 3155
555 Ga0496118_0062423 3300048921 Bacteria 2751
556 Ga0496119_0000380 3300048922 Bacteria 61208
557 Ga0496120_0002710 3300048923 Bacteria 17352
558 Ga0496121_0002023 3300048924 Bacteria 32177
559 Ga0496121_0004919 3300048924 Bacteria 17531
560 Ga0496121_0012236 3300048924 Bacteria 9396
561 Ga0496121_0098675 3300048924 Bacteria 2260
562 Ga0496122_0002009 3300048925 Bacteria 30251
563 Ga0496122_0004970 3300048925 Bacteria 16089
564 Ga0496122_0028114 3300048925 Bacteria 4784
565 Ga0496122_0101033 3300048925 Bacteria 1928
566 Ga0496123_0001344 3300048926 Bacteria 34725
567 Ga0496123_0002392 3300048926 Bacteria 23471
568 Ga0496123_0004350 3300048926 Bacteria 14974
569 Ga0496123_0029385 3300048926 Bacteria 4047
570 Ga0496124_0000132 3300048927 Bacteria 155405
571 Ga0496124_0013196 3300048927 Bacteria 8080
572 Ga0496124_0015039 3300048927 Bacteria 7443
573 Ga0496124_0017029 3300048927 Bacteria 6875
574 Ga0496124_0022494 3300048927 Bacteria 5776
575 Ga0496124_0043984 3300048927 Bacteria 3835
576 Ga0496124_0044639 3300048927 Bacteria 3801
577 Ga0496125_0006982 3300048928 Bacteria 12084
578 Ga0496125_0049175 3300048928 Bacteria 3506
579 Ga0496125_0054771 3300048928 Bacteria 3256
580 Ga0496125_0175800 3300048928 Bacteria 1433
581 Ga0496126_0085441 3300048929 Bacteria 2781
582 Ga0496126_0106389 3300048929 Bacteria 2448
583 Ga0496126_0448479 3300048929 Bacteria 1039
584 Ga0495678_000486 3300049459 Bacteria 39405
585 Ga0495678_000536 3300049459 Bacteria 36666
586 Ga0495678_001447 3300049459 Bacteria 18697
587 Ga0495678_010910 3300049459 Bacteria 4379
588 Ga0495678_025918 3300049459 Bacteria 2510
589 Ga0495682_0000017 3300049460 Bacteria 233333
590 Ga0495682_0000613 3300049460 Bacteria 24066
591 Ga0495682_0000919 3300049460 Bacteria 17922
592 Ga0501031_0103010 3300049568 Bacteria 1863
593 Ga0501032_0033460 3300049569 Bacteria 3522
594 Ga0501032_0183511 3300049569 Bacteria 1369
595 Ga0501034_0000692 3300049571 Bacteria 51206
596 Ga0501037_0011353 3300049573 Bacteria 6559
597 Ga0501037_0049484 3300049573 Bacteria 3077
598 Ga0501037_0219797 3300049573 Bacteria 1337
599 Ga0501046_0100572 3300049580 Bacteria 2218
600 Ga0501069_0157089 3300049585 Bacteria 1309
601 Ga0501070_0020266 3300049586 Bacteria 5577
602 Ga0501070_0022149 3300049586 Bacteria 5322
603 Ga0501070_0022612 3300049586 Bacteria 5265
604 Ga0501072_0187681 3300049588 Bacteria 1649
605 Ga0501074_0000775 3300049590 Bacteria 20164
606 Ga0501080_0000912 3300049742 Bacteria 24221
607 Ga0501080_0375360 3300049742 Bacteria 1282
608 Ga0501241_009848 3300049758 Bacteria 1738
609 Ga0501226_000010 3300049853 Bacteria 180094
610 nmdc:mga03n38_85_c1 3300050490 Bacteria 20170
611 nmdc:mga00v17_1290_c1 3300050491 Bacteria 13149
612 nmdc:mga00v17_40322_c1 3300050491 Bacteria 2801
613 nmdc:mga00v17_4798_c1 3300050491 Bacteria 7077
614 nmdc:mga0yw44_139_c1 3300050492 Bacteria 24821
615 nmdc:mga06z11_14097_c1 3300050494 Bacteria 3531
616 nmdc:mga04h51_1938_c1 3300050495 Bacteria 3817
617 nmdc:mga07m45_169_c1 3300050496 Bacteria 26198
618 nmdc:mga09592_51673_c1 3300050508 Bacteria 3468
619 nmdc:mga0n895_23697_c1 3300050512 Bacteria 5773
620 nmdc:mga0sz30_21_c1 3300050516 Bacteria 30668
621 Ga0500650_0000172 3300053098 Bacteria 16408
622 Ga0500621_000004 3300053126 Bacteria 485792
623 Ga0500659_0003033 3300053135 Bacteria 9998
624 Ga0587072_010257 3300059643 Bacteria 1511
625 2506576791 2506520007 Bacteria 5442880
626 2506581929 2506520008 Bacteria 5443009
627 2508850757 2508501071 Bacteria 5454741
628 2510283469 2510065053 Bacteria 5005518
629 2510292703 2510065055 Bacteria 5037935
630 2510311795 2510065058 Bacteria 5005894
631 2511258135 2511231004 Bacteria 6669789
632 2511264553 2511231006 Bacteria 6794709
633 2511273508 2511231007 Bacteria 6306603
634 2511280899 2511231008 Bacteria 6624100
635 2511290093 2511231010 Bacteria 6373152
636 2511295624 2511231011 Bacteria 6149768
637 2511299523 2511231012 Bacteria 6738011
638 2511315702 2511231014 Bacteria 6462302
639 2511319618 2511231015 Bacteria 6598026
640 2511326676 2511231016 Bacteria 6704427
641 2511333438 2511231017 Bacteria 6503007
642 2511338386 2511231018 Bacteria 6436256
643 2511344035 2511231019 Bacteria 6520662
644 2511353227 2511231020 Bacteria 6115223
645 2511355497 2511231021 Bacteria 7302637
646 2511363692 2511231022 Bacteria 6719296
647 2511369187 2511231023 Bacteria 6808468
648 2511377528 2511231024 Bacteria 5835885
649 2511379729 2511231025 Bacteria 5324661
650 2511410984 2511231031 Bacteria 6558529
651 2511437431 2511231035 Bacteria 5341610
652 2511823152 2511231156 Bacteria 6845832
653 2512328640 2512047018 Bacteria 6663241
654 2538427159 2537561728 Bacteria 5149301
655 2547696391 2547132181 Bacteria 4945084
656 2548649491 2547132416 Bacteria 4633861
657 2554813684 2554235132 Bacteria 6772433
658 2555245857 2554235231 Bacteria 5215788
659 2555258388 2554235234 Bacteria 5762085
660 2555668170 2554235341 Bacteria 6867980
661 2562464169 2561511199 Bacteria 5155034
662 2566035372 2565956521 Bacteria 4468993
663 2583790607 2582580891 Bacteria 6800976
664 2585826081 2585427591 Bacteria 5482980
665 2585831865 2585427592 Bacteria 5370892
666 2597856384 2597489887 Bacteria 6666321
667 2597862560 2597489888 Bacteria 6179543
668 2597868405 2597489889 Bacteria 6297495
669 2599328480 2599185155 Bacteria 5827168
670 2599355169 2599185160 Bacteria 6844013
671 2599361007 2599185161 Bacteria 6960462
672 2599367329 2599185162 Bacteria 6957254
673 2599374119 2599185163 Bacteria 6995158
674 2599380275 2599185164 Bacteria 6841688
675 2599386722 2599185165 Bacteria 6843250
676 2599392977 2599185166 Bacteria 6959206
677 2599396848 2599185167 Bacteria 6353609
678 2599404744 2599185168 Bacteria 6997636
679 2599409834 2599185169 Bacteria 5441380
680 2599448826 2599185179 Bacteria 6611171
681 2599462003 2599185181 Bacteria 6844519
682 2599466954 2599185182 Bacteria 6883168
683 2599483362 2599185185 Bacteria 6652270
684 2599490904 2599185186 Bacteria 6831633
685 2599501256 2599185188 Bacteria 6164180
686 2599507799 2599185189 Bacteria 5862825
687 2599511415 2599185190 Bacteria 6285678
688 2599517645 2599185191 Bacteria 6297582
689 2599613782 2599185212 Bacteria 6765997
690 2599770664 2599185248 Bacteria 6696816
691 2599805267 2599185257 Bacteria 6492581
692 2599879871 2599185288 Bacteria 6666191
693 2599886546 2599185289 Bacteria 6778765
694 2599890789 2599185290 Bacteria 6289611
695 2599896911 2599185291 Bacteria 6775623
696 2599928868 2599185299 Bacteria 4854625
697 2599934024 2599185300 Bacteria 6062622
698 2599942925 2599185302 Bacteria 5954930
699 2599948379 2599185303 Bacteria 6512725
700 2599954036 2599185304 Bacteria 5951361
701 2599959554 2599185305 Bacteria 6748700
702 2599966199 2599185306 Bacteria 6637356
703 2599973884 2599185307 Bacteria 6194719
704 2599978187 2599185308 Bacteria 6621546
705 2599986057 2599185309 Bacteria 5969593
706 2599987145 2599185310 Bacteria 6014457
707 2599995556 2599185311 Bacteria 6354990
708 2600000026 2599185312 Bacteria 5912071
709 2600006401 2599185313 Bacteria 6658188
710 2600012343 2599185314 Bacteria 6621749
711 2600016749 2599185315 Bacteria 6771107
712 2600024837 2599185316 Bacteria 6320029
713 2600029714 2599185317 Bacteria 6435722
714 2600035399 2599185318 Bacteria 6961590
715 2600041246 2599185319 Bacteria 6637840
716 2600045471 2599185320 Bacteria 5963263
717 2600054815 2599185321 Bacteria 6764560
718 2600058370 2599185322 Bacteria 6763055
719 2600063955 2599185323 Bacteria 6688755
720 2600073128 2599185324 Bacteria 6590677
721 2600079421 2599185325 Bacteria 6324919
722 2600214625 2599185356 Bacteria 6843884
723 2600358392 2600254930 Bacteria 6431253
724 2600363974 2600254931 Bacteria 6734225
725 2600446476 2600254954 Bacteria 5100516
726 2601523030 2600255254 Bacteria 5281859
727 2601528189 2600255255 Bacteria 5282785
728 2601533010 2600255256 Bacteria 5597742
729 2601538377 2600255257 Bacteria 5597196
730 2601615020 2600255280 Bacteria 5292309
731 2601620051 2600255281 Bacteria 5288753
732 2601626441 2600255283 Bacteria 6061572
733 2601643488 2600255287 Bacteria 5210468
734 2601648457 2600255288 Bacteria 5282738
735 2601653074 2600255289 Bacteria 5281907
736 2601658804 2600255290 Bacteria 5282218
737 2601663311 2600255291 Bacteria 5217298
738 2601691148 2600255296 Bacteria 5784754
739 2601696806 2600255298 Bacteria 5215185
740 2601700944 2600255299 Bacteria 5218662
741 2601705729 2600255300 Bacteria 5287774
742 2601711314 2600255301 Bacteria 5280532
743 2601716332 2600255302 Bacteria 5288235
744 2601721831 2600255303 Bacteria 5219315
745 2601726738 2600255304 Bacteria 5283973
746 2601731278 2600255305 Bacteria 5282329
747 2601736290 2600255306 Bacteria 5281613
748 2601740727 2600255307 Bacteria 5439064
749 2601751662 2600255309 Bacteria 5431045
750 2601756723 2600255310 Bacteria 5600903
751 2601761822 2600255311 Bacteria 5598766
752 2601774670 2600255313 Bacteria 6842543
753 2601800202 2600255318 Bacteria 6383414
754 2602010461 2600255389 Bacteria 5275336
755 2602018477 2600255392 Bacteria 5437392
756 2603639951 2602042046 Bacteria 5483348
757 2603643933 2602042047 Bacteria 4697674
758 2603660695 2602042052 Bacteria 5215873
759 2603665967 2602042053 Bacteria 5214361
760 2603700887 2602042066 Bacteria 4423871
761 2603704425 2602042067 Bacteria 4863713
762 2603838673 2602042103 Bacteria 5284714
763 2603844068 2602042104 Bacteria 5281639
764 2603848829 2602042105 Bacteria 5282303
765 2603853900 2602042106 Bacteria 5282744
766 2603865219 2602042109 Bacteria 5152801
767 2603871954 2602042110 Bacteria 5283285
768 2603876780 2602042111 Bacteria 5212080
769 2606049136 2603880178 Bacteria 5283018
770 2606070401 2603880184 Bacteria 5217896
771 2606074531 2603880185 Bacteria 6379190
772 2606127394 2603880199 Bacteria 6377649
773 2606146819 2603880202 Bacteria 5284684
774 2606176543 2603880211 Bacteria 5284226
775 2608381151 2606217733 Bacteria 6360972
776 2608670939 2608642108 Bacteria 4104624
777 2609912951 2609459761 Bacteria 5513740
778 2621301301 2619619299 Bacteria 6649820
779 2624478956 2623620443 Bacteria 6427864
780 2624494024 2623620446 Bacteria 6500345
781 2637223621 2636415599 Bacteria 5718434
782 2643845434 2643221565 Bacteria 6216018
783 2643873220 2643221571 Bacteria 6228673
784 2643952144 2643221589 Bacteria 6250934
785 2644024094 2643221602 Bacteria 6249926
786 2644184752 2643221633 Bacteria 6733554
787 2644285678 2643221650 Bacteria 7029547
788 2644624241 2643221713 Bacteria 6554480
789 2649121357 2648501241 Bacteria 5312320
790 2650897537 2648501693 Bacteria 5069560
791 2652545515 2651869719 Bacteria 6047974
792 2652974526 2651869818 Bacteria 5864031
793 2656277975 2654587920 Bacteria 5475511
794 2671092267 2667528170 Bacteria 6786960
795 2671097770 2667528171 Bacteria 6900659
796 2671104227 2667528172 Bacteria 5170840
797 2671109641 2667528173 Bacteria 5375747
798 2671127490 2667528176 Bacteria 6724917
799 2671586318 2671180115 Bacteria 5353919
800 2671767998 2671180172 Bacteria 6495783
801 2676408204 2675903046 Bacteria 5451247
802 2677897707 2675903420 Bacteria 6247433
803 2678261687 2675903515 Bacteria 6580491
804 2681998713 2681812866 Bacteria 4552357
805 2682007785 2681812869 Bacteria 5014465
806 2686354912 2684622997 Bacteria 4624240
807 2687580134 2687453129 Bacteria 4387428
808 2689443183 2687453601 Bacteria 5546041
809 2691329792 2690315857 Bacteria 4396207
810 2707098077 2706794495 Bacteria 4536932
811 2712472552 2711768156 Bacteria 4471618
812 2715752866 2713897148 Bacteria 5883533
813 2715757666 2713897149 Bacteria 6506249
814 2718632842 2718217725 Bacteria 5758958
815 2723247444 2721755607 Bacteria 5841722
816 2729147311 2728369097 Bacteria 4333476
817 2738673928 2738541265 Bacteria 6594665
818 2738689967 2738541271 Bacteria 5657310
819 2738715717 2738541276 Bacteria 4690596
820 2738752321 2738541282 Bacteria 6593925
821 2738809333 2738541294 Bacteria 6925949
822 2738861362 2738541303 Bacteria 6591772
823 2738896693 2738541309 Bacteria 6926455
824 2739198531 2738543004 Bacteria 6381073
825 2739256707 2738543015 Bacteria 6750701
826 2739265741 2738543016 Bacteria 5657564
827 2739286632 2738543020 Bacteria 5718238
828 2739291945 2738543021 Bacteria 5718241
829 2739312909 2738543025 Bacteria 6600348
830 2743735791 2740892503 Bacteria 6855563
831 2745008036 2744054620 Bacteria 6551379
832 2753857348 2751185917 Bacteria 4551186
833 2765582350 2765235841 Bacteria 6137024
834 2765590421 2765235842 Bacteria 4799256
835 2772437338 2772190666 Bacteria 5117644
836 2774121601 2773857670 Bacteria 6407454
837 2774128764 2773857672 Bacteria 4993178
838 2774136253 2773857673 Bacteria 6513460
839 2775539972 2775506706 Bacteria 4873073
840 2777019938 2775507074 Bacteria 5532402
841 2784260322 2784132063 Bacteria 6262788
842 2784317343 2784132072 Bacteria 6596533
843 2791925534 2791354903 Bacteria 4937680
844 2792313887 2791355010 Bacteria 4864581
845 2793404323 2791355275 Bacteria 4429597
846 2794594479 2791355520 Bacteria 5948615
847 2807177598 2806310673 Bacteria 4801221
848 2807409797 2806310737 Bacteria 5751088
849 2807458146 2806310745 Bacteria 5742165
850 2808854201 2808606361 Bacteria 6136259
851 2808907008 2808606373 Bacteria 4423627
852 2808923488 2808606376 Bacteria 6248667
853 2808929488 2808606377 Bacteria 6646337
854 2808934233 2808606378 Bacteria 6177535
855 2808939436 2808606379 Bacteria 5022697
856 2808945237 2808606380 Bacteria 6248705
857 2808951404 2808606381 Bacteria 6646461
858 2808960393 2808606382 Bacteria 6841132
859 2808962366 2808606383 Bacteria 6138645
860 2808975481 2808606385 Bacteria 6711065
861 2808990880 2808606388 Bacteria 6706662
862 2808997593 2808606389 Bacteria 6138126
863 2809126375 2808606414 Bacteria 4917181
864 2809215893 2808606445 Bacteria 6057339
865 2812371053 2811994881 Bacteria 6298475
866 2813727218 2811995292 Bacteria 5303342
867 2814694742 2814123068 Bacteria 5687681
868 2817489335 2816332298 Bacteria 6852809
869 2819658507 2818991456 Bacteria 6123676
870 2819702853 2818991464 Bacteria 6907494
871 2821120269 2821118458 Bacteria 4714306
872 2823376081 2823373977 Bacteria 4779415
873 2823423006 2823421272 Bacteria 5372474
874 2825653590 2825651385 Bacteria 6715909
875 2826584245 2826581358 Bacteria 5963467
876 2834029237 2834028612 Bacteria 6354979
877 2842809390 2842805378 Bacteria 5385175
878 2842817930 2842815866 Bacteria 5947510
879 2842828940 2842826826 Bacteria 5974129
880 2842835578 2842832357 Bacteria 5959113
881 2842839851 2842837860 Bacteria 6066181
882 2842847321 2842843487 Bacteria 6004777
883 2842849580 2842849001 Bacteria 5924277
884 2842857147 2842854478 Bacteria 6143501
885 2844428776 2844425489 Bacteria 4854065
886 2844530356 2844528606 Bacteria 4733806
887 2844668676 2844665904 Bacteria 6817974
888 2846040158 2846037992 Bacteria 4526407
889 2846542540 2846540461 Bacteria 5471451
890 2847086078 2847085930 Bacteria 5070450
891 2847798539 2847797336 Bacteria 5176640
892 2852106368 2852103415 Bacteria 5193810
893 2852615284 2852612431 Bacteria 6885235
894 2852658452 2852657418 Bacteria 6472974
895 2852670252 2852667396 Bacteria 6885555
896 2854605670 2854601825 Bacteria 4797592
897 2855199162 2855195626 Bacteria 4927512
898 2858467156 2858466076 Bacteria 4722413
899 2860340513 2860339153 Bacteria 6846989
900 2865016287 2865014394 Bacteria 4764573
901 2869552590 2869551831 Bacteria 5474685
902 2871272993 2871272651 Bacteria 5042015
903 2871284095 2871282230 Bacteria 4917173
904 2876601565 2876601092 Bacteria 5114497
905 2878030915 2878029506 Bacteria 6418441
906 2880231834 2880230671 Bacteria 6140320
907 2881610631 2881609920 Bacteria 4405319
908 2884087449 2884086401 Bacteria 5005459
909 2887633451 2887630918 Bacteria 3239855
910 2888367384 2888366609 Bacteria 5155009
911 2888374918 2888373701 Bacteria 5098052
912 2891672520 2891670763 Bacteria 4967099
913 2894513770 2894510363 Bacteria 5121143
914 2900053395 2900051742 Bacteria 4985156
915 2904478063 2904474040 Bacteria 5504324
916 2904506894 2904504865 Bacteria 5152820
917 2904516905 2904513164 Bacteria 5476410
918 2904520867 2904518522 Bacteria 6068986
919 2904551741 2904550169 Bacteria 6221258
920 2908448145 2908446538 Bacteria 6829095
921 2908672176 2908669403 Bacteria 5740494
922 2912965003 2912963787 Bacteria 5646108
923 2913038021 2913036834 Bacteria 6704877
924 2916181844 2916178963 Bacteria 5265078
925 2917071932 2917070673 Bacteria 6868303
926 2917833705 2917832318 Bacteria 5346010
927 2919064572 2919063839 Bacteria 6302690
928 2919110251 2919108558 Bacteria 5897419
929 2919129124 2919125081 Bacteria 5385106
930 2919153973 2919150387 Bacteria 5500879
931 2919158774 2919155634 Bacteria 4860545
932 2919385960 2919385768 Bacteria 5897293
933 2919458160 2919456309 Bacteria 6586567
934 2919482931 2919481497 Bacteria 6907839
935 2919490746 2919487758 Bacteria 5929766
936 2919497012 2919493220 Bacteria 4598500
937 2919498324 2919497567 Bacteria 4408621
938 2919505602 2919501602 Bacteria 5286340
939 2919538320 2919534386 Bacteria 4577686
940 2919546353 2919543075 Bacteria 4728703
941 2919690037 2919688452 Bacteria 4595932
942 2919700057 2919697872 Bacteria 6553725
943 2923154800 2923153595 Bacteria 6870622
944 2923525160 2923519811 Bacteria 6298479
945 2923529915 2923525760 Bacteria 4472324
946 2923590854 2923586266 Bacteria 6565975
947 2923636317 2923634449 Bacteria 4753480
948 2926067279 2926063275 Bacteria 5285848
949 2927147510 2927143783 Bacteria 5504251
950 2927837200 2927833300 Bacteria 4923934
951 2929145478 2929144301 Bacteria 6622272
952 2929191263 2929189879 Bacteria 5930554
953 2931371184 2931369376 Bacteria 6847892
954 2931392251 2931390751 Bacteria 6273349
955 2931399584 2931396565 Bacteria 7251677
956 2932410240 2932406140 Bacteria 5134491
957 2935354104 2935353572 Unclassified 6955622
958 2935628104 2935625433 Bacteria 5042964
959 2937543788 2937539931 Bacteria 4639830
960 2937970618 2937967321 Bacteria 5094075
961 2939571082 2939568625 Bacteria 4542555
962 2939577189 2939573065 Bacteria 4926053
963 2939582612 2939577877 Bacteria 5132791
964 2939604517 2939602548 Bacteria 4950493
965 2939610138 2939607340 Bacteria 4719256
966 2939620208 2939617950 Bacteria 4820956
967 2939637909 2939636861 Bacteria 6297853
968 2939645185 2939642701 Bacteria 4475280
969 2939653361 2939651529 Bacteria 5895393
970 2945876319 2945874760 Bacteria 5527237
971 2945929320 2945928738 Bacteria 6053221
972 2945951782 2945951305 Bacteria 4918162
973 2945961500 2945961074 Bacteria 7342064
974 2946011593 2946006987 Bacteria 6705746
975 2946029487 2946027586 Bacteria 6049274
976 2947236076 2947233263 Bacteria 6439278
977 2952254376 2952252522 Bacteria 4171745
978 2969080656 2969079654 Bacteria 5439582
979 2969305737 2969304461 Bacteria 6601805
980 2971822030 2971820967 Bacteria 5823634
981 2974292637 2974289157 Bacteria 6080362
982 2974299112 2974298342 Bacteria 4840922
983 2974315370 2974310843 Bacteria 4947816
984 2974439908 2974435778 Bacteria 4876478
985 2978978318 2978975091 Bacteria 4704313
986 2984291229 2984286254 Bacteria 6702062
987 2984495356 2984494565 Bacteria 5000175
988 2984501425 2984499530 Bacteria 5020881
989 2984507932 2984504281 Bacteria 5262371
990 2984563097 2984559226 Bacteria 5683096
991 2984601155 2984595703 Bacteria 5682994
992 2988733016 2988728565 Bacteria 6124362
993 2990200462 2990196909 Bacteria 4054280
994 2990265067 2990261002 Bacteria 4919493
995 2998141177 2998139840 Bacteria 6073514
996 2998348361 2998344455 Bacteria 4222996
997 3000377926 3000376612 Bacteria 4705565
998 3007253886 3007252601 Bacteria 4559114
999 3007317373 3007315729 Bacteria 5076637
1000 3007400329 3007395558 Bacteria 6755444
1001 3007420809 3007419365 Bacteria 7026924
1002 3007512551 3007511990 Bacteria 6481491
1003 3007618210 3007614139 Bacteria 6053559
1004 3007623005 3007619802 Bacteria 6411688
1005 3007720905 3007718800 Bacteria 5971527
1006 3007808667 3007803356 Bacteria 5931491
1007 3007860474 3007855910 Bacteria 5637581
1008 3007863601 3007861166 Bacteria 6045338
1009 3007871372 3007866637 Bacteria 5899198
1010 3007874468 3007872151 Bacteria 5268868
1011 637318547 637000220 Bacteria 7074893
1012 640487525 640427133 Bacteria 4567418
1013 640936343 640753048 Bacteria 5495657
1014 651175466 651053060 Bacteria 4689946
1015 8002745902 8002745576 Bacteria 4840272
1016 8004597714 8004592986 Bacteria 5122074
1017 8011356803 8011350971 Bacteria 6158957
1018 8015397491 8015394850 Bacteria 5064660
1019 8015689034 8015687852 Bacteria 6613826
1020 8016729902 8016728285 Bacteria 5263933
1021 8016734711 8016733728 Bacteria 5274317
1022 8018226096 8018221730 Bacteria 4616064
1023 8018405945 8018405270 Bacteria 4978981
1024 8019503826 8019499862 Bacteria 5169538
1025 8019508521 8019504834 Bacteria 4819156
1026 8019773413 8019769354 Bacteria 6924660
1027 8019776724 8019775933 Bacteria 6858656
1028 8029999587 8029995093 Bacteria 5990776
1029 8034964065 8034962539 Bacteria 4884839
1030 8052495803 8052494512 Bacteria 5765634
1031 8054285566 8054285046 Bacteria 6919322
1032 8054348314 8054347763 Bacteria 5901107
1033 8054359585 8054357960 Bacteria 2867777
1034 8054504827 8054503363 Bacteria 6101651
1035 8054847809 8054844752 Bacteria 4450330
1036 8054853478 8054849141 Bacteria 5232694
1037 8054929612 8054929484 Bacteria 5599761
1038 8055088791 8055087960 Bacteria 4784273
1039 8055097087 8055092621 Bacteria 4873875
1040 8055101059 8055097453 Bacteria 4865496
1041 8055694728 8055693939 Bacteria 4772047
1042 8055772153 8055770955 Bacteria 6827675
1043 8055819272 8055817908 Bacteria 6609162
1044 8055884328 8055878733 Bacteria 5907058
1045 8056120135 8056115690 Bacteria 5527654
1046 8056121982 8056120720 Bacteria 5758328
1047 8056127255 8056125926 Bacteria 6228218
1048 8056133190 8056131705 Bacteria 6107031
1049 8056141749 8056137416 Bacteria 6147080
1050 8056147801 8056143049 Bacteria 6307666
1051 8056149438 8056148874 Bacteria 6479865
1052 8056159593 8056155041 Bacteria 6486948
1053 8056164600 8056161164 Bacteria 6106669
1054 8056169877 8056166840 Bacteria 5820959
1055 8056176004 8056172158 Bacteria 6133900
1056 8056180406 8056177738 Bacteria 6748268
1057 8056569828 8056569372 Bacteria 5997322
1058 8057163175 8057160832 Bacteria 3268302
1059 8057304976 8057304971 Bacteria 4649742
1060 8057803442 8057798959 Bacteria 6713499
1061 Ga0157373_10024353
1062 MRS2a_Contig_5
1063 SwRhRL2b_contig_195785
1064 JGI25162J39368_1000314
1065 JGI25162J39368_1000320
1066 JGI25154J39366_1002279
1067 JGI25163J39215_1003232
1068 JGI25163J39215_1003241
1069 JGI25164J39214_1000233
1070 JGI25164J39214_1000237
1071 JGI25165J46597_1000429
1072 JGI25165J46597_1000437
1073 Ga0006758J48902_1023556
1074 rootH1_10069926
1075 rootL2_10048495
1076 rootH1_10014691
1077 rootH1_10130777
1078 Ga0007410J51695_1042200
1079 Ga0007409J51694_1037896
1080 Ga0055538_1000096
1081 Ga0055539_1000142
1082 Ga0055533_1000146
1083 Ga0055532_1000132
1084 Ga0055525_1000226
1085 Ga0055536_1000217
1086 Ga0055536_1014192
1087 Ga0055536_1014380
1088 Ga0055530_10001975
1089 Ga0055530_10003100
1090 Ga0055530_10016500
1091 Ga0055530_10017736
1092 Ga0055540_1001484
1093 Ga0055540_1002192
1094 Ga0055540_1002238
1095 Ga0055531_10000642
1096 Ga0055541_1000096
1097 Ga0065714_10001187
1098 Ga0065714_10012277
1099 Ga0065714_10012898
1100 Ga0065714_10067066
1101 Ga0065714_10069591
1102 Ga0065714_10093548
1103 Ga0065714_10093894
1104 Ga0065704_10000775
1105 Ga0065704_10071509
1106 Ga0065704_10095265
1107 Ga0065704_10203247
1108 Ga0065712_10000443
1109 Ga0065712_10074620
1110 Ga0065715_10092878
1111 Ga0070670_100000015
1112 Ga0070670_100123128
1113 Ga0070670_100339935
1114 Ga0070687_100012310
1115 Ga0070661_100000306
1116 Ga0070669_100002434
1117 Ga0070669_100026832
1118 Ga0070669_100140820
1119 Ga0070671_100000240
1120 Ga0070671_100027037
1121 Ga0070688_100019396
1122 Ga0070659_100555513
1123 Ga0070667_100000015
1124 Ga0070662_100000360
1125 Ga0070685_10000004
1126 Ga0068853_100028026
1127 Ga0070665_100012700
1128 Ga0070664_100000741
1129 Ga0068854_100028524
1130 Ga0068859_100008057
1131 Ga0068864_100000072
1132 Ga0068851_10000019
1133 Ga0068858_100052905
1134 Ga0068860_100000271
1135 Ga0068862_100003971
1136 Ga0075365_10000215
1137 Ga0075368_10008663
1138 Ga0075363_100020069
1139 Ga0075364_10000013
1140 Ga0075364_10006085
1141 Ga0075364_10062654
1142 Ga0075432_10009154
1143 Ga0075432_10024776
1144 Ga0075432_10033157
1145 Ga0075432_10056460
1146 Ga0075369_10001215
1147 Ga0075369_10058267
1148 Ga0075370_10000352
1149 Ga0075429_100086097
1150 Ga0097620_100008057
1151 Ga0099823_1000119
1152 Ga0079104_1001155
1153 Ga0079104_1005472
1154 Ga0099826_10000860
1155 Ga0105251_10000444
1156 Ga0105251_10000619
1157 Ga0105251_10001959
1158 Ga0105251_10003015
1159 Ga0105251_10036856
1160 Ga0105251_10054942
1161 Ga0105251_10083711
1162 Ga0105251_10093823
1163 Ga0105251_10096447
1164 Ga0105251_10099770
1165 Ga0105244_10005246
1166 Ga0105244_10006585
1167 Ga0105244_10011745
1168 Ga0105244_10024956
1169 Ga0105244_10026994
1170 Ga0105244_10045749
1171 Ga0105244_10079052
1172 Ga0105250_10000959
1173 Ga0105250_10034463
1174 Ga0105250_10039494
1175 Ga0105250_10041579
1176 Ga0105250_10071275
1177 Ga0105250_10079982
1178 Ga0105243_10003511
1179 Ga0105243_10087600
1180 Ga0105243_10096687
1181 Ga0105243_10117689
1182 Ga0105242_10001061
1183 Ga0105242_10079122
1184 Ga0105237_10002041
1185 Ga0105249_10053921
1186 Ga0105249_10097866
1187 Ga0105246_10001083
1188 Ga0105246_10001761
1189 Ga0105246_10094363
1190 Ga0157345_1000607
1191 Ga0157373_10029248
1192 Ga0157371_10005548
1193 Ga0157371_10006276
1194 Ga0157371_10012444
1195 Ga0157371_10016653
1196 Ga0157370_10001690
1197 Ga0157370_10125089
1198 Ga0157378_10026399
1199 Ga0163162_10289801
1200 Ga0157372_10000663
1201 Ga0157372_10033882
1202 Ga0163163_10000118
1203 Ga0182008_10002900
1204 Ga0182008_10051446
1205 Ga0182008_10088693
1206 Ga0157376_10457540
1207 Ga0182006_1003483
1208 Ga0182006_1040520
1209 Ga0182006_1055610
1210 Ga0182007_10001511
1211 Ga0182005_1019757
1212 Ga0213872_10002808
1213 Ga0213872_10003010
1214 Ga0213872_10003822
1215 Ga0213872_10004946
1216 Ga0209435_100393
1217 Ga0209760_100021
1218 Ga0209760_100046
1219 Ga0209784_100015
1220 Ga0209566_100012
1221 Ga0209674_100027
1222 Ga0209147_100019
1223 Ga0209563_100031
1224 Ga0209563_101829
1225 Ga0207427_100001
1226 Ga0207427_100029
1227 Ga0209437_100003
1228 Ga0209437_100009
1229 Ga0209437_102448
1230 Ga0209258_100824
1231 Ga0209646_1000220
1232 Ga0209677_100016
1233 Ga0209759_1004898
1234 Ga0209759_1005930
1235 Ga0209233_1000007
1236 Ga0209233_1000032
1237 Ga0209675_1001096
1238 Ga0209676_1000016
1239 Ga0209676_1000080
1240 Ga0209676_1000397
1241 Ga0209676_1015743
1242 Ga0209050_1000208
1243 Ga0209050_1001191
1244 Ga0209050_1001235
1245 Ga0209050_1002753
1246 Ga0209051_1000219
1247 Ga0209051_1000498
1248 Ga0209051_1000879
1249 Ga0209257_1000342
1250 Ga0209257_1008743
1251 Ga0207656_10000042
1252 Ga0207696_1000032
1253 Ga0207696_1000141
1254 Ga0207696_1000164
1255 Ga0207696_1000604
1256 Ga0207696_1001566
1257 Ga0207696_1006225
1258 Ga0207696_1014133
1259 Ga0207696_1021239
1260 Ga0207655_1000005
1261 Ga0207655_1000015
1262 Ga0207655_1000488
1263 Ga0207655_1001023
1264 Ga0207655_1001253
1265 Ga0207655_1002739
1266 Ga0207655_1009566
1267 Ga0207655_1012134
1268 Ga0207655_1017526
1269 Ga0207655_1017992
1270 Ga0207655_1021544
1271 Ga0207655_1033900
1272 Ga0207655_1035374
1273 Ga0207655_1038488
1274 Ga0207713_1000085
1275 Ga0207713_1000098
1276 Ga0207713_1000338
1277 Ga0207713_1000751
1278 Ga0207713_1000843
1279 Ga0207713_1002039
1280 Ga0207713_1005190
1281 Ga0207713_1006982
1282 Ga0207713_1008734
1283 Ga0207713_1032973
1284 Ga0207713_1059199
1285 Ga0207713_1063976
1286 Ga0207710_10058597
1287 Ga0207671_10000420
1288 Ga0207662_10067998
1289 Ga0207649_10000002
1290 Ga0207681_10002129
1291 Ga0207681_10402761
1292 Ga0207650_10000013
1293 Ga0207650_10000606
1294 Ga0207650_10045152
1295 Ga0207644_10000015
1296 Ga0207706_10007522
1297 Ga0207709_10000228
1298 Ga0207709_10000510
1299 Ga0207709_10034056
1300 Ga0207711_10000103
1301 Ga0207711_10000277
1302 Ga0207679_10000006
1303 Ga0207712_10029560
1304 Ga0207658_10000005
1305 Ga0207703_10027118
1306 Ga0207639_10013206
1307 Ga0207641_10034212
1308 Ga0207641_10037311
1309 Ga0207676_10000010
1310 Ga0207674_10391280
1311 Ga0209281_1000013
1312 Ga0209281_1000015
1313 Ga0209281_1003287
1314 Ga0209389_1000205
1315 Ga0209371_1000165
1316 Ga0209371_1000584
1317 Ga0209371_1024188
1318 Ga0209981_1005160
1319 Ga0209996_1003171
1320 Ga0209984_1001385
1321 Ga0209995_1002255
1322 Ga0209968_1007756
1323 Ga0210002_1001652
1324 Ga0209983_1000260
1325 Ga0209282_1017939
1326 Ga0209971_1000463
1327 Ga0209813_10006508
1328 Ga0207428_10137455
1329 Ga0207428_10176571
1330 Ga0207428_10254512
1331 Ga0207428_10318293
1332 Ga0268266_10011036
1333 Ga0268266_10262646
1334 Ga0268265_10002237
1335 Ga0268264_10000036
1336 Ga0307517_10175495
1337 Ga0268256_1000112
1338 Ga0268256_1000436
1339 Ga0268256_1027483
1340 Ga0316179_1077882
1341 Ga0316178_1009525
1342 Ga0316181_1106926
1343 Ga0265331_10019849
1344 Ga0265327_10000014
1345 Ga0265327_10000170
1346 Ga0307408_100000042
1347 Ga0307408_100002417
1348 Ga0307408_100002567
1349 Ga0316576_10025351
1350 Ga0316578_10126639
1351 Ga0316577_10095962
1352 Ga0316577_10145087
1353 Ga0307406_10001355
1354 Ga0307406_10086930
1355 Ga0307414_10008646
1356 Ga0316585_10018592
1357 Ga0316587_1008417
1358 Ga0316587_1010941
1359 Ga0373960_0005597
1360 Ga0316574_0017625
1361 Ga0316574_0136801
1362 Ga0316582_0004214
1363 Ga0316582_0293491
1364 Ga0316584_0024150
1365 Ga0316584_0077921
1366 Ga0395900_0029706
1367 Ga0400483_022490
1368 Ga0400483_026308
1369 Ga0400483_077384
1370 Ga0400483_116699
1371 Ga0400483_235996
1372 Ga0400483_249072
1373 Ga0400483_250036
1374 Ga0400487_52686
1375 Ga0436361_0052642
1376 Ga0436361_0777562
1377 Ga0436361_0891393
1378 Ga0439436_0000093
1379 Ga0439436_0000606
1380 Ga0439438_002379
1381 Ga0439438_002924
1382 Ga0439438_003070
1383 Ga0439438_006968
1384 Ga0439447_000651
1385 Ga0439447_005171
1386 Ga0439447_026562
1387 Ga0439466_0000870
1388 Ga0439466_0012474
1389 Ga0439466_0030953
1390 Ga0451807_1403825
1391 Ga0439437_000719
1392 Ga0439432_013881
1393 Ga0439432_039883
1394 Ga0439451_001040
1395 Ga0439451_015030
1396 Ga0439452_002393
1397 Ga0439452_002554
1398 Ga0439452_015295
1399 Ga0439456_000224
1400 Ga0439463_000713
1401 Ga0439463_014393
1402 Ga0450911_000005
1403 Ga0450900_003653
1404 Ga0450904_000002
1405 Ga0450905_000063
1406 Ga0450907_001644
1407 Ga0439446_0001114
1408 Ga0439446_0001152
1409 Ga0439446_0006551
1410 Ga0450908_001752
1411 Ga0439434_0001359
1412 Ga0439464_0000031
1413 Ga0439464_0012859
1414 Ga0439460_0002293
1415 Ga0439460_0004649
1416 Ga0450901_000289
1417 Ga0451577_0168843
1418 Ga0466969_0001528
1419 Ga0466965_0002201
1420 Ga0466966_0003088
1421 Ga0466961_0001154
1422 Ga0453684_0000211
1423 Ga0453684_0568292
1424 Ga0466959_0088268
1425 Ga0451576_0000234
1426 Ga0495627_001316
1427 Ga0495627_029273
1428 Ga0495591_000212
1429 Ga0495591_000849
1430 Ga0495591_001650
1431 Ga0495591_002049
1432 Ga0495591_002381
1433 Ga0495591_006498
1434 Ga0495591_009341
1435 Ga0495591_020376
1436 Ga0495638_0019589
1437 Ga0495638_0085174
1438 Ga0495638_0115396
1439 Ga0495653_0005238
1440 Ga0495650_0000008
1441 Ga0495650_0000515
1442 Ga0495650_0001154
1443 Ga0495650_0007032
1444 Ga0495650_0089352
1445 Ga0495605_0000323
1446 Ga0495605_0000449
1447 Ga0495605_0000461
1448 Ga0495605_0001257
1449 Ga0495605_0001417
1450 Ga0495605_0050379
1451 Ga0495605_0057136
1452 Ga0495605_0089006
1453 Ga0495584_0013435
1454 Ga0495584_0022750
1455 Ga0495585_0003113
1456 Ga0495585_0009384
1457 Ga0495585_0039267
1458 Ga0495596_0000148
1459 Ga0495596_0030807
1460 Ga0495607_0000276
1461 Ga0495607_0000490
1462 Ga0495607_0000544
1463 Ga0495607_0000841
1464 Ga0495607_0005018
1465 Ga0495607_0020434
1466 Ga0495607_0063674
1467 Ga0495607_0077091
1468 Ga0495607_0098794
1469 Ga0495607_0122764
1470 Ga0495583_0000861
1471 Ga0495583_0000884
1472 Ga0495583_0002615
1473 Ga0495583_0004142
1474 Ga0495583_0004417
1475 Ga0495606_0000126
1476 Ga0495606_0001121
1477 Ga0495606_0001804
1478 Ga0495606_0002489
1479 Ga0495606_0006268
1480 Ga0495606_0012166
1481 Ga0495606_0016744
1482 Ga0495606_0023582
1483 Ga0495610_0003557
1484 Ga0495610_0013190
1485 Ga0495616_0035062
1486 Ga0495616_0096084
1487 Ga0495620_0000003
1488 Ga0495620_0001260
1489 Ga0495620_0003107
1490 Ga0495620_0006420
1491 Ga0495620_0012230
1492 Ga0495620_0016101
1493 Ga0495620_0019997
1494 Ga0495631_0009673
1495 Ga0495631_0023789
1496 Ga0495631_0040393
1497 Ga0495632_0001207
1498 Ga0495632_0003927
1499 Ga0495632_0005427
1500 Ga0495632_0059256
1501 Ga0495637_0001766
1502 Ga0495637_0002014
1503 Ga0495637_0011318
1504 Ga0495637_0014996
1505 Ga0495637_0038282
1506 Ga0495637_0040424
1507 Ga0495643_0000917
1508 Ga0495643_0001861
1509 Ga0495643_0003034
1510 Ga0495643_0006177
1511 Ga0495644_0001824
1512 Ga0495644_0009791
1513 Ga0495648_0003241
1514 Ga0495648_0003639
1515 Ga0495648_0003944
1516 Ga0495648_0011116
1517 Ga0495648_0015115
1518 Ga0495648_0017142
1519 Ga0495648_0045951
1520 Ga0495642_0000739
1521 Ga0495654_0000375
1522 Ga0495654_0003257
1523 Ga0495654_0003974
1524 Ga0495654_0016324
1525 Ga0495654_0020728
1526 Ga0495654_0029037
1527 Ga0495609_0000153
1528 Ga0495609_0000210
1529 Ga0495609_0000371
1530 Ga0495609_0055439
1531 Ga0495597_0000098
1532 Ga0495597_0012842
1533 Ga0495622_0003943
1534 Ga0495622_0009647
1535 Ga0495622_0044005
1536 Ga0495633_0000300
1537 Ga0495668_0017621
1538 Ga0495668_0066726
1539 Ga0495611_0000872
1540 Ga0495611_0003885
1541 Ga0495625_0002792
1542 Ga0495625_0017915
1543 Ga0495625_0019844
1544 Ga0495661_0000337
1545 Ga0495661_0000538
1546 Ga0495661_0001311
1547 Ga0495661_0002290
1548 Ga0495661_0016967
1549 Ga0495661_0045241
1550 Ga0495670_0003681
1551 Ga0495671_0001322
1552 Ga0495671_0002986
1553 Ga0495671_0004634
1554 Ga0495671_0006387
1555 Ga0495671_0035909
1556 Ga0495671_0163335
1557 Ga0495649_0006756
1558 Ga0495649_0009022
1559 Ga0495649_0009084
1560 Ga0495589_0003579
1561 Ga0495589_0060461
1562 Ga0495660_0000019
1563 Ga0495660_0000879
1564 Ga0495660_0000911
1565 Ga0495660_0006749
1566 Ga0495660_0046791
1567 Ga0495660_0056203
1568 Ga0495672_0000003
1569 Ga0495672_0004648
1570 Ga0495672_0009343
1571 Ga0495672_0009796
1572 Ga0495672_0014719
1573 Ga0495672_0015889
1574 Ga0495676_0000126
1575 Ga0495680_0019915
1576 Ga0495683_0000223
1577 Ga0495683_0000371
1578 Ga0495683_0003228
1579 Ga0495683_0013430
1580 Ga0495683_0024834
1581 Ga0495675_0070126
1582 Ga0495679_001295
1583 Ga0495679_001695
1584 Ga0495673_0000011
1585 Ga0495673_0001897
1586 Ga0495673_0005418
1587 Ga0495673_0008585
1588 Ga0495673_0014761
1589 Ga0495673_0046063
1590 Ga0495681_0016053
1591 Ga0495681_0016475
1592 Ga0495681_0038268
1593 Ga0495681_0067105
1594 Ga0495686_0020807
1595 Ga0495626_0000471
1596 Ga0495626_0003765
1597 Ga0495626_0007765
1598 Ga0495626_0012177
1599 Ga0495626_0048033
1600 Ga0496102_0484666
1601 Ga0496110_0009253
1602 Ga0496112_0127866
1603 Ga0496114_0028572
1604 Ga0496116_0000663
1605 Ga0496116_0016264
1606 Ga0496116_0119954
1607 Ga0496117_0000088
1608 Ga0496117_0001425
1609 Ga0496117_0006004
1610 Ga0496117_0007449
1611 Ga0496117_0057179
1612 Ga0496118_0003619
1613 Ga0496118_0005722
1614 Ga0496118_0051348
1615 Ga0496118_0062423
1616 Ga0496119_0000380
1617 Ga0496120_0002710
1618 Ga0496121_0002023
1619 Ga0496121_0004919
1620 Ga0496121_0012236
1621 Ga0496121_0098675
1622 Ga0496122_0002009
1623 Ga0496122_0004970
1624 Ga0496122_0028114
1625 Ga0496122_0101033
1626 Ga0496123_0001344
1627 Ga0496123_0002392
1628 Ga0496123_0004350
1629 Ga0496123_0029385
1630 Ga0496124_0000132
1631 Ga0496124_0013196
1632 Ga0496124_0015039
1633 Ga0496124_0017029
1634 Ga0496124_0022494
1635 Ga0496124_0043984
1636 Ga0496124_0044639
1637 Ga0496125_0006982
1638 Ga0496125_0049175
1639 Ga0496125_0054771
1640 Ga0496125_0175800
1641 Ga0496126_0085441
1642 Ga0496126_0106389
1643 Ga0496126_0448479
1644 Ga0495678_000486
1645 Ga0495678_000536
1646 Ga0495678_001447
1647 Ga0495678_010910
1648 Ga0495678_025918
1649 Ga0495682_0000017
1650 Ga0495682_0000613
1651 Ga0495682_0000919
1652 Ga0501031_0103010
1653 Ga0501032_0033460
1654 Ga0501032_0183511
1655 Ga0501034_0000692
1656 Ga0501037_0011353
1657 Ga0501037_0049484
1658 Ga0501037_0219797
1659 Ga0501046_0100572
1660 Ga0501069_0157089
1661 Ga0501070_0020266
1662 Ga0501070_0022149
1663 Ga0501070_0022612
1664 Ga0501072_0187681
1665 Ga0501074_0000775
1666 Ga0501080_0000912
1667 Ga0501080_0375360
1668 Ga0501241_009848
1669 Ga0501226_000010
1670 nmdc:mga03n38_85_c1
1671 nmdc:mga00v17_1290_c1
1672 nmdc:mga00v17_40322_c1
1673 nmdc:mga00v17_4798_c1
1674 nmdc:mga0yw44_139_c1
1675 nmdc:mga06z11_14097_c1
1676 nmdc:mga04h51_1938_c1
1677 nmdc:mga07m45_169_c1
1678 nmdc:mga09592_51673_c1
1679 nmdc:mga0n895_23697_c1
1680 nmdc:mga0sz30_21_c1
1681 Ga0500650_0000172
1682 Ga0500621_000004
1683 Ga0500659_0003033
1684 Ga0587072_010257
1685 2506576791
1686 2506581929
1687 2508850757
1688 2510283469
1689 2510292703
1690 2510311795
1691 2511258135
1692 2511264553
1693 2511273508
1694 2511280899
1695 2511290093
1696 2511295624
1697 2511299523
1698 2511315702
1699 2511319618
1700 2511326676
1701 2511333438
1702 2511338386
1703 2511344035
1704 2511353227
1705 2511355497
1706 2511363692
1707 2511369187
1708 2511377528
1709 2511379729
1710 2511410984
1711 2511437431
1712 2511823152
1713 2512328640
1714 2538427159
1715 2547696391
1716 2548649491
1717 2554813684
1718 2555245857
1719 2555258388
1720 2555668170
1721 2562464169
1722 2566035372
1723 2583790607
1724 2585826081
1725 2585831865
1726 2597856384
1727 2597862560
1728 2597868405
1729 2599328480
1730 2599355169
1731 2599361007
1732 2599367329
1733 2599374119
1734 2599380275
1735 2599386722
1736 2599392977
1737 2599396848
1738 2599404744
1739 2599409834
1740 2599448826
1741 2599462003
1742 2599466954
1743 2599483362
1744 2599490904
1745 2599501256
1746 2599507799
1747 2599511415
1748 2599517645
1749 2599613782
1750 2599770664
1751 2599805267
1752 2599879871
1753 2599886546
1754 2599890789
1755 2599896911
1756 2599928868
1757 2599934024
1758 2599942925
1759 2599948379
1760 2599954036
1761 2599959554
1762 2599966199
1763 2599973884
1764 2599978187
1765 2599986057
1766 2599987145
1767 2599995556
1768 2600000026
1769 2600006401
1770 2600012343
1771 2600016749
1772 2600024837
1773 2600029714
1774 2600035399
1775 2600041246
1776 2600045471
1777 2600054815
1778 2600058370
1779 2600063955
1780 2600073128
1781 2600079421
1782 2600214625
1783 2600358392
1784 2600363974
1785 2600446476
1786 2601523030
1787 2601528189
1788 2601533010
1789 2601538377
1790 2601615020
1791 2601620051
1792 2601626441
1793 2601643488
1794 2601648457
1795 2601653074
1796 2601658804
1797 2601663311
1798 2601691148
1799 2601696806
1800 2601700944
1801 2601705729
1802 2601711314
1803 2601716332
1804 2601721831
1805 2601726738
1806 2601731278
1807 2601736290
1808 2601740727
1809 2601751662
1810 2601756723
1811 2601761822
1812 2601774670
1813 2601800202
1814 2602010461
1815 2602018477
1816 2603639951
1817 2603643933
1818 2603660695
1819 2603665967
1820 2603700887
1821 2603704425
1822 2603838673
1823 2603844068
1824 2603848829
1825 2603853900
1826 2603865219
1827 2603871954
1828 2603876780
1829 2606049136
1830 2606070401
1831 2606074531
1832 2606127394
1833 2606146819
1834 2606176543
1835 2608381151
1836 2608670939
1837 2609912951
1838 2621301301
1839 2624478956
1840 2624494024
1841 2637223621
1842 2643845434
1843 2643873220
1844 2643952144
1845 2644024094
1846 2644184752
1847 2644285678
1848 2644624241
1849 2649121357
1850 2650897537
1851 2652545515
1852 2652974526
1853 2656277975
1854 2671092267
1855 2671097770
1856 2671104227
1857 2671109641
1858 2671127490
1859 2671586318
1860 2671767998
1861 2676408204
1862 2677897707
1863 2678261687
1864 2681998713
1865 2682007785
1866 2686354912
1867 2687580134
1868 2689443183
1869 2691329792
1870 2707098077
1871 2712472552
1872 2715752866
1873 2715757666
1874 2718632842
1875 2723247444
1876 2729147311
1877 2738673928
1878 2738689967
1879 2738715717
1880 2738752321
1881 2738809333
1882 2738861362
1883 2738896693
1884 2739198531
1885 2739256707
1886 2739265741
1887 2739286632
1888 2739291945
1889 2739312909
1890 2743735791
1891 2745008036
1892 2753857348
1893 2765582350
1894 2765590421
1895 2772437338
1896 2774121601
1897 2774128764
1898 2774136253
1899 2775539972
1900 2777019938
1901 2784260322
1902 2784317343
1903 2791925534
1904 2792313887
1905 2793404323
1906 2794594479
1907 2807177598
1908 2807409797
1909 2807458146
1910 2808854201
1911 2808907008
1912 2808923488
1913 2808929488
1914 2808934233
1915 2808939436
1916 2808945237
1917 2808951404
1918 2808960393
1919 2808962366
1920 2808975481
1921 2808990880
1922 2808997593
1923 2809126375
1924 2809215893
1925 2812371053
1926 2813727218
1927 2814694742
1928 2817489335
1929 2819658507
1930 2819702853
1931 2821120269
1932 2823376081
1933 2823423006
1934 2825653590
1935 2826584245
1936 2834029237
1937 2842809390
1938 2842817930
1939 2842828940
1940 2842835578
1941 2842839851
1942 2842847321
1943 2842849580
1944 2842857147
1945 2844428776
1946 2844530356
1947 2844668676
1948 2846040158
1949 2846542540
1950 2847086078
1951 2847798539
1952 2852106368
1953 2852615284
1954 2852658452
1955 2852670252
1956 2854605670
1957 2855199162
1958 2858467156
1959 2860340513
1960 2865016287
1961 2869552590
1962 2871272993
1963 2871284095
1964 2876601565
1965 2878030915
1966 2880231834
1967 2881610631
1968 2884087449
1969 2887633451
1970 2888367384
1971 2888374918
1972 2891672520
1973 2894513770
1974 2900053395
1975 2904478063
1976 2904506894
1977 2904516905
1978 2904520867
1979 2904551741
1980 2908448145
1981 2908672176
1982 2912965003
1983 2913038021
1984 2916181844
1985 2917071932
1986 2917833705
1987 2919064572
1988 2919110251
1989 2919129124
1990 2919153973
1991 2919158774
1992 2919385960
1993 2919458160
1994 2919482931
1995 2919490746
1996 2919497012
1997 2919498324
1998 2919505602
1999 2919538320
2000 2919546353
2001 2919690037
2002 2919700057
2003 2923154800
2004 2923525160
2005 2923529915
2006 2923590854
2007 2923636317
2008 2926067279
2009 2927147510
2010 2927837200
2011 2929145478
2012 2929191263
2013 2931371184
2014 2931392251
2015 2931399584
2016 2932410240
2017 2935354104
2018 2935628104
2019 2937543788
2020 2937970618
2021 2939571082
2022 2939577189
2023 2939582612
2024 2939604517
2025 2939610138
2026 2939620208
2027 2939637909
2028 2939645185
2029 2939653361
2030 2945876319
2031 2945929320
2032 2945951782
2033 2945961500
2034 2946011593
2035 2946029487
2036 2947236076
2037 2952254376
2038 2969080656
2039 2969305737
2040 2971822030
2041 2974292637
2042 2974299112
2043 2974315370
2044 2974439908
2045 2978978318
2046 2984291229
2047 2984495356
2048 2984501425
2049 2984507932
2050 2984563097
2051 2984601155
2052 2988733016
2053 2990200462
2054 2990265067
2055 2998141177
2056 2998348361
2057 3000377926
2058 3007253886
2059 3007317373
2060 3007400329
2061 3007420809
2062 3007512551
2063 3007618210
2064 3007623005
2065 3007720905
2066 3007808667
2067 3007860474
2068 3007863601
2069 3007871372
2070 3007874468
2071 637318547
2072 640487525
2073 640936343
2074 651175466
2075 8002745902
2076 8004597714
2077 8011356803
2078 8015397491
2079 8015689034
2080 8016729902
2081 8016734711
2082 8018226096
2083 8018405945
2084 8019503826
2085 8019508521
2086 8019773413
2087 8019776724
2088 8029999587
2089 8034964065
2090 8052495803
2091 8054285566
2092 8054348314
2093 8054359585
2094 8054504827
2095 8054847809
2096 8054853478
2097 8054929612
2098 8055088791
2099 8055097087
2100 8055101059
2101 8055694728
2102 8055772153
2103 8055819272
2104 8055884328
2105 8056120135
2106 8056121982
2107 8056127255
2108 8056133190
2109 8056141749
2110 8056147801
2111 8056149438
2112 8056159593
2113 8056164600
2114 8056169877
2115 8056176004
2116 8056180406
2117 8056569828
2118 8057163175
2119 8057304976
2120 8057803442

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00140

Sigma70_r1_2

Sigma-70 factor, region 1.2

85

118

0.97

PF04539

Sigma70_r3

Sigma-70 region 3

202

279

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

123

193

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

291

344

0.96

Map