F489267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1060 | 716 | 2120 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10024353|Ga0157373_100243532 |
| Length | 358 |
| Sequence | MLPRRSAHQGLLVELSKGRNNKMALNTKAAPEFDIDEEVLLMEPDIDLDEADDKAATAKVATRSKAKQPNGSKQHKYIDYTRALDATQLYLNEIGFSPLLTPEEEVFFARLAQKGDPAGRKRMIESNLRLVVKIARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARELTQKLDHEPSPEEIANLLEKPVGEVKRMLGLNERVSSVDVSLGPDSDKTLLDTLTDDRPTDPCELLQDDDLSQSIDQWLSDPTEKQREVVVRRFGLRGHESCTLEEVGQEIGLTRERVRQIQVEALKRLREILEKNGLSADSLFQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 59 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 60 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 134 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 143 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 144 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 149 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 150 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 153 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 154 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 157 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 158 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 161 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 162 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 163 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 164 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 165 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 166 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 167 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 168 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 169 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 170 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 171 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 172 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 173 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 174 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 175 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 176 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 177 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 178 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 181 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 182 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 183 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 184 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 244 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 245 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 246 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 247 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 278 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 279 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 280 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 282 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 283 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 284 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 285 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 286 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 287 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 288 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 289 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 290 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 291 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 292 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 293 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 294 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 295 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 296 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 297 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 298 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 299 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 300 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 301 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 302 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 303 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 304 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 305 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 306 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 307 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 308 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 309 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 310 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 311 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 312 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 313 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 314 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 315 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 316 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 317 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 318 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 319 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 320 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 321 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 322 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 323 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 324 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 325 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 326 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 327 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 328 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 329 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 330 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 331 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 332 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 333 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 334 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 335 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 336 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 337 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 338 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 339 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 340 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 341 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 342 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 343 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 344 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 345 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 346 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 347 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 348 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 349 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 350 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 351 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 352 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 353 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 354 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 355 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 356 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 357 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 358 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 359 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 360 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 361 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 362 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 363 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 364 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 365 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 366 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 367 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 368 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 369 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 370 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 371 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 372 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 373 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 374 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 375 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 376 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 377 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 378 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 379 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 380 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 381 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 382 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 383 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 384 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 385 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 386 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 387 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 388 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 389 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 390 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 391 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 392 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 393 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 394 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 395 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 396 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 397 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 398 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 399 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 400 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 401 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 402 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 403 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 404 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 405 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 406 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 407 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 408 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 409 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 410 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 411 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 412 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 413 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 414 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 415 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 416 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 417 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 418 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 419 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 420 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 421 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 422 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 423 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 424 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 425 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 426 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 427 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 428 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 429 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 430 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 431 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 432 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 433 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 434 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 435 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 436 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 437 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 438 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 439 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 440 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 441 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 442 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 443 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 444 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 445 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 446 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 447 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 448 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 449 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 450 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 451 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 452 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 453 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 454 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 455 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 456 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 457 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 458 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 459 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 460 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 461 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 462 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 463 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 464 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 465 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 466 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 467 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 468 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 469 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 470 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 471 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 472 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 473 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 474 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 475 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 476 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 477 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 478 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 479 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 480 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 481 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 482 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 483 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 484 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 485 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 486 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 487 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 488 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 489 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 490 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 491 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 492 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 493 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 494 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 495 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 496 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 497 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 498 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 499 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 500 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 501 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 502 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 503 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 504 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 505 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 506 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 507 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 508 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 509 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 510 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 511 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 512 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 513 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 514 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 515 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 516 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 517 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 518 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 519 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 520 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 521 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 522 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 523 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 524 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 525 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 526 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 527 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 528 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 529 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 530 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 531 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 532 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 533 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 534 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 535 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 536 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 537 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 538 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 539 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 540 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 541 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 542 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 543 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 544 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 545 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 546 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 547 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 548 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 549 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 550 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 551 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 552 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 553 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 554 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 555 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 556 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 557 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 558 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 559 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 560 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 561 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 562 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 563 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 564 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 565 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 566 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 567 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 568 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 569 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 570 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 571 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 572 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 573 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 574 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 575 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 576 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 577 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 578 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 579 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 580 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 581 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 582 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 583 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 584 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 585 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 586 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 587 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 588 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 589 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 590 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 591 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 592 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 593 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 594 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 595 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 596 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 597 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 598 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 599 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 600 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 601 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 602 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 603 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 604 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 605 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 606 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 607 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 608 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 609 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 610 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 611 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 612 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 613 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 614 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 615 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 616 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 617 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 618 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 619 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 620 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 621 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 622 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 623 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 624 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 625 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 626 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 627 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 628 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 629 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 630 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 631 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 632 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 633 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 634 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 635 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 636 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 637 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 638 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 639 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 640 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 641 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 642 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 643 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 644 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 645 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 646 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 647 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 648 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 649 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 650 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 651 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 652 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 653 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 654 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 655 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 656 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 657 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 658 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 659 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 660 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 661 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 662 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 663 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 664 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 665 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 666 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 667 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 668 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 669 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 670 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 671 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 672 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 673 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 674 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 675 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 676 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 677 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 678 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 679 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 680 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 681 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 682 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 683 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 684 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 685 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 686 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 687 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 688 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 689 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 690 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 691 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 692 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 693 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 694 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 695 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 696 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 697 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 698 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 699 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 700 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 701 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 702 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 703 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 704 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 705 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 706 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 707 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 708 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 709 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 710 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 711 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 712 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 713 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 714 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 715 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 716 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 58.3 |
| Metatranscriptomes | 0.57 |
| Isolates | 41.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0.09 |
| Endosphere | 7.45 |
| Nodule | 2.83 |
| Rhizoplane | 12.17 |
| Rhizosphere | 59.34 |
| Stem | 0.09 |
| Stem Tuber | 0.57 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10024353 | 3300013100 | Bacteria | 4386 |
| 2 | MRS2a_Contig_5 | 2124908027 | Bacteria | 78295 |
| 3 | SwRhRL2b_contig_195785 | 2162886007 | Bacteria | 2174 |
| 4 | JGI25162J39368_1000314 | 3300002737 | Bacteria | 42959 |
| 5 | JGI25162J39368_1000320 | 3300002737 | Bacteria | 42271 |
| 6 | JGI25154J39366_1002279 | 3300002738 | Bacteria | 5188 |
| 7 | JGI25163J39215_1003232 | 3300002771 | Bacteria | 1371 |
| 8 | JGI25163J39215_1003241 | 3300002771 | Bacteria | 1366 |
| 9 | JGI25164J39214_1000233 | 3300002772 | Bacteria | 42959 |
| 10 | JGI25164J39214_1000237 | 3300002772 | Bacteria | 42271 |
| 11 | JGI25165J46597_1000429 | 3300003214 | Bacteria | 42959 |
| 12 | JGI25165J46597_1000437 | 3300003214 | Bacteria | 42271 |
| 13 | Ga0006758J48902_1023556 | 3300003300 | Bacteria | 1446 |
| 14 | rootH1_10069926 | 3300003316 | Bacteria | 3973 |
| 15 | rootL2_10048495 | 3300003322 | Bacteria | 5584 |
| 16 | rootH1_10014691 | 3300003323 | Bacteria | 26302 |
| 17 | rootH1_10130777 | 3300003323 | Bacteria | 9742 |
| 18 | Ga0007410J51695_1042200 | 3300003574 | Bacteria | 1438 |
| 19 | Ga0007409J51694_1037896 | 3300003575 | Bacteria | 1449 |
| 20 | Ga0055538_1000096 | 3300003751 | Bacteria | 73286 |
| 21 | Ga0055539_1000142 | 3300003752 | Bacteria | 73286 |
| 22 | Ga0055533_1000146 | 3300003756 | Bacteria | 73286 |
| 23 | Ga0055532_1000132 | 3300003758 | Bacteria | 73282 |
| 24 | Ga0055525_1000226 | 3300003759 | Bacteria | 61151 |
| 25 | Ga0055536_1000217 | 3300003781 | Bacteria | 47045 |
| 26 | Ga0055536_1014192 | 3300003781 | Bacteria | 2816 |
| 27 | Ga0055536_1014380 | 3300003781 | Bacteria | 2784 |
| 28 | Ga0055530_10001975 | 3300003791 | Bacteria | 13943 |
| 29 | Ga0055530_10003100 | 3300003791 | Bacteria | 9849 |
| 30 | Ga0055530_10016500 | 3300003791 | Bacteria | 2357 |
| 31 | Ga0055530_10017736 | 3300003791 | Bacteria | 2217 |
| 32 | Ga0055540_1001484 | 3300003792 | Bacteria | 13943 |
| 33 | Ga0055540_1002192 | 3300003792 | Bacteria | 10618 |
| 34 | Ga0055540_1002238 | 3300003792 | Bacteria | 10474 |
| 35 | Ga0055531_10000642 | 3300003794 | Bacteria | 30171 |
| 36 | Ga0055541_1000096 | 3300003841 | Bacteria | 73286 |
| 37 | Ga0065714_10001187 | 3300005288 | Bacteria | 1507 |
| 38 | Ga0065714_10012277 | 3300005288 | Bacteria | 1824 |
| 39 | Ga0065714_10012898 | 3300005288 | Bacteria | 1877 |
| 40 | Ga0065714_10067066 | 3300005288 | Bacteria | 5934 |
| 41 | Ga0065714_10069591 | 3300005288 | Bacteria | 4167 |
| 42 | Ga0065714_10093548 | 3300005288 | Bacteria | 1842 |
| 43 | Ga0065714_10093894 | 3300005288 | Bacteria | 1833 |
| 44 | Ga0065704_10000775 | 3300005289 | Bacteria | 13484 |
| 45 | Ga0065704_10071509 | 3300005289 | Bacteria | 10859 |
| 46 | Ga0065704_10095265 | 3300005289 | Bacteria | 2496 |
| 47 | Ga0065704_10203247 | 3300005289 | Bacteria | 1137 |
| 48 | Ga0065712_10000443 | 3300005290 | Bacteria | 14297 |
| 49 | Ga0065712_10074620 | 3300005290 | Bacteria | 4050 |
| 50 | Ga0065715_10092878 | 3300005293 | Bacteria | 4894 |
| 51 | Ga0070670_100000015 | 3300005331 | Bacteria | 228819 |
| 52 | Ga0070670_100123128 | 3300005331 | Bacteria | 2237 |
| 53 | Ga0070670_100339935 | 3300005331 | Bacteria | 1317 |
| 54 | Ga0070687_100012310 | 3300005343 | Bacteria | 3774 |
| 55 | Ga0070661_100000306 | 3300005344 | Bacteria | 39537 |
| 56 | Ga0070669_100002434 | 3300005353 | Bacteria | 13479 |
| 57 | Ga0070669_100026832 | 3300005353 | Bacteria | 4145 |
| 58 | Ga0070669_100140820 | 3300005353 | Bacteria | 1859 |
| 59 | Ga0070671_100000240 | 3300005355 | Bacteria | 36919 |
| 60 | Ga0070671_100027037 | 3300005355 | Bacteria | 4720 |
| 61 | Ga0070688_100019396 | 3300005365 | Bacteria | 3939 |
| 62 | Ga0070659_100555513 | 3300005366 | Bacteria | 983 |
| 63 | Ga0070667_100000015 | 3300005367 | Bacteria | 238203 |
| 64 | Ga0070662_100000360 | 3300005457 | Bacteria | 27248 |
| 65 | Ga0070685_10000004 | 3300005466 | Bacteria | 246215 |
| 66 | Ga0068853_100028026 | 3300005539 | Bacteria | 4737 |
| 67 | Ga0070665_100012700 | 3300005548 | Bacteria | 8481 |
| 68 | Ga0070664_100000741 | 3300005564 | Bacteria | 25147 |
| 69 | Ga0068854_100028524 | 3300005578 | Bacteria | 3858 |
| 70 | Ga0068859_100008057 | 3300005617 | Bacteria | 10682 |
| 71 | Ga0068864_100000072 | 3300005618 | Bacteria | 110066 |
| 72 | Ga0068851_10000019 | 3300005834 | Bacteria | 135877 |
| 73 | Ga0068858_100052905 | 3300005842 | Bacteria | 3757 |
| 74 | Ga0068860_100000271 | 3300005843 | Bacteria | 75530 |
| 75 | Ga0068862_100003971 | 3300005844 | Bacteria | 12558 |
| 76 | Ga0075365_10000215 | 3300006038 | Bacteria | 19419 |
| 77 | Ga0075368_10008663 | 3300006042 | Bacteria | 3632 |
| 78 | Ga0075363_100020069 | 3300006048 | Bacteria | 3348 |
| 79 | Ga0075364_10000013 | 3300006051 | Bacteria | 58691 |
| 80 | Ga0075364_10006085 | 3300006051 | Bacteria | 7070 |
| 81 | Ga0075364_10062654 | 3300006051 | Bacteria | 2440 |
| 82 | Ga0075432_10009154 | 3300006058 | Bacteria | 3374 |
| 83 | Ga0075432_10024776 | 3300006058 | Bacteria | 2057 |
| 84 | Ga0075432_10033157 | 3300006058 | Bacteria | 1790 |
| 85 | Ga0075432_10056460 | 3300006058 | Bacteria | 1392 |
| 86 | Ga0075369_10001215 | 3300006186 | Bacteria | 8729 |
| 87 | Ga0075369_10058267 | 3300006186 | Bacteria | 1682 |
| 88 | Ga0075370_10000352 | 3300006353 | Bacteria | 16746 |
| 89 | Ga0075429_100086097 | 3300006880 | Bacteria | 2739 |
| 90 | Ga0097620_100008057 | 3300006931 | Bacteria | 10682 |
| 91 | Ga0099823_1000119 | 3300006944 | Bacteria | 39691 |
| 92 | Ga0079104_1001155 | 3300006946 | Bacteria | 19100 |
| 93 | Ga0079104_1005472 | 3300006946 | Bacteria | 5063 |
| 94 | Ga0099826_10000860 | 3300006948 | Bacteria | 16486 |
| 95 | Ga0105251_10000444 | 3300009011 | Bacteria | 40000 |
| 96 | Ga0105251_10000619 | 3300009011 | Bacteria | 32604 |
| 97 | Ga0105251_10001959 | 3300009011 | Bacteria | 16837 |
| 98 | Ga0105251_10003015 | 3300009011 | Bacteria | 12560 |
| 99 | Ga0105251_10036856 | 3300009011 | Bacteria | 2403 |
| 100 | Ga0105251_10054942 | 3300009011 | Bacteria | 1889 |
| 101 | Ga0105251_10083711 | 3300009011 | Bacteria | 1472 |
| 102 | Ga0105251_10093823 | 3300009011 | Bacteria | 1377 |
| 103 | Ga0105251_10096447 | 3300009011 | Bacteria | 1354 |
| 104 | Ga0105251_10099770 | 3300009011 | Bacteria | 1327 |
| 105 | Ga0105244_10005246 | 3300009036 | Bacteria | 8651 |
| 106 | Ga0105244_10006585 | 3300009036 | Bacteria | 7491 |
| 107 | Ga0105244_10011745 | 3300009036 | Bacteria | 5225 |
| 108 | Ga0105244_10024956 | 3300009036 | Bacteria | 3256 |
| 109 | Ga0105244_10026994 | 3300009036 | Bacteria | 3100 |
| 110 | Ga0105244_10045749 | 3300009036 | Bacteria | 2250 |
| 111 | Ga0105244_10079052 | 3300009036 | Bacteria | 1630 |
| 112 | Ga0105250_10000959 | 3300009092 | Bacteria | 16902 |
| 113 | Ga0105250_10034463 | 3300009092 | Bacteria | 2032 |
| 114 | Ga0105250_10039494 | 3300009092 | Bacteria | 1892 |
| 115 | Ga0105250_10041579 | 3300009092 | Bacteria | 1843 |
| 116 | Ga0105250_10071275 | 3300009092 | Bacteria | 1403 |
| 117 | Ga0105250_10079982 | 3300009092 | Bacteria | 1324 |
| 118 | Ga0105243_10003511 | 3300009148 | Bacteria | 12664 |
| 119 | Ga0105243_10087600 | 3300009148 | Bacteria | 2556 |
| 120 | Ga0105243_10096687 | 3300009148 | Bacteria | 2443 |
| 121 | Ga0105243_10117689 | 3300009148 | Bacteria | 2234 |
| 122 | Ga0105242_10001061 | 3300009176 | Bacteria | 21612 |
| 123 | Ga0105242_10079122 | 3300009176 | Bacteria | 2745 |
| 124 | Ga0105237_10002041 | 3300009545 | Bacteria | 25677 |
| 125 | Ga0105249_10053921 | 3300009553 | Bacteria | 3676 |
| 126 | Ga0105249_10097866 | 3300009553 | Bacteria | 2755 |
| 127 | Ga0105246_10001083 | 3300011119 | Bacteria | 15751 |
| 128 | Ga0105246_10001761 | 3300011119 | Bacteria | 12951 |
| 129 | Ga0105246_10094363 | 3300011119 | Bacteria | 2164 |
| 130 | Ga0157345_1000607 | 3300012498 | Bacteria | 3052 |
| 131 | Ga0157373_10029248 | 3300013100 | Bacteria | 3970 |
| 132 | Ga0157371_10005548 | 3300013102 | Bacteria | 10613 |
| 133 | Ga0157371_10006276 | 3300013102 | Bacteria | 9843 |
| 134 | Ga0157371_10012444 | 3300013102 | Bacteria | 6503 |
| 135 | Ga0157371_10016653 | 3300013102 | Bacteria | 5479 |
| 136 | Ga0157370_10001690 | 3300013104 | Bacteria | 27178 |
| 137 | Ga0157370_10125089 | 3300013104 | Bacteria | 2400 |
| 138 | Ga0157378_10026399 | 3300013297 | Bacteria | 5120 |
| 139 | Ga0163162_10289801 | 3300013306 | Bacteria | 1769 |
| 140 | Ga0157372_10000663 | 3300013307 | Bacteria | 37808 |
| 141 | Ga0157372_10033882 | 3300013307 | Bacteria | 5613 |
| 142 | Ga0163163_10000118 | 3300014325 | Bacteria | 84379 |
| 143 | Ga0182008_10002900 | 3300014497 | Bacteria | 10613 |
| 144 | Ga0182008_10051446 | 3300014497 | Bacteria | 2043 |
| 145 | Ga0182008_10088693 | 3300014497 | Bacteria | 1524 |
| 146 | Ga0157376_10457540 | 3300014969 | Bacteria | 1246 |
| 147 | Ga0182006_1003483 | 3300015261 | Bacteria | 8034 |
| 148 | Ga0182006_1040520 | 3300015261 | Bacteria | 1833 |
| 149 | Ga0182006_1055610 | 3300015261 | Bacteria | 1510 |
| 150 | Ga0182007_10001511 | 3300015262 | Bacteria | 12420 |
| 151 | Ga0182005_1019757 | 3300015265 | Bacteria | 1855 |
| 152 | Ga0213872_10002808 | 3300021361 | Bacteria | 9962 |
| 153 | Ga0213872_10003010 | 3300021361 | Bacteria | 9526 |
| 154 | Ga0213872_10003822 | 3300021361 | Bacteria | 8203 |
| 155 | Ga0213872_10004946 | 3300021361 | Bacteria | 6930 |
| 156 | Ga0209435_100393 | 3300025206 | Bacteria | 9481 |
| 157 | Ga0209760_100021 | 3300025207 | Bacteria | 163688 |
| 158 | Ga0209760_100046 | 3300025207 | Bacteria | 107840 |
| 159 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 160 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 161 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 162 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 163 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 164 | Ga0209563_101829 | 3300025230 | Bacteria | 5242 |
| 165 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 166 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 167 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 168 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 169 | Ga0209437_102448 | 3300025233 | Bacteria | 3601 |
| 170 | Ga0209258_100824 | 3300025242 | Bacteria | 17348 |
| 171 | Ga0209646_1000220 | 3300025246 | Bacteria | 61752 |
| 172 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 173 | Ga0209759_1004898 | 3300025256 | Bacteria | 4848 |
| 174 | Ga0209759_1005930 | 3300025256 | Bacteria | 4175 |
| 175 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 176 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 177 | Ga0209675_1001096 | 3300025291 | Bacteria | 16643 |
| 178 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 179 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 180 | Ga0209676_1000397 | 3300025292 | Bacteria | 79463 |
| 181 | Ga0209676_1015743 | 3300025292 | Bacteria | 2768 |
| 182 | Ga0209050_1000208 | 3300025298 | Bacteria | 131310 |
| 183 | Ga0209050_1001191 | 3300025298 | Bacteria | 30589 |
| 184 | Ga0209050_1001235 | 3300025298 | Bacteria | 29568 |
| 185 | Ga0209050_1002753 | 3300025298 | Bacteria | 14150 |
| 186 | Ga0209051_1000219 | 3300025303 | Bacteria | 96484 |
| 187 | Ga0209051_1000498 | 3300025303 | Bacteria | 50496 |
| 188 | Ga0209051_1000879 | 3300025303 | Bacteria | 30297 |
| 189 | Ga0209257_1000342 | 3300025304 | Bacteria | 97045 |
| 190 | Ga0209257_1008743 | 3300025304 | Bacteria | 5638 |
| 191 | Ga0207656_10000042 | 3300025321 | Bacteria | 53832 |
| 192 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 193 | Ga0207696_1000141 | 3300025711 | Bacteria | 127091 |
| 194 | Ga0207696_1000164 | 3300025711 | Bacteria | 106057 |
| 195 | Ga0207696_1000604 | 3300025711 | Bacteria | 27037 |
| 196 | Ga0207696_1001566 | 3300025711 | Bacteria | 12170 |
| 197 | Ga0207696_1006225 | 3300025711 | Bacteria | 4836 |
| 198 | Ga0207696_1014133 | 3300025711 | Bacteria | 2749 |
| 199 | Ga0207696_1021239 | 3300025711 | Bacteria | 2082 |
| 200 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 201 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 202 | Ga0207655_1000488 | 3300025728 | Bacteria | 51094 |
| 203 | Ga0207655_1001023 | 3300025728 | Bacteria | 28252 |
| 204 | Ga0207655_1001253 | 3300025728 | Bacteria | 24224 |
| 205 | Ga0207655_1002739 | 3300025728 | Bacteria | 13759 |
| 206 | Ga0207655_1009566 | 3300025728 | Bacteria | 6005 |
| 207 | Ga0207655_1012134 | 3300025728 | Bacteria | 5064 |
| 208 | Ga0207655_1017526 | 3300025728 | Bacteria | 3858 |
| 209 | Ga0207655_1017992 | 3300025728 | Bacteria | 3778 |
| 210 | Ga0207655_1021544 | 3300025728 | Bacteria | 3267 |
| 211 | Ga0207655_1033900 | 3300025728 | Bacteria | 2305 |
| 212 | Ga0207655_1035374 | 3300025728 | Bacteria | 2231 |
| 213 | Ga0207655_1038488 | 3300025728 | Bacteria | 2090 |
| 214 | Ga0207713_1000085 | 3300025735 | Bacteria | 160800 |
| 215 | Ga0207713_1000098 | 3300025735 | Bacteria | 143900 |
| 216 | Ga0207713_1000338 | 3300025735 | Bacteria | 51882 |
| 217 | Ga0207713_1000751 | 3300025735 | Bacteria | 30209 |
| 218 | Ga0207713_1000843 | 3300025735 | Bacteria | 28206 |
| 219 | Ga0207713_1002039 | 3300025735 | Bacteria | 15121 |
| 220 | Ga0207713_1005190 | 3300025735 | Bacteria | 8224 |
| 221 | Ga0207713_1006982 | 3300025735 | Bacteria | 6768 |
| 222 | Ga0207713_1008734 | 3300025735 | Bacteria | 5783 |
| 223 | Ga0207713_1032973 | 3300025735 | Bacteria | 2268 |
| 224 | Ga0207713_1059199 | 3300025735 | Bacteria | 1471 |
| 225 | Ga0207713_1063976 | 3300025735 | Bacteria | 1387 |
| 226 | Ga0207710_10058597 | 3300025900 | Bacteria | 1742 |
| 227 | Ga0207671_10000420 | 3300025914 | Bacteria | 58883 |
| 228 | Ga0207662_10067998 | 3300025918 | Bacteria | 2150 |
| 229 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 230 | Ga0207681_10002129 | 3300025923 | Bacteria | 12641 |
| 231 | Ga0207681_10402761 | 3300025923 | Bacteria | 1105 |
| 232 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 233 | Ga0207650_10000606 | 3300025925 | Bacteria | 28719 |
| 234 | Ga0207650_10045152 | 3300025925 | Bacteria | 3241 |
| 235 | Ga0207644_10000015 | 3300025931 | Bacteria | 179880 |
| 236 | Ga0207706_10007522 | 3300025933 | Bacteria | 10079 |
| 237 | Ga0207709_10000228 | 3300025935 | Bacteria | 70988 |
| 238 | Ga0207709_10000510 | 3300025935 | Bacteria | 34223 |
| 239 | Ga0207709_10034056 | 3300025935 | Bacteria | 2998 |
| 240 | Ga0207711_10000103 | 3300025941 | Bacteria | 90172 |
| 241 | Ga0207711_10000277 | 3300025941 | Bacteria | 55359 |
| 242 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 243 | Ga0207712_10029560 | 3300025961 | Bacteria | 3677 |
| 244 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 245 | Ga0207703_10027118 | 3300026035 | Bacteria | 4511 |
| 246 | Ga0207639_10013206 | 3300026041 | Bacteria | 5774 |
| 247 | Ga0207641_10034212 | 3300026088 | Bacteria | 4225 |
| 248 | Ga0207641_10037311 | 3300026088 | Bacteria | 4057 |
| 249 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 250 | Ga0207674_10391280 | 3300026116 | Bacteria | 1344 |
| 251 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 252 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 253 | Ga0209281_1003287 | 3300027111 | Bacteria | 5470 |
| 254 | Ga0209389_1000205 | 3300027296 | Bacteria | 42388 |
| 255 | Ga0209371_1000165 | 3300027312 | Bacteria | 100598 |
| 256 | Ga0209371_1000584 | 3300027312 | Bacteria | 32775 |
| 257 | Ga0209371_1024188 | 3300027312 | Bacteria | 1417 |
| 258 | Ga0209981_1005160 | 3300027378 | Bacteria | 1728 |
| 259 | Ga0209996_1003171 | 3300027395 | Bacteria | 2058 |
| 260 | Ga0209984_1001385 | 3300027424 | Bacteria | 2624 |
| 261 | Ga0209995_1002255 | 3300027471 | Bacteria | 3037 |
| 262 | Ga0209968_1007756 | 3300027526 | Bacteria | 1627 |
| 263 | Ga0210002_1001652 | 3300027617 | Bacteria | 3177 |
| 264 | Ga0209983_1000260 | 3300027665 | Bacteria | 10898 |
| 265 | Ga0209282_1017939 | 3300027666 | Bacteria | 4497 |
| 266 | Ga0209971_1000463 | 3300027682 | Bacteria | 10788 |
| 267 | Ga0209813_10006508 | 3300027866 | Bacteria | 2889 |
| 268 | Ga0207428_10137455 | 3300027907 | Bacteria | 1868 |
| 269 | Ga0207428_10176571 | 3300027907 | Bacteria | 1615 |
| 270 | Ga0207428_10254512 | 3300027907 | Bacteria | 1309 |
| 271 | Ga0207428_10318293 | 3300027907 | Bacteria | 1149 |
| 272 | Ga0268266_10011036 | 3300028379 | Bacteria | 7864 |
| 273 | Ga0268266_10262646 | 3300028379 | Bacteria | 1600 |
| 274 | Ga0268265_10002237 | 3300028380 | Bacteria | 14847 |
| 275 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 276 | Ga0307517_10175495 | 3300028786 | Bacteria | 1397 |
| 277 | Ga0268256_1000112 | 3300030500 | Bacteria | 118510 |
| 278 | Ga0268256_1000436 | 3300030500 | Bacteria | 37153 |
| 279 | Ga0268256_1027483 | 3300030500 | Bacteria | 1417 |
| 280 | Ga0316179_1077882 | 3300030734 | Bacteria | 2571 |
| 281 | Ga0316178_1009525 | 3300030735 | Bacteria | 55280 |
| 282 | Ga0316181_1106926 | 3300030744 | Bacteria | 3102 |
| 283 | Ga0265331_10019849 | 3300031250 | Bacteria | 3462 |
| 284 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 285 | Ga0265327_10000170 | 3300031251 | Bacteria | 140044 |
| 286 | Ga0307408_100000042 | 3300031548 | Bacteria | 172505 |
| 287 | Ga0307408_100002417 | 3300031548 | Bacteria | 13144 |
| 288 | Ga0307408_100002567 | 3300031548 | Bacteria | 12662 |
| 289 | Ga0316576_10025351 | 3300031727 | Bacteria | 4150 |
| 290 | Ga0316578_10126639 | 3300031728 | Bacteria | 1536 |
| 291 | Ga0316577_10095962 | 3300031733 | Bacteria | 1661 |
| 292 | Ga0316577_10145087 | 3300031733 | Bacteria | 1337 |
| 293 | Ga0307406_10001355 | 3300031901 | Bacteria | 13719 |
| 294 | Ga0307406_10086930 | 3300031901 | Bacteria | 2095 |
| 295 | Ga0307414_10008646 | 3300032004 | Bacteria | 5792 |
| 296 | Ga0316585_10018592 | 3300032137 | Bacteria | 2111 |
| 297 | Ga0316587_1008417 | 3300033529 | Bacteria | 1620 |
| 298 | Ga0316587_1010941 | 3300033529 | Bacteria | 1458 |
| 299 | Ga0373960_0005597 | 3300035121 | Bacteria | 2919 |
| 300 | Ga0316574_0017625 | 3300035398 | Bacteria | 4183 |
| 301 | Ga0316574_0136801 | 3300035398 | Bacteria | 1577 |
| 302 | Ga0316582_0004214 | 3300036647 | Bacteria | 7216 |
| 303 | Ga0316582_0293491 | 3300036647 | Bacteria | 1117 |
| 304 | Ga0316584_0024150 | 3300036712 | Bacteria | 4447 |
| 305 | Ga0316584_0077921 | 3300036712 | Bacteria | 2482 |
| 306 | Ga0395900_0029706 | 3300037418 | Bacteria | 5609 |
| 307 | Ga0400483_022490 | 3300039062 | Bacteria | 18816 |
| 308 | Ga0400483_026308 | 3300039062 | Bacteria | 223136 |
| 309 | Ga0400483_077384 | 3300039062 | Bacteria | 6478 |
| 310 | Ga0400483_116699 | 3300039062 | Bacteria | 1333 |
| 311 | Ga0400483_235996 | 3300039062 | Bacteria | 4512 |
| 312 | Ga0400483_249072 | 3300039062 | Bacteria | 19418 |
| 313 | Ga0400483_250036 | 3300039062 | Bacteria | 396353 |
| 314 | Ga0400487_52686 | 3300039110 | Bacteria | 5081 |
| 315 | Ga0436361_0052642 | 3300039447 | Bacteria | 25463 |
| 316 | Ga0436361_0777562 | 3300039447 | Bacteria | 10245 |
| 317 | Ga0436361_0891393 | 3300039447 | Bacteria | 99242 |
| 318 | Ga0439436_0000093 | 3300041404 | Bacteria | 21035 |
| 319 | Ga0439436_0000606 | 3300041404 | Bacteria | 9491 |
| 320 | Ga0439438_002379 | 3300041405 | Bacteria | 8020 |
| 321 | Ga0439438_002924 | 3300041405 | Bacteria | 7092 |
| 322 | Ga0439438_003070 | 3300041405 | Bacteria | 6866 |
| 323 | Ga0439438_006968 | 3300041405 | Bacteria | 3919 |
| 324 | Ga0439447_000651 | 3300041407 | Bacteria | 12896 |
| 325 | Ga0439447_005171 | 3300041407 | Bacteria | 4370 |
| 326 | Ga0439447_026562 | 3300041407 | Bacteria | 1484 |
| 327 | Ga0439466_0000870 | 3300041411 | Bacteria | 11526 |
| 328 | Ga0439466_0012474 | 3300041411 | Bacteria | 3129 |
| 329 | Ga0439466_0030953 | 3300041411 | Bacteria | 1832 |
| 330 | Ga0451807_1403825 | 3300041486 | Bacteria | 1196 |
| 331 | Ga0439437_000719 | 3300042000 | Bacteria | 3342 |
| 332 | Ga0439432_013881 | 3300042006 | Bacteria | 2731 |
| 333 | Ga0439432_039883 | 3300042006 | Bacteria | 1491 |
| 334 | Ga0439451_001040 | 3300042009 | Bacteria | 5400 |
| 335 | Ga0439451_015030 | 3300042009 | Bacteria | 1560 |
| 336 | Ga0439452_002393 | 3300042010 | Bacteria | 6953 |
| 337 | Ga0439452_002554 | 3300042010 | Bacteria | 6688 |
| 338 | Ga0439452_015295 | 3300042010 | Bacteria | 2110 |
| 339 | Ga0439456_000224 | 3300042013 | Bacteria | 15438 |
| 340 | Ga0439463_000713 | 3300042016 | Bacteria | 9201 |
| 341 | Ga0439463_014393 | 3300042016 | Bacteria | 1949 |
| 342 | Ga0450911_000005 | 3300042115 | Bacteria | 233469 |
| 343 | Ga0450900_003653 | 3300042136 | Bacteria | 1720 |
| 344 | Ga0450904_000002 | 3300042139 | Bacteria | 82376 |
| 345 | Ga0450905_000063 | 3300042142 | Bacteria | 9811 |
| 346 | Ga0450907_001644 | 3300042146 | Bacteria | 4680 |
| 347 | Ga0439446_0001114 | 3300042156 | Bacteria | 5947 |
| 348 | Ga0439446_0001152 | 3300042156 | Bacteria | 5867 |
| 349 | Ga0439446_0006551 | 3300042156 | Bacteria | 3042 |
| 350 | Ga0450908_001752 | 3300042184 | Bacteria | 4231 |
| 351 | Ga0439434_0001359 | 3300042435 | Bacteria | 7046 |
| 352 | Ga0439464_0000031 | 3300042439 | Bacteria | 17710 |
| 353 | Ga0439464_0012859 | 3300042439 | Bacteria | 2234 |
| 354 | Ga0439460_0002293 | 3300042461 | Bacteria | 4602 |
| 355 | Ga0439460_0004649 | 3300042461 | Bacteria | 3349 |
| 356 | Ga0450901_000289 | 3300042533 | Bacteria | 6122 |
| 357 | Ga0451577_0168843 | 3300042876 | Bacteria | 1971 |
| 358 | Ga0466969_0001528 | 3300044656 | Bacteria | 12438 |
| 359 | Ga0466965_0002201 | 3300044683 | Bacteria | 8204 |
| 360 | Ga0466966_0003088 | 3300044684 | Bacteria | 10973 |
| 361 | Ga0466961_0001154 | 3300044693 | Bacteria | 16232 |
| 362 | Ga0453684_0000211 | 3300044712 | Bacteria | 254993 |
| 363 | Ga0453684_0568292 | 3300044712 | Bacteria | 1247 |
| 364 | Ga0466959_0088268 | 3300045049 | Bacteria | 2229 |
| 365 | Ga0451576_0000234 | 3300045051 | Bacteria | 135387 |
| 366 | Ga0495627_001316 | 3300046453 | Bacteria | 15137 |
| 367 | Ga0495627_029273 | 3300046453 | Bacteria | 1753 |
| 368 | Ga0495591_000212 | 3300046458 | Bacteria | 58623 |
| 369 | Ga0495591_000849 | 3300046458 | Bacteria | 21493 |
| 370 | Ga0495591_001650 | 3300046458 | Bacteria | 13441 |
| 371 | Ga0495591_002049 | 3300046458 | Bacteria | 11685 |
| 372 | Ga0495591_002381 | 3300046458 | Bacteria | 10546 |
| 373 | Ga0495591_006498 | 3300046458 | Bacteria | 5161 |
| 374 | Ga0495591_009341 | 3300046458 | Bacteria | 3906 |
| 375 | Ga0495591_020376 | 3300046458 | Bacteria | 2192 |
| 376 | Ga0495638_0019589 | 3300046460 | Bacteria | 4475 |
| 377 | Ga0495638_0085174 | 3300046460 | Bacteria | 1912 |
| 378 | Ga0495638_0115396 | 3300046460 | Bacteria | 1591 |
| 379 | Ga0495653_0005238 | 3300046463 | Bacteria | 10546 |
| 380 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 381 | Ga0495650_0000515 | 3300046471 | Bacteria | 57432 |
| 382 | Ga0495650_0001154 | 3300046471 | Bacteria | 28448 |
| 383 | Ga0495650_0007032 | 3300046471 | Bacteria | 6852 |
| 384 | Ga0495650_0089352 | 3300046471 | Bacteria | 1174 |
| 385 | Ga0495605_0000323 | 3300046474 | Bacteria | 49229 |
| 386 | Ga0495605_0000449 | 3300046474 | Bacteria | 36901 |
| 387 | Ga0495605_0000461 | 3300046474 | Bacteria | 36449 |
| 388 | Ga0495605_0001257 | 3300046474 | Bacteria | 16803 |
| 389 | Ga0495605_0001417 | 3300046474 | Bacteria | 15714 |
| 390 | Ga0495605_0050379 | 3300046474 | Bacteria | 2031 |
| 391 | Ga0495605_0057136 | 3300046474 | Bacteria | 1879 |
| 392 | Ga0495605_0089006 | 3300046474 | Bacteria | 1433 |
| 393 | Ga0495584_0013435 | 3300046491 | Bacteria | 4181 |
| 394 | Ga0495584_0022750 | 3300046491 | Bacteria | 3179 |
| 395 | Ga0495585_0003113 | 3300046492 | Bacteria | 11385 |
| 396 | Ga0495585_0009384 | 3300046492 | Bacteria | 5868 |
| 397 | Ga0495585_0039267 | 3300046492 | Bacteria | 2661 |
| 398 | Ga0495596_0000148 | 3300046500 | Bacteria | 48823 |
| 399 | Ga0495596_0030807 | 3300046500 | Bacteria | 2145 |
| 400 | Ga0495607_0000276 | 3300046501 | Bacteria | 55274 |
| 401 | Ga0495607_0000490 | 3300046501 | Bacteria | 39577 |
| 402 | Ga0495607_0000544 | 3300046501 | Bacteria | 36921 |
| 403 | Ga0495607_0000841 | 3300046501 | Bacteria | 29029 |
| 404 | Ga0495607_0005018 | 3300046501 | Bacteria | 9600 |
| 405 | Ga0495607_0020434 | 3300046501 | Bacteria | 4186 |
| 406 | Ga0495607_0063674 | 3300046501 | Bacteria | 2085 |
| 407 | Ga0495607_0077091 | 3300046501 | Bacteria | 1842 |
| 408 | Ga0495607_0098794 | 3300046501 | Bacteria | 1567 |
| 409 | Ga0495607_0122764 | 3300046501 | Bacteria | 1361 |
| 410 | Ga0495583_0000861 | 3300046506 | Bacteria | 36885 |
| 411 | Ga0495583_0000884 | 3300046506 | Bacteria | 36045 |
| 412 | Ga0495583_0002615 | 3300046506 | Bacteria | 15053 |
| 413 | Ga0495583_0004142 | 3300046506 | Bacteria | 10609 |
| 414 | Ga0495583_0004417 | 3300046506 | Bacteria | 10076 |
| 415 | Ga0495606_0000126 | 3300046507 | Bacteria | 129862 |
| 416 | Ga0495606_0001121 | 3300046507 | Bacteria | 38297 |
| 417 | Ga0495606_0001804 | 3300046507 | Bacteria | 27243 |
| 418 | Ga0495606_0002489 | 3300046507 | Bacteria | 21308 |
| 419 | Ga0495606_0006268 | 3300046507 | Bacteria | 11034 |
| 420 | Ga0495606_0012166 | 3300046507 | Bacteria | 6937 |
| 421 | Ga0495606_0016744 | 3300046507 | Bacteria | 5574 |
| 422 | Ga0495606_0023582 | 3300046507 | Bacteria | 4452 |
| 423 | Ga0495610_0003557 | 3300046512 | Bacteria | 12062 |
| 424 | Ga0495610_0013190 | 3300046512 | Bacteria | 4922 |
| 425 | Ga0495616_0035062 | 3300046513 | Bacteria | 2599 |
| 426 | Ga0495616_0096084 | 3300046513 | Bacteria | 1395 |
| 427 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 428 | Ga0495620_0001260 | 3300046515 | Bacteria | 15445 |
| 429 | Ga0495620_0003107 | 3300046515 | Bacteria | 9537 |
| 430 | Ga0495620_0006420 | 3300046515 | Bacteria | 6463 |
| 431 | Ga0495620_0012230 | 3300046515 | Bacteria | 4444 |
| 432 | Ga0495620_0016101 | 3300046515 | Bacteria | 3763 |
| 433 | Ga0495620_0019997 | 3300046515 | Bacteria | 3279 |
| 434 | Ga0495631_0009673 | 3300046518 | Bacteria | 4807 |
| 435 | Ga0495631_0023789 | 3300046518 | Bacteria | 2835 |
| 436 | Ga0495631_0040393 | 3300046518 | Bacteria | 2067 |
| 437 | Ga0495632_0001207 | 3300046519 | Bacteria | 21937 |
| 438 | Ga0495632_0003927 | 3300046519 | Bacteria | 10327 |
| 439 | Ga0495632_0005427 | 3300046519 | Bacteria | 8431 |
| 440 | Ga0495632_0059256 | 3300046519 | Bacteria | 1863 |
| 441 | Ga0495637_0001766 | 3300046520 | Bacteria | 12380 |
| 442 | Ga0495637_0002014 | 3300046520 | Bacteria | 11466 |
| 443 | Ga0495637_0011318 | 3300046520 | Bacteria | 4290 |
| 444 | Ga0495637_0014996 | 3300046520 | Bacteria | 3645 |
| 445 | Ga0495637_0038282 | 3300046520 | Bacteria | 2077 |
| 446 | Ga0495637_0040424 | 3300046520 | Bacteria | 2008 |
| 447 | Ga0495643_0000917 | 3300046522 | Bacteria | 30970 |
| 448 | Ga0495643_0001861 | 3300046522 | Bacteria | 17902 |
| 449 | Ga0495643_0003034 | 3300046522 | Bacteria | 12623 |
| 450 | Ga0495643_0006177 | 3300046522 | Bacteria | 7950 |
| 451 | Ga0495644_0001824 | 3300046523 | Bacteria | 8583 |
| 452 | Ga0495644_0009791 | 3300046523 | Bacteria | 3690 |
| 453 | Ga0495648_0003241 | 3300046524 | Bacteria | 14432 |
| 454 | Ga0495648_0003639 | 3300046524 | Bacteria | 13473 |
| 455 | Ga0495648_0003944 | 3300046524 | Bacteria | 12851 |
| 456 | Ga0495648_0011116 | 3300046524 | Bacteria | 6810 |
| 457 | Ga0495648_0015115 | 3300046524 | Bacteria | 5620 |
| 458 | Ga0495648_0017142 | 3300046524 | Bacteria | 5189 |
| 459 | Ga0495648_0045951 | 3300046524 | Bacteria | 2711 |
| 460 | Ga0495642_0000739 | 3300046528 | Bacteria | 16193 |
| 461 | Ga0495654_0000375 | 3300046530 | Bacteria | 38551 |
| 462 | Ga0495654_0003257 | 3300046530 | Bacteria | 10013 |
| 463 | Ga0495654_0003974 | 3300046530 | Bacteria | 8905 |
| 464 | Ga0495654_0016324 | 3300046530 | Bacteria | 3928 |
| 465 | Ga0495654_0020728 | 3300046530 | Bacteria | 3424 |
| 466 | Ga0495654_0029037 | 3300046530 | Bacteria | 2823 |
| 467 | Ga0495609_0000153 | 3300046538 | Bacteria | 71744 |
| 468 | Ga0495609_0000210 | 3300046538 | Bacteria | 58516 |
| 469 | Ga0495609_0000371 | 3300046538 | Bacteria | 38670 |
| 470 | Ga0495609_0055439 | 3300046538 | Bacteria | 1759 |
| 471 | Ga0495597_0000098 | 3300046542 | Bacteria | 77976 |
| 472 | Ga0495597_0012842 | 3300046542 | Bacteria | 4031 |
| 473 | Ga0495622_0003943 | 3300046557 | Bacteria | 6933 |
| 474 | Ga0495622_0009647 | 3300046557 | Bacteria | 4464 |
| 475 | Ga0495622_0044005 | 3300046557 | Bacteria | 2075 |
| 476 | Ga0495633_0000300 | 3300046558 | Bacteria | 56356 |
| 477 | Ga0495668_0017621 | 3300046616 | Bacteria | 4138 |
| 478 | Ga0495668_0066726 | 3300046616 | Bacteria | 1979 |
| 479 | Ga0495611_0000872 | 3300046648 | Bacteria | 16411 |
| 480 | Ga0495611_0003885 | 3300046648 | Bacteria | 6509 |
| 481 | Ga0495625_0002792 | 3300046660 | Bacteria | 18413 |
| 482 | Ga0495625_0017915 | 3300046660 | Bacteria | 5535 |
| 483 | Ga0495625_0019844 | 3300046660 | Bacteria | 5201 |
| 484 | Ga0495661_0000337 | 3300046665 | Bacteria | 51165 |
| 485 | Ga0495661_0000538 | 3300046665 | Bacteria | 39127 |
| 486 | Ga0495661_0001311 | 3300046665 | Bacteria | 21132 |
| 487 | Ga0495661_0002290 | 3300046665 | Bacteria | 14778 |
| 488 | Ga0495661_0016967 | 3300046665 | Bacteria | 4811 |
| 489 | Ga0495661_0045241 | 3300046665 | Bacteria | 2693 |
| 490 | Ga0495670_0003681 | 3300046691 | Bacteria | 7537 |
| 491 | Ga0495671_0001322 | 3300046692 | Bacteria | 16818 |
| 492 | Ga0495671_0002986 | 3300046692 | Bacteria | 10508 |
| 493 | Ga0495671_0004634 | 3300046692 | Bacteria | 8152 |
| 494 | Ga0495671_0006387 | 3300046692 | Bacteria | 6812 |
| 495 | Ga0495671_0035909 | 3300046692 | Bacteria | 2514 |
| 496 | Ga0495671_0163335 | 3300046692 | Bacteria | 1083 |
| 497 | Ga0495649_0006756 | 3300046694 | Bacteria | 7107 |
| 498 | Ga0495649_0009022 | 3300046694 | Bacteria | 5955 |
| 499 | Ga0495649_0009084 | 3300046694 | Bacteria | 5931 |
| 500 | Ga0495589_0003579 | 3300046794 | Bacteria | 8398 |
| 501 | Ga0495589_0060461 | 3300046794 | Bacteria | 1861 |
| 502 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 503 | Ga0495660_0000879 | 3300046810 | Bacteria | 22220 |
| 504 | Ga0495660_0000911 | 3300046810 | Bacteria | 21797 |
| 505 | Ga0495660_0006749 | 3300046810 | Bacteria | 6773 |
| 506 | Ga0495660_0046791 | 3300046810 | Bacteria | 2371 |
| 507 | Ga0495660_0056203 | 3300046810 | Bacteria | 2127 |
| 508 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 509 | Ga0495672_0004648 | 3300047320 | Bacteria | 11142 |
| 510 | Ga0495672_0009343 | 3300047320 | Bacteria | 7117 |
| 511 | Ga0495672_0009796 | 3300047320 | Bacteria | 6897 |
| 512 | Ga0495672_0014719 | 3300047320 | Bacteria | 5340 |
| 513 | Ga0495672_0015889 | 3300047320 | Bacteria | 5096 |
| 514 | Ga0495676_0000126 | 3300047321 | Bacteria | 58187 |
| 515 | Ga0495680_0019915 | 3300047322 | Bacteria | 5655 |
| 516 | Ga0495683_0000223 | 3300047323 | Bacteria | 53222 |
| 517 | Ga0495683_0000371 | 3300047323 | Bacteria | 36984 |
| 518 | Ga0495683_0003228 | 3300047323 | Bacteria | 9526 |
| 519 | Ga0495683_0013430 | 3300047323 | Bacteria | 4282 |
| 520 | Ga0495683_0024834 | 3300047323 | Bacteria | 3073 |
| 521 | Ga0495675_0070126 | 3300047444 | Bacteria | 2212 |
| 522 | Ga0495679_001295 | 3300047446 | Bacteria | 14582 |
| 523 | Ga0495679_001695 | 3300047446 | Bacteria | 12223 |
| 524 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 525 | Ga0495673_0001897 | 3300047469 | Bacteria | 15655 |
| 526 | Ga0495673_0005418 | 3300047469 | Bacteria | 7714 |
| 527 | Ga0495673_0008585 | 3300047469 | Bacteria | 5724 |
| 528 | Ga0495673_0014761 | 3300047469 | Bacteria | 4051 |
| 529 | Ga0495673_0046063 | 3300047469 | Bacteria | 1934 |
| 530 | Ga0495681_0016053 | 3300047470 | Bacteria | 4218 |
| 531 | Ga0495681_0016475 | 3300047470 | Bacteria | 4139 |
| 532 | Ga0495681_0038268 | 3300047470 | Bacteria | 2352 |
| 533 | Ga0495681_0067105 | 3300047470 | Bacteria | 1635 |
| 534 | Ga0495686_0020807 | 3300047472 | Bacteria | 4371 |
| 535 | Ga0495626_0000471 | 3300048091 | Bacteria | 41011 |
| 536 | Ga0495626_0003765 | 3300048091 | Bacteria | 9540 |
| 537 | Ga0495626_0007765 | 3300048091 | Bacteria | 5943 |
| 538 | Ga0495626_0012177 | 3300048091 | Bacteria | 4521 |
| 539 | Ga0495626_0048033 | 3300048091 | Bacteria | 1981 |
| 540 | Ga0496102_0484666 | 3300048905 | Bacteria | 1158 |
| 541 | Ga0496110_0009253 | 3300048913 | Bacteria | 7962 |
| 542 | Ga0496112_0127866 | 3300048915 | Bacteria | 2512 |
| 543 | Ga0496114_0028572 | 3300048917 | Bacteria | 4577 |
| 544 | Ga0496116_0000663 | 3300048919 | Bacteria | 44852 |
| 545 | Ga0496116_0016264 | 3300048919 | Bacteria | 5831 |
| 546 | Ga0496116_0119954 | 3300048919 | Bacteria | 1525 |
| 547 | Ga0496117_0000088 | 3300048920 | Bacteria | 211093 |
| 548 | Ga0496117_0001425 | 3300048920 | Bacteria | 34584 |
| 549 | Ga0496117_0006004 | 3300048920 | Bacteria | 12502 |
| 550 | Ga0496117_0007449 | 3300048920 | Bacteria | 10690 |
| 551 | Ga0496117_0057179 | 3300048920 | Bacteria | 2711 |
| 552 | Ga0496118_0003619 | 3300048921 | Bacteria | 19184 |
| 553 | Ga0496118_0005722 | 3300048921 | Bacteria | 13986 |
| 554 | Ga0496118_0051348 | 3300048921 | Bacteria | 3155 |
| 555 | Ga0496118_0062423 | 3300048921 | Bacteria | 2751 |
| 556 | Ga0496119_0000380 | 3300048922 | Bacteria | 61208 |
| 557 | Ga0496120_0002710 | 3300048923 | Bacteria | 17352 |
| 558 | Ga0496121_0002023 | 3300048924 | Bacteria | 32177 |
| 559 | Ga0496121_0004919 | 3300048924 | Bacteria | 17531 |
| 560 | Ga0496121_0012236 | 3300048924 | Bacteria | 9396 |
| 561 | Ga0496121_0098675 | 3300048924 | Bacteria | 2260 |
| 562 | Ga0496122_0002009 | 3300048925 | Bacteria | 30251 |
| 563 | Ga0496122_0004970 | 3300048925 | Bacteria | 16089 |
| 564 | Ga0496122_0028114 | 3300048925 | Bacteria | 4784 |
| 565 | Ga0496122_0101033 | 3300048925 | Bacteria | 1928 |
| 566 | Ga0496123_0001344 | 3300048926 | Bacteria | 34725 |
| 567 | Ga0496123_0002392 | 3300048926 | Bacteria | 23471 |
| 568 | Ga0496123_0004350 | 3300048926 | Bacteria | 14974 |
| 569 | Ga0496123_0029385 | 3300048926 | Bacteria | 4047 |
| 570 | Ga0496124_0000132 | 3300048927 | Bacteria | 155405 |
| 571 | Ga0496124_0013196 | 3300048927 | Bacteria | 8080 |
| 572 | Ga0496124_0015039 | 3300048927 | Bacteria | 7443 |
| 573 | Ga0496124_0017029 | 3300048927 | Bacteria | 6875 |
| 574 | Ga0496124_0022494 | 3300048927 | Bacteria | 5776 |
| 575 | Ga0496124_0043984 | 3300048927 | Bacteria | 3835 |
| 576 | Ga0496124_0044639 | 3300048927 | Bacteria | 3801 |
| 577 | Ga0496125_0006982 | 3300048928 | Bacteria | 12084 |
| 578 | Ga0496125_0049175 | 3300048928 | Bacteria | 3506 |
| 579 | Ga0496125_0054771 | 3300048928 | Bacteria | 3256 |
| 580 | Ga0496125_0175800 | 3300048928 | Bacteria | 1433 |
| 581 | Ga0496126_0085441 | 3300048929 | Bacteria | 2781 |
| 582 | Ga0496126_0106389 | 3300048929 | Bacteria | 2448 |
| 583 | Ga0496126_0448479 | 3300048929 | Bacteria | 1039 |
| 584 | Ga0495678_000486 | 3300049459 | Bacteria | 39405 |
| 585 | Ga0495678_000536 | 3300049459 | Bacteria | 36666 |
| 586 | Ga0495678_001447 | 3300049459 | Bacteria | 18697 |
| 587 | Ga0495678_010910 | 3300049459 | Bacteria | 4379 |
| 588 | Ga0495678_025918 | 3300049459 | Bacteria | 2510 |
| 589 | Ga0495682_0000017 | 3300049460 | Bacteria | 233333 |
| 590 | Ga0495682_0000613 | 3300049460 | Bacteria | 24066 |
| 591 | Ga0495682_0000919 | 3300049460 | Bacteria | 17922 |
| 592 | Ga0501031_0103010 | 3300049568 | Bacteria | 1863 |
| 593 | Ga0501032_0033460 | 3300049569 | Bacteria | 3522 |
| 594 | Ga0501032_0183511 | 3300049569 | Bacteria | 1369 |
| 595 | Ga0501034_0000692 | 3300049571 | Bacteria | 51206 |
| 596 | Ga0501037_0011353 | 3300049573 | Bacteria | 6559 |
| 597 | Ga0501037_0049484 | 3300049573 | Bacteria | 3077 |
| 598 | Ga0501037_0219797 | 3300049573 | Bacteria | 1337 |
| 599 | Ga0501046_0100572 | 3300049580 | Bacteria | 2218 |
| 600 | Ga0501069_0157089 | 3300049585 | Bacteria | 1309 |
| 601 | Ga0501070_0020266 | 3300049586 | Bacteria | 5577 |
| 602 | Ga0501070_0022149 | 3300049586 | Bacteria | 5322 |
| 603 | Ga0501070_0022612 | 3300049586 | Bacteria | 5265 |
| 604 | Ga0501072_0187681 | 3300049588 | Bacteria | 1649 |
| 605 | Ga0501074_0000775 | 3300049590 | Bacteria | 20164 |
| 606 | Ga0501080_0000912 | 3300049742 | Bacteria | 24221 |
| 607 | Ga0501080_0375360 | 3300049742 | Bacteria | 1282 |
| 608 | Ga0501241_009848 | 3300049758 | Bacteria | 1738 |
| 609 | Ga0501226_000010 | 3300049853 | Bacteria | 180094 |
| 610 | nmdc:mga03n38_85_c1 | 3300050490 | Bacteria | 20170 |
| 611 | nmdc:mga00v17_1290_c1 | 3300050491 | Bacteria | 13149 |
| 612 | nmdc:mga00v17_40322_c1 | 3300050491 | Bacteria | 2801 |
| 613 | nmdc:mga00v17_4798_c1 | 3300050491 | Bacteria | 7077 |
| 614 | nmdc:mga0yw44_139_c1 | 3300050492 | Bacteria | 24821 |
| 615 | nmdc:mga06z11_14097_c1 | 3300050494 | Bacteria | 3531 |
| 616 | nmdc:mga04h51_1938_c1 | 3300050495 | Bacteria | 3817 |
| 617 | nmdc:mga07m45_169_c1 | 3300050496 | Bacteria | 26198 |
| 618 | nmdc:mga09592_51673_c1 | 3300050508 | Bacteria | 3468 |
| 619 | nmdc:mga0n895_23697_c1 | 3300050512 | Bacteria | 5773 |
| 620 | nmdc:mga0sz30_21_c1 | 3300050516 | Bacteria | 30668 |
| 621 | Ga0500650_0000172 | 3300053098 | Bacteria | 16408 |
| 622 | Ga0500621_000004 | 3300053126 | Bacteria | 485792 |
| 623 | Ga0500659_0003033 | 3300053135 | Bacteria | 9998 |
| 624 | Ga0587072_010257 | 3300059643 | Bacteria | 1511 |
| 625 | 2506576791 | 2506520007 | Bacteria | 5442880 |
| 626 | 2506581929 | 2506520008 | Bacteria | 5443009 |
| 627 | 2508850757 | 2508501071 | Bacteria | 5454741 |
| 628 | 2510283469 | 2510065053 | Bacteria | 5005518 |
| 629 | 2510292703 | 2510065055 | Bacteria | 5037935 |
| 630 | 2510311795 | 2510065058 | Bacteria | 5005894 |
| 631 | 2511258135 | 2511231004 | Bacteria | 6669789 |
| 632 | 2511264553 | 2511231006 | Bacteria | 6794709 |
| 633 | 2511273508 | 2511231007 | Bacteria | 6306603 |
| 634 | 2511280899 | 2511231008 | Bacteria | 6624100 |
| 635 | 2511290093 | 2511231010 | Bacteria | 6373152 |
| 636 | 2511295624 | 2511231011 | Bacteria | 6149768 |
| 637 | 2511299523 | 2511231012 | Bacteria | 6738011 |
| 638 | 2511315702 | 2511231014 | Bacteria | 6462302 |
| 639 | 2511319618 | 2511231015 | Bacteria | 6598026 |
| 640 | 2511326676 | 2511231016 | Bacteria | 6704427 |
| 641 | 2511333438 | 2511231017 | Bacteria | 6503007 |
| 642 | 2511338386 | 2511231018 | Bacteria | 6436256 |
| 643 | 2511344035 | 2511231019 | Bacteria | 6520662 |
| 644 | 2511353227 | 2511231020 | Bacteria | 6115223 |
| 645 | 2511355497 | 2511231021 | Bacteria | 7302637 |
| 646 | 2511363692 | 2511231022 | Bacteria | 6719296 |
| 647 | 2511369187 | 2511231023 | Bacteria | 6808468 |
| 648 | 2511377528 | 2511231024 | Bacteria | 5835885 |
| 649 | 2511379729 | 2511231025 | Bacteria | 5324661 |
| 650 | 2511410984 | 2511231031 | Bacteria | 6558529 |
| 651 | 2511437431 | 2511231035 | Bacteria | 5341610 |
| 652 | 2511823152 | 2511231156 | Bacteria | 6845832 |
| 653 | 2512328640 | 2512047018 | Bacteria | 6663241 |
| 654 | 2538427159 | 2537561728 | Bacteria | 5149301 |
| 655 | 2547696391 | 2547132181 | Bacteria | 4945084 |
| 656 | 2548649491 | 2547132416 | Bacteria | 4633861 |
| 657 | 2554813684 | 2554235132 | Bacteria | 6772433 |
| 658 | 2555245857 | 2554235231 | Bacteria | 5215788 |
| 659 | 2555258388 | 2554235234 | Bacteria | 5762085 |
| 660 | 2555668170 | 2554235341 | Bacteria | 6867980 |
| 661 | 2562464169 | 2561511199 | Bacteria | 5155034 |
| 662 | 2566035372 | 2565956521 | Bacteria | 4468993 |
| 663 | 2583790607 | 2582580891 | Bacteria | 6800976 |
| 664 | 2585826081 | 2585427591 | Bacteria | 5482980 |
| 665 | 2585831865 | 2585427592 | Bacteria | 5370892 |
| 666 | 2597856384 | 2597489887 | Bacteria | 6666321 |
| 667 | 2597862560 | 2597489888 | Bacteria | 6179543 |
| 668 | 2597868405 | 2597489889 | Bacteria | 6297495 |
| 669 | 2599328480 | 2599185155 | Bacteria | 5827168 |
| 670 | 2599355169 | 2599185160 | Bacteria | 6844013 |
| 671 | 2599361007 | 2599185161 | Bacteria | 6960462 |
| 672 | 2599367329 | 2599185162 | Bacteria | 6957254 |
| 673 | 2599374119 | 2599185163 | Bacteria | 6995158 |
| 674 | 2599380275 | 2599185164 | Bacteria | 6841688 |
| 675 | 2599386722 | 2599185165 | Bacteria | 6843250 |
| 676 | 2599392977 | 2599185166 | Bacteria | 6959206 |
| 677 | 2599396848 | 2599185167 | Bacteria | 6353609 |
| 678 | 2599404744 | 2599185168 | Bacteria | 6997636 |
| 679 | 2599409834 | 2599185169 | Bacteria | 5441380 |
| 680 | 2599448826 | 2599185179 | Bacteria | 6611171 |
| 681 | 2599462003 | 2599185181 | Bacteria | 6844519 |
| 682 | 2599466954 | 2599185182 | Bacteria | 6883168 |
| 683 | 2599483362 | 2599185185 | Bacteria | 6652270 |
| 684 | 2599490904 | 2599185186 | Bacteria | 6831633 |
| 685 | 2599501256 | 2599185188 | Bacteria | 6164180 |
| 686 | 2599507799 | 2599185189 | Bacteria | 5862825 |
| 687 | 2599511415 | 2599185190 | Bacteria | 6285678 |
| 688 | 2599517645 | 2599185191 | Bacteria | 6297582 |
| 689 | 2599613782 | 2599185212 | Bacteria | 6765997 |
| 690 | 2599770664 | 2599185248 | Bacteria | 6696816 |
| 691 | 2599805267 | 2599185257 | Bacteria | 6492581 |
| 692 | 2599879871 | 2599185288 | Bacteria | 6666191 |
| 693 | 2599886546 | 2599185289 | Bacteria | 6778765 |
| 694 | 2599890789 | 2599185290 | Bacteria | 6289611 |
| 695 | 2599896911 | 2599185291 | Bacteria | 6775623 |
| 696 | 2599928868 | 2599185299 | Bacteria | 4854625 |
| 697 | 2599934024 | 2599185300 | Bacteria | 6062622 |
| 698 | 2599942925 | 2599185302 | Bacteria | 5954930 |
| 699 | 2599948379 | 2599185303 | Bacteria | 6512725 |
| 700 | 2599954036 | 2599185304 | Bacteria | 5951361 |
| 701 | 2599959554 | 2599185305 | Bacteria | 6748700 |
| 702 | 2599966199 | 2599185306 | Bacteria | 6637356 |
| 703 | 2599973884 | 2599185307 | Bacteria | 6194719 |
| 704 | 2599978187 | 2599185308 | Bacteria | 6621546 |
| 705 | 2599986057 | 2599185309 | Bacteria | 5969593 |
| 706 | 2599987145 | 2599185310 | Bacteria | 6014457 |
| 707 | 2599995556 | 2599185311 | Bacteria | 6354990 |
| 708 | 2600000026 | 2599185312 | Bacteria | 5912071 |
| 709 | 2600006401 | 2599185313 | Bacteria | 6658188 |
| 710 | 2600012343 | 2599185314 | Bacteria | 6621749 |
| 711 | 2600016749 | 2599185315 | Bacteria | 6771107 |
| 712 | 2600024837 | 2599185316 | Bacteria | 6320029 |
| 713 | 2600029714 | 2599185317 | Bacteria | 6435722 |
| 714 | 2600035399 | 2599185318 | Bacteria | 6961590 |
| 715 | 2600041246 | 2599185319 | Bacteria | 6637840 |
| 716 | 2600045471 | 2599185320 | Bacteria | 5963263 |
| 717 | 2600054815 | 2599185321 | Bacteria | 6764560 |
| 718 | 2600058370 | 2599185322 | Bacteria | 6763055 |
| 719 | 2600063955 | 2599185323 | Bacteria | 6688755 |
| 720 | 2600073128 | 2599185324 | Bacteria | 6590677 |
| 721 | 2600079421 | 2599185325 | Bacteria | 6324919 |
| 722 | 2600214625 | 2599185356 | Bacteria | 6843884 |
| 723 | 2600358392 | 2600254930 | Bacteria | 6431253 |
| 724 | 2600363974 | 2600254931 | Bacteria | 6734225 |
| 725 | 2600446476 | 2600254954 | Bacteria | 5100516 |
| 726 | 2601523030 | 2600255254 | Bacteria | 5281859 |
| 727 | 2601528189 | 2600255255 | Bacteria | 5282785 |
| 728 | 2601533010 | 2600255256 | Bacteria | 5597742 |
| 729 | 2601538377 | 2600255257 | Bacteria | 5597196 |
| 730 | 2601615020 | 2600255280 | Bacteria | 5292309 |
| 731 | 2601620051 | 2600255281 | Bacteria | 5288753 |
| 732 | 2601626441 | 2600255283 | Bacteria | 6061572 |
| 733 | 2601643488 | 2600255287 | Bacteria | 5210468 |
| 734 | 2601648457 | 2600255288 | Bacteria | 5282738 |
| 735 | 2601653074 | 2600255289 | Bacteria | 5281907 |
| 736 | 2601658804 | 2600255290 | Bacteria | 5282218 |
| 737 | 2601663311 | 2600255291 | Bacteria | 5217298 |
| 738 | 2601691148 | 2600255296 | Bacteria | 5784754 |
| 739 | 2601696806 | 2600255298 | Bacteria | 5215185 |
| 740 | 2601700944 | 2600255299 | Bacteria | 5218662 |
| 741 | 2601705729 | 2600255300 | Bacteria | 5287774 |
| 742 | 2601711314 | 2600255301 | Bacteria | 5280532 |
| 743 | 2601716332 | 2600255302 | Bacteria | 5288235 |
| 744 | 2601721831 | 2600255303 | Bacteria | 5219315 |
| 745 | 2601726738 | 2600255304 | Bacteria | 5283973 |
| 746 | 2601731278 | 2600255305 | Bacteria | 5282329 |
| 747 | 2601736290 | 2600255306 | Bacteria | 5281613 |
| 748 | 2601740727 | 2600255307 | Bacteria | 5439064 |
| 749 | 2601751662 | 2600255309 | Bacteria | 5431045 |
| 750 | 2601756723 | 2600255310 | Bacteria | 5600903 |
| 751 | 2601761822 | 2600255311 | Bacteria | 5598766 |
| 752 | 2601774670 | 2600255313 | Bacteria | 6842543 |
| 753 | 2601800202 | 2600255318 | Bacteria | 6383414 |
| 754 | 2602010461 | 2600255389 | Bacteria | 5275336 |
| 755 | 2602018477 | 2600255392 | Bacteria | 5437392 |
| 756 | 2603639951 | 2602042046 | Bacteria | 5483348 |
| 757 | 2603643933 | 2602042047 | Bacteria | 4697674 |
| 758 | 2603660695 | 2602042052 | Bacteria | 5215873 |
| 759 | 2603665967 | 2602042053 | Bacteria | 5214361 |
| 760 | 2603700887 | 2602042066 | Bacteria | 4423871 |
| 761 | 2603704425 | 2602042067 | Bacteria | 4863713 |
| 762 | 2603838673 | 2602042103 | Bacteria | 5284714 |
| 763 | 2603844068 | 2602042104 | Bacteria | 5281639 |
| 764 | 2603848829 | 2602042105 | Bacteria | 5282303 |
| 765 | 2603853900 | 2602042106 | Bacteria | 5282744 |
| 766 | 2603865219 | 2602042109 | Bacteria | 5152801 |
| 767 | 2603871954 | 2602042110 | Bacteria | 5283285 |
| 768 | 2603876780 | 2602042111 | Bacteria | 5212080 |
| 769 | 2606049136 | 2603880178 | Bacteria | 5283018 |
| 770 | 2606070401 | 2603880184 | Bacteria | 5217896 |
| 771 | 2606074531 | 2603880185 | Bacteria | 6379190 |
| 772 | 2606127394 | 2603880199 | Bacteria | 6377649 |
| 773 | 2606146819 | 2603880202 | Bacteria | 5284684 |
| 774 | 2606176543 | 2603880211 | Bacteria | 5284226 |
| 775 | 2608381151 | 2606217733 | Bacteria | 6360972 |
| 776 | 2608670939 | 2608642108 | Bacteria | 4104624 |
| 777 | 2609912951 | 2609459761 | Bacteria | 5513740 |
| 778 | 2621301301 | 2619619299 | Bacteria | 6649820 |
| 779 | 2624478956 | 2623620443 | Bacteria | 6427864 |
| 780 | 2624494024 | 2623620446 | Bacteria | 6500345 |
| 781 | 2637223621 | 2636415599 | Bacteria | 5718434 |
| 782 | 2643845434 | 2643221565 | Bacteria | 6216018 |
| 783 | 2643873220 | 2643221571 | Bacteria | 6228673 |
| 784 | 2643952144 | 2643221589 | Bacteria | 6250934 |
| 785 | 2644024094 | 2643221602 | Bacteria | 6249926 |
| 786 | 2644184752 | 2643221633 | Bacteria | 6733554 |
| 787 | 2644285678 | 2643221650 | Bacteria | 7029547 |
| 788 | 2644624241 | 2643221713 | Bacteria | 6554480 |
| 789 | 2649121357 | 2648501241 | Bacteria | 5312320 |
| 790 | 2650897537 | 2648501693 | Bacteria | 5069560 |
| 791 | 2652545515 | 2651869719 | Bacteria | 6047974 |
| 792 | 2652974526 | 2651869818 | Bacteria | 5864031 |
| 793 | 2656277975 | 2654587920 | Bacteria | 5475511 |
| 794 | 2671092267 | 2667528170 | Bacteria | 6786960 |
| 795 | 2671097770 | 2667528171 | Bacteria | 6900659 |
| 796 | 2671104227 | 2667528172 | Bacteria | 5170840 |
| 797 | 2671109641 | 2667528173 | Bacteria | 5375747 |
| 798 | 2671127490 | 2667528176 | Bacteria | 6724917 |
| 799 | 2671586318 | 2671180115 | Bacteria | 5353919 |
| 800 | 2671767998 | 2671180172 | Bacteria | 6495783 |
| 801 | 2676408204 | 2675903046 | Bacteria | 5451247 |
| 802 | 2677897707 | 2675903420 | Bacteria | 6247433 |
| 803 | 2678261687 | 2675903515 | Bacteria | 6580491 |
| 804 | 2681998713 | 2681812866 | Bacteria | 4552357 |
| 805 | 2682007785 | 2681812869 | Bacteria | 5014465 |
| 806 | 2686354912 | 2684622997 | Bacteria | 4624240 |
| 807 | 2687580134 | 2687453129 | Bacteria | 4387428 |
| 808 | 2689443183 | 2687453601 | Bacteria | 5546041 |
| 809 | 2691329792 | 2690315857 | Bacteria | 4396207 |
| 810 | 2707098077 | 2706794495 | Bacteria | 4536932 |
| 811 | 2712472552 | 2711768156 | Bacteria | 4471618 |
| 812 | 2715752866 | 2713897148 | Bacteria | 5883533 |
| 813 | 2715757666 | 2713897149 | Bacteria | 6506249 |
| 814 | 2718632842 | 2718217725 | Bacteria | 5758958 |
| 815 | 2723247444 | 2721755607 | Bacteria | 5841722 |
| 816 | 2729147311 | 2728369097 | Bacteria | 4333476 |
| 817 | 2738673928 | 2738541265 | Bacteria | 6594665 |
| 818 | 2738689967 | 2738541271 | Bacteria | 5657310 |
| 819 | 2738715717 | 2738541276 | Bacteria | 4690596 |
| 820 | 2738752321 | 2738541282 | Bacteria | 6593925 |
| 821 | 2738809333 | 2738541294 | Bacteria | 6925949 |
| 822 | 2738861362 | 2738541303 | Bacteria | 6591772 |
| 823 | 2738896693 | 2738541309 | Bacteria | 6926455 |
| 824 | 2739198531 | 2738543004 | Bacteria | 6381073 |
| 825 | 2739256707 | 2738543015 | Bacteria | 6750701 |
| 826 | 2739265741 | 2738543016 | Bacteria | 5657564 |
| 827 | 2739286632 | 2738543020 | Bacteria | 5718238 |
| 828 | 2739291945 | 2738543021 | Bacteria | 5718241 |
| 829 | 2739312909 | 2738543025 | Bacteria | 6600348 |
| 830 | 2743735791 | 2740892503 | Bacteria | 6855563 |
| 831 | 2745008036 | 2744054620 | Bacteria | 6551379 |
| 832 | 2753857348 | 2751185917 | Bacteria | 4551186 |
| 833 | 2765582350 | 2765235841 | Bacteria | 6137024 |
| 834 | 2765590421 | 2765235842 | Bacteria | 4799256 |
| 835 | 2772437338 | 2772190666 | Bacteria | 5117644 |
| 836 | 2774121601 | 2773857670 | Bacteria | 6407454 |
| 837 | 2774128764 | 2773857672 | Bacteria | 4993178 |
| 838 | 2774136253 | 2773857673 | Bacteria | 6513460 |
| 839 | 2775539972 | 2775506706 | Bacteria | 4873073 |
| 840 | 2777019938 | 2775507074 | Bacteria | 5532402 |
| 841 | 2784260322 | 2784132063 | Bacteria | 6262788 |
| 842 | 2784317343 | 2784132072 | Bacteria | 6596533 |
| 843 | 2791925534 | 2791354903 | Bacteria | 4937680 |
| 844 | 2792313887 | 2791355010 | Bacteria | 4864581 |
| 845 | 2793404323 | 2791355275 | Bacteria | 4429597 |
| 846 | 2794594479 | 2791355520 | Bacteria | 5948615 |
| 847 | 2807177598 | 2806310673 | Bacteria | 4801221 |
| 848 | 2807409797 | 2806310737 | Bacteria | 5751088 |
| 849 | 2807458146 | 2806310745 | Bacteria | 5742165 |
| 850 | 2808854201 | 2808606361 | Bacteria | 6136259 |
| 851 | 2808907008 | 2808606373 | Bacteria | 4423627 |
| 852 | 2808923488 | 2808606376 | Bacteria | 6248667 |
| 853 | 2808929488 | 2808606377 | Bacteria | 6646337 |
| 854 | 2808934233 | 2808606378 | Bacteria | 6177535 |
| 855 | 2808939436 | 2808606379 | Bacteria | 5022697 |
| 856 | 2808945237 | 2808606380 | Bacteria | 6248705 |
| 857 | 2808951404 | 2808606381 | Bacteria | 6646461 |
| 858 | 2808960393 | 2808606382 | Bacteria | 6841132 |
| 859 | 2808962366 | 2808606383 | Bacteria | 6138645 |
| 860 | 2808975481 | 2808606385 | Bacteria | 6711065 |
| 861 | 2808990880 | 2808606388 | Bacteria | 6706662 |
| 862 | 2808997593 | 2808606389 | Bacteria | 6138126 |
| 863 | 2809126375 | 2808606414 | Bacteria | 4917181 |
| 864 | 2809215893 | 2808606445 | Bacteria | 6057339 |
| 865 | 2812371053 | 2811994881 | Bacteria | 6298475 |
| 866 | 2813727218 | 2811995292 | Bacteria | 5303342 |
| 867 | 2814694742 | 2814123068 | Bacteria | 5687681 |
| 868 | 2817489335 | 2816332298 | Bacteria | 6852809 |
| 869 | 2819658507 | 2818991456 | Bacteria | 6123676 |
| 870 | 2819702853 | 2818991464 | Bacteria | 6907494 |
| 871 | 2821120269 | 2821118458 | Bacteria | 4714306 |
| 872 | 2823376081 | 2823373977 | Bacteria | 4779415 |
| 873 | 2823423006 | 2823421272 | Bacteria | 5372474 |
| 874 | 2825653590 | 2825651385 | Bacteria | 6715909 |
| 875 | 2826584245 | 2826581358 | Bacteria | 5963467 |
| 876 | 2834029237 | 2834028612 | Bacteria | 6354979 |
| 877 | 2842809390 | 2842805378 | Bacteria | 5385175 |
| 878 | 2842817930 | 2842815866 | Bacteria | 5947510 |
| 879 | 2842828940 | 2842826826 | Bacteria | 5974129 |
| 880 | 2842835578 | 2842832357 | Bacteria | 5959113 |
| 881 | 2842839851 | 2842837860 | Bacteria | 6066181 |
| 882 | 2842847321 | 2842843487 | Bacteria | 6004777 |
| 883 | 2842849580 | 2842849001 | Bacteria | 5924277 |
| 884 | 2842857147 | 2842854478 | Bacteria | 6143501 |
| 885 | 2844428776 | 2844425489 | Bacteria | 4854065 |
| 886 | 2844530356 | 2844528606 | Bacteria | 4733806 |
| 887 | 2844668676 | 2844665904 | Bacteria | 6817974 |
| 888 | 2846040158 | 2846037992 | Bacteria | 4526407 |
| 889 | 2846542540 | 2846540461 | Bacteria | 5471451 |
| 890 | 2847086078 | 2847085930 | Bacteria | 5070450 |
| 891 | 2847798539 | 2847797336 | Bacteria | 5176640 |
| 892 | 2852106368 | 2852103415 | Bacteria | 5193810 |
| 893 | 2852615284 | 2852612431 | Bacteria | 6885235 |
| 894 | 2852658452 | 2852657418 | Bacteria | 6472974 |
| 895 | 2852670252 | 2852667396 | Bacteria | 6885555 |
| 896 | 2854605670 | 2854601825 | Bacteria | 4797592 |
| 897 | 2855199162 | 2855195626 | Bacteria | 4927512 |
| 898 | 2858467156 | 2858466076 | Bacteria | 4722413 |
| 899 | 2860340513 | 2860339153 | Bacteria | 6846989 |
| 900 | 2865016287 | 2865014394 | Bacteria | 4764573 |
| 901 | 2869552590 | 2869551831 | Bacteria | 5474685 |
| 902 | 2871272993 | 2871272651 | Bacteria | 5042015 |
| 903 | 2871284095 | 2871282230 | Bacteria | 4917173 |
| 904 | 2876601565 | 2876601092 | Bacteria | 5114497 |
| 905 | 2878030915 | 2878029506 | Bacteria | 6418441 |
| 906 | 2880231834 | 2880230671 | Bacteria | 6140320 |
| 907 | 2881610631 | 2881609920 | Bacteria | 4405319 |
| 908 | 2884087449 | 2884086401 | Bacteria | 5005459 |
| 909 | 2887633451 | 2887630918 | Bacteria | 3239855 |
| 910 | 2888367384 | 2888366609 | Bacteria | 5155009 |
| 911 | 2888374918 | 2888373701 | Bacteria | 5098052 |
| 912 | 2891672520 | 2891670763 | Bacteria | 4967099 |
| 913 | 2894513770 | 2894510363 | Bacteria | 5121143 |
| 914 | 2900053395 | 2900051742 | Bacteria | 4985156 |
| 915 | 2904478063 | 2904474040 | Bacteria | 5504324 |
| 916 | 2904506894 | 2904504865 | Bacteria | 5152820 |
| 917 | 2904516905 | 2904513164 | Bacteria | 5476410 |
| 918 | 2904520867 | 2904518522 | Bacteria | 6068986 |
| 919 | 2904551741 | 2904550169 | Bacteria | 6221258 |
| 920 | 2908448145 | 2908446538 | Bacteria | 6829095 |
| 921 | 2908672176 | 2908669403 | Bacteria | 5740494 |
| 922 | 2912965003 | 2912963787 | Bacteria | 5646108 |
| 923 | 2913038021 | 2913036834 | Bacteria | 6704877 |
| 924 | 2916181844 | 2916178963 | Bacteria | 5265078 |
| 925 | 2917071932 | 2917070673 | Bacteria | 6868303 |
| 926 | 2917833705 | 2917832318 | Bacteria | 5346010 |
| 927 | 2919064572 | 2919063839 | Bacteria | 6302690 |
| 928 | 2919110251 | 2919108558 | Bacteria | 5897419 |
| 929 | 2919129124 | 2919125081 | Bacteria | 5385106 |
| 930 | 2919153973 | 2919150387 | Bacteria | 5500879 |
| 931 | 2919158774 | 2919155634 | Bacteria | 4860545 |
| 932 | 2919385960 | 2919385768 | Bacteria | 5897293 |
| 933 | 2919458160 | 2919456309 | Bacteria | 6586567 |
| 934 | 2919482931 | 2919481497 | Bacteria | 6907839 |
| 935 | 2919490746 | 2919487758 | Bacteria | 5929766 |
| 936 | 2919497012 | 2919493220 | Bacteria | 4598500 |
| 937 | 2919498324 | 2919497567 | Bacteria | 4408621 |
| 938 | 2919505602 | 2919501602 | Bacteria | 5286340 |
| 939 | 2919538320 | 2919534386 | Bacteria | 4577686 |
| 940 | 2919546353 | 2919543075 | Bacteria | 4728703 |
| 941 | 2919690037 | 2919688452 | Bacteria | 4595932 |
| 942 | 2919700057 | 2919697872 | Bacteria | 6553725 |
| 943 | 2923154800 | 2923153595 | Bacteria | 6870622 |
| 944 | 2923525160 | 2923519811 | Bacteria | 6298479 |
| 945 | 2923529915 | 2923525760 | Bacteria | 4472324 |
| 946 | 2923590854 | 2923586266 | Bacteria | 6565975 |
| 947 | 2923636317 | 2923634449 | Bacteria | 4753480 |
| 948 | 2926067279 | 2926063275 | Bacteria | 5285848 |
| 949 | 2927147510 | 2927143783 | Bacteria | 5504251 |
| 950 | 2927837200 | 2927833300 | Bacteria | 4923934 |
| 951 | 2929145478 | 2929144301 | Bacteria | 6622272 |
| 952 | 2929191263 | 2929189879 | Bacteria | 5930554 |
| 953 | 2931371184 | 2931369376 | Bacteria | 6847892 |
| 954 | 2931392251 | 2931390751 | Bacteria | 6273349 |
| 955 | 2931399584 | 2931396565 | Bacteria | 7251677 |
| 956 | 2932410240 | 2932406140 | Bacteria | 5134491 |
| 957 | 2935354104 | 2935353572 | Unclassified | 6955622 |
| 958 | 2935628104 | 2935625433 | Bacteria | 5042964 |
| 959 | 2937543788 | 2937539931 | Bacteria | 4639830 |
| 960 | 2937970618 | 2937967321 | Bacteria | 5094075 |
| 961 | 2939571082 | 2939568625 | Bacteria | 4542555 |
| 962 | 2939577189 | 2939573065 | Bacteria | 4926053 |
| 963 | 2939582612 | 2939577877 | Bacteria | 5132791 |
| 964 | 2939604517 | 2939602548 | Bacteria | 4950493 |
| 965 | 2939610138 | 2939607340 | Bacteria | 4719256 |
| 966 | 2939620208 | 2939617950 | Bacteria | 4820956 |
| 967 | 2939637909 | 2939636861 | Bacteria | 6297853 |
| 968 | 2939645185 | 2939642701 | Bacteria | 4475280 |
| 969 | 2939653361 | 2939651529 | Bacteria | 5895393 |
| 970 | 2945876319 | 2945874760 | Bacteria | 5527237 |
| 971 | 2945929320 | 2945928738 | Bacteria | 6053221 |
| 972 | 2945951782 | 2945951305 | Bacteria | 4918162 |
| 973 | 2945961500 | 2945961074 | Bacteria | 7342064 |
| 974 | 2946011593 | 2946006987 | Bacteria | 6705746 |
| 975 | 2946029487 | 2946027586 | Bacteria | 6049274 |
| 976 | 2947236076 | 2947233263 | Bacteria | 6439278 |
| 977 | 2952254376 | 2952252522 | Bacteria | 4171745 |
| 978 | 2969080656 | 2969079654 | Bacteria | 5439582 |
| 979 | 2969305737 | 2969304461 | Bacteria | 6601805 |
| 980 | 2971822030 | 2971820967 | Bacteria | 5823634 |
| 981 | 2974292637 | 2974289157 | Bacteria | 6080362 |
| 982 | 2974299112 | 2974298342 | Bacteria | 4840922 |
| 983 | 2974315370 | 2974310843 | Bacteria | 4947816 |
| 984 | 2974439908 | 2974435778 | Bacteria | 4876478 |
| 985 | 2978978318 | 2978975091 | Bacteria | 4704313 |
| 986 | 2984291229 | 2984286254 | Bacteria | 6702062 |
| 987 | 2984495356 | 2984494565 | Bacteria | 5000175 |
| 988 | 2984501425 | 2984499530 | Bacteria | 5020881 |
| 989 | 2984507932 | 2984504281 | Bacteria | 5262371 |
| 990 | 2984563097 | 2984559226 | Bacteria | 5683096 |
| 991 | 2984601155 | 2984595703 | Bacteria | 5682994 |
| 992 | 2988733016 | 2988728565 | Bacteria | 6124362 |
| 993 | 2990200462 | 2990196909 | Bacteria | 4054280 |
| 994 | 2990265067 | 2990261002 | Bacteria | 4919493 |
| 995 | 2998141177 | 2998139840 | Bacteria | 6073514 |
| 996 | 2998348361 | 2998344455 | Bacteria | 4222996 |
| 997 | 3000377926 | 3000376612 | Bacteria | 4705565 |
| 998 | 3007253886 | 3007252601 | Bacteria | 4559114 |
| 999 | 3007317373 | 3007315729 | Bacteria | 5076637 |
| 1000 | 3007400329 | 3007395558 | Bacteria | 6755444 |
| 1001 | 3007420809 | 3007419365 | Bacteria | 7026924 |
| 1002 | 3007512551 | 3007511990 | Bacteria | 6481491 |
| 1003 | 3007618210 | 3007614139 | Bacteria | 6053559 |
| 1004 | 3007623005 | 3007619802 | Bacteria | 6411688 |
| 1005 | 3007720905 | 3007718800 | Bacteria | 5971527 |
| 1006 | 3007808667 | 3007803356 | Bacteria | 5931491 |
| 1007 | 3007860474 | 3007855910 | Bacteria | 5637581 |
| 1008 | 3007863601 | 3007861166 | Bacteria | 6045338 |
| 1009 | 3007871372 | 3007866637 | Bacteria | 5899198 |
| 1010 | 3007874468 | 3007872151 | Bacteria | 5268868 |
| 1011 | 637318547 | 637000220 | Bacteria | 7074893 |
| 1012 | 640487525 | 640427133 | Bacteria | 4567418 |
| 1013 | 640936343 | 640753048 | Bacteria | 5495657 |
| 1014 | 651175466 | 651053060 | Bacteria | 4689946 |
| 1015 | 8002745902 | 8002745576 | Bacteria | 4840272 |
| 1016 | 8004597714 | 8004592986 | Bacteria | 5122074 |
| 1017 | 8011356803 | 8011350971 | Bacteria | 6158957 |
| 1018 | 8015397491 | 8015394850 | Bacteria | 5064660 |
| 1019 | 8015689034 | 8015687852 | Bacteria | 6613826 |
| 1020 | 8016729902 | 8016728285 | Bacteria | 5263933 |
| 1021 | 8016734711 | 8016733728 | Bacteria | 5274317 |
| 1022 | 8018226096 | 8018221730 | Bacteria | 4616064 |
| 1023 | 8018405945 | 8018405270 | Bacteria | 4978981 |
| 1024 | 8019503826 | 8019499862 | Bacteria | 5169538 |
| 1025 | 8019508521 | 8019504834 | Bacteria | 4819156 |
| 1026 | 8019773413 | 8019769354 | Bacteria | 6924660 |
| 1027 | 8019776724 | 8019775933 | Bacteria | 6858656 |
| 1028 | 8029999587 | 8029995093 | Bacteria | 5990776 |
| 1029 | 8034964065 | 8034962539 | Bacteria | 4884839 |
| 1030 | 8052495803 | 8052494512 | Bacteria | 5765634 |
| 1031 | 8054285566 | 8054285046 | Bacteria | 6919322 |
| 1032 | 8054348314 | 8054347763 | Bacteria | 5901107 |
| 1033 | 8054359585 | 8054357960 | Bacteria | 2867777 |
| 1034 | 8054504827 | 8054503363 | Bacteria | 6101651 |
| 1035 | 8054847809 | 8054844752 | Bacteria | 4450330 |
| 1036 | 8054853478 | 8054849141 | Bacteria | 5232694 |
| 1037 | 8054929612 | 8054929484 | Bacteria | 5599761 |
| 1038 | 8055088791 | 8055087960 | Bacteria | 4784273 |
| 1039 | 8055097087 | 8055092621 | Bacteria | 4873875 |
| 1040 | 8055101059 | 8055097453 | Bacteria | 4865496 |
| 1041 | 8055694728 | 8055693939 | Bacteria | 4772047 |
| 1042 | 8055772153 | 8055770955 | Bacteria | 6827675 |
| 1043 | 8055819272 | 8055817908 | Bacteria | 6609162 |
| 1044 | 8055884328 | 8055878733 | Bacteria | 5907058 |
| 1045 | 8056120135 | 8056115690 | Bacteria | 5527654 |
| 1046 | 8056121982 | 8056120720 | Bacteria | 5758328 |
| 1047 | 8056127255 | 8056125926 | Bacteria | 6228218 |
| 1048 | 8056133190 | 8056131705 | Bacteria | 6107031 |
| 1049 | 8056141749 | 8056137416 | Bacteria | 6147080 |
| 1050 | 8056147801 | 8056143049 | Bacteria | 6307666 |
| 1051 | 8056149438 | 8056148874 | Bacteria | 6479865 |
| 1052 | 8056159593 | 8056155041 | Bacteria | 6486948 |
| 1053 | 8056164600 | 8056161164 | Bacteria | 6106669 |
| 1054 | 8056169877 | 8056166840 | Bacteria | 5820959 |
| 1055 | 8056176004 | 8056172158 | Bacteria | 6133900 |
| 1056 | 8056180406 | 8056177738 | Bacteria | 6748268 |
| 1057 | 8056569828 | 8056569372 | Bacteria | 5997322 |
| 1058 | 8057163175 | 8057160832 | Bacteria | 3268302 |
| 1059 | 8057304976 | 8057304971 | Bacteria | 4649742 |
| 1060 | 8057803442 | 8057798959 | Bacteria | 6713499 |
| 1061 | Ga0157373_10024353 | |||
| 1062 | MRS2a_Contig_5 | |||
| 1063 | SwRhRL2b_contig_195785 | |||
| 1064 | JGI25162J39368_1000314 | |||
| 1065 | JGI25162J39368_1000320 | |||
| 1066 | JGI25154J39366_1002279 | |||
| 1067 | JGI25163J39215_1003232 | |||
| 1068 | JGI25163J39215_1003241 | |||
| 1069 | JGI25164J39214_1000233 | |||
| 1070 | JGI25164J39214_1000237 | |||
| 1071 | JGI25165J46597_1000429 | |||
| 1072 | JGI25165J46597_1000437 | |||
| 1073 | Ga0006758J48902_1023556 | |||
| 1074 | rootH1_10069926 | |||
| 1075 | rootL2_10048495 | |||
| 1076 | rootH1_10014691 | |||
| 1077 | rootH1_10130777 | |||
| 1078 | Ga0007410J51695_1042200 | |||
| 1079 | Ga0007409J51694_1037896 | |||
| 1080 | Ga0055538_1000096 | |||
| 1081 | Ga0055539_1000142 | |||
| 1082 | Ga0055533_1000146 | |||
| 1083 | Ga0055532_1000132 | |||
| 1084 | Ga0055525_1000226 | |||
| 1085 | Ga0055536_1000217 | |||
| 1086 | Ga0055536_1014192 | |||
| 1087 | Ga0055536_1014380 | |||
| 1088 | Ga0055530_10001975 | |||
| 1089 | Ga0055530_10003100 | |||
| 1090 | Ga0055530_10016500 | |||
| 1091 | Ga0055530_10017736 | |||
| 1092 | Ga0055540_1001484 | |||
| 1093 | Ga0055540_1002192 | |||
| 1094 | Ga0055540_1002238 | |||
| 1095 | Ga0055531_10000642 | |||
| 1096 | Ga0055541_1000096 | |||
| 1097 | Ga0065714_10001187 | |||
| 1098 | Ga0065714_10012277 | |||
| 1099 | Ga0065714_10012898 | |||
| 1100 | Ga0065714_10067066 | |||
| 1101 | Ga0065714_10069591 | |||
| 1102 | Ga0065714_10093548 | |||
| 1103 | Ga0065714_10093894 | |||
| 1104 | Ga0065704_10000775 | |||
| 1105 | Ga0065704_10071509 | |||
| 1106 | Ga0065704_10095265 | |||
| 1107 | Ga0065704_10203247 | |||
| 1108 | Ga0065712_10000443 | |||
| 1109 | Ga0065712_10074620 | |||
| 1110 | Ga0065715_10092878 | |||
| 1111 | Ga0070670_100000015 | |||
| 1112 | Ga0070670_100123128 | |||
| 1113 | Ga0070670_100339935 | |||
| 1114 | Ga0070687_100012310 | |||
| 1115 | Ga0070661_100000306 | |||
| 1116 | Ga0070669_100002434 | |||
| 1117 | Ga0070669_100026832 | |||
| 1118 | Ga0070669_100140820 | |||
| 1119 | Ga0070671_100000240 | |||
| 1120 | Ga0070671_100027037 | |||
| 1121 | Ga0070688_100019396 | |||
| 1122 | Ga0070659_100555513 | |||
| 1123 | Ga0070667_100000015 | |||
| 1124 | Ga0070662_100000360 | |||
| 1125 | Ga0070685_10000004 | |||
| 1126 | Ga0068853_100028026 | |||
| 1127 | Ga0070665_100012700 | |||
| 1128 | Ga0070664_100000741 | |||
| 1129 | Ga0068854_100028524 | |||
| 1130 | Ga0068859_100008057 | |||
| 1131 | Ga0068864_100000072 | |||
| 1132 | Ga0068851_10000019 | |||
| 1133 | Ga0068858_100052905 | |||
| 1134 | Ga0068860_100000271 | |||
| 1135 | Ga0068862_100003971 | |||
| 1136 | Ga0075365_10000215 | |||
| 1137 | Ga0075368_10008663 | |||
| 1138 | Ga0075363_100020069 | |||
| 1139 | Ga0075364_10000013 | |||
| 1140 | Ga0075364_10006085 | |||
| 1141 | Ga0075364_10062654 | |||
| 1142 | Ga0075432_10009154 | |||
| 1143 | Ga0075432_10024776 | |||
| 1144 | Ga0075432_10033157 | |||
| 1145 | Ga0075432_10056460 | |||
| 1146 | Ga0075369_10001215 | |||
| 1147 | Ga0075369_10058267 | |||
| 1148 | Ga0075370_10000352 | |||
| 1149 | Ga0075429_100086097 | |||
| 1150 | Ga0097620_100008057 | |||
| 1151 | Ga0099823_1000119 | |||
| 1152 | Ga0079104_1001155 | |||
| 1153 | Ga0079104_1005472 | |||
| 1154 | Ga0099826_10000860 | |||
| 1155 | Ga0105251_10000444 | |||
| 1156 | Ga0105251_10000619 | |||
| 1157 | Ga0105251_10001959 | |||
| 1158 | Ga0105251_10003015 | |||
| 1159 | Ga0105251_10036856 | |||
| 1160 | Ga0105251_10054942 | |||
| 1161 | Ga0105251_10083711 | |||
| 1162 | Ga0105251_10093823 | |||
| 1163 | Ga0105251_10096447 | |||
| 1164 | Ga0105251_10099770 | |||
| 1165 | Ga0105244_10005246 | |||
| 1166 | Ga0105244_10006585 | |||
| 1167 | Ga0105244_10011745 | |||
| 1168 | Ga0105244_10024956 | |||
| 1169 | Ga0105244_10026994 | |||
| 1170 | Ga0105244_10045749 | |||
| 1171 | Ga0105244_10079052 | |||
| 1172 | Ga0105250_10000959 | |||
| 1173 | Ga0105250_10034463 | |||
| 1174 | Ga0105250_10039494 | |||
| 1175 | Ga0105250_10041579 | |||
| 1176 | Ga0105250_10071275 | |||
| 1177 | Ga0105250_10079982 | |||
| 1178 | Ga0105243_10003511 | |||
| 1179 | Ga0105243_10087600 | |||
| 1180 | Ga0105243_10096687 | |||
| 1181 | Ga0105243_10117689 | |||
| 1182 | Ga0105242_10001061 | |||
| 1183 | Ga0105242_10079122 | |||
| 1184 | Ga0105237_10002041 | |||
| 1185 | Ga0105249_10053921 | |||
| 1186 | Ga0105249_10097866 | |||
| 1187 | Ga0105246_10001083 | |||
| 1188 | Ga0105246_10001761 | |||
| 1189 | Ga0105246_10094363 | |||
| 1190 | Ga0157345_1000607 | |||
| 1191 | Ga0157373_10029248 | |||
| 1192 | Ga0157371_10005548 | |||
| 1193 | Ga0157371_10006276 | |||
| 1194 | Ga0157371_10012444 | |||
| 1195 | Ga0157371_10016653 | |||
| 1196 | Ga0157370_10001690 | |||
| 1197 | Ga0157370_10125089 | |||
| 1198 | Ga0157378_10026399 | |||
| 1199 | Ga0163162_10289801 | |||
| 1200 | Ga0157372_10000663 | |||
| 1201 | Ga0157372_10033882 | |||
| 1202 | Ga0163163_10000118 | |||
| 1203 | Ga0182008_10002900 | |||
| 1204 | Ga0182008_10051446 | |||
| 1205 | Ga0182008_10088693 | |||
| 1206 | Ga0157376_10457540 | |||
| 1207 | Ga0182006_1003483 | |||
| 1208 | Ga0182006_1040520 | |||
| 1209 | Ga0182006_1055610 | |||
| 1210 | Ga0182007_10001511 | |||
| 1211 | Ga0182005_1019757 | |||
| 1212 | Ga0213872_10002808 | |||
| 1213 | Ga0213872_10003010 | |||
| 1214 | Ga0213872_10003822 | |||
| 1215 | Ga0213872_10004946 | |||
| 1216 | Ga0209435_100393 | |||
| 1217 | Ga0209760_100021 | |||
| 1218 | Ga0209760_100046 | |||
| 1219 | Ga0209784_100015 | |||
| 1220 | Ga0209566_100012 | |||
| 1221 | Ga0209674_100027 | |||
| 1222 | Ga0209147_100019 | |||
| 1223 | Ga0209563_100031 | |||
| 1224 | Ga0209563_101829 | |||
| 1225 | Ga0207427_100001 | |||
| 1226 | Ga0207427_100029 | |||
| 1227 | Ga0209437_100003 | |||
| 1228 | Ga0209437_100009 | |||
| 1229 | Ga0209437_102448 | |||
| 1230 | Ga0209258_100824 | |||
| 1231 | Ga0209646_1000220 | |||
| 1232 | Ga0209677_100016 | |||
| 1233 | Ga0209759_1004898 | |||
| 1234 | Ga0209759_1005930 | |||
| 1235 | Ga0209233_1000007 | |||
| 1236 | Ga0209233_1000032 | |||
| 1237 | Ga0209675_1001096 | |||
| 1238 | Ga0209676_1000016 | |||
| 1239 | Ga0209676_1000080 | |||
| 1240 | Ga0209676_1000397 | |||
| 1241 | Ga0209676_1015743 | |||
| 1242 | Ga0209050_1000208 | |||
| 1243 | Ga0209050_1001191 | |||
| 1244 | Ga0209050_1001235 | |||
| 1245 | Ga0209050_1002753 | |||
| 1246 | Ga0209051_1000219 | |||
| 1247 | Ga0209051_1000498 | |||
| 1248 | Ga0209051_1000879 | |||
| 1249 | Ga0209257_1000342 | |||
| 1250 | Ga0209257_1008743 | |||
| 1251 | Ga0207656_10000042 | |||
| 1252 | Ga0207696_1000032 | |||
| 1253 | Ga0207696_1000141 | |||
| 1254 | Ga0207696_1000164 | |||
| 1255 | Ga0207696_1000604 | |||
| 1256 | Ga0207696_1001566 | |||
| 1257 | Ga0207696_1006225 | |||
| 1258 | Ga0207696_1014133 | |||
| 1259 | Ga0207696_1021239 | |||
| 1260 | Ga0207655_1000005 | |||
| 1261 | Ga0207655_1000015 | |||
| 1262 | Ga0207655_1000488 | |||
| 1263 | Ga0207655_1001023 | |||
| 1264 | Ga0207655_1001253 | |||
| 1265 | Ga0207655_1002739 | |||
| 1266 | Ga0207655_1009566 | |||
| 1267 | Ga0207655_1012134 | |||
| 1268 | Ga0207655_1017526 | |||
| 1269 | Ga0207655_1017992 | |||
| 1270 | Ga0207655_1021544 | |||
| 1271 | Ga0207655_1033900 | |||
| 1272 | Ga0207655_1035374 | |||
| 1273 | Ga0207655_1038488 | |||
| 1274 | Ga0207713_1000085 | |||
| 1275 | Ga0207713_1000098 | |||
| 1276 | Ga0207713_1000338 | |||
| 1277 | Ga0207713_1000751 | |||
| 1278 | Ga0207713_1000843 | |||
| 1279 | Ga0207713_1002039 | |||
| 1280 | Ga0207713_1005190 | |||
| 1281 | Ga0207713_1006982 | |||
| 1282 | Ga0207713_1008734 | |||
| 1283 | Ga0207713_1032973 | |||
| 1284 | Ga0207713_1059199 | |||
| 1285 | Ga0207713_1063976 | |||
| 1286 | Ga0207710_10058597 | |||
| 1287 | Ga0207671_10000420 | |||
| 1288 | Ga0207662_10067998 | |||
| 1289 | Ga0207649_10000002 | |||
| 1290 | Ga0207681_10002129 | |||
| 1291 | Ga0207681_10402761 | |||
| 1292 | Ga0207650_10000013 | |||
| 1293 | Ga0207650_10000606 | |||
| 1294 | Ga0207650_10045152 | |||
| 1295 | Ga0207644_10000015 | |||
| 1296 | Ga0207706_10007522 | |||
| 1297 | Ga0207709_10000228 | |||
| 1298 | Ga0207709_10000510 | |||
| 1299 | Ga0207709_10034056 | |||
| 1300 | Ga0207711_10000103 | |||
| 1301 | Ga0207711_10000277 | |||
| 1302 | Ga0207679_10000006 | |||
| 1303 | Ga0207712_10029560 | |||
| 1304 | Ga0207658_10000005 | |||
| 1305 | Ga0207703_10027118 | |||
| 1306 | Ga0207639_10013206 | |||
| 1307 | Ga0207641_10034212 | |||
| 1308 | Ga0207641_10037311 | |||
| 1309 | Ga0207676_10000010 | |||
| 1310 | Ga0207674_10391280 | |||
| 1311 | Ga0209281_1000013 | |||
| 1312 | Ga0209281_1000015 | |||
| 1313 | Ga0209281_1003287 | |||
| 1314 | Ga0209389_1000205 | |||
| 1315 | Ga0209371_1000165 | |||
| 1316 | Ga0209371_1000584 | |||
| 1317 | Ga0209371_1024188 | |||
| 1318 | Ga0209981_1005160 | |||
| 1319 | Ga0209996_1003171 | |||
| 1320 | Ga0209984_1001385 | |||
| 1321 | Ga0209995_1002255 | |||
| 1322 | Ga0209968_1007756 | |||
| 1323 | Ga0210002_1001652 | |||
| 1324 | Ga0209983_1000260 | |||
| 1325 | Ga0209282_1017939 | |||
| 1326 | Ga0209971_1000463 | |||
| 1327 | Ga0209813_10006508 | |||
| 1328 | Ga0207428_10137455 | |||
| 1329 | Ga0207428_10176571 | |||
| 1330 | Ga0207428_10254512 | |||
| 1331 | Ga0207428_10318293 | |||
| 1332 | Ga0268266_10011036 | |||
| 1333 | Ga0268266_10262646 | |||
| 1334 | Ga0268265_10002237 | |||
| 1335 | Ga0268264_10000036 | |||
| 1336 | Ga0307517_10175495 | |||
| 1337 | Ga0268256_1000112 | |||
| 1338 | Ga0268256_1000436 | |||
| 1339 | Ga0268256_1027483 | |||
| 1340 | Ga0316179_1077882 | |||
| 1341 | Ga0316178_1009525 | |||
| 1342 | Ga0316181_1106926 | |||
| 1343 | Ga0265331_10019849 | |||
| 1344 | Ga0265327_10000014 | |||
| 1345 | Ga0265327_10000170 | |||
| 1346 | Ga0307408_100000042 | |||
| 1347 | Ga0307408_100002417 | |||
| 1348 | Ga0307408_100002567 | |||
| 1349 | Ga0316576_10025351 | |||
| 1350 | Ga0316578_10126639 | |||
| 1351 | Ga0316577_10095962 | |||
| 1352 | Ga0316577_10145087 | |||
| 1353 | Ga0307406_10001355 | |||
| 1354 | Ga0307406_10086930 | |||
| 1355 | Ga0307414_10008646 | |||
| 1356 | Ga0316585_10018592 | |||
| 1357 | Ga0316587_1008417 | |||
| 1358 | Ga0316587_1010941 | |||
| 1359 | Ga0373960_0005597 | |||
| 1360 | Ga0316574_0017625 | |||
| 1361 | Ga0316574_0136801 | |||
| 1362 | Ga0316582_0004214 | |||
| 1363 | Ga0316582_0293491 | |||
| 1364 | Ga0316584_0024150 | |||
| 1365 | Ga0316584_0077921 | |||
| 1366 | Ga0395900_0029706 | |||
| 1367 | Ga0400483_022490 | |||
| 1368 | Ga0400483_026308 | |||
| 1369 | Ga0400483_077384 | |||
| 1370 | Ga0400483_116699 | |||
| 1371 | Ga0400483_235996 | |||
| 1372 | Ga0400483_249072 | |||
| 1373 | Ga0400483_250036 | |||
| 1374 | Ga0400487_52686 | |||
| 1375 | Ga0436361_0052642 | |||
| 1376 | Ga0436361_0777562 | |||
| 1377 | Ga0436361_0891393 | |||
| 1378 | Ga0439436_0000093 | |||
| 1379 | Ga0439436_0000606 | |||
| 1380 | Ga0439438_002379 | |||
| 1381 | Ga0439438_002924 | |||
| 1382 | Ga0439438_003070 | |||
| 1383 | Ga0439438_006968 | |||
| 1384 | Ga0439447_000651 | |||
| 1385 | Ga0439447_005171 | |||
| 1386 | Ga0439447_026562 | |||
| 1387 | Ga0439466_0000870 | |||
| 1388 | Ga0439466_0012474 | |||
| 1389 | Ga0439466_0030953 | |||
| 1390 | Ga0451807_1403825 | |||
| 1391 | Ga0439437_000719 | |||
| 1392 | Ga0439432_013881 | |||
| 1393 | Ga0439432_039883 | |||
| 1394 | Ga0439451_001040 | |||
| 1395 | Ga0439451_015030 | |||
| 1396 | Ga0439452_002393 | |||
| 1397 | Ga0439452_002554 | |||
| 1398 | Ga0439452_015295 | |||
| 1399 | Ga0439456_000224 | |||
| 1400 | Ga0439463_000713 | |||
| 1401 | Ga0439463_014393 | |||
| 1402 | Ga0450911_000005 | |||
| 1403 | Ga0450900_003653 | |||
| 1404 | Ga0450904_000002 | |||
| 1405 | Ga0450905_000063 | |||
| 1406 | Ga0450907_001644 | |||
| 1407 | Ga0439446_0001114 | |||
| 1408 | Ga0439446_0001152 | |||
| 1409 | Ga0439446_0006551 | |||
| 1410 | Ga0450908_001752 | |||
| 1411 | Ga0439434_0001359 | |||
| 1412 | Ga0439464_0000031 | |||
| 1413 | Ga0439464_0012859 | |||
| 1414 | Ga0439460_0002293 | |||
| 1415 | Ga0439460_0004649 | |||
| 1416 | Ga0450901_000289 | |||
| 1417 | Ga0451577_0168843 | |||
| 1418 | Ga0466969_0001528 | |||
| 1419 | Ga0466965_0002201 | |||
| 1420 | Ga0466966_0003088 | |||
| 1421 | Ga0466961_0001154 | |||
| 1422 | Ga0453684_0000211 | |||
| 1423 | Ga0453684_0568292 | |||
| 1424 | Ga0466959_0088268 | |||
| 1425 | Ga0451576_0000234 | |||
| 1426 | Ga0495627_001316 | |||
| 1427 | Ga0495627_029273 | |||
| 1428 | Ga0495591_000212 | |||
| 1429 | Ga0495591_000849 | |||
| 1430 | Ga0495591_001650 | |||
| 1431 | Ga0495591_002049 | |||
| 1432 | Ga0495591_002381 | |||
| 1433 | Ga0495591_006498 | |||
| 1434 | Ga0495591_009341 | |||
| 1435 | Ga0495591_020376 | |||
| 1436 | Ga0495638_0019589 | |||
| 1437 | Ga0495638_0085174 | |||
| 1438 | Ga0495638_0115396 | |||
| 1439 | Ga0495653_0005238 | |||
| 1440 | Ga0495650_0000008 | |||
| 1441 | Ga0495650_0000515 | |||
| 1442 | Ga0495650_0001154 | |||
| 1443 | Ga0495650_0007032 | |||
| 1444 | Ga0495650_0089352 | |||
| 1445 | Ga0495605_0000323 | |||
| 1446 | Ga0495605_0000449 | |||
| 1447 | Ga0495605_0000461 | |||
| 1448 | Ga0495605_0001257 | |||
| 1449 | Ga0495605_0001417 | |||
| 1450 | Ga0495605_0050379 | |||
| 1451 | Ga0495605_0057136 | |||
| 1452 | Ga0495605_0089006 | |||
| 1453 | Ga0495584_0013435 | |||
| 1454 | Ga0495584_0022750 | |||
| 1455 | Ga0495585_0003113 | |||
| 1456 | Ga0495585_0009384 | |||
| 1457 | Ga0495585_0039267 | |||
| 1458 | Ga0495596_0000148 | |||
| 1459 | Ga0495596_0030807 | |||
| 1460 | Ga0495607_0000276 | |||
| 1461 | Ga0495607_0000490 | |||
| 1462 | Ga0495607_0000544 | |||
| 1463 | Ga0495607_0000841 | |||
| 1464 | Ga0495607_0005018 | |||
| 1465 | Ga0495607_0020434 | |||
| 1466 | Ga0495607_0063674 | |||
| 1467 | Ga0495607_0077091 | |||
| 1468 | Ga0495607_0098794 | |||
| 1469 | Ga0495607_0122764 | |||
| 1470 | Ga0495583_0000861 | |||
| 1471 | Ga0495583_0000884 | |||
| 1472 | Ga0495583_0002615 | |||
| 1473 | Ga0495583_0004142 | |||
| 1474 | Ga0495583_0004417 | |||
| 1475 | Ga0495606_0000126 | |||
| 1476 | Ga0495606_0001121 | |||
| 1477 | Ga0495606_0001804 | |||
| 1478 | Ga0495606_0002489 | |||
| 1479 | Ga0495606_0006268 | |||
| 1480 | Ga0495606_0012166 | |||
| 1481 | Ga0495606_0016744 | |||
| 1482 | Ga0495606_0023582 | |||
| 1483 | Ga0495610_0003557 | |||
| 1484 | Ga0495610_0013190 | |||
| 1485 | Ga0495616_0035062 | |||
| 1486 | Ga0495616_0096084 | |||
| 1487 | Ga0495620_0000003 | |||
| 1488 | Ga0495620_0001260 | |||
| 1489 | Ga0495620_0003107 | |||
| 1490 | Ga0495620_0006420 | |||
| 1491 | Ga0495620_0012230 | |||
| 1492 | Ga0495620_0016101 | |||
| 1493 | Ga0495620_0019997 | |||
| 1494 | Ga0495631_0009673 | |||
| 1495 | Ga0495631_0023789 | |||
| 1496 | Ga0495631_0040393 | |||
| 1497 | Ga0495632_0001207 | |||
| 1498 | Ga0495632_0003927 | |||
| 1499 | Ga0495632_0005427 | |||
| 1500 | Ga0495632_0059256 | |||
| 1501 | Ga0495637_0001766 | |||
| 1502 | Ga0495637_0002014 | |||
| 1503 | Ga0495637_0011318 | |||
| 1504 | Ga0495637_0014996 | |||
| 1505 | Ga0495637_0038282 | |||
| 1506 | Ga0495637_0040424 | |||
| 1507 | Ga0495643_0000917 | |||
| 1508 | Ga0495643_0001861 | |||
| 1509 | Ga0495643_0003034 | |||
| 1510 | Ga0495643_0006177 | |||
| 1511 | Ga0495644_0001824 | |||
| 1512 | Ga0495644_0009791 | |||
| 1513 | Ga0495648_0003241 | |||
| 1514 | Ga0495648_0003639 | |||
| 1515 | Ga0495648_0003944 | |||
| 1516 | Ga0495648_0011116 | |||
| 1517 | Ga0495648_0015115 | |||
| 1518 | Ga0495648_0017142 | |||
| 1519 | Ga0495648_0045951 | |||
| 1520 | Ga0495642_0000739 | |||
| 1521 | Ga0495654_0000375 | |||
| 1522 | Ga0495654_0003257 | |||
| 1523 | Ga0495654_0003974 | |||
| 1524 | Ga0495654_0016324 | |||
| 1525 | Ga0495654_0020728 | |||
| 1526 | Ga0495654_0029037 | |||
| 1527 | Ga0495609_0000153 | |||
| 1528 | Ga0495609_0000210 | |||
| 1529 | Ga0495609_0000371 | |||
| 1530 | Ga0495609_0055439 | |||
| 1531 | Ga0495597_0000098 | |||
| 1532 | Ga0495597_0012842 | |||
| 1533 | Ga0495622_0003943 | |||
| 1534 | Ga0495622_0009647 | |||
| 1535 | Ga0495622_0044005 | |||
| 1536 | Ga0495633_0000300 | |||
| 1537 | Ga0495668_0017621 | |||
| 1538 | Ga0495668_0066726 | |||
| 1539 | Ga0495611_0000872 | |||
| 1540 | Ga0495611_0003885 | |||
| 1541 | Ga0495625_0002792 | |||
| 1542 | Ga0495625_0017915 | |||
| 1543 | Ga0495625_0019844 | |||
| 1544 | Ga0495661_0000337 | |||
| 1545 | Ga0495661_0000538 | |||
| 1546 | Ga0495661_0001311 | |||
| 1547 | Ga0495661_0002290 | |||
| 1548 | Ga0495661_0016967 | |||
| 1549 | Ga0495661_0045241 | |||
| 1550 | Ga0495670_0003681 | |||
| 1551 | Ga0495671_0001322 | |||
| 1552 | Ga0495671_0002986 | |||
| 1553 | Ga0495671_0004634 | |||
| 1554 | Ga0495671_0006387 | |||
| 1555 | Ga0495671_0035909 | |||
| 1556 | Ga0495671_0163335 | |||
| 1557 | Ga0495649_0006756 | |||
| 1558 | Ga0495649_0009022 | |||
| 1559 | Ga0495649_0009084 | |||
| 1560 | Ga0495589_0003579 | |||
| 1561 | Ga0495589_0060461 | |||
| 1562 | Ga0495660_0000019 | |||
| 1563 | Ga0495660_0000879 | |||
| 1564 | Ga0495660_0000911 | |||
| 1565 | Ga0495660_0006749 | |||
| 1566 | Ga0495660_0046791 | |||
| 1567 | Ga0495660_0056203 | |||
| 1568 | Ga0495672_0000003 | |||
| 1569 | Ga0495672_0004648 | |||
| 1570 | Ga0495672_0009343 | |||
| 1571 | Ga0495672_0009796 | |||
| 1572 | Ga0495672_0014719 | |||
| 1573 | Ga0495672_0015889 | |||
| 1574 | Ga0495676_0000126 | |||
| 1575 | Ga0495680_0019915 | |||
| 1576 | Ga0495683_0000223 | |||
| 1577 | Ga0495683_0000371 | |||
| 1578 | Ga0495683_0003228 | |||
| 1579 | Ga0495683_0013430 | |||
| 1580 | Ga0495683_0024834 | |||
| 1581 | Ga0495675_0070126 | |||
| 1582 | Ga0495679_001295 | |||
| 1583 | Ga0495679_001695 | |||
| 1584 | Ga0495673_0000011 | |||
| 1585 | Ga0495673_0001897 | |||
| 1586 | Ga0495673_0005418 | |||
| 1587 | Ga0495673_0008585 | |||
| 1588 | Ga0495673_0014761 | |||
| 1589 | Ga0495673_0046063 | |||
| 1590 | Ga0495681_0016053 | |||
| 1591 | Ga0495681_0016475 | |||
| 1592 | Ga0495681_0038268 | |||
| 1593 | Ga0495681_0067105 | |||
| 1594 | Ga0495686_0020807 | |||
| 1595 | Ga0495626_0000471 | |||
| 1596 | Ga0495626_0003765 | |||
| 1597 | Ga0495626_0007765 | |||
| 1598 | Ga0495626_0012177 | |||
| 1599 | Ga0495626_0048033 | |||
| 1600 | Ga0496102_0484666 | |||
| 1601 | Ga0496110_0009253 | |||
| 1602 | Ga0496112_0127866 | |||
| 1603 | Ga0496114_0028572 | |||
| 1604 | Ga0496116_0000663 | |||
| 1605 | Ga0496116_0016264 | |||
| 1606 | Ga0496116_0119954 | |||
| 1607 | Ga0496117_0000088 | |||
| 1608 | Ga0496117_0001425 | |||
| 1609 | Ga0496117_0006004 | |||
| 1610 | Ga0496117_0007449 | |||
| 1611 | Ga0496117_0057179 | |||
| 1612 | Ga0496118_0003619 | |||
| 1613 | Ga0496118_0005722 | |||
| 1614 | Ga0496118_0051348 | |||
| 1615 | Ga0496118_0062423 | |||
| 1616 | Ga0496119_0000380 | |||
| 1617 | Ga0496120_0002710 | |||
| 1618 | Ga0496121_0002023 | |||
| 1619 | Ga0496121_0004919 | |||
| 1620 | Ga0496121_0012236 | |||
| 1621 | Ga0496121_0098675 | |||
| 1622 | Ga0496122_0002009 | |||
| 1623 | Ga0496122_0004970 | |||
| 1624 | Ga0496122_0028114 | |||
| 1625 | Ga0496122_0101033 | |||
| 1626 | Ga0496123_0001344 | |||
| 1627 | Ga0496123_0002392 | |||
| 1628 | Ga0496123_0004350 | |||
| 1629 | Ga0496123_0029385 | |||
| 1630 | Ga0496124_0000132 | |||
| 1631 | Ga0496124_0013196 | |||
| 1632 | Ga0496124_0015039 | |||
| 1633 | Ga0496124_0017029 | |||
| 1634 | Ga0496124_0022494 | |||
| 1635 | Ga0496124_0043984 | |||
| 1636 | Ga0496124_0044639 | |||
| 1637 | Ga0496125_0006982 | |||
| 1638 | Ga0496125_0049175 | |||
| 1639 | Ga0496125_0054771 | |||
| 1640 | Ga0496125_0175800 | |||
| 1641 | Ga0496126_0085441 | |||
| 1642 | Ga0496126_0106389 | |||
| 1643 | Ga0496126_0448479 | |||
| 1644 | Ga0495678_000486 | |||
| 1645 | Ga0495678_000536 | |||
| 1646 | Ga0495678_001447 | |||
| 1647 | Ga0495678_010910 | |||
| 1648 | Ga0495678_025918 | |||
| 1649 | Ga0495682_0000017 | |||
| 1650 | Ga0495682_0000613 | |||
| 1651 | Ga0495682_0000919 | |||
| 1652 | Ga0501031_0103010 | |||
| 1653 | Ga0501032_0033460 | |||
| 1654 | Ga0501032_0183511 | |||
| 1655 | Ga0501034_0000692 | |||
| 1656 | Ga0501037_0011353 | |||
| 1657 | Ga0501037_0049484 | |||
| 1658 | Ga0501037_0219797 | |||
| 1659 | Ga0501046_0100572 | |||
| 1660 | Ga0501069_0157089 | |||
| 1661 | Ga0501070_0020266 | |||
| 1662 | Ga0501070_0022149 | |||
| 1663 | Ga0501070_0022612 | |||
| 1664 | Ga0501072_0187681 | |||
| 1665 | Ga0501074_0000775 | |||
| 1666 | Ga0501080_0000912 | |||
| 1667 | Ga0501080_0375360 | |||
| 1668 | Ga0501241_009848 | |||
| 1669 | Ga0501226_000010 | |||
| 1670 | nmdc:mga03n38_85_c1 | |||
| 1671 | nmdc:mga00v17_1290_c1 | |||
| 1672 | nmdc:mga00v17_40322_c1 | |||
| 1673 | nmdc:mga00v17_4798_c1 | |||
| 1674 | nmdc:mga0yw44_139_c1 | |||
| 1675 | nmdc:mga06z11_14097_c1 | |||
| 1676 | nmdc:mga04h51_1938_c1 | |||
| 1677 | nmdc:mga07m45_169_c1 | |||
| 1678 | nmdc:mga09592_51673_c1 | |||
| 1679 | nmdc:mga0n895_23697_c1 | |||
| 1680 | nmdc:mga0sz30_21_c1 | |||
| 1681 | Ga0500650_0000172 | |||
| 1682 | Ga0500621_000004 | |||
| 1683 | Ga0500659_0003033 | |||
| 1684 | Ga0587072_010257 | |||
| 1685 | 2506576791 | |||
| 1686 | 2506581929 | |||
| 1687 | 2508850757 | |||
| 1688 | 2510283469 | |||
| 1689 | 2510292703 | |||
| 1690 | 2510311795 | |||
| 1691 | 2511258135 | |||
| 1692 | 2511264553 | |||
| 1693 | 2511273508 | |||
| 1694 | 2511280899 | |||
| 1695 | 2511290093 | |||
| 1696 | 2511295624 | |||
| 1697 | 2511299523 | |||
| 1698 | 2511315702 | |||
| 1699 | 2511319618 | |||
| 1700 | 2511326676 | |||
| 1701 | 2511333438 | |||
| 1702 | 2511338386 | |||
| 1703 | 2511344035 | |||
| 1704 | 2511353227 | |||
| 1705 | 2511355497 | |||
| 1706 | 2511363692 | |||
| 1707 | 2511369187 | |||
| 1708 | 2511377528 | |||
| 1709 | 2511379729 | |||
| 1710 | 2511410984 | |||
| 1711 | 2511437431 | |||
| 1712 | 2511823152 | |||
| 1713 | 2512328640 | |||
| 1714 | 2538427159 | |||
| 1715 | 2547696391 | |||
| 1716 | 2548649491 | |||
| 1717 | 2554813684 | |||
| 1718 | 2555245857 | |||
| 1719 | 2555258388 | |||
| 1720 | 2555668170 | |||
| 1721 | 2562464169 | |||
| 1722 | 2566035372 | |||
| 1723 | 2583790607 | |||
| 1724 | 2585826081 | |||
| 1725 | 2585831865 | |||
| 1726 | 2597856384 | |||
| 1727 | 2597862560 | |||
| 1728 | 2597868405 | |||
| 1729 | 2599328480 | |||
| 1730 | 2599355169 | |||
| 1731 | 2599361007 | |||
| 1732 | 2599367329 | |||
| 1733 | 2599374119 | |||
| 1734 | 2599380275 | |||
| 1735 | 2599386722 | |||
| 1736 | 2599392977 | |||
| 1737 | 2599396848 | |||
| 1738 | 2599404744 | |||
| 1739 | 2599409834 | |||
| 1740 | 2599448826 | |||
| 1741 | 2599462003 | |||
| 1742 | 2599466954 | |||
| 1743 | 2599483362 | |||
| 1744 | 2599490904 | |||
| 1745 | 2599501256 | |||
| 1746 | 2599507799 | |||
| 1747 | 2599511415 | |||
| 1748 | 2599517645 | |||
| 1749 | 2599613782 | |||
| 1750 | 2599770664 | |||
| 1751 | 2599805267 | |||
| 1752 | 2599879871 | |||
| 1753 | 2599886546 | |||
| 1754 | 2599890789 | |||
| 1755 | 2599896911 | |||
| 1756 | 2599928868 | |||
| 1757 | 2599934024 | |||
| 1758 | 2599942925 | |||
| 1759 | 2599948379 | |||
| 1760 | 2599954036 | |||
| 1761 | 2599959554 | |||
| 1762 | 2599966199 | |||
| 1763 | 2599973884 | |||
| 1764 | 2599978187 | |||
| 1765 | 2599986057 | |||
| 1766 | 2599987145 | |||
| 1767 | 2599995556 | |||
| 1768 | 2600000026 | |||
| 1769 | 2600006401 | |||
| 1770 | 2600012343 | |||
| 1771 | 2600016749 | |||
| 1772 | 2600024837 | |||
| 1773 | 2600029714 | |||
| 1774 | 2600035399 | |||
| 1775 | 2600041246 | |||
| 1776 | 2600045471 | |||
| 1777 | 2600054815 | |||
| 1778 | 2600058370 | |||
| 1779 | 2600063955 | |||
| 1780 | 2600073128 | |||
| 1781 | 2600079421 | |||
| 1782 | 2600214625 | |||
| 1783 | 2600358392 | |||
| 1784 | 2600363974 | |||
| 1785 | 2600446476 | |||
| 1786 | 2601523030 | |||
| 1787 | 2601528189 | |||
| 1788 | 2601533010 | |||
| 1789 | 2601538377 | |||
| 1790 | 2601615020 | |||
| 1791 | 2601620051 | |||
| 1792 | 2601626441 | |||
| 1793 | 2601643488 | |||
| 1794 | 2601648457 | |||
| 1795 | 2601653074 | |||
| 1796 | 2601658804 | |||
| 1797 | 2601663311 | |||
| 1798 | 2601691148 | |||
| 1799 | 2601696806 | |||
| 1800 | 2601700944 | |||
| 1801 | 2601705729 | |||
| 1802 | 2601711314 | |||
| 1803 | 2601716332 | |||
| 1804 | 2601721831 | |||
| 1805 | 2601726738 | |||
| 1806 | 2601731278 | |||
| 1807 | 2601736290 | |||
| 1808 | 2601740727 | |||
| 1809 | 2601751662 | |||
| 1810 | 2601756723 | |||
| 1811 | 2601761822 | |||
| 1812 | 2601774670 | |||
| 1813 | 2601800202 | |||
| 1814 | 2602010461 | |||
| 1815 | 2602018477 | |||
| 1816 | 2603639951 | |||
| 1817 | 2603643933 | |||
| 1818 | 2603660695 | |||
| 1819 | 2603665967 | |||
| 1820 | 2603700887 | |||
| 1821 | 2603704425 | |||
| 1822 | 2603838673 | |||
| 1823 | 2603844068 | |||
| 1824 | 2603848829 | |||
| 1825 | 2603853900 | |||
| 1826 | 2603865219 | |||
| 1827 | 2603871954 | |||
| 1828 | 2603876780 | |||
| 1829 | 2606049136 | |||
| 1830 | 2606070401 | |||
| 1831 | 2606074531 | |||
| 1832 | 2606127394 | |||
| 1833 | 2606146819 | |||
| 1834 | 2606176543 | |||
| 1835 | 2608381151 | |||
| 1836 | 2608670939 | |||
| 1837 | 2609912951 | |||
| 1838 | 2621301301 | |||
| 1839 | 2624478956 | |||
| 1840 | 2624494024 | |||
| 1841 | 2637223621 | |||
| 1842 | 2643845434 | |||
| 1843 | 2643873220 | |||
| 1844 | 2643952144 | |||
| 1845 | 2644024094 | |||
| 1846 | 2644184752 | |||
| 1847 | 2644285678 | |||
| 1848 | 2644624241 | |||
| 1849 | 2649121357 | |||
| 1850 | 2650897537 | |||
| 1851 | 2652545515 | |||
| 1852 | 2652974526 | |||
| 1853 | 2656277975 | |||
| 1854 | 2671092267 | |||
| 1855 | 2671097770 | |||
| 1856 | 2671104227 | |||
| 1857 | 2671109641 | |||
| 1858 | 2671127490 | |||
| 1859 | 2671586318 | |||
| 1860 | 2671767998 | |||
| 1861 | 2676408204 | |||
| 1862 | 2677897707 | |||
| 1863 | 2678261687 | |||
| 1864 | 2681998713 | |||
| 1865 | 2682007785 | |||
| 1866 | 2686354912 | |||
| 1867 | 2687580134 | |||
| 1868 | 2689443183 | |||
| 1869 | 2691329792 | |||
| 1870 | 2707098077 | |||
| 1871 | 2712472552 | |||
| 1872 | 2715752866 | |||
| 1873 | 2715757666 | |||
| 1874 | 2718632842 | |||
| 1875 | 2723247444 | |||
| 1876 | 2729147311 | |||
| 1877 | 2738673928 | |||
| 1878 | 2738689967 | |||
| 1879 | 2738715717 | |||
| 1880 | 2738752321 | |||
| 1881 | 2738809333 | |||
| 1882 | 2738861362 | |||
| 1883 | 2738896693 | |||
| 1884 | 2739198531 | |||
| 1885 | 2739256707 | |||
| 1886 | 2739265741 | |||
| 1887 | 2739286632 | |||
| 1888 | 2739291945 | |||
| 1889 | 2739312909 | |||
| 1890 | 2743735791 | |||
| 1891 | 2745008036 | |||
| 1892 | 2753857348 | |||
| 1893 | 2765582350 | |||
| 1894 | 2765590421 | |||
| 1895 | 2772437338 | |||
| 1896 | 2774121601 | |||
| 1897 | 2774128764 | |||
| 1898 | 2774136253 | |||
| 1899 | 2775539972 | |||
| 1900 | 2777019938 | |||
| 1901 | 2784260322 | |||
| 1902 | 2784317343 | |||
| 1903 | 2791925534 | |||
| 1904 | 2792313887 | |||
| 1905 | 2793404323 | |||
| 1906 | 2794594479 | |||
| 1907 | 2807177598 | |||
| 1908 | 2807409797 | |||
| 1909 | 2807458146 | |||
| 1910 | 2808854201 | |||
| 1911 | 2808907008 | |||
| 1912 | 2808923488 | |||
| 1913 | 2808929488 | |||
| 1914 | 2808934233 | |||
| 1915 | 2808939436 | |||
| 1916 | 2808945237 | |||
| 1917 | 2808951404 | |||
| 1918 | 2808960393 | |||
| 1919 | 2808962366 | |||
| 1920 | 2808975481 | |||
| 1921 | 2808990880 | |||
| 1922 | 2808997593 | |||
| 1923 | 2809126375 | |||
| 1924 | 2809215893 | |||
| 1925 | 2812371053 | |||
| 1926 | 2813727218 | |||
| 1927 | 2814694742 | |||
| 1928 | 2817489335 | |||
| 1929 | 2819658507 | |||
| 1930 | 2819702853 | |||
| 1931 | 2821120269 | |||
| 1932 | 2823376081 | |||
| 1933 | 2823423006 | |||
| 1934 | 2825653590 | |||
| 1935 | 2826584245 | |||
| 1936 | 2834029237 | |||
| 1937 | 2842809390 | |||
| 1938 | 2842817930 | |||
| 1939 | 2842828940 | |||
| 1940 | 2842835578 | |||
| 1941 | 2842839851 | |||
| 1942 | 2842847321 | |||
| 1943 | 2842849580 | |||
| 1944 | 2842857147 | |||
| 1945 | 2844428776 | |||
| 1946 | 2844530356 | |||
| 1947 | 2844668676 | |||
| 1948 | 2846040158 | |||
| 1949 | 2846542540 | |||
| 1950 | 2847086078 | |||
| 1951 | 2847798539 | |||
| 1952 | 2852106368 | |||
| 1953 | 2852615284 | |||
| 1954 | 2852658452 | |||
| 1955 | 2852670252 | |||
| 1956 | 2854605670 | |||
| 1957 | 2855199162 | |||
| 1958 | 2858467156 | |||
| 1959 | 2860340513 | |||
| 1960 | 2865016287 | |||
| 1961 | 2869552590 | |||
| 1962 | 2871272993 | |||
| 1963 | 2871284095 | |||
| 1964 | 2876601565 | |||
| 1965 | 2878030915 | |||
| 1966 | 2880231834 | |||
| 1967 | 2881610631 | |||
| 1968 | 2884087449 | |||
| 1969 | 2887633451 | |||
| 1970 | 2888367384 | |||
| 1971 | 2888374918 | |||
| 1972 | 2891672520 | |||
| 1973 | 2894513770 | |||
| 1974 | 2900053395 | |||
| 1975 | 2904478063 | |||
| 1976 | 2904506894 | |||
| 1977 | 2904516905 | |||
| 1978 | 2904520867 | |||
| 1979 | 2904551741 | |||
| 1980 | 2908448145 | |||
| 1981 | 2908672176 | |||
| 1982 | 2912965003 | |||
| 1983 | 2913038021 | |||
| 1984 | 2916181844 | |||
| 1985 | 2917071932 | |||
| 1986 | 2917833705 | |||
| 1987 | 2919064572 | |||
| 1988 | 2919110251 | |||
| 1989 | 2919129124 | |||
| 1990 | 2919153973 | |||
| 1991 | 2919158774 | |||
| 1992 | 2919385960 | |||
| 1993 | 2919458160 | |||
| 1994 | 2919482931 | |||
| 1995 | 2919490746 | |||
| 1996 | 2919497012 | |||
| 1997 | 2919498324 | |||
| 1998 | 2919505602 | |||
| 1999 | 2919538320 | |||
| 2000 | 2919546353 | |||
| 2001 | 2919690037 | |||
| 2002 | 2919700057 | |||
| 2003 | 2923154800 | |||
| 2004 | 2923525160 | |||
| 2005 | 2923529915 | |||
| 2006 | 2923590854 | |||
| 2007 | 2923636317 | |||
| 2008 | 2926067279 | |||
| 2009 | 2927147510 | |||
| 2010 | 2927837200 | |||
| 2011 | 2929145478 | |||
| 2012 | 2929191263 | |||
| 2013 | 2931371184 | |||
| 2014 | 2931392251 | |||
| 2015 | 2931399584 | |||
| 2016 | 2932410240 | |||
| 2017 | 2935354104 | |||
| 2018 | 2935628104 | |||
| 2019 | 2937543788 | |||
| 2020 | 2937970618 | |||
| 2021 | 2939571082 | |||
| 2022 | 2939577189 | |||
| 2023 | 2939582612 | |||
| 2024 | 2939604517 | |||
| 2025 | 2939610138 | |||
| 2026 | 2939620208 | |||
| 2027 | 2939637909 | |||
| 2028 | 2939645185 | |||
| 2029 | 2939653361 | |||
| 2030 | 2945876319 | |||
| 2031 | 2945929320 | |||
| 2032 | 2945951782 | |||
| 2033 | 2945961500 | |||
| 2034 | 2946011593 | |||
| 2035 | 2946029487 | |||
| 2036 | 2947236076 | |||
| 2037 | 2952254376 | |||
| 2038 | 2969080656 | |||
| 2039 | 2969305737 | |||
| 2040 | 2971822030 | |||
| 2041 | 2974292637 | |||
| 2042 | 2974299112 | |||
| 2043 | 2974315370 | |||
| 2044 | 2974439908 | |||
| 2045 | 2978978318 | |||
| 2046 | 2984291229 | |||
| 2047 | 2984495356 | |||
| 2048 | 2984501425 | |||
| 2049 | 2984507932 | |||
| 2050 | 2984563097 | |||
| 2051 | 2984601155 | |||
| 2052 | 2988733016 | |||
| 2053 | 2990200462 | |||
| 2054 | 2990265067 | |||
| 2055 | 2998141177 | |||
| 2056 | 2998348361 | |||
| 2057 | 3000377926 | |||
| 2058 | 3007253886 | |||
| 2059 | 3007317373 | |||
| 2060 | 3007400329 | |||
| 2061 | 3007420809 | |||
| 2062 | 3007512551 | |||
| 2063 | 3007618210 | |||
| 2064 | 3007623005 | |||
| 2065 | 3007720905 | |||
| 2066 | 3007808667 | |||
| 2067 | 3007860474 | |||
| 2068 | 3007863601 | |||
| 2069 | 3007871372 | |||
| 2070 | 3007874468 | |||
| 2071 | 637318547 | |||
| 2072 | 640487525 | |||
| 2073 | 640936343 | |||
| 2074 | 651175466 | |||
| 2075 | 8002745902 | |||
| 2076 | 8004597714 | |||
| 2077 | 8011356803 | |||
| 2078 | 8015397491 | |||
| 2079 | 8015689034 | |||
| 2080 | 8016729902 | |||
| 2081 | 8016734711 | |||
| 2082 | 8018226096 | |||
| 2083 | 8018405945 | |||
| 2084 | 8019503826 | |||
| 2085 | 8019508521 | |||
| 2086 | 8019773413 | |||
| 2087 | 8019776724 | |||
| 2088 | 8029999587 | |||
| 2089 | 8034964065 | |||
| 2090 | 8052495803 | |||
| 2091 | 8054285566 | |||
| 2092 | 8054348314 | |||
| 2093 | 8054359585 | |||
| 2094 | 8054504827 | |||
| 2095 | 8054847809 | |||
| 2096 | 8054853478 | |||
| 2097 | 8054929612 | |||
| 2098 | 8055088791 | |||
| 2099 | 8055097087 | |||
| 2100 | 8055101059 | |||
| 2101 | 8055694728 | |||
| 2102 | 8055772153 | |||
| 2103 | 8055819272 | |||
| 2104 | 8055884328 | |||
| 2105 | 8056120135 | |||
| 2106 | 8056121982 | |||
| 2107 | 8056127255 | |||
| 2108 | 8056133190 | |||
| 2109 | 8056141749 | |||
| 2110 | 8056147801 | |||
| 2111 | 8056149438 | |||
| 2112 | 8056159593 | |||
| 2113 | 8056164600 | |||
| 2114 | 8056169877 | |||
| 2115 | 8056176004 | |||
| 2116 | 8056180406 | |||
| 2117 | 8056569828 | |||
| 2118 | 8057163175 | |||
| 2119 | 8057304976 | |||
| 2120 | 8057803442 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy