F489271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1060 | 459 | 2110 | 365 |
Family's Representative Sequence
| Representative Sequence | 3300031249|Ga0265339_10006627|Ga0265339_100066272 |
| Length | 451 |
| Sequence | MKRRDFIKVTGIGAAAAASIAAPAIAQSMPELKWRMTTSWPKSLDTLHGAAEVMAKVVGEATDNKFQIQTFAAGEIVPGLQVLDAVQNGTVEMGHTASYYYFGKDPTFTFGSSIPFGPNARLNQAWYMLGGGKELLNEFYKGYNVTSLLAGNTTCQMGGWFRKEINTVADLQGLKFRIGGFAGRVMQKLGCVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGLYKVAPHYYYPGWWEGGPMLLAMINLDKWNGLPKYYQNILEQAGHLANNWMMAKYDTVNPSALKKLLAGGAKLHGFSQPIMEASFKAARELHAEVAATNPNFQLGLSVVPGRRSRLRQLHGAPRADLGREPIKTRWIAACPFLAIGTDRPPSEDAISAAKTLPRPPHAPAPPGKNSAVGNRSESRVLPRRSSEASCDRDRARRAPGCRCCRQRAAPHSVRRGSRRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 98 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 99 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 134 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 135 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 136 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 233 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 272 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 273 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 364 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 365 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 366 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 372 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 373 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 374 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 375 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 376 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 377 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 378 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 379 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 410 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 413 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 415 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 416 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 431 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 432 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 434 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 435 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 436 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 437 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 438 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 439 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 440 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 443 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 444 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 445 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 449 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 451 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 452 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 453 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 454 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 455 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 456 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 459 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.28 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.51 |
| Nodule | 1.7 |
| Rhizoplane | 6.7 |
| Rhizosphere | 75.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265339_10006627 | 3300031249 | Bacteria | 7574 |
| 2 | JGI24744J21845_10020808 | 3300002077 | Bacteria | 1292 |
| 3 | JGI25159J45721_1005354 | 3300002987 | Bacteria | 4042 |
| 4 | JGI25406J46586_10000107 | 3300003203 | Bacteria | 37037 |
| 5 | JGI25406J46586_10005606 | 3300003203 | Bacteria | 5812 |
| 6 | JGI25160J50197_1006152 | 3300003354 | Bacteria | 4887 |
| 7 | JGI25160J50197_1009539 | 3300003354 | Bacteria | 3588 |
| 8 | JGI25161J50226_1003761 | 3300003374 | Bacteria | 3367 |
| 9 | Ga0055526_1012505 | 3300003771 | Bacteria | 3693 |
| 10 | Ga0055537_1004285 | 3300003773 | Bacteria | 4112 |
| 11 | Ga0055524_1000027 | 3300003775 | Bacteria | 213655 |
| 12 | Ga0055524_1001507 | 3300003775 | Bacteria | 13205 |
| 13 | Ga0055534_1001016 | 3300003784 | Bacteria | 12322 |
| 14 | Ga0055530_10020158 | 3300003791 | Bacteria | 2001 |
| 15 | Ga0055531_10003173 | 3300003794 | Bacteria | 10574 |
| 16 | Ga0055531_10004688 | 3300003794 | Bacteria | 8193 |
| 17 | Ga0055543_1007517 | 3300004625 | Bacteria | 2506 |
| 18 | Ga0065165_1000187 | 3300005262 | Bacteria | 108694 |
| 19 | Ga0065165_1013117 | 3300005262 | Bacteria | 3317 |
| 20 | Ga0070658_10378234 | 3300005327 | Bacteria | 1214 |
| 21 | Ga0070683_100038935 | 3300005329 | Bacteria | 4361 |
| 22 | Ga0070683_100201913 | 3300005329 | Bacteria | 1888 |
| 23 | Ga0070670_100069923 | 3300005331 | Bacteria | 3013 |
| 24 | Ga0068869_100057326 | 3300005334 | Bacteria | 2843 |
| 25 | Ga0068869_100294375 | 3300005334 | Bacteria | 1309 |
| 26 | Ga0070666_10003036 | 3300005335 | Bacteria | 10187 |
| 27 | Ga0070680_100012506 | 3300005336 | Bacteria | 6597 |
| 28 | Ga0070682_100021605 | 3300005337 | Bacteria | 3801 |
| 29 | Ga0068868_100065593 | 3300005338 | Bacteria | 2885 |
| 30 | Ga0068868_100156211 | 3300005338 | Bacteria | 1881 |
| 31 | Ga0070691_10092090 | 3300005341 | Bacteria | 1496 |
| 32 | Ga0070661_100046186 | 3300005344 | Bacteria | 3186 |
| 33 | Ga0070692_10040747 | 3300005345 | Bacteria | 2377 |
| 34 | Ga0070668_100077274 | 3300005347 | Bacteria | 2602 |
| 35 | Ga0070668_100102574 | 3300005347 | Bacteria | 2268 |
| 36 | Ga0070668_100122322 | 3300005347 | Bacteria | 2081 |
| 37 | Ga0070669_100072612 | 3300005353 | Bacteria | 2548 |
| 38 | Ga0070669_100125977 | 3300005353 | Bacteria | 1960 |
| 39 | Ga0070675_100180760 | 3300005354 | Bacteria | 1824 |
| 40 | Ga0070671_100014401 | 3300005355 | Bacteria | 6389 |
| 41 | Ga0070671_100018526 | 3300005355 | Bacteria | 5656 |
| 42 | Ga0070671_100403274 | 3300005355 | Bacteria | 1170 |
| 43 | Ga0070674_100011939 | 3300005356 | Bacteria | 5312 |
| 44 | Ga0070674_100235081 | 3300005356 | Bacteria | 1432 |
| 45 | Ga0070688_100012440 | 3300005365 | Bacteria | 4769 |
| 46 | Ga0070659_100207023 | 3300005366 | Bacteria | 1616 |
| 47 | Ga0070667_100057909 | 3300005367 | Bacteria | 3276 |
| 48 | Ga0070709_10007278 | 3300005434 | Bacteria | 6065 |
| 49 | Ga0070709_10007833 | 3300005434 | Bacteria | 5865 |
| 50 | Ga0070709_10056068 | 3300005434 | Bacteria | 2490 |
| 51 | Ga0070709_10198288 | 3300005434 | Bacteria | 1420 |
| 52 | Ga0070714_100019413 | 3300005435 | Bacteria | 5538 |
| 53 | Ga0070714_100023632 | 3300005435 | Bacteria | 5052 |
| 54 | Ga0070714_100314626 | 3300005435 | Bacteria | 1463 |
| 55 | Ga0070713_100000654 | 3300005436 | Bacteria | 22167 |
| 56 | Ga0070713_100004079 | 3300005436 | Bacteria | 9728 |
| 57 | Ga0070713_100023546 | 3300005436 | Bacteria | 4780 |
| 58 | Ga0070713_100031411 | 3300005436 | Bacteria | 4230 |
| 59 | Ga0070713_100154904 | 3300005436 | Bacteria | 2042 |
| 60 | Ga0070710_10000619 | 3300005437 | Bacteria | 16925 |
| 61 | Ga0070710_10000725 | 3300005437 | Bacteria | 15717 |
| 62 | Ga0070710_10003810 | 3300005437 | Bacteria | 7134 |
| 63 | Ga0070710_10010571 | 3300005437 | Bacteria | 4536 |
| 64 | Ga0070710_10105365 | 3300005437 | Bacteria | 1685 |
| 65 | Ga0070701_10114761 | 3300005438 | Bacteria | 1510 |
| 66 | Ga0070711_100002407 | 3300005439 | Bacteria | 10674 |
| 67 | Ga0070711_100013681 | 3300005439 | Bacteria | 5099 |
| 68 | Ga0070711_100016017 | 3300005439 | Bacteria | 4752 |
| 69 | Ga0070711_100024301 | 3300005439 | Bacteria | 3951 |
| 70 | Ga0070711_100091624 | 3300005439 | Bacteria | 2192 |
| 71 | Ga0070711_100186005 | 3300005439 | Bacteria | 1593 |
| 72 | Ga0070700_100218815 | 3300005441 | Bacteria | 1348 |
| 73 | Ga0070663_100033696 | 3300005455 | Bacteria | 3540 |
| 74 | Ga0070663_100053685 | 3300005455 | Bacteria | 2878 |
| 75 | Ga0070663_100067051 | 3300005455 | Bacteria | 2602 |
| 76 | Ga0070678_100001526 | 3300005456 | Bacteria | 12364 |
| 77 | Ga0070678_100056721 | 3300005456 | Bacteria | 2866 |
| 78 | Ga0070678_100246315 | 3300005456 | Bacteria | 1497 |
| 79 | Ga0070662_100109629 | 3300005457 | Bacteria | 2101 |
| 80 | Ga0070662_100111646 | 3300005457 | Bacteria | 2083 |
| 81 | Ga0070681_10116684 | 3300005458 | Bacteria | 2606 |
| 82 | Ga0070681_10203693 | 3300005458 | Bacteria | 1896 |
| 83 | Ga0068867_100158819 | 3300005459 | Bacteria | 1781 |
| 84 | Ga0070706_100062316 | 3300005467 | Bacteria | 3446 |
| 85 | Ga0070706_100142083 | 3300005467 | Bacteria | 2240 |
| 86 | Ga0070698_100145193 | 3300005471 | Bacteria | 2323 |
| 87 | Ga0070699_100016195 | 3300005518 | Bacteria | 6399 |
| 88 | Ga0070679_100002694 | 3300005530 | Bacteria | 16173 |
| 89 | Ga0070679_100003367 | 3300005530 | Bacteria | 14649 |
| 90 | Ga0070679_100105547 | 3300005530 | Bacteria | 2803 |
| 91 | Ga0070679_100152364 | 3300005530 | Bacteria | 2288 |
| 92 | Ga0070684_100000621 | 3300005535 | Bacteria | 24483 |
| 93 | Ga0070684_100051868 | 3300005535 | Bacteria | 3565 |
| 94 | Ga0070684_100072695 | 3300005535 | Bacteria | 3028 |
| 95 | Ga0070684_100181949 | 3300005535 | Bacteria | 1911 |
| 96 | Ga0068853_100042614 | 3300005539 | Bacteria | 3882 |
| 97 | Ga0068853_100065063 | 3300005539 | Bacteria | 3163 |
| 98 | Ga0070686_100025190 | 3300005544 | Bacteria | 3577 |
| 99 | Ga0070665_100063530 | 3300005548 | Bacteria | 3702 |
| 100 | Ga0070665_100075446 | 3300005548 | Bacteria | 3379 |
| 101 | Ga0070665_100129720 | 3300005548 | Bacteria | 2523 |
| 102 | Ga0070665_100152976 | 3300005548 | Bacteria | 2309 |
| 103 | Ga0068855_100017251 | 3300005563 | Bacteria | 8689 |
| 104 | Ga0068855_100049447 | 3300005563 | Bacteria | 4959 |
| 105 | Ga0068855_100061782 | 3300005563 | Bacteria | 4376 |
| 106 | Ga0068855_100225009 | 3300005563 | Bacteria | 2103 |
| 107 | Ga0068855_100298739 | 3300005563 | Bacteria | 1784 |
| 108 | Ga0070664_100012468 | 3300005564 | Bacteria | 6910 |
| 109 | Ga0068857_100180340 | 3300005577 | Bacteria | 1922 |
| 110 | Ga0068854_100049257 | 3300005578 | Bacteria | 3008 |
| 111 | Ga0068854_100155644 | 3300005578 | Bacteria | 1766 |
| 112 | Ga0068856_100006276 | 3300005614 | Bacteria | 11671 |
| 113 | Ga0068856_100033823 | 3300005614 | Bacteria | 5006 |
| 114 | Ga0068856_100100869 | 3300005614 | Bacteria | 2879 |
| 115 | Ga0068856_100116369 | 3300005614 | Bacteria | 2674 |
| 116 | Ga0068856_100162134 | 3300005614 | Bacteria | 2246 |
| 117 | Ga0070702_100119426 | 3300005615 | Bacteria | 1648 |
| 118 | Ga0070702_100229466 | 3300005615 | Bacteria | 1246 |
| 119 | Ga0068852_100014911 | 3300005616 | Bacteria | 6005 |
| 120 | Ga0068852_100029395 | 3300005616 | Bacteria | 4515 |
| 121 | Ga0068852_100087741 | 3300005616 | Bacteria | 2776 |
| 122 | Ga0068852_100169964 | 3300005616 | Bacteria | 2043 |
| 123 | Ga0068852_100312122 | 3300005616 | Bacteria | 1525 |
| 124 | Ga0068859_100035622 | 3300005617 | Bacteria | 4994 |
| 125 | Ga0068859_100050138 | 3300005617 | Bacteria | 4193 |
| 126 | Ga0068864_100034639 | 3300005618 | Bacteria | 4295 |
| 127 | Ga0068864_100066071 | 3300005618 | Bacteria | 3138 |
| 128 | Ga0068864_100173219 | 3300005618 | Bacteria | 1969 |
| 129 | Ga0068866_10024805 | 3300005718 | Bacteria | 2811 |
| 130 | Ga0068861_100176954 | 3300005719 | Bacteria | 1772 |
| 131 | Ga0068851_10032548 | 3300005834 | Bacteria | 2594 |
| 132 | Ga0068863_100032539 | 3300005841 | Bacteria | 4970 |
| 133 | Ga0068863_100217006 | 3300005841 | Bacteria | 1842 |
| 134 | Ga0068863_100400900 | 3300005841 | Bacteria | 1342 |
| 135 | Ga0068858_100112856 | 3300005842 | Bacteria | 2538 |
| 136 | Ga0068858_100148950 | 3300005842 | Bacteria | 2199 |
| 137 | Ga0068860_100075752 | 3300005843 | Bacteria | 3200 |
| 138 | Ga0068862_100062346 | 3300005844 | Bacteria | 3206 |
| 139 | Ga0068862_100122830 | 3300005844 | Bacteria | 2290 |
| 140 | Ga0081455_10002932 | 3300005937 | Bacteria | 19999 |
| 141 | Ga0081455_10004237 | 3300005937 | Bacteria | 16172 |
| 142 | Ga0081455_10008523 | 3300005937 | Bacteria | 10645 |
| 143 | Ga0081455_10020159 | 3300005937 | Bacteria | 6290 |
| 144 | Ga0081455_10040732 | 3300005937 | Bacteria | 4094 |
| 145 | Ga0081455_10097899 | 3300005937 | Bacteria | 2363 |
| 146 | Ga0081538_10077591 | 3300005981 | Bacteria | 1788 |
| 147 | Ga0081540_1002792 | 3300005983 | Bacteria | 14160 |
| 148 | Ga0081540_1004157 | 3300005983 | Bacteria | 11154 |
| 149 | Ga0081540_1004412 | 3300005983 | Bacteria | 10739 |
| 150 | Ga0081540_1011890 | 3300005983 | Bacteria | 5777 |
| 151 | Ga0081540_1013019 | 3300005983 | Bacteria | 5433 |
| 152 | Ga0081540_1015177 | 3300005983 | Bacteria | 4889 |
| 153 | Ga0081540_1034570 | 3300005983 | Bacteria | 2723 |
| 154 | Ga0081540_1047327 | 3300005983 | Bacteria | 2164 |
| 155 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 156 | Ga0081539_10000148 | 3300005985 | Bacteria | 163442 |
| 157 | Ga0081539_10029652 | 3300005985 | Bacteria | 3412 |
| 158 | Ga0081539_10099458 | 3300005985 | Bacteria | 1485 |
| 159 | Ga0070717_10009594 | 3300006028 | Bacteria | 7281 |
| 160 | Ga0070717_10074234 | 3300006028 | Bacteria | 2842 |
| 161 | Ga0070717_10145777 | 3300006028 | Bacteria | 2045 |
| 162 | Ga0075365_10007541 | 3300006038 | Bacteria | 6106 |
| 163 | Ga0075365_10096491 | 3300006038 | Bacteria | 2020 |
| 164 | Ga0075365_10144684 | 3300006038 | Bacteria | 1651 |
| 165 | Ga0075363_100030733 | 3300006048 | Bacteria | 2781 |
| 166 | Ga0075363_100036522 | 3300006048 | Bacteria | 2577 |
| 167 | Ga0075364_10041920 | 3300006051 | Bacteria | 2973 |
| 168 | Ga0075364_10090179 | 3300006051 | Bacteria | 2033 |
| 169 | Ga0075432_10000491 | 3300006058 | Bacteria | 11809 |
| 170 | Ga0070715_10004128 | 3300006163 | Bacteria | 4723 |
| 171 | Ga0070715_10011486 | 3300006163 | Bacteria | 3191 |
| 172 | Ga0070715_10017678 | 3300006163 | Bacteria | 2703 |
| 173 | Ga0070716_100001675 | 3300006173 | Bacteria | 9998 |
| 174 | Ga0070716_100002224 | 3300006173 | Bacteria | 8938 |
| 175 | Ga0070716_100003768 | 3300006173 | Bacteria | 7180 |
| 176 | Ga0070712_100060483 | 3300006175 | Bacteria | 2672 |
| 177 | Ga0070712_100086848 | 3300006175 | Bacteria | 2281 |
| 178 | Ga0070712_100092989 | 3300006175 | Bacteria | 2213 |
| 179 | Ga0070712_100127347 | 3300006175 | Bacteria | 1925 |
| 180 | Ga0075362_10002041 | 3300006177 | Bacteria | 6657 |
| 181 | Ga0075362_10003906 | 3300006177 | Bacteria | 5293 |
| 182 | Ga0075362_10013039 | 3300006177 | Bacteria | 3316 |
| 183 | Ga0075362_10041562 | 3300006177 | Bacteria | 2029 |
| 184 | Ga0075367_10020499 | 3300006178 | Bacteria | 3683 |
| 185 | Ga0075367_10023743 | 3300006178 | Bacteria | 3453 |
| 186 | Ga0075367_10117108 | 3300006178 | Bacteria | 1639 |
| 187 | Ga0075369_10000420 | 3300006186 | Bacteria | 12842 |
| 188 | Ga0075369_10036016 | 3300006186 | Bacteria | 2105 |
| 189 | Ga0075369_10075292 | 3300006186 | Bacteria | 1490 |
| 190 | Ga0075366_10049089 | 3300006195 | Bacteria | 2504 |
| 191 | Ga0097621_100001495 | 3300006237 | Bacteria | 16032 |
| 192 | Ga0097621_100041011 | 3300006237 | Bacteria | 3724 |
| 193 | Ga0075370_10013923 | 3300006353 | Bacteria | 4280 |
| 194 | Ga0075370_10051208 | 3300006353 | Bacteria | 2342 |
| 195 | Ga0075370_10060809 | 3300006353 | Bacteria | 2152 |
| 196 | Ga0075370_10069111 | 3300006353 | Bacteria | 2018 |
| 197 | Ga0068871_100018020 | 3300006358 | Bacteria | 5358 |
| 198 | Ga0068871_100345134 | 3300006358 | Bacteria | 1315 |
| 199 | Ga0075428_100012516 | 3300006844 | Bacteria | 9435 |
| 200 | Ga0075428_100117276 | 3300006844 | Bacteria | 2900 |
| 201 | Ga0075430_100007118 | 3300006846 | Bacteria | 9435 |
| 202 | Ga0075430_100170848 | 3300006846 | Bacteria | 1809 |
| 203 | Ga0075431_100008980 | 3300006847 | Bacteria | 10018 |
| 204 | Ga0075431_100105225 | 3300006847 | Bacteria | 2912 |
| 205 | Ga0075433_10003920 | 3300006852 | Bacteria | 11526 |
| 206 | Ga0075433_10118939 | 3300006852 | Bacteria | 2345 |
| 207 | Ga0075433_10162203 | 3300006852 | Bacteria | 1990 |
| 208 | Ga0075434_100012465 | 3300006871 | Bacteria | 8063 |
| 209 | Ga0075434_100053856 | 3300006871 | Bacteria | 3997 |
| 210 | Ga0075434_100060206 | 3300006871 | Bacteria | 3776 |
| 211 | Ga0075434_100108266 | 3300006871 | Bacteria | 2789 |
| 212 | Ga0075429_100006654 | 3300006880 | Bacteria | 10018 |
| 213 | Ga0068865_100022754 | 3300006881 | Bacteria | 4093 |
| 214 | Ga0068865_100075715 | 3300006881 | Bacteria | 2400 |
| 215 | Ga0068865_100152278 | 3300006881 | Bacteria | 1756 |
| 216 | Ga0097620_100035614 | 3300006931 | Bacteria | 4994 |
| 217 | Ga0097620_100050136 | 3300006931 | Bacteria | 4193 |
| 218 | Ga0099822_1008625 | 3300006943 | Bacteria | 13004 |
| 219 | Ga0099823_1055427 | 3300006944 | Bacteria | 2247 |
| 220 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 221 | Ga0075435_100023709 | 3300007076 | Bacteria | 4751 |
| 222 | Ga0075435_100038135 | 3300007076 | Bacteria | 3830 |
| 223 | Ga0099794_10017092 | 3300007265 | Bacteria | 3228 |
| 224 | Ga0099795_10004340 | 3300007788 | Bacteria | 3646 |
| 225 | Ga0105251_10019476 | 3300009011 | Bacteria | 3584 |
| 226 | Ga0105240_10001465 | 3300009093 | Bacteria | 40343 |
| 227 | Ga0105240_10005244 | 3300009093 | Bacteria | 19360 |
| 228 | Ga0105240_10108493 | 3300009093 | Bacteria | 3363 |
| 229 | Ga0105240_10199716 | 3300009093 | Bacteria | 2344 |
| 230 | Ga0105240_10241035 | 3300009093 | Bacteria | 2096 |
| 231 | Ga0105240_10294766 | 3300009093 | Bacteria | 1858 |
| 232 | Ga0105240_10525974 | 3300009093 | Bacteria | 1312 |
| 233 | Ga0111539_10168243 | 3300009094 | Bacteria | 2562 |
| 234 | Ga0105245_10035400 | 3300009098 | Bacteria | 4431 |
| 235 | Ga0105245_10101657 | 3300009098 | Bacteria | 2661 |
| 236 | Ga0105245_10127164 | 3300009098 | Bacteria | 2387 |
| 237 | Ga0105245_10214607 | 3300009098 | Bacteria | 1854 |
| 238 | Ga0105247_10006238 | 3300009101 | Bacteria | 7394 |
| 239 | Ga0105247_10034815 | 3300009101 | Bacteria | 3067 |
| 240 | Ga0105247_10077827 | 3300009101 | Bacteria | 2085 |
| 241 | Ga0114129_10046884 | 3300009147 | Bacteria | 6074 |
| 242 | Ga0114129_10116035 | 3300009147 | Bacteria | 3689 |
| 243 | Ga0114129_10238278 | 3300009147 | Bacteria | 2447 |
| 244 | Ga0114129_10485646 | 3300009147 | Bacteria | 1615 |
| 245 | Ga0105243_10124740 | 3300009148 | Bacteria | 2176 |
| 246 | Ga0105243_10144557 | 3300009148 | Bacteria | 2033 |
| 247 | Ga0105243_10378322 | 3300009148 | Bacteria | 1309 |
| 248 | Ga0105242_10026017 | 3300009176 | Bacteria | 4635 |
| 249 | Ga0105248_10236306 | 3300009177 | Bacteria | 2057 |
| 250 | Ga0105248_10282782 | 3300009177 | Bacteria | 1868 |
| 251 | Ga0105248_10456698 | 3300009177 | Bacteria | 1440 |
| 252 | Ga0105237_10022354 | 3300009545 | Bacteria | 6490 |
| 253 | Ga0105237_10027674 | 3300009545 | Bacteria | 5781 |
| 254 | Ga0105237_10027794 | 3300009545 | Bacteria | 5765 |
| 255 | Ga0105237_10089708 | 3300009545 | Bacteria | 3063 |
| 256 | Ga0105237_10383296 | 3300009545 | Bacteria | 1411 |
| 257 | Ga0105238_10071296 | 3300009551 | Bacteria | 3472 |
| 258 | Ga0105238_10077832 | 3300009551 | Bacteria | 3307 |
| 259 | Ga0105238_10223182 | 3300009551 | Bacteria | 1861 |
| 260 | Ga0105238_10251991 | 3300009551 | Bacteria | 1744 |
| 261 | Ga0105249_10236354 | 3300009553 | Bacteria | 1804 |
| 262 | Ga0099796_10017191 | 3300010159 | Bacteria | 2149 |
| 263 | Ga0105239_10057074 | 3300010375 | Bacteria | 4283 |
| 264 | Ga0105239_10115805 | 3300010375 | Bacteria | 2973 |
| 265 | Ga0105239_10120704 | 3300010375 | Bacteria | 2911 |
| 266 | Ga0105239_10161677 | 3300010375 | Bacteria | 2502 |
| 267 | Ga0105239_10254643 | 3300010375 | Bacteria | 1972 |
| 268 | Ga0105239_10408433 | 3300010375 | Bacteria | 1537 |
| 269 | Ga0105239_10583852 | 3300010375 | Bacteria | 1274 |
| 270 | Ga0105246_10022551 | 3300011119 | Bacteria | 4063 |
| 271 | Ga0105246_10026712 | 3300011119 | Bacteria | 3776 |
| 272 | Ga0105246_10232685 | 3300011119 | Bacteria | 1452 |
| 273 | Ga0157371_10039643 | 3300013102 | Bacteria | 3368 |
| 274 | Ga0157370_10044798 | 3300013104 | Bacteria | 4249 |
| 275 | Ga0157369_10014950 | 3300013105 | Bacteria | 8760 |
| 276 | Ga0157369_10084587 | 3300013105 | Bacteria | 3391 |
| 277 | Ga0157374_10010342 | 3300013296 | Bacteria | 8025 |
| 278 | Ga0157374_10112011 | 3300013296 | Bacteria | 2626 |
| 279 | Ga0157374_10162798 | 3300013296 | Bacteria | 2173 |
| 280 | Ga0157374_10189133 | 3300013296 | Bacteria | 2013 |
| 281 | Ga0157378_10007029 | 3300013297 | Bacteria | 9823 |
| 282 | Ga0157378_10120601 | 3300013297 | Bacteria | 2417 |
| 283 | Ga0163162_10018426 | 3300013306 | Bacteria | 6840 |
| 284 | Ga0163162_10043821 | 3300013306 | Bacteria | 4480 |
| 285 | Ga0163162_10187543 | 3300013306 | Bacteria | 2195 |
| 286 | Ga0163162_10219894 | 3300013306 | Bacteria | 2029 |
| 287 | Ga0163162_10240105 | 3300013306 | Bacteria | 1943 |
| 288 | Ga0157372_10050726 | 3300013307 | Bacteria | 4615 |
| 289 | Ga0157372_10069033 | 3300013307 | Bacteria | 3975 |
| 290 | Ga0157372_10506932 | 3300013307 | Bacteria | 1407 |
| 291 | Ga0157375_10007832 | 3300013308 | Bacteria | 9349 |
| 292 | Ga0157375_10037712 | 3300013308 | Bacteria | 4633 |
| 293 | Ga0157375_10049724 | 3300013308 | Bacteria | 4109 |
| 294 | Ga0157375_10200926 | 3300013308 | Bacteria | 2149 |
| 295 | Ga0157375_10221839 | 3300013308 | Bacteria | 2049 |
| 296 | Ga0163163_10039428 | 3300014325 | Bacteria | 4609 |
| 297 | Ga0163163_10221585 | 3300014325 | Bacteria | 1940 |
| 298 | Ga0157380_10200443 | 3300014326 | Bacteria | 1770 |
| 299 | Ga0157377_10016274 | 3300014745 | Bacteria | 3822 |
| 300 | Ga0157377_10070526 | 3300014745 | Bacteria | 2019 |
| 301 | Ga0157379_10005524 | 3300014968 | Bacteria | 10862 |
| 302 | Ga0157379_10089518 | 3300014968 | Bacteria | 2761 |
| 303 | Ga0157379_10189085 | 3300014968 | Bacteria | 1861 |
| 304 | Ga0157376_10016269 | 3300014969 | Bacteria | 5641 |
| 305 | Ga0157376_10023498 | 3300014969 | Bacteria | 4825 |
| 306 | Ga0157376_10154222 | 3300014969 | Bacteria | 2075 |
| 307 | Ga0157376_10243057 | 3300014969 | Bacteria | 1678 |
| 308 | Ga0157376_10259526 | 3300014969 | Bacteria | 1627 |
| 309 | Ga0163161_10019886 | 3300017792 | Bacteria | 4709 |
| 310 | Ga0163161_10159533 | 3300017792 | Bacteria | 1719 |
| 311 | Ga0206349_1737788 | 3300020075 | Bacteria | 1186 |
| 312 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 313 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 314 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 315 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 316 | Ga0213876_10000453 | 3300021384 | Bacteria | 33103 |
| 317 | Ga0224712_10025112 | 3300022467 | Bacteria | 2091 |
| 318 | Ga0209436_109541 | 3300025208 | Bacteria | 1838 |
| 319 | Ga0207425_1000062 | 3300025245 | Bacteria | 136118 |
| 320 | Ga0209233_1002966 | 3300025261 | Bacteria | 6052 |
| 321 | Ga0209565_1000608 | 3300025263 | Bacteria | 23858 |
| 322 | Ga0209130_1000191 | 3300025284 | Bacteria | 85239 |
| 323 | Ga0209130_1006139 | 3300025284 | Bacteria | 3966 |
| 324 | Ga0209130_1015904 | 3300025284 | Bacteria | 1838 |
| 325 | Ga0209675_1002903 | 3300025291 | Bacteria | 8481 |
| 326 | Ga0209564_1001379 | 3300025295 | Bacteria | 25334 |
| 327 | Ga0209564_1003158 | 3300025295 | Bacteria | 11599 |
| 328 | Ga0209564_1021361 | 3300025295 | Bacteria | 2331 |
| 329 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 330 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 331 | Ga0209758_1001914 | 3300025297 | Bacteria | 22658 |
| 332 | Ga0209758_1003656 | 3300025297 | Bacteria | 13704 |
| 333 | Ga0209758_1003852 | 3300025297 | Bacteria | 13164 |
| 334 | Ga0209050_1000064 | 3300025298 | Bacteria | 314803 |
| 335 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 336 | Ga0209256_1002763 | 3300025299 | Bacteria | 13536 |
| 337 | Ga0209256_1004276 | 3300025299 | Bacteria | 9114 |
| 338 | Ga0207426_1013675 | 3300025302 | Bacteria | 2997 |
| 339 | Ga0209051_1014434 | 3300025303 | Bacteria | 3687 |
| 340 | Ga0209051_1029847 | 3300025303 | Bacteria | 2126 |
| 341 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 342 | Ga0209257_1000416 | 3300025304 | Bacteria | 82474 |
| 343 | Ga0209257_1000998 | 3300025304 | Bacteria | 38347 |
| 344 | Ga0209257_1023876 | 3300025304 | Bacteria | 2134 |
| 345 | Ga0207697_10020898 | 3300025315 | Bacteria | 2680 |
| 346 | Ga0207697_10034422 | 3300025315 | Bacteria | 2074 |
| 347 | Ga0207656_10015225 | 3300025321 | Bacteria | 2974 |
| 348 | Ga0207692_10001466 | 3300025898 | Bacteria | 8837 |
| 349 | Ga0207692_10007323 | 3300025898 | Bacteria | 4519 |
| 350 | Ga0207692_10026000 | 3300025898 | Bacteria | 2742 |
| 351 | Ga0207692_10034637 | 3300025898 | Bacteria | 2446 |
| 352 | Ga0207692_10155647 | 3300025898 | Bacteria | 1313 |
| 353 | Ga0207642_10052492 | 3300025899 | Bacteria | 1850 |
| 354 | Ga0207642_10121474 | 3300025899 | Bacteria | 1348 |
| 355 | Ga0207710_10005963 | 3300025900 | Bacteria | 5227 |
| 356 | Ga0207710_10012937 | 3300025900 | Bacteria | 3515 |
| 357 | Ga0207710_10027372 | 3300025900 | Bacteria | 2468 |
| 358 | Ga0207710_10054759 | 3300025900 | Bacteria | 1797 |
| 359 | Ga0207688_10067989 | 3300025901 | Bacteria | 2016 |
| 360 | Ga0207680_10038154 | 3300025903 | Bacteria | 2780 |
| 361 | Ga0207647_10028229 | 3300025904 | Bacteria | 3648 |
| 362 | Ga0207647_10068423 | 3300025904 | Bacteria | 2150 |
| 363 | Ga0207685_10014351 | 3300025905 | Bacteria | 2478 |
| 364 | Ga0207699_10004660 | 3300025906 | Bacteria | 6557 |
| 365 | Ga0207699_10011040 | 3300025906 | Bacteria | 4550 |
| 366 | Ga0207699_10015027 | 3300025906 | Bacteria | 4011 |
| 367 | Ga0207699_10016282 | 3300025906 | Bacteria | 3885 |
| 368 | Ga0207699_10174078 | 3300025906 | Bacteria | 1442 |
| 369 | Ga0207699_10198413 | 3300025906 | Bacteria | 1358 |
| 370 | Ga0207643_10047788 | 3300025908 | Bacteria | 2423 |
| 371 | Ga0207643_10052253 | 3300025908 | Bacteria | 2320 |
| 372 | Ga0207705_10013315 | 3300025909 | Bacteria | 5935 |
| 373 | Ga0207684_10025013 | 3300025910 | Bacteria | 5089 |
| 374 | Ga0207684_10125590 | 3300025910 | Bacteria | 2201 |
| 375 | Ga0207684_10155625 | 3300025910 | Bacteria | 1967 |
| 376 | Ga0207654_10026674 | 3300025911 | Bacteria | 3131 |
| 377 | Ga0207654_10030221 | 3300025911 | Bacteria | 2972 |
| 378 | Ga0207654_10059805 | 3300025911 | Bacteria | 2224 |
| 379 | Ga0207654_10087440 | 3300025911 | Bacteria | 1891 |
| 380 | Ga0207654_10116434 | 3300025911 | Bacteria | 1671 |
| 381 | Ga0207707_10000826 | 3300025912 | Bacteria | 30384 |
| 382 | Ga0207707_10007843 | 3300025912 | Bacteria | 9281 |
| 383 | Ga0207707_10027522 | 3300025912 | Bacteria | 4971 |
| 384 | Ga0207707_10059293 | 3300025912 | Bacteria | 3330 |
| 385 | Ga0207707_10374125 | 3300025912 | Bacteria | 1225 |
| 386 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 387 | Ga0207695_10000548 | 3300025913 | Bacteria | 77673 |
| 388 | Ga0207695_10142986 | 3300025913 | Bacteria | 2339 |
| 389 | Ga0207671_10002452 | 3300025914 | Bacteria | 19841 |
| 390 | Ga0207671_10008611 | 3300025914 | Bacteria | 8622 |
| 391 | Ga0207671_10040916 | 3300025914 | Bacteria | 3430 |
| 392 | Ga0207671_10149254 | 3300025914 | Bacteria | 1805 |
| 393 | Ga0207671_10149570 | 3300025914 | Bacteria | 1804 |
| 394 | Ga0207693_10001694 | 3300025915 | Bacteria | 19413 |
| 395 | Ga0207693_10049013 | 3300025915 | Bacteria | 3317 |
| 396 | Ga0207693_10082251 | 3300025915 | Bacteria | 2521 |
| 397 | Ga0207663_10000319 | 3300025916 | Bacteria | 20997 |
| 398 | Ga0207663_10002033 | 3300025916 | Bacteria | 9618 |
| 399 | Ga0207663_10003305 | 3300025916 | Bacteria | 7865 |
| 400 | Ga0207663_10014660 | 3300025916 | Bacteria | 4300 |
| 401 | Ga0207663_10045074 | 3300025916 | Bacteria | 2710 |
| 402 | Ga0207663_10155315 | 3300025916 | Bacteria | 1609 |
| 403 | Ga0207663_10185182 | 3300025916 | Bacteria | 1490 |
| 404 | Ga0207660_10020422 | 3300025917 | Bacteria | 4444 |
| 405 | Ga0207660_10137146 | 3300025917 | Bacteria | 1868 |
| 406 | Ga0207657_10005175 | 3300025919 | Bacteria | 13681 |
| 407 | Ga0207657_10018400 | 3300025919 | Bacteria | 6669 |
| 408 | Ga0207657_10096872 | 3300025919 | Bacteria | 2454 |
| 409 | Ga0207657_10139466 | 3300025919 | Bacteria | 1982 |
| 410 | Ga0207649_10015177 | 3300025920 | Bacteria | 4326 |
| 411 | Ga0207652_10005120 | 3300025921 | Bacteria | 10636 |
| 412 | Ga0207652_10007205 | 3300025921 | Bacteria | 8973 |
| 413 | Ga0207652_10010590 | 3300025921 | Bacteria | 7422 |
| 414 | Ga0207652_10020097 | 3300025921 | Bacteria | 5499 |
| 415 | Ga0207652_10109279 | 3300025921 | Bacteria | 2451 |
| 416 | Ga0207681_10172077 | 3300025923 | Bacteria | 1642 |
| 417 | Ga0207694_10009346 | 3300025924 | Bacteria | 7396 |
| 418 | Ga0207694_10019168 | 3300025924 | Bacteria | 5172 |
| 419 | Ga0207694_10046298 | 3300025924 | Bacteria | 3362 |
| 420 | Ga0207694_10073386 | 3300025924 | Bacteria | 2677 |
| 421 | Ga0207694_10195946 | 3300025924 | Bacteria | 1642 |
| 422 | Ga0207650_10043348 | 3300025925 | Bacteria | 3302 |
| 423 | Ga0207650_10088767 | 3300025925 | Bacteria | 2358 |
| 424 | Ga0207687_10017194 | 3300025927 | Bacteria | 4757 |
| 425 | Ga0207700_10005747 | 3300025928 | Bacteria | 7450 |
| 426 | Ga0207700_10019069 | 3300025928 | Bacteria | 4627 |
| 427 | Ga0207700_10049821 | 3300025928 | Bacteria | 3118 |
| 428 | Ga0207700_10137915 | 3300025928 | Bacteria | 2000 |
| 429 | Ga0207700_10143492 | 3300025928 | Bacteria | 1965 |
| 430 | Ga0207700_10183651 | 3300025928 | Bacteria | 1753 |
| 431 | Ga0207664_10009456 | 3300025929 | Bacteria | 6843 |
| 432 | Ga0207664_10070746 | 3300025929 | Bacteria | 2808 |
| 433 | Ga0207644_10006104 | 3300025931 | Bacteria | 7856 |
| 434 | Ga0207690_10173663 | 3300025932 | Bacteria | 1616 |
| 435 | Ga0207706_10049922 | 3300025933 | Bacteria | 3697 |
| 436 | Ga0207686_10009285 | 3300025934 | Bacteria | 5336 |
| 437 | Ga0207686_10064625 | 3300025934 | Bacteria | 2331 |
| 438 | Ga0207686_10116014 | 3300025934 | Bacteria | 1814 |
| 439 | Ga0207669_10042509 | 3300025937 | Bacteria | 2653 |
| 440 | Ga0207669_10136963 | 3300025937 | Bacteria | 1693 |
| 441 | Ga0207669_10165871 | 3300025937 | Bacteria | 1566 |
| 442 | Ga0207704_10045781 | 3300025938 | Bacteria | 2602 |
| 443 | Ga0207704_10200035 | 3300025938 | Bacteria | 1461 |
| 444 | Ga0207665_10009461 | 3300025939 | Bacteria | 6397 |
| 445 | Ga0207665_10011216 | 3300025939 | Bacteria | 5881 |
| 446 | Ga0207665_10011249 | 3300025939 | Bacteria | 5871 |
| 447 | Ga0207665_10035047 | 3300025939 | Bacteria | 3330 |
| 448 | Ga0207665_10072485 | 3300025939 | Bacteria | 2353 |
| 449 | Ga0207665_10133127 | 3300025939 | Bacteria | 1767 |
| 450 | Ga0207665_10134640 | 3300025939 | Bacteria | 1757 |
| 451 | Ga0207691_10137576 | 3300025940 | Bacteria | 2154 |
| 452 | Ga0207711_10007294 | 3300025941 | Bacteria | 9261 |
| 453 | Ga0207661_10012708 | 3300025944 | Bacteria | 6131 |
| 454 | Ga0207661_10015114 | 3300025944 | Bacteria | 5673 |
| 455 | Ga0207661_10016612 | 3300025944 | Bacteria | 5432 |
| 456 | Ga0207679_10019013 | 3300025945 | Bacteria | 4611 |
| 457 | Ga0207679_10031984 | 3300025945 | Bacteria | 3688 |
| 458 | Ga0207679_10107274 | 3300025945 | Bacteria | 2197 |
| 459 | Ga0207679_10361027 | 3300025945 | Bacteria | 1269 |
| 460 | Ga0207667_10006896 | 3300025949 | Bacteria | 13722 |
| 461 | Ga0207667_10045333 | 3300025949 | Bacteria | 4658 |
| 462 | Ga0207667_10150187 | 3300025949 | Bacteria | 2398 |
| 463 | Ga0207667_10161102 | 3300025949 | Bacteria | 2307 |
| 464 | Ga0207667_10389701 | 3300025949 | Bacteria | 1419 |
| 465 | Ga0207712_10126549 | 3300025961 | Bacteria | 1941 |
| 466 | Ga0207668_10116810 | 3300025972 | Bacteria | 2012 |
| 467 | Ga0207668_10185805 | 3300025972 | Bacteria | 1643 |
| 468 | Ga0207640_10110166 | 3300025981 | Bacteria | 1950 |
| 469 | Ga0207640_10138739 | 3300025981 | Bacteria | 1769 |
| 470 | Ga0207658_10009309 | 3300025986 | Bacteria | 6663 |
| 471 | Ga0207658_10210590 | 3300025986 | Bacteria | 1629 |
| 472 | Ga0207677_10019811 | 3300026023 | Bacteria | 4071 |
| 473 | Ga0207677_10136655 | 3300026023 | Bacteria | 1870 |
| 474 | Ga0207677_10151313 | 3300026023 | Bacteria | 1791 |
| 475 | Ga0207677_10185028 | 3300026023 | Bacteria | 1642 |
| 476 | Ga0207703_10034023 | 3300026035 | Bacteria | 4042 |
| 477 | Ga0207703_10191533 | 3300026035 | Bacteria | 1811 |
| 478 | Ga0207703_10369775 | 3300026035 | Bacteria | 1324 |
| 479 | Ga0207639_10112437 | 3300026041 | Bacteria | 2222 |
| 480 | Ga0207639_10164430 | 3300026041 | Bacteria | 1873 |
| 481 | Ga0207639_10218174 | 3300026041 | Bacteria | 1646 |
| 482 | Ga0207678_10004970 | 3300026067 | Bacteria | 11931 |
| 483 | Ga0207678_10067644 | 3300026067 | Bacteria | 3066 |
| 484 | Ga0207678_10067770 | 3300026067 | Bacteria | 3063 |
| 485 | Ga0207678_10104461 | 3300026067 | Bacteria | 2418 |
| 486 | Ga0207702_10063329 | 3300026078 | Bacteria | 3162 |
| 487 | Ga0207702_10066937 | 3300026078 | Bacteria | 3081 |
| 488 | Ga0207702_10138961 | 3300026078 | Bacteria | 2196 |
| 489 | Ga0207702_10150659 | 3300026078 | Bacteria | 2115 |
| 490 | Ga0207641_10192717 | 3300026088 | Bacteria | 1874 |
| 491 | Ga0207641_10212213 | 3300026088 | Bacteria | 1791 |
| 492 | Ga0207641_10282778 | 3300026088 | Bacteria | 1561 |
| 493 | Ga0207648_10086119 | 3300026089 | Bacteria | 2741 |
| 494 | Ga0207648_10124041 | 3300026089 | Bacteria | 2272 |
| 495 | Ga0207648_10217345 | 3300026089 | Bacteria | 1698 |
| 496 | Ga0207676_10060038 | 3300026095 | Bacteria | 3005 |
| 497 | Ga0207676_10237389 | 3300026095 | Bacteria | 1633 |
| 498 | Ga0207674_10083706 | 3300026116 | Bacteria | 3189 |
| 499 | Ga0207674_10143401 | 3300026116 | Bacteria | 2348 |
| 500 | Ga0207675_100122304 | 3300026118 | Bacteria | 2463 |
| 501 | Ga0207675_100141236 | 3300026118 | Bacteria | 2288 |
| 502 | Ga0207683_10012582 | 3300026121 | Bacteria | 7219 |
| 503 | Ga0207683_10020872 | 3300026121 | Bacteria | 5604 |
| 504 | Ga0207698_10008380 | 3300026142 | Bacteria | 6535 |
| 505 | Ga0207698_10013393 | 3300026142 | Bacteria | 5409 |
| 506 | Ga0207698_10025189 | 3300026142 | Bacteria | 4186 |
| 507 | Ga0207698_10191176 | 3300026142 | Bacteria | 1823 |
| 508 | Ga0207698_10228155 | 3300026142 | Bacteria | 1688 |
| 509 | Ga0209389_1000100 | 3300027296 | Bacteria | 79023 |
| 510 | Ga0209389_1000181 | 3300027296 | Bacteria | 49013 |
| 511 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 512 | Ga0209589_1000092 | 3300027357 | Bacteria | 89530 |
| 513 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 514 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 515 | Ga0209489_103729 | 3300027361 | Bacteria | 29160 |
| 516 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 517 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 518 | Ga0209179_1000974 | 3300027512 | Bacteria | 3256 |
| 519 | Ga0209179_1002052 | 3300027512 | Bacteria | 2635 |
| 520 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 521 | Ga0209588_1000484 | 3300027671 | Bacteria | 10221 |
| 522 | Ga0209588_1002746 | 3300027671 | Bacteria | 4810 |
| 523 | Ga0209966_1004940 | 3300027695 | Bacteria | 2277 |
| 524 | Ga0209998_10003532 | 3300027717 | Bacteria | 3408 |
| 525 | Ga0209813_10005381 | 3300027866 | Bacteria | 3104 |
| 526 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 527 | Ga0268266_10037165 | 3300028379 | Bacteria | 4148 |
| 528 | Ga0268266_10041167 | 3300028379 | Bacteria | 3940 |
| 529 | Ga0268265_10010594 | 3300028380 | Bacteria | 6227 |
| 530 | Ga0268265_10254927 | 3300028380 | Bacteria | 1556 |
| 531 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 532 | Ga0268264_10020914 | 3300028381 | Bacteria | 5345 |
| 533 | Ga0265337_1019953 | 3300028556 | Bacteria | 2107 |
| 534 | Ga0265334_10007602 | 3300028573 | Bacteria | 4643 |
| 535 | Ga0265323_10000702 | 3300028653 | Bacteria | 18204 |
| 536 | Ga0265336_10000093 | 3300028666 | Bacteria | 68442 |
| 537 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 538 | Ga0307515_10084914 | 3300028794 | Bacteria | 4058 |
| 539 | Ga0265338_10000078 | 3300028800 | Bacteria | 177516 |
| 540 | Ga0307511_10002494 | 3300030521 | Bacteria | 19230 |
| 541 | Ga0265330_10010510 | 3300031235 | Bacteria | 4360 |
| 542 | Ga0265325_10010203 | 3300031241 | Bacteria | 5451 |
| 543 | Ga0265340_10001286 | 3300031247 | Bacteria | 14397 |
| 544 | Ga0265340_10046614 | 3300031247 | Bacteria | 2114 |
| 545 | Ga0265316_10240283 | 3300031344 | Bacteria | 1332 |
| 546 | Ga0307513_10099720 | 3300031456 | Bacteria | 2932 |
| 547 | Ga0307513_10219462 | 3300031456 | Bacteria | 1724 |
| 548 | Ga0307509_10053610 | 3300031507 | Bacteria | 4298 |
| 549 | Ga0307509_10157872 | 3300031507 | Bacteria | 2171 |
| 550 | Ga0307509_10251340 | 3300031507 | Bacteria | 1551 |
| 551 | Ga0307408_100005905 | 3300031548 | Bacteria | 8154 |
| 552 | Ga0265313_10036962 | 3300031595 | Bacteria | 2447 |
| 553 | Ga0307508_10050977 | 3300031616 | Bacteria | 3680 |
| 554 | Ga0307508_10230610 | 3300031616 | Bacteria | 1450 |
| 555 | Ga0265314_10054879 | 3300031711 | Bacteria | 2754 |
| 556 | Ga0265342_10055531 | 3300031712 | Bacteria | 2351 |
| 557 | Ga0307516_10006838 | 3300031730 | Bacteria | 13294 |
| 558 | Ga0307516_10039241 | 3300031730 | Bacteria | 4721 |
| 559 | Ga0307516_10039797 | 3300031730 | Bacteria | 4683 |
| 560 | Ga0307516_10113185 | 3300031730 | Bacteria | 2512 |
| 561 | Ga0307413_10107504 | 3300031824 | Bacteria | 1859 |
| 562 | Ga0307411_10067629 | 3300032005 | Bacteria | 2405 |
| 563 | Ga0307507_10033808 | 3300033179 | Bacteria | 5300 |
| 564 | Ga0307510_10218629 | 3300033180 | Bacteria | 1419 |
| 565 | Ga0316215_1002301 | 3300033544 | Bacteria | 1807 |
| 566 | Ga0373954_0006616 | 3300035118 | Bacteria | 5057 |
| 567 | Ga0373954_0010673 | 3300035118 | Bacteria | 4058 |
| 568 | Ga0373956_0035765 | 3300035119 | Bacteria | 2191 |
| 569 | Ga0373957_0002096 | 3300035120 | Bacteria | 5595 |
| 570 | Ga0373957_0051780 | 3300035120 | Bacteria | 1571 |
| 571 | Ga0373943_0003155 | 3300035170 | Bacteria | 7485 |
| 572 | Ga0373943_0103415 | 3300035170 | Bacteria | 1493 |
| 573 | Ga0373943_0140132 | 3300035170 | Bacteria | 1302 |
| 574 | Ga0373946_0022128 | 3300035171 | Bacteria | 2472 |
| 575 | Ga0373924_0082010 | 3300035410 | Bacteria | 1372 |
| 576 | Ga0373931_0019954 | 3300035691 | Bacteria | 3350 |
| 577 | Ga0373931_0036922 | 3300035691 | Bacteria | 2549 |
| 578 | Ga0373935_0032432 | 3300035692 | Bacteria | 3247 |
| 579 | Ga0373935_0117915 | 3300035692 | Bacteria | 1770 |
| 580 | Ga0373927_0000488 | 3300035695 | Bacteria | 30514 |
| 581 | Ga0373927_0031206 | 3300035695 | Bacteria | 3474 |
| 582 | Ga0373927_0091899 | 3300035695 | Bacteria | 1971 |
| 583 | Ga0373927_0094294 | 3300035695 | Bacteria | 1945 |
| 584 | Ga0373933_0000728 | 3300035724 | Bacteria | 20193 |
| 585 | Ga0373933_0012963 | 3300035724 | Bacteria | 4611 |
| 586 | Ga0373933_0018325 | 3300035724 | Bacteria | 3936 |
| 587 | Ga0373933_0031533 | 3300035724 | Bacteria | 3075 |
| 588 | Ga0373933_0046558 | 3300035724 | Bacteria | 2576 |
| 589 | Ga0373947_0000909 | 3300035725 | Bacteria | 17934 |
| 590 | Ga0373947_0160671 | 3300035725 | Bacteria | 1453 |
| 591 | Ga0373937_0019708 | 3300036401 | Bacteria | 6041 |
| 592 | Ga0373937_0073161 | 3300036401 | Bacteria | 3161 |
| 593 | Ga0373925_0009396 | 3300037068 | Bacteria | 7118 |
| 594 | Ga0373925_0025709 | 3300037068 | Bacteria | 4305 |
| 595 | Ga0373925_0070259 | 3300037068 | Bacteria | 2646 |
| 596 | Ga0373925_0117310 | 3300037068 | Bacteria | 2063 |
| 597 | Ga0373925_0327603 | 3300037068 | Bacteria | 1240 |
| 598 | Ga0395899_0039532 | 3300037312 | Bacteria | 3531 |
| 599 | Ga0395900_0001158 | 3300037418 | Bacteria | 33053 |
| 600 | Ga0395900_0110847 | 3300037418 | Bacteria | 2819 |
| 601 | Ga0395898_0003218 | 3300037466 | Bacteria | 18368 |
| 602 | Ga0395898_0013915 | 3300037466 | Bacteria | 8269 |
| 603 | Ga0395898_0066538 | 3300037466 | Bacteria | 3491 |
| 604 | Ga0395898_0087922 | 3300037466 | Bacteria | 2993 |
| 605 | Ga0395898_0181749 | 3300037466 | Bacteria | 2010 |
| 606 | Ga0395905_0058197 | 3300037471 | Bacteria | 3614 |
| 607 | Ga0436364_0818702 | 3300037853 | Bacteria | 1779 |
| 608 | Ga0436364_1189605 | 3300037853 | Bacteria | 3008 |
| 609 | Ga0395901_0029555 | 3300038443 | Bacteria | 5643 |
| 610 | Ga0395901_0105934 | 3300038443 | Bacteria | 2951 |
| 611 | Ga0395901_0384694 | 3300038443 | Bacteria | 1444 |
| 612 | Ga0436365_0250762 | 3300039437 | Bacteria | 38553 |
| 613 | Ga0436360_0912462 | 3300039438 | Bacteria | 1562 |
| 614 | Ga0436360_1310166 | 3300039438 | Bacteria | 2001 |
| 615 | Ga0436361_0882993 | 3300039447 | Bacteria | 15074 |
| 616 | Ga0436363_0939093 | 3300039450 | Bacteria | 1184 |
| 617 | Ga0436362_0825905 | 3300039453 | Bacteria | 7268 |
| 618 | Ga0466969_0014903 | 3300044656 | Bacteria | 4080 |
| 619 | Ga0466972_0000776 | 3300044658 | Bacteria | 15182 |
| 620 | Ga0466972_0008969 | 3300044658 | Bacteria | 5018 |
| 621 | Ga0466966_0034451 | 3300044684 | Bacteria | 3273 |
| 622 | Ga0466966_0084518 | 3300044684 | Bacteria | 1974 |
| 623 | Ga0466961_0000008 | 3300044693 | Bacteria | 142607 |
| 624 | Ga0466968_0003144 | 3300044735 | Bacteria | 6094 |
| 625 | Ga0466957_0050583 | 3300044842 | Bacteria | 2529 |
| 626 | Ga0466960_0065511 | 3300044901 | Bacteria | 1794 |
| 627 | Ga0466959_0039720 | 3300045049 | Bacteria | 3478 |
| 628 | Ga0466967_0033513 | 3300045976 | Bacteria | 4348 |
| 629 | Ga0466967_0085556 | 3300045976 | Bacteria | 2855 |
| 630 | Ga0466967_0139080 | 3300045976 | Bacteria | 2260 |
| 631 | Ga0466967_0141031 | 3300045976 | Bacteria | 2245 |
| 632 | Ga0495592_0000975 | 3300046454 | Bacteria | 19854 |
| 633 | Ga0495592_0007754 | 3300046454 | Bacteria | 8043 |
| 634 | Ga0495592_0012082 | 3300046454 | Bacteria | 6547 |
| 635 | Ga0495592_0035103 | 3300046454 | Bacteria | 3779 |
| 636 | Ga0495592_0200136 | 3300046454 | Bacteria | 1348 |
| 637 | Ga0495603_0006651 | 3300046455 | Bacteria | 6935 |
| 638 | Ga0495603_0035149 | 3300046455 | Bacteria | 3011 |
| 639 | Ga0495603_0035443 | 3300046455 | Bacteria | 2997 |
| 640 | Ga0495603_0073905 | 3300046455 | Bacteria | 2002 |
| 641 | Ga0495629_0000483 | 3300046459 | Bacteria | 33389 |
| 642 | Ga0495629_0009417 | 3300046459 | Bacteria | 7142 |
| 643 | Ga0495629_0041234 | 3300046459 | Bacteria | 3249 |
| 644 | Ga0495629_0071148 | 3300046459 | Bacteria | 2427 |
| 645 | Ga0495629_0075816 | 3300046459 | Bacteria | 2348 |
| 646 | Ga0495638_0000114 | 3300046460 | Bacteria | 129141 |
| 647 | Ga0495638_0054695 | 3300046460 | Bacteria | 2480 |
| 648 | Ga0495638_0129453 | 3300046460 | Bacteria | 1484 |
| 649 | Ga0495651_0001882 | 3300046462 | Bacteria | 16229 |
| 650 | Ga0495651_0018721 | 3300046462 | Bacteria | 5364 |
| 651 | Ga0495651_0025732 | 3300046462 | Bacteria | 4582 |
| 652 | Ga0495651_0031740 | 3300046462 | Bacteria | 4118 |
| 653 | Ga0495653_0002189 | 3300046463 | Bacteria | 15460 |
| 654 | Ga0495653_0010887 | 3300046463 | Bacteria | 7445 |
| 655 | Ga0495580_0000574 | 3300046472 | Bacteria | 30931 |
| 656 | Ga0495580_0149532 | 3300046472 | Bacteria | 1618 |
| 657 | Ga0495582_0000221 | 3300046473 | Bacteria | 31591 |
| 658 | Ga0495605_0070215 | 3300046474 | Bacteria | 1657 |
| 659 | Ga0495639_0000308 | 3300046475 | Bacteria | 23799 |
| 660 | Ga0495662_0001537 | 3300046476 | Bacteria | 11466 |
| 661 | Ga0495664_0005425 | 3300046477 | Bacteria | 7005 |
| 662 | Ga0495664_0005911 | 3300046477 | Bacteria | 6735 |
| 663 | Ga0495664_0023288 | 3300046477 | Bacteria | 3594 |
| 664 | Ga0495584_0117897 | 3300046491 | Bacteria | 1344 |
| 665 | Ga0495585_0137170 | 3300046492 | Bacteria | 1283 |
| 666 | Ga0495594_0000259 | 3300046499 | Bacteria | 25796 |
| 667 | Ga0495607_0076461 | 3300046501 | Bacteria | 1852 |
| 668 | Ga0495583_0000468 | 3300046506 | Bacteria | 59782 |
| 669 | Ga0495583_0012425 | 3300046506 | Bacteria | 4818 |
| 670 | Ga0495606_0002401 | 3300046507 | Bacteria | 21883 |
| 671 | Ga0495606_0015832 | 3300046507 | Bacteria | 5787 |
| 672 | Ga0495606_0023441 | 3300046507 | Bacteria | 4471 |
| 673 | Ga0495606_0047252 | 3300046507 | Bacteria | 2838 |
| 674 | Ga0495608_0000491 | 3300046511 | Bacteria | 27379 |
| 675 | Ga0495608_0013169 | 3300046511 | Bacteria | 5740 |
| 676 | Ga0495608_0049281 | 3300046511 | Bacteria | 2796 |
| 677 | Ga0495608_0113769 | 3300046511 | Bacteria | 1738 |
| 678 | Ga0495616_0045555 | 3300046513 | Bacteria | 2219 |
| 679 | Ga0495618_0014263 | 3300046514 | Bacteria | 4839 |
| 680 | Ga0495618_0023456 | 3300046514 | Bacteria | 3816 |
| 681 | Ga0495618_0219364 | 3300046514 | Bacteria | 1200 |
| 682 | Ga0495628_0002686 | 3300046516 | Bacteria | 15907 |
| 683 | Ga0495628_0084129 | 3300046516 | Bacteria | 2469 |
| 684 | Ga0495630_0003908 | 3300046517 | Bacteria | 10417 |
| 685 | Ga0495630_0080669 | 3300046517 | Bacteria | 2455 |
| 686 | Ga0495630_0119663 | 3300046517 | Bacteria | 1998 |
| 687 | Ga0495630_0147923 | 3300046517 | Bacteria | 1787 |
| 688 | Ga0495631_0047883 | 3300046518 | Bacteria | 1875 |
| 689 | Ga0495643_0024772 | 3300046522 | Bacteria | 3401 |
| 690 | Ga0495643_0034765 | 3300046522 | Bacteria | 2778 |
| 691 | Ga0495648_0000035 | 3300046524 | Bacteria | 196251 |
| 692 | Ga0495663_0054015 | 3300046525 | Bacteria | 1250 |
| 693 | Ga0495642_0008573 | 3300046528 | Bacteria | 3912 |
| 694 | Ga0495652_0001609 | 3300046529 | Bacteria | 24670 |
| 695 | Ga0495652_0012482 | 3300046529 | Bacteria | 7661 |
| 696 | Ga0495652_0028565 | 3300046529 | Bacteria | 4906 |
| 697 | Ga0495652_0033341 | 3300046529 | Bacteria | 4495 |
| 698 | Ga0495665_0000153 | 3300046531 | Bacteria | 34092 |
| 699 | Ga0495640_0000198 | 3300046533 | Bacteria | 40193 |
| 700 | Ga0495640_0005502 | 3300046533 | Bacteria | 10075 |
| 701 | Ga0495640_0035847 | 3300046533 | Bacteria | 3509 |
| 702 | Ga0495640_0058512 | 3300046533 | Bacteria | 2628 |
| 703 | Ga0495640_0142942 | 3300046533 | Bacteria | 1541 |
| 704 | Ga0495586_0011964 | 3300046535 | Bacteria | 4610 |
| 705 | Ga0495587_0007333 | 3300046536 | Bacteria | 7149 |
| 706 | Ga0495587_0027522 | 3300046536 | Bacteria | 3461 |
| 707 | Ga0495609_0004740 | 3300046538 | Bacteria | 7354 |
| 708 | Ga0495609_0089026 | 3300046538 | Bacteria | 1343 |
| 709 | Ga0495597_0008936 | 3300046542 | Bacteria | 4997 |
| 710 | Ga0495597_0010944 | 3300046542 | Bacteria | 4411 |
| 711 | Ga0495597_0017474 | 3300046542 | Bacteria | 3374 |
| 712 | Ga0495645_0008945 | 3300046543 | Bacteria | 6995 |
| 713 | Ga0495645_0018654 | 3300046543 | Bacteria | 4986 |
| 714 | Ga0495645_0022931 | 3300046543 | Bacteria | 4518 |
| 715 | Ga0495645_0032593 | 3300046543 | Bacteria | 3802 |
| 716 | Ga0495645_0037758 | 3300046543 | Bacteria | 3522 |
| 717 | Ga0495645_0146269 | 3300046543 | Bacteria | 1646 |
| 718 | Ga0495622_0000258 | 3300046557 | Bacteria | 40426 |
| 719 | Ga0495622_0004435 | 3300046557 | Bacteria | 6515 |
| 720 | Ga0495622_0035457 | 3300046557 | Bacteria | 2326 |
| 721 | Ga0495622_0039298 | 3300046557 | Bacteria | 2203 |
| 722 | Ga0495622_0059919 | 3300046557 | Bacteria | 1762 |
| 723 | Ga0495633_0000224 | 3300046558 | Bacteria | 70187 |
| 724 | Ga0495633_0034756 | 3300046558 | Bacteria | 2422 |
| 725 | Ga0495667_0008032 | 3300046559 | Bacteria | 7158 |
| 726 | Ga0495667_0014322 | 3300046559 | Bacteria | 5356 |
| 727 | Ga0495667_0023264 | 3300046559 | Bacteria | 4174 |
| 728 | Ga0495656_0021268 | 3300046615 | Bacteria | 2524 |
| 729 | Ga0495656_0041372 | 3300046615 | Bacteria | 1925 |
| 730 | Ga0495668_0000462 | 3300046616 | Bacteria | 51830 |
| 731 | Ga0495668_0048144 | 3300046616 | Bacteria | 2365 |
| 732 | Ga0495668_0059875 | 3300046616 | Bacteria | 2101 |
| 733 | Ga0495668_0066077 | 3300046616 | Bacteria | 1990 |
| 734 | Ga0495668_0097256 | 3300046616 | Bacteria | 1611 |
| 735 | Ga0495634_0001034 | 3300046642 | Bacteria | 26091 |
| 736 | Ga0495634_0017351 | 3300046642 | Bacteria | 5139 |
| 737 | Ga0495634_0033492 | 3300046642 | Bacteria | 3530 |
| 738 | Ga0495634_0035820 | 3300046642 | Bacteria | 3396 |
| 739 | Ga0495625_0000481 | 3300046660 | Bacteria | 59753 |
| 740 | Ga0495625_0005750 | 3300046660 | Bacteria | 11211 |
| 741 | Ga0495625_0013861 | 3300046660 | Bacteria | 6455 |
| 742 | Ga0495635_0007557 | 3300046663 | Bacteria | 7583 |
| 743 | Ga0495635_0011150 | 3300046663 | Bacteria | 6302 |
| 744 | Ga0495635_0018033 | 3300046663 | Bacteria | 4927 |
| 745 | Ga0495635_0035860 | 3300046663 | Bacteria | 3439 |
| 746 | Ga0495659_0033546 | 3300046664 | Bacteria | 1802 |
| 747 | Ga0495661_0032846 | 3300046665 | Bacteria | 3277 |
| 748 | Ga0495661_0123667 | 3300046665 | Bacteria | 1426 |
| 749 | Ga0495588_0006694 | 3300046674 | Bacteria | 5205 |
| 750 | Ga0495588_0019358 | 3300046674 | Bacteria | 3333 |
| 751 | Ga0495657_0000620 | 3300046675 | Bacteria | 32206 |
| 752 | Ga0495657_0010901 | 3300046675 | Bacteria | 6818 |
| 753 | Ga0495657_0031369 | 3300046675 | Bacteria | 3715 |
| 754 | Ga0495599_0003016 | 3300046678 | Bacteria | 9799 |
| 755 | Ga0495599_0006700 | 3300046678 | Bacteria | 6956 |
| 756 | Ga0495599_0033743 | 3300046678 | Bacteria | 3217 |
| 757 | Ga0495599_0059124 | 3300046678 | Bacteria | 2397 |
| 758 | Ga0495599_0076515 | 3300046678 | Bacteria | 2090 |
| 759 | Ga0495623_0001651 | 3300046679 | Bacteria | 14991 |
| 760 | Ga0495623_0004884 | 3300046679 | Bacteria | 8791 |
| 761 | Ga0495623_0098240 | 3300046679 | Bacteria | 1787 |
| 762 | Ga0495646_0004029 | 3300046680 | Bacteria | 9208 |
| 763 | Ga0495646_0005528 | 3300046680 | Bacteria | 7994 |
| 764 | Ga0495658_0000722 | 3300046683 | Bacteria | 17856 |
| 765 | Ga0495669_0018573 | 3300046684 | Bacteria | 2990 |
| 766 | Ga0495669_0059799 | 3300046684 | Bacteria | 1722 |
| 767 | Ga0495669_0080980 | 3300046684 | Bacteria | 1490 |
| 768 | Ga0495613_0000393 | 3300046689 | Bacteria | 37458 |
| 769 | Ga0495613_0251195 | 3300046689 | Bacteria | 1234 |
| 770 | Ga0495624_0000182 | 3300046690 | Bacteria | 46968 |
| 771 | Ga0495670_0042884 | 3300046691 | Bacteria | 2257 |
| 772 | Ga0495649_0049325 | 3300046694 | Bacteria | 2287 |
| 773 | Ga0495589_0059640 | 3300046794 | Bacteria | 1875 |
| 774 | Ga0495600_0001979 | 3300046809 | Bacteria | 11514 |
| 775 | Ga0495600_0006648 | 3300046809 | Bacteria | 7044 |
| 776 | Ga0495600_0023137 | 3300046809 | Bacteria | 3997 |
| 777 | Ga0495600_0024698 | 3300046809 | Bacteria | 3870 |
| 778 | Ga0495600_0032723 | 3300046809 | Bacteria | 3374 |
| 779 | Ga0495660_0000420 | 3300046810 | Bacteria | 35871 |
| 780 | Ga0495660_0012335 | 3300046810 | Bacteria | 4959 |
| 781 | Ga0495660_0039324 | 3300046810 | Bacteria | 2627 |
| 782 | Ga0495581_0000502 | 3300047315 | Bacteria | 20006 |
| 783 | Ga0495604_0000700 | 3300047317 | Bacteria | 28451 |
| 784 | Ga0495604_0002824 | 3300047317 | Bacteria | 13945 |
| 785 | Ga0495604_0025288 | 3300047317 | Bacteria | 4731 |
| 786 | Ga0495604_0026093 | 3300047317 | Bacteria | 4652 |
| 787 | Ga0495604_0232233 | 3300047317 | Bacteria | 1264 |
| 788 | Ga0495674_0001836 | 3300047319 | Bacteria | 20935 |
| 789 | Ga0495674_0032998 | 3300047319 | Bacteria | 4693 |
| 790 | Ga0495674_0048074 | 3300047319 | Bacteria | 3778 |
| 791 | Ga0495674_0065924 | 3300047319 | Bacteria | 3143 |
| 792 | Ga0495674_0075371 | 3300047319 | Bacteria | 2903 |
| 793 | Ga0495672_0042847 | 3300047320 | Bacteria | 2726 |
| 794 | Ga0495676_0027914 | 3300047321 | Bacteria | 4833 |
| 795 | Ga0495676_0129834 | 3300047321 | Bacteria | 1821 |
| 796 | Ga0495680_0011172 | 3300047322 | Bacteria | 7972 |
| 797 | Ga0495680_0011988 | 3300047322 | Bacteria | 7650 |
| 798 | Ga0495680_0012924 | 3300047322 | Bacteria | 7316 |
| 799 | Ga0495680_0013853 | 3300047322 | Bacteria | 7015 |
| 800 | Ga0495680_0029336 | 3300047322 | Bacteria | 4505 |
| 801 | Ga0495680_0036395 | 3300047322 | Bacteria | 3951 |
| 802 | Ga0495680_0232486 | 3300047322 | Bacteria | 1312 |
| 803 | Ga0495687_022234 | 3300047443 | Bacteria | 3048 |
| 804 | Ga0495675_0015303 | 3300047444 | Bacteria | 4852 |
| 805 | Ga0495675_0044857 | 3300047444 | Bacteria | 2815 |
| 806 | Ga0495677_0008053 | 3300047445 | Bacteria | 3914 |
| 807 | Ga0495679_026621 | 3300047446 | Bacteria | 1918 |
| 808 | Ga0495685_003761 | 3300047447 | Bacteria | 4858 |
| 809 | Ga0495681_0064311 | 3300047470 | Bacteria | 1681 |
| 810 | Ga0495684_0026202 | 3300047471 | Bacteria | 4479 |
| 811 | Ga0495684_0076386 | 3300047471 | Bacteria | 2544 |
| 812 | Ga0495686_0136459 | 3300047472 | Bacteria | 1451 |
| 813 | Ga0495593_0000477 | 3300047673 | Bacteria | 22563 |
| 814 | Ga0495593_0019236 | 3300047673 | Bacteria | 3830 |
| 815 | Ga0495593_0043823 | 3300047673 | Bacteria | 2396 |
| 816 | Ga0495602_0002073 | 3300048088 | Bacteria | 20164 |
| 817 | Ga0495602_0006751 | 3300048088 | Bacteria | 12046 |
| 818 | Ga0495602_0024308 | 3300048088 | Bacteria | 5879 |
| 819 | Ga0495614_0015945 | 3300048089 | Bacteria | 3273 |
| 820 | Ga0496100_0003627 | 3300048903 | Bacteria | 8064 |
| 821 | Ga0496101_0002421 | 3300048904 | Bacteria | 11461 |
| 822 | Ga0496101_0011583 | 3300048904 | Bacteria | 5856 |
| 823 | Ga0496101_0025657 | 3300048904 | Bacteria | 4091 |
| 824 | Ga0496101_0028886 | 3300048904 | Bacteria | 3875 |
| 825 | Ga0496101_0079839 | 3300048904 | Bacteria | 2416 |
| 826 | Ga0496102_0010164 | 3300048905 | Bacteria | 8091 |
| 827 | Ga0496102_0022662 | 3300048905 | Bacteria | 5565 |
| 828 | Ga0496102_0217499 | 3300048905 | Bacteria | 1801 |
| 829 | Ga0496102_0282882 | 3300048905 | Bacteria | 1563 |
| 830 | Ga0496102_0388913 | 3300048905 | Bacteria | 1312 |
| 831 | Ga0496103_0002137 | 3300048906 | Bacteria | 12584 |
| 832 | Ga0496103_0006589 | 3300048906 | Bacteria | 6926 |
| 833 | Ga0496103_0038771 | 3300048906 | Bacteria | 2926 |
| 834 | Ga0496103_0039473 | 3300048906 | Bacteria | 2901 |
| 835 | Ga0496103_0051312 | 3300048906 | Bacteria | 2553 |
| 836 | Ga0496103_0075815 | 3300048906 | Bacteria | 2110 |
| 837 | Ga0496104_0005077 | 3300048907 | Bacteria | 11485 |
| 838 | Ga0496104_0023984 | 3300048907 | Bacteria | 5612 |
| 839 | Ga0496104_0064111 | 3300048907 | Bacteria | 3486 |
| 840 | Ga0496104_0073509 | 3300048907 | Bacteria | 3252 |
| 841 | Ga0496104_0115804 | 3300048907 | Bacteria | 2572 |
| 842 | Ga0496104_0174631 | 3300048907 | Bacteria | 2059 |
| 843 | Ga0496105_0026517 | 3300048908 | Bacteria | 4728 |
| 844 | Ga0496105_0034654 | 3300048908 | Bacteria | 4152 |
| 845 | Ga0496105_0040202 | 3300048908 | Bacteria | 3855 |
| 846 | Ga0496105_0068330 | 3300048908 | Bacteria | 2935 |
| 847 | Ga0496105_0174075 | 3300048908 | Bacteria | 1764 |
| 848 | Ga0496106_0004280 | 3300048909 | Bacteria | 10614 |
| 849 | Ga0496106_0011700 | 3300048909 | Bacteria | 6481 |
| 850 | Ga0496106_0053413 | 3300048909 | Bacteria | 3051 |
| 851 | Ga0496106_0075080 | 3300048909 | Bacteria | 2589 |
| 852 | Ga0496106_0110857 | 3300048909 | Bacteria | 2136 |
| 853 | Ga0496106_0137054 | 3300048909 | Bacteria | 1923 |
| 854 | Ga0496107_0036075 | 3300048910 | Bacteria | 3546 |
| 855 | Ga0496107_0103021 | 3300048910 | Bacteria | 2093 |
| 856 | Ga0496108_0064995 | 3300048911 | Bacteria | 3074 |
| 857 | Ga0496108_0128333 | 3300048911 | Bacteria | 2178 |
| 858 | Ga0496109_0014667 | 3300048912 | Bacteria | 6819 |
| 859 | Ga0496109_0014714 | 3300048912 | Bacteria | 6809 |
| 860 | Ga0496109_0076059 | 3300048912 | Bacteria | 3087 |
| 861 | Ga0496109_0214390 | 3300048912 | Bacteria | 1811 |
| 862 | Ga0496109_0279442 | 3300048912 | Bacteria | 1574 |
| 863 | Ga0496110_0001620 | 3300048913 | Bacteria | 16501 |
| 864 | Ga0496110_0041677 | 3300048913 | Bacteria | 4006 |
| 865 | Ga0496110_0052012 | 3300048913 | Bacteria | 3600 |
| 866 | Ga0496110_0134216 | 3300048913 | Bacteria | 2236 |
| 867 | Ga0496111_0001911 | 3300048914 | Bacteria | 12332 |
| 868 | Ga0496111_0076819 | 3300048914 | Bacteria | 2434 |
| 869 | Ga0496111_0214751 | 3300048914 | Bacteria | 1429 |
| 870 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 871 | Ga0496112_0010712 | 3300048915 | Bacteria | 8335 |
| 872 | Ga0496112_0051627 | 3300048915 | Bacteria | 4033 |
| 873 | Ga0496112_0060412 | 3300048915 | Bacteria | 3735 |
| 874 | Ga0496112_0102386 | 3300048915 | Bacteria | 2833 |
| 875 | Ga0496112_0145600 | 3300048915 | Bacteria | 2337 |
| 876 | Ga0496112_0255667 | 3300048915 | Bacteria | 1702 |
| 877 | Ga0496113_0000558 | 3300048916 | Bacteria | 18513 |
| 878 | Ga0496113_0002228 | 3300048916 | Bacteria | 11191 |
| 879 | Ga0496113_0036089 | 3300048916 | Bacteria | 3620 |
| 880 | Ga0496113_0043982 | 3300048916 | Bacteria | 3307 |
| 881 | Ga0496113_0110239 | 3300048916 | Bacteria | 2141 |
| 882 | Ga0496113_0298297 | 3300048916 | Bacteria | 1290 |
| 883 | Ga0496114_0052188 | 3300048917 | Bacteria | 3406 |
| 884 | Ga0496115_0024630 | 3300048918 | Bacteria | 4680 |
| 885 | Ga0496115_0031403 | 3300048918 | Bacteria | 4186 |
| 886 | Ga0496115_0046964 | 3300048918 | Bacteria | 3452 |
| 887 | Ga0496115_0054671 | 3300048918 | Bacteria | 3206 |
| 888 | Ga0496115_0064567 | 3300048918 | Bacteria | 2955 |
| 889 | Ga0496115_0125659 | 3300048918 | Bacteria | 2113 |
| 890 | Ga0496115_0146855 | 3300048918 | Bacteria | 1946 |
| 891 | Ga0496117_0100305 | 3300048920 | Bacteria | 1834 |
| 892 | Ga0496117_0134157 | 3300048920 | Bacteria | 1495 |
| 893 | Ga0496118_0011127 | 3300048921 | Bacteria | 8819 |
| 894 | Ga0496118_0014948 | 3300048921 | Bacteria | 7222 |
| 895 | Ga0496119_0007084 | 3300048922 | Bacteria | 10196 |
| 896 | Ga0496119_0063654 | 3300048922 | Bacteria | 2193 |
| 897 | Ga0496120_0021911 | 3300048923 | Bacteria | 4027 |
| 898 | Ga0496121_0001081 | 3300048924 | Bacteria | 48118 |
| 899 | Ga0496121_0002560 | 3300048924 | Bacteria | 27532 |
| 900 | Ga0496121_0022929 | 3300048924 | Bacteria | 6033 |
| 901 | Ga0496121_0039695 | 3300048924 | Bacteria | 4142 |
| 902 | Ga0496121_0156738 | 3300048924 | Bacteria | 1670 |
| 903 | Ga0496121_0263100 | 3300048924 | Bacteria | 1190 |
| 904 | Ga0496122_0052992 | 3300048925 | Bacteria | 3063 |
| 905 | Ga0496124_0000722 | 3300048927 | Bacteria | 54175 |
| 906 | Ga0496124_0033338 | 3300048927 | Bacteria | 4530 |
| 907 | Ga0496125_0023066 | 3300048928 | Bacteria | 5758 |
| 908 | Ga0496125_0037171 | 3300048928 | Bacteria | 4236 |
| 909 | Ga0496125_0062071 | 3300048928 | Bacteria | 2992 |
| 910 | Ga0496125_0161836 | 3300048928 | Bacteria | 1519 |
| 911 | Ga0496126_0010006 | 3300048929 | Bacteria | 10007 |
| 912 | Ga0496126_0012727 | 3300048929 | Bacteria | 8603 |
| 913 | Ga0496126_0023351 | 3300048929 | Bacteria | 5994 |
| 914 | Ga0496126_0029780 | 3300048929 | Bacteria | 5182 |
| 915 | Ga0496126_0037510 | 3300048929 | Bacteria | 4521 |
| 916 | Ga0496126_0084504 | 3300048929 | Bacteria | 2799 |
| 917 | Ga0496126_0096389 | 3300048929 | Bacteria | 2593 |
| 918 | Ga0496126_0098033 | 3300048929 | Bacteria | 2568 |
| 919 | Ga0496126_0186097 | 3300048929 | Bacteria | 1761 |
| 920 | Ga0495682_0010974 | 3300049460 | Bacteria | 3493 |
| 921 | Ga0501032_0000216 | 3300049569 | Bacteria | 47842 |
| 922 | Ga0501033_0000344 | 3300049570 | Bacteria | 44238 |
| 923 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 924 | Ga0501034_0004118 | 3300049571 | Bacteria | 16299 |
| 925 | Ga0501034_0004422 | 3300049571 | Bacteria | 15639 |
| 926 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 927 | Ga0501036_0010773 | 3300049572 | Bacteria | 7556 |
| 928 | Ga0501037_0000183 | 3300049573 | Bacteria | 57879 |
| 929 | Ga0501037_0002727 | 3300049573 | Bacteria | 12774 |
| 930 | Ga0501038_0000054 | 3300049574 | Bacteria | 94123 |
| 931 | Ga0501039_0026215 | 3300049575 | Bacteria | 4480 |
| 932 | Ga0501043_0000106 | 3300049579 | Bacteria | 77699 |
| 933 | Ga0501046_0000742 | 3300049580 | Bacteria | 31595 |
| 934 | Ga0501046_0034319 | 3300049580 | Bacteria | 4095 |
| 935 | Ga0501047_0000493 | 3300049581 | Bacteria | 42827 |
| 936 | Ga0501047_0015277 | 3300049581 | Bacteria | 7313 |
| 937 | Ga0501048_0001189 | 3300049582 | Bacteria | 19702 |
| 938 | Ga0501067_0000098 | 3300049583 | Bacteria | 50026 |
| 939 | Ga0501068_0004912 | 3300049584 | Bacteria | 7283 |
| 940 | Ga0501068_0008768 | 3300049584 | Bacteria | 5642 |
| 941 | Ga0501068_0129291 | 3300049584 | Bacteria | 1579 |
| 942 | Ga0501069_0004988 | 3300049585 | Bacteria | 6882 |
| 943 | Ga0501070_0005534 | 3300049586 | Bacteria | 10770 |
| 944 | Ga0501070_0008632 | 3300049586 | Bacteria | 8613 |
| 945 | Ga0501070_0009508 | 3300049586 | Bacteria | 8218 |
| 946 | Ga0501070_0181488 | 3300049586 | Bacteria | 1732 |
| 947 | Ga0501072_0002739 | 3300049588 | Bacteria | 13227 |
| 948 | Ga0501073_0000330 | 3300049589 | Bacteria | 31813 |
| 949 | Ga0501074_0112501 | 3300049590 | Bacteria | 1948 |
| 950 | Ga0501238_000704 | 3300049671 | Bacteria | 3760 |
| 951 | Ga0501080_0001470 | 3300049742 | Bacteria | 19839 |
| 952 | Ga0501080_0025001 | 3300049742 | Bacteria | 5540 |
| 953 | Ga0501083_0000116 | 3300049744 | Bacteria | 54656 |
| 954 | Ga0501083_0045253 | 3300049744 | Bacteria | 2978 |
| 955 | Ga0501035_0000817 | 3300049822 | Bacteria | 33190 |
| 956 | Ga0501035_0029501 | 3300049822 | Bacteria | 5002 |
| 957 | Ga0501044_0019620 | 3300049823 | Bacteria | 7228 |
| 958 | Ga0501044_0020178 | 3300049823 | Bacteria | 7113 |
| 959 | Ga0501045_0066977 | 3300049824 | Bacteria | 2636 |
| 960 | nmdc:mga03683_12761_c1 | 3300050489 | Bacteria | 3076 |
| 961 | nmdc:mga03683_15237_c1 | 3300050489 | Bacteria | 2865 |
| 962 | nmdc:mga03683_24889_c1 | 3300050489 | Bacteria | 2345 |
| 963 | nmdc:mga03683_85699_c1 | 3300050489 | Bacteria | 1367 |
| 964 | nmdc:mga03n38_2017_c1 | 3300050490 | Bacteria | 6112 |
| 965 | nmdc:mga00v17_17429_c1 | 3300050491 | Bacteria | 4067 |
| 966 | nmdc:mga00v17_44107_c1 | 3300050491 | Bacteria | 2688 |
| 967 | nmdc:mga0yw44_193543_c1 | 3300050492 | Bacteria | 1342 |
| 968 | nmdc:mga0yw44_50592_c1 | 3300050492 | Bacteria | 2513 |
| 969 | nmdc:mga0yw44_7155_c1 | 3300050492 | Bacteria | 5465 |
| 970 | nmdc:mga0yw44_91144_c1 | 3300050492 | Bacteria | 1927 |
| 971 | nmdc:mga0k408_29996_c1 | 3300050493 | Bacteria | 3099 |
| 972 | nmdc:mga0k408_82217_c1 | 3300050493 | Bacteria | 1887 |
| 973 | nmdc:mga0k408_9138_c1 | 3300050493 | Bacteria | 5339 |
| 974 | nmdc:mga06z11_14434_c1 | 3300050494 | Bacteria | 3499 |
| 975 | nmdc:mga06z11_3255_c1 | 3300050494 | Bacteria | 6275 |
| 976 | nmdc:mga06z11_8432_c1 | 3300050494 | Bacteria | 4297 |
| 977 | nmdc:mga04h51_1861_c1 | 3300050495 | Bacteria | 4931 |
| 978 | nmdc:mga07m45_75572_c1 | 3300050496 | Bacteria | 1920 |
| 979 | nmdc:mga07m45_89051_c1 | 3300050496 | Bacteria | 1767 |
| 980 | nmdc:mga05p37_354_c1 | 3300050507 | Bacteria | 49188 |
| 981 | nmdc:mga05p37_38822_c1 | 3300050507 | Bacteria | 5842 |
| 982 | nmdc:mga05p37_497181_c1 | 3300050507 | Bacteria | 1401 |
| 983 | nmdc:mga09592_1311_c1 | 3300050508 | Bacteria | 19973 |
| 984 | nmdc:mga0qj67_1940_c1 | 3300050509 | Bacteria | 14712 |
| 985 | nmdc:mga0qj67_75906_c1 | 3300050509 | Bacteria | 2687 |
| 986 | nmdc:mga06r32_147_c1 | 3300050510 | Bacteria | 53171 |
| 987 | nmdc:mga06r32_41028_c1 | 3300050510 | Bacteria | 4395 |
| 988 | nmdc:mga08y16_1264_c1 | 3300050511 | Bacteria | 25114 |
| 989 | nmdc:mga08y16_226168_c1 | 3300050511 | Bacteria | 1936 |
| 990 | nmdc:mga08y16_361604_c1 | 3300050511 | Bacteria | 1490 |
| 991 | nmdc:mga08y16_388635_c1 | 3300050511 | Bacteria | 1429 |
| 992 | nmdc:mga0n895_121956_c1 | 3300050512 | Bacteria | 2628 |
| 993 | nmdc:mga0n895_141675_c1 | 3300050512 | Bacteria | 2433 |
| 994 | nmdc:mga0n895_202621_c1 | 3300050512 | Bacteria | 2015 |
| 995 | nmdc:mga0n895_4541_c1 | 3300050512 | Bacteria | 11425 |
| 996 | nmdc:mga0rr50_273_c1 | 3300050513 | Bacteria | 28156 |
| 997 | nmdc:mga0rr50_29015_c1 | 3300050513 | Bacteria | 3896 |
| 998 | nmdc:mga0rr50_37015_c1 | 3300050513 | Bacteria | 3519 |
| 999 | nmdc:mga0a205_60_c1 | 3300050515 | Bacteria | 60202 |
| 1000 | nmdc:mga0sz30_26549_c1 | 3300050516 | Bacteria | 2374 |
| 1001 | nmdc:mga0sz30_28641_c1 | 3300050516 | Bacteria | 2293 |
| 1002 | nmdc:mga0sz30_34769_c1 | 3300050516 | Bacteria | 2100 |
| 1003 | nmdc:mga0sz30_6454_c1 | 3300050516 | Bacteria | 4352 |
| 1004 | Ga0495601_0000068 | 3300053077 | Bacteria | 56524 |
| 1005 | Ga0495601_0005787 | 3300053077 | Bacteria | 7209 |
| 1006 | Ga0495601_0031642 | 3300053077 | Bacteria | 3289 |
| 1007 | Ga0495601_0040459 | 3300053077 | Bacteria | 2919 |
| 1008 | Ga0495612_0007426 | 3300053078 | Bacteria | 4479 |
| 1009 | Ga0495612_0009322 | 3300053078 | Bacteria | 3983 |
| 1010 | Ga0495612_0056836 | 3300053078 | Bacteria | 1615 |
| 1011 | Ga0500635_0063860 | 3300053080 | Bacteria | 1292 |
| 1012 | Ga0495595_0002320 | 3300053084 | Bacteria | 7420 |
| 1013 | Ga0495595_0025813 | 3300053084 | Bacteria | 2606 |
| 1014 | Ga0495595_0038103 | 3300053084 | Bacteria | 2189 |
| 1015 | Ga0495619_0000154 | 3300053085 | Bacteria | 50900 |
| 1016 | Ga0495619_0001079 | 3300053085 | Bacteria | 17901 |
| 1017 | Ga0495619_0003930 | 3300053085 | Bacteria | 9550 |
| 1018 | Ga0495619_0008147 | 3300053085 | Bacteria | 6632 |
| 1019 | Ga0495619_0043731 | 3300053085 | Bacteria | 2938 |
| 1020 | Ga0500646_0003943 | 3300053090 | Bacteria | 3774 |
| 1021 | Ga0500583_0041093 | 3300053092 | Bacteria | 2098 |
| 1022 | Ga0500566_0004572 | 3300053094 | Bacteria | 8253 |
| 1023 | Ga0500566_0050049 | 3300053094 | Bacteria | 2393 |
| 1024 | Ga0500640_007663 | 3300053095 | Bacteria | 4220 |
| 1025 | Ga0500554_000760 | 3300053102 | Bacteria | 6464 |
| 1026 | Ga0500557_000013 | 3300053105 | Bacteria | 108649 |
| 1027 | Ga0500572_000518 | 3300053111 | Bacteria | 13190 |
| 1028 | Ga0500595_000418 | 3300053119 | Bacteria | 26871 |
| 1029 | Ga0500595_003759 | 3300053119 | Bacteria | 6990 |
| 1030 | Ga0500595_012532 | 3300053119 | Bacteria | 3276 |
| 1031 | Ga0500614_000454 | 3300053123 | Bacteria | 10610 |
| 1032 | Ga0500642_0000031 | 3300053130 | Bacteria | 114671 |
| 1033 | Ga0500642_0014551 | 3300053130 | Bacteria | 2932 |
| 1034 | Ga0500658_0041454 | 3300053134 | Bacteria | 1846 |
| 1035 | Ga0500559_0016265 | 3300053136 | Bacteria | 3141 |
| 1036 | Ga0500559_0045245 | 3300053136 | Bacteria | 1926 |
| 1037 | Ga0500561_0002283 | 3300053137 | Bacteria | 3211 |
| 1038 | Ga0500568_0096067 | 3300053139 | Bacteria | 1114 |
| 1039 | Ga0500573_0083294 | 3300053140 | Bacteria | 1815 |
| 1040 | Ga0500603_002366 | 3300053150 | Bacteria | 4141 |
| 1041 | Ga0500604_0001167 | 3300053151 | Bacteria | 7301 |
| 1042 | Ga0500616_0001491 | 3300053153 | Bacteria | 22149 |
| 1043 | Ga0500620_009559 | 3300053155 | Bacteria | 2509 |
| 1044 | Ga0500627_0056410 | 3300053158 | Bacteria | 1722 |
| 1045 | Ga0500630_014273 | 3300053159 | Bacteria | 3913 |
| 1046 | Ga0500634_0063644 | 3300053161 | Bacteria | 1950 |
| 1047 | Ga0500638_064571 | 3300053162 | Bacteria | 1755 |
| 1048 | Ga0500639_000020 | 3300053163 | Bacteria | 102959 |
| 1049 | Ga0500637_0042676 | 3300053178 | Bacteria | 2564 |
| 1050 | Ga0500637_0081892 | 3300053178 | Bacteria | 1864 |
| 1051 | Ga0500596_002299 | 3300053735 | Bacteria | 3783 |
| 1052 | Ga0587085_010762 | 3300059506 | Bacteria | 1221 |
| 1053 | Ga0501082_0044817 | 3300060353 | Bacteria | 3815 |
| 1054 | Ga0466962_0090053 | 3300061719 | Bacteria | 1470 |
| 1055 | 2513703064 | 2513237102 | Bacteria | 7703324 |
| 1056 | Ga0265339_10006627 | |||
| 1057 | JGI24744J21845_10020808 | |||
| 1058 | JGI25159J45721_1005354 | |||
| 1059 | JGI25406J46586_10000107 | |||
| 1060 | JGI25406J46586_10005606 | |||
| 1061 | JGI25160J50197_1006152 | |||
| 1062 | JGI25160J50197_1009539 | |||
| 1063 | JGI25161J50226_1003761 | |||
| 1064 | Ga0055526_1012505 | |||
| 1065 | Ga0055537_1004285 | |||
| 1066 | Ga0055524_1000027 | |||
| 1067 | Ga0055524_1001507 | |||
| 1068 | Ga0055534_1001016 | |||
| 1069 | Ga0055530_10020158 | |||
| 1070 | Ga0055531_10003173 | |||
| 1071 | Ga0055531_10004688 | |||
| 1072 | Ga0055543_1007517 | |||
| 1073 | Ga0065165_1000187 | |||
| 1074 | Ga0065165_1013117 | |||
| 1075 | Ga0070658_10378234 | |||
| 1076 | Ga0070683_100038935 | |||
| 1077 | Ga0070683_100201913 | |||
| 1078 | Ga0070670_100069923 | |||
| 1079 | Ga0068869_100057326 | |||
| 1080 | Ga0068869_100294375 | |||
| 1081 | Ga0070666_10003036 | |||
| 1082 | Ga0070680_100012506 | |||
| 1083 | Ga0070682_100021605 | |||
| 1084 | Ga0068868_100065593 | |||
| 1085 | Ga0068868_100156211 | |||
| 1086 | Ga0070691_10092090 | |||
| 1087 | Ga0070661_100046186 | |||
| 1088 | Ga0070692_10040747 | |||
| 1089 | Ga0070668_100077274 | |||
| 1090 | Ga0070668_100102574 | |||
| 1091 | Ga0070668_100122322 | |||
| 1092 | Ga0070669_100072612 | |||
| 1093 | Ga0070669_100125977 | |||
| 1094 | Ga0070675_100180760 | |||
| 1095 | Ga0070671_100014401 | |||
| 1096 | Ga0070671_100018526 | |||
| 1097 | Ga0070671_100403274 | |||
| 1098 | Ga0070674_100011939 | |||
| 1099 | Ga0070674_100235081 | |||
| 1100 | Ga0070688_100012440 | |||
| 1101 | Ga0070659_100207023 | |||
| 1102 | Ga0070667_100057909 | |||
| 1103 | Ga0070709_10007278 | |||
| 1104 | Ga0070709_10007833 | |||
| 1105 | Ga0070709_10056068 | |||
| 1106 | Ga0070709_10198288 | |||
| 1107 | Ga0070714_100019413 | |||
| 1108 | Ga0070714_100023632 | |||
| 1109 | Ga0070714_100314626 | |||
| 1110 | Ga0070713_100000654 | |||
| 1111 | Ga0070713_100004079 | |||
| 1112 | Ga0070713_100023546 | |||
| 1113 | Ga0070713_100031411 | |||
| 1114 | Ga0070713_100154904 | |||
| 1115 | Ga0070710_10000619 | |||
| 1116 | Ga0070710_10000725 | |||
| 1117 | Ga0070710_10003810 | |||
| 1118 | Ga0070710_10010571 | |||
| 1119 | Ga0070710_10105365 | |||
| 1120 | Ga0070701_10114761 | |||
| 1121 | Ga0070711_100002407 | |||
| 1122 | Ga0070711_100013681 | |||
| 1123 | Ga0070711_100016017 | |||
| 1124 | Ga0070711_100024301 | |||
| 1125 | Ga0070711_100091624 | |||
| 1126 | Ga0070711_100186005 | |||
| 1127 | Ga0070700_100218815 | |||
| 1128 | Ga0070663_100033696 | |||
| 1129 | Ga0070663_100053685 | |||
| 1130 | Ga0070663_100067051 | |||
| 1131 | Ga0070678_100001526 | |||
| 1132 | Ga0070678_100056721 | |||
| 1133 | Ga0070678_100246315 | |||
| 1134 | Ga0070662_100109629 | |||
| 1135 | Ga0070662_100111646 | |||
| 1136 | Ga0070681_10116684 | |||
| 1137 | Ga0070681_10203693 | |||
| 1138 | Ga0068867_100158819 | |||
| 1139 | Ga0070706_100062316 | |||
| 1140 | Ga0070706_100142083 | |||
| 1141 | Ga0070698_100145193 | |||
| 1142 | Ga0070699_100016195 | |||
| 1143 | Ga0070679_100002694 | |||
| 1144 | Ga0070679_100003367 | |||
| 1145 | Ga0070679_100105547 | |||
| 1146 | Ga0070679_100152364 | |||
| 1147 | Ga0070684_100000621 | |||
| 1148 | Ga0070684_100051868 | |||
| 1149 | Ga0070684_100072695 | |||
| 1150 | Ga0070684_100181949 | |||
| 1151 | Ga0068853_100042614 | |||
| 1152 | Ga0068853_100065063 | |||
| 1153 | Ga0070686_100025190 | |||
| 1154 | Ga0070665_100063530 | |||
| 1155 | Ga0070665_100075446 | |||
| 1156 | Ga0070665_100129720 | |||
| 1157 | Ga0070665_100152976 | |||
| 1158 | Ga0068855_100017251 | |||
| 1159 | Ga0068855_100049447 | |||
| 1160 | Ga0068855_100061782 | |||
| 1161 | Ga0068855_100225009 | |||
| 1162 | Ga0068855_100298739 | |||
| 1163 | Ga0070664_100012468 | |||
| 1164 | Ga0068857_100180340 | |||
| 1165 | Ga0068854_100049257 | |||
| 1166 | Ga0068854_100155644 | |||
| 1167 | Ga0068856_100006276 | |||
| 1168 | Ga0068856_100033823 | |||
| 1169 | Ga0068856_100100869 | |||
| 1170 | Ga0068856_100116369 | |||
| 1171 | Ga0068856_100162134 | |||
| 1172 | Ga0070702_100119426 | |||
| 1173 | Ga0070702_100229466 | |||
| 1174 | Ga0068852_100014911 | |||
| 1175 | Ga0068852_100029395 | |||
| 1176 | Ga0068852_100087741 | |||
| 1177 | Ga0068852_100169964 | |||
| 1178 | Ga0068852_100312122 | |||
| 1179 | Ga0068859_100035622 | |||
| 1180 | Ga0068859_100050138 | |||
| 1181 | Ga0068864_100034639 | |||
| 1182 | Ga0068864_100066071 | |||
| 1183 | Ga0068864_100173219 | |||
| 1184 | Ga0068866_10024805 | |||
| 1185 | Ga0068861_100176954 | |||
| 1186 | Ga0068851_10032548 | |||
| 1187 | Ga0068863_100032539 | |||
| 1188 | Ga0068863_100217006 | |||
| 1189 | Ga0068863_100400900 | |||
| 1190 | Ga0068858_100112856 | |||
| 1191 | Ga0068858_100148950 | |||
| 1192 | Ga0068860_100075752 | |||
| 1193 | Ga0068862_100062346 | |||
| 1194 | Ga0068862_100122830 | |||
| 1195 | Ga0081455_10002932 | |||
| 1196 | Ga0081455_10004237 | |||
| 1197 | Ga0081455_10008523 | |||
| 1198 | Ga0081455_10020159 | |||
| 1199 | Ga0081455_10040732 | |||
| 1200 | Ga0081455_10097899 | |||
| 1201 | Ga0081538_10077591 | |||
| 1202 | Ga0081540_1002792 | |||
| 1203 | Ga0081540_1004157 | |||
| 1204 | Ga0081540_1004412 | |||
| 1205 | Ga0081540_1011890 | |||
| 1206 | Ga0081540_1013019 | |||
| 1207 | Ga0081540_1015177 | |||
| 1208 | Ga0081540_1034570 | |||
| 1209 | Ga0081540_1047327 | |||
| 1210 | Ga0081539_10000051 | |||
| 1211 | Ga0081539_10000148 | |||
| 1212 | Ga0081539_10029652 | |||
| 1213 | Ga0081539_10099458 | |||
| 1214 | Ga0070717_10009594 | |||
| 1215 | Ga0070717_10074234 | |||
| 1216 | Ga0070717_10145777 | |||
| 1217 | Ga0075365_10007541 | |||
| 1218 | Ga0075365_10096491 | |||
| 1219 | Ga0075365_10144684 | |||
| 1220 | Ga0075363_100030733 | |||
| 1221 | Ga0075363_100036522 | |||
| 1222 | Ga0075364_10041920 | |||
| 1223 | Ga0075364_10090179 | |||
| 1224 | Ga0075432_10000491 | |||
| 1225 | Ga0070715_10004128 | |||
| 1226 | Ga0070715_10011486 | |||
| 1227 | Ga0070715_10017678 | |||
| 1228 | Ga0070716_100001675 | |||
| 1229 | Ga0070716_100002224 | |||
| 1230 | Ga0070716_100003768 | |||
| 1231 | Ga0070712_100060483 | |||
| 1232 | Ga0070712_100086848 | |||
| 1233 | Ga0070712_100092989 | |||
| 1234 | Ga0070712_100127347 | |||
| 1235 | Ga0075362_10002041 | |||
| 1236 | Ga0075362_10003906 | |||
| 1237 | Ga0075362_10013039 | |||
| 1238 | Ga0075362_10041562 | |||
| 1239 | Ga0075367_10020499 | |||
| 1240 | Ga0075367_10023743 | |||
| 1241 | Ga0075367_10117108 | |||
| 1242 | Ga0075369_10000420 | |||
| 1243 | Ga0075369_10036016 | |||
| 1244 | Ga0075369_10075292 | |||
| 1245 | Ga0075366_10049089 | |||
| 1246 | Ga0097621_100001495 | |||
| 1247 | Ga0097621_100041011 | |||
| 1248 | Ga0075370_10013923 | |||
| 1249 | Ga0075370_10051208 | |||
| 1250 | Ga0075370_10060809 | |||
| 1251 | Ga0075370_10069111 | |||
| 1252 | Ga0068871_100018020 | |||
| 1253 | Ga0068871_100345134 | |||
| 1254 | Ga0075428_100012516 | |||
| 1255 | Ga0075428_100117276 | |||
| 1256 | Ga0075430_100007118 | |||
| 1257 | Ga0075430_100170848 | |||
| 1258 | Ga0075431_100008980 | |||
| 1259 | Ga0075431_100105225 | |||
| 1260 | Ga0075433_10003920 | |||
| 1261 | Ga0075433_10118939 | |||
| 1262 | Ga0075433_10162203 | |||
| 1263 | Ga0075434_100012465 | |||
| 1264 | Ga0075434_100053856 | |||
| 1265 | Ga0075434_100060206 | |||
| 1266 | Ga0075434_100108266 | |||
| 1267 | Ga0075429_100006654 | |||
| 1268 | Ga0068865_100022754 | |||
| 1269 | Ga0068865_100075715 | |||
| 1270 | Ga0068865_100152278 | |||
| 1271 | Ga0097620_100035614 | |||
| 1272 | Ga0097620_100050136 | |||
| 1273 | Ga0099822_1008625 | |||
| 1274 | Ga0099823_1055427 | |||
| 1275 | Ga0099826_10000003 | |||
| 1276 | Ga0075435_100023709 | |||
| 1277 | Ga0075435_100038135 | |||
| 1278 | Ga0099794_10017092 | |||
| 1279 | Ga0099795_10004340 | |||
| 1280 | Ga0105251_10019476 | |||
| 1281 | Ga0105240_10001465 | |||
| 1282 | Ga0105240_10005244 | |||
| 1283 | Ga0105240_10108493 | |||
| 1284 | Ga0105240_10199716 | |||
| 1285 | Ga0105240_10241035 | |||
| 1286 | Ga0105240_10294766 | |||
| 1287 | Ga0105240_10525974 | |||
| 1288 | Ga0111539_10168243 | |||
| 1289 | Ga0105245_10035400 | |||
| 1290 | Ga0105245_10101657 | |||
| 1291 | Ga0105245_10127164 | |||
| 1292 | Ga0105245_10214607 | |||
| 1293 | Ga0105247_10006238 | |||
| 1294 | Ga0105247_10034815 | |||
| 1295 | Ga0105247_10077827 | |||
| 1296 | Ga0114129_10046884 | |||
| 1297 | Ga0114129_10116035 | |||
| 1298 | Ga0114129_10238278 | |||
| 1299 | Ga0114129_10485646 | |||
| 1300 | Ga0105243_10124740 | |||
| 1301 | Ga0105243_10144557 | |||
| 1302 | Ga0105243_10378322 | |||
| 1303 | Ga0105242_10026017 | |||
| 1304 | Ga0105248_10236306 | |||
| 1305 | Ga0105248_10282782 | |||
| 1306 | Ga0105248_10456698 | |||
| 1307 | Ga0105237_10022354 | |||
| 1308 | Ga0105237_10027674 | |||
| 1309 | Ga0105237_10027794 | |||
| 1310 | Ga0105237_10089708 | |||
| 1311 | Ga0105237_10383296 | |||
| 1312 | Ga0105238_10071296 | |||
| 1313 | Ga0105238_10077832 | |||
| 1314 | Ga0105238_10223182 | |||
| 1315 | Ga0105238_10251991 | |||
| 1316 | Ga0105249_10236354 | |||
| 1317 | Ga0099796_10017191 | |||
| 1318 | Ga0105239_10057074 | |||
| 1319 | Ga0105239_10115805 | |||
| 1320 | Ga0105239_10120704 | |||
| 1321 | Ga0105239_10161677 | |||
| 1322 | Ga0105239_10254643 | |||
| 1323 | Ga0105239_10408433 | |||
| 1324 | Ga0105239_10583852 | |||
| 1325 | Ga0105246_10022551 | |||
| 1326 | Ga0105246_10026712 | |||
| 1327 | Ga0105246_10232685 | |||
| 1328 | Ga0157371_10039643 | |||
| 1329 | Ga0157370_10044798 | |||
| 1330 | Ga0157369_10014950 | |||
| 1331 | Ga0157369_10084587 | |||
| 1332 | Ga0157374_10010342 | |||
| 1333 | Ga0157374_10112011 | |||
| 1334 | Ga0157374_10162798 | |||
| 1335 | Ga0157374_10189133 | |||
| 1336 | Ga0157378_10007029 | |||
| 1337 | Ga0157378_10120601 | |||
| 1338 | Ga0163162_10018426 | |||
| 1339 | Ga0163162_10043821 | |||
| 1340 | Ga0163162_10187543 | |||
| 1341 | Ga0163162_10219894 | |||
| 1342 | Ga0163162_10240105 | |||
| 1343 | Ga0157372_10050726 | |||
| 1344 | Ga0157372_10069033 | |||
| 1345 | Ga0157372_10506932 | |||
| 1346 | Ga0157375_10007832 | |||
| 1347 | Ga0157375_10037712 | |||
| 1348 | Ga0157375_10049724 | |||
| 1349 | Ga0157375_10200926 | |||
| 1350 | Ga0157375_10221839 | |||
| 1351 | Ga0163163_10039428 | |||
| 1352 | Ga0163163_10221585 | |||
| 1353 | Ga0157380_10200443 | |||
| 1354 | Ga0157377_10016274 | |||
| 1355 | Ga0157377_10070526 | |||
| 1356 | Ga0157379_10005524 | |||
| 1357 | Ga0157379_10089518 | |||
| 1358 | Ga0157379_10189085 | |||
| 1359 | Ga0157376_10016269 | |||
| 1360 | Ga0157376_10023498 | |||
| 1361 | Ga0157376_10154222 | |||
| 1362 | Ga0157376_10243057 | |||
| 1363 | Ga0157376_10259526 | |||
| 1364 | Ga0163161_10019886 | |||
| 1365 | Ga0163161_10159533 | |||
| 1366 | Ga0206349_1737788 | |||
| 1367 | Ga0214544_1000002 | |||
| 1368 | Ga0214542_1000001 | |||
| 1369 | Ga0214545_1000001 | |||
| 1370 | Ga0214543_1000001 | |||
| 1371 | Ga0213876_10000453 | |||
| 1372 | Ga0224712_10025112 | |||
| 1373 | Ga0209436_109541 | |||
| 1374 | Ga0207425_1000062 | |||
| 1375 | Ga0209233_1002966 | |||
| 1376 | Ga0209565_1000608 | |||
| 1377 | Ga0209130_1000191 | |||
| 1378 | Ga0209130_1006139 | |||
| 1379 | Ga0209130_1015904 | |||
| 1380 | Ga0209675_1002903 | |||
| 1381 | Ga0209564_1001379 | |||
| 1382 | Ga0209564_1003158 | |||
| 1383 | Ga0209564_1021361 | |||
| 1384 | Ga0209758_1000024 | |||
| 1385 | Ga0209758_1000068 | |||
| 1386 | Ga0209758_1001914 | |||
| 1387 | Ga0209758_1003656 | |||
| 1388 | Ga0209758_1003852 | |||
| 1389 | Ga0209050_1000064 | |||
| 1390 | Ga0209256_1000013 | |||
| 1391 | Ga0209256_1002763 | |||
| 1392 | Ga0209256_1004276 | |||
| 1393 | Ga0207426_1013675 | |||
| 1394 | Ga0209051_1014434 | |||
| 1395 | Ga0209051_1029847 | |||
| 1396 | Ga0209257_1000010 | |||
| 1397 | Ga0209257_1000416 | |||
| 1398 | Ga0209257_1000998 | |||
| 1399 | Ga0209257_1023876 | |||
| 1400 | Ga0207697_10020898 | |||
| 1401 | Ga0207697_10034422 | |||
| 1402 | Ga0207656_10015225 | |||
| 1403 | Ga0207692_10001466 | |||
| 1404 | Ga0207692_10007323 | |||
| 1405 | Ga0207692_10026000 | |||
| 1406 | Ga0207692_10034637 | |||
| 1407 | Ga0207692_10155647 | |||
| 1408 | Ga0207642_10052492 | |||
| 1409 | Ga0207642_10121474 | |||
| 1410 | Ga0207710_10005963 | |||
| 1411 | Ga0207710_10012937 | |||
| 1412 | Ga0207710_10027372 | |||
| 1413 | Ga0207710_10054759 | |||
| 1414 | Ga0207688_10067989 | |||
| 1415 | Ga0207680_10038154 | |||
| 1416 | Ga0207647_10028229 | |||
| 1417 | Ga0207647_10068423 | |||
| 1418 | Ga0207685_10014351 | |||
| 1419 | Ga0207699_10004660 | |||
| 1420 | Ga0207699_10011040 | |||
| 1421 | Ga0207699_10015027 | |||
| 1422 | Ga0207699_10016282 | |||
| 1423 | Ga0207699_10174078 | |||
| 1424 | Ga0207699_10198413 | |||
| 1425 | Ga0207643_10047788 | |||
| 1426 | Ga0207643_10052253 | |||
| 1427 | Ga0207705_10013315 | |||
| 1428 | Ga0207684_10025013 | |||
| 1429 | Ga0207684_10125590 | |||
| 1430 | Ga0207684_10155625 | |||
| 1431 | Ga0207654_10026674 | |||
| 1432 | Ga0207654_10030221 | |||
| 1433 | Ga0207654_10059805 | |||
| 1434 | Ga0207654_10087440 | |||
| 1435 | Ga0207654_10116434 | |||
| 1436 | Ga0207707_10000826 | |||
| 1437 | Ga0207707_10007843 | |||
| 1438 | Ga0207707_10027522 | |||
| 1439 | Ga0207707_10059293 | |||
| 1440 | Ga0207707_10374125 | |||
| 1441 | Ga0207695_10000008 | |||
| 1442 | Ga0207695_10000548 | |||
| 1443 | Ga0207695_10142986 | |||
| 1444 | Ga0207671_10002452 | |||
| 1445 | Ga0207671_10008611 | |||
| 1446 | Ga0207671_10040916 | |||
| 1447 | Ga0207671_10149254 | |||
| 1448 | Ga0207671_10149570 | |||
| 1449 | Ga0207693_10001694 | |||
| 1450 | Ga0207693_10049013 | |||
| 1451 | Ga0207693_10082251 | |||
| 1452 | Ga0207663_10000319 | |||
| 1453 | Ga0207663_10002033 | |||
| 1454 | Ga0207663_10003305 | |||
| 1455 | Ga0207663_10014660 | |||
| 1456 | Ga0207663_10045074 | |||
| 1457 | Ga0207663_10155315 | |||
| 1458 | Ga0207663_10185182 | |||
| 1459 | Ga0207660_10020422 | |||
| 1460 | Ga0207660_10137146 | |||
| 1461 | Ga0207657_10005175 | |||
| 1462 | Ga0207657_10018400 | |||
| 1463 | Ga0207657_10096872 | |||
| 1464 | Ga0207657_10139466 | |||
| 1465 | Ga0207649_10015177 | |||
| 1466 | Ga0207652_10005120 | |||
| 1467 | Ga0207652_10007205 | |||
| 1468 | Ga0207652_10010590 | |||
| 1469 | Ga0207652_10020097 | |||
| 1470 | Ga0207652_10109279 | |||
| 1471 | Ga0207681_10172077 | |||
| 1472 | Ga0207694_10009346 | |||
| 1473 | Ga0207694_10019168 | |||
| 1474 | Ga0207694_10046298 | |||
| 1475 | Ga0207694_10073386 | |||
| 1476 | Ga0207694_10195946 | |||
| 1477 | Ga0207650_10043348 | |||
| 1478 | Ga0207650_10088767 | |||
| 1479 | Ga0207687_10017194 | |||
| 1480 | Ga0207700_10005747 | |||
| 1481 | Ga0207700_10019069 | |||
| 1482 | Ga0207700_10049821 | |||
| 1483 | Ga0207700_10137915 | |||
| 1484 | Ga0207700_10143492 | |||
| 1485 | Ga0207700_10183651 | |||
| 1486 | Ga0207664_10009456 | |||
| 1487 | Ga0207664_10070746 | |||
| 1488 | Ga0207644_10006104 | |||
| 1489 | Ga0207690_10173663 | |||
| 1490 | Ga0207706_10049922 | |||
| 1491 | Ga0207686_10009285 | |||
| 1492 | Ga0207686_10064625 | |||
| 1493 | Ga0207686_10116014 | |||
| 1494 | Ga0207669_10042509 | |||
| 1495 | Ga0207669_10136963 | |||
| 1496 | Ga0207669_10165871 | |||
| 1497 | Ga0207704_10045781 | |||
| 1498 | Ga0207704_10200035 | |||
| 1499 | Ga0207665_10009461 | |||
| 1500 | Ga0207665_10011216 | |||
| 1501 | Ga0207665_10011249 | |||
| 1502 | Ga0207665_10035047 | |||
| 1503 | Ga0207665_10072485 | |||
| 1504 | Ga0207665_10133127 | |||
| 1505 | Ga0207665_10134640 | |||
| 1506 | Ga0207691_10137576 | |||
| 1507 | Ga0207711_10007294 | |||
| 1508 | Ga0207661_10012708 | |||
| 1509 | Ga0207661_10015114 | |||
| 1510 | Ga0207661_10016612 | |||
| 1511 | Ga0207679_10019013 | |||
| 1512 | Ga0207679_10031984 | |||
| 1513 | Ga0207679_10107274 | |||
| 1514 | Ga0207679_10361027 | |||
| 1515 | Ga0207667_10006896 | |||
| 1516 | Ga0207667_10045333 | |||
| 1517 | Ga0207667_10150187 | |||
| 1518 | Ga0207667_10161102 | |||
| 1519 | Ga0207667_10389701 | |||
| 1520 | Ga0207712_10126549 | |||
| 1521 | Ga0207668_10116810 | |||
| 1522 | Ga0207668_10185805 | |||
| 1523 | Ga0207640_10110166 | |||
| 1524 | Ga0207640_10138739 | |||
| 1525 | Ga0207658_10009309 | |||
| 1526 | Ga0207658_10210590 | |||
| 1527 | Ga0207677_10019811 | |||
| 1528 | Ga0207677_10136655 | |||
| 1529 | Ga0207677_10151313 | |||
| 1530 | Ga0207677_10185028 | |||
| 1531 | Ga0207703_10034023 | |||
| 1532 | Ga0207703_10191533 | |||
| 1533 | Ga0207703_10369775 | |||
| 1534 | Ga0207639_10112437 | |||
| 1535 | Ga0207639_10164430 | |||
| 1536 | Ga0207639_10218174 | |||
| 1537 | Ga0207678_10004970 | |||
| 1538 | Ga0207678_10067644 | |||
| 1539 | Ga0207678_10067770 | |||
| 1540 | Ga0207678_10104461 | |||
| 1541 | Ga0207702_10063329 | |||
| 1542 | Ga0207702_10066937 | |||
| 1543 | Ga0207702_10138961 | |||
| 1544 | Ga0207702_10150659 | |||
| 1545 | Ga0207641_10192717 | |||
| 1546 | Ga0207641_10212213 | |||
| 1547 | Ga0207641_10282778 | |||
| 1548 | Ga0207648_10086119 | |||
| 1549 | Ga0207648_10124041 | |||
| 1550 | Ga0207648_10217345 | |||
| 1551 | Ga0207676_10060038 | |||
| 1552 | Ga0207676_10237389 | |||
| 1553 | Ga0207674_10083706 | |||
| 1554 | Ga0207674_10143401 | |||
| 1555 | Ga0207675_100122304 | |||
| 1556 | Ga0207675_100141236 | |||
| 1557 | Ga0207683_10012582 | |||
| 1558 | Ga0207683_10020872 | |||
| 1559 | Ga0207698_10008380 | |||
| 1560 | Ga0207698_10013393 | |||
| 1561 | Ga0207698_10025189 | |||
| 1562 | Ga0207698_10191176 | |||
| 1563 | Ga0207698_10228155 | |||
| 1564 | Ga0209389_1000100 | |||
| 1565 | Ga0209389_1000181 | |||
| 1566 | Ga0209589_1000001 | |||
| 1567 | Ga0209589_1000092 | |||
| 1568 | Ga0209489_100001 | |||
| 1569 | Ga0209489_100006 | |||
| 1570 | Ga0209489_103729 | |||
| 1571 | Ga0209700_100001 | |||
| 1572 | Ga0209700_100005 | |||
| 1573 | Ga0209179_1000974 | |||
| 1574 | Ga0209179_1002052 | |||
| 1575 | Ga0209282_1000002 | |||
| 1576 | Ga0209588_1000484 | |||
| 1577 | Ga0209588_1002746 | |||
| 1578 | Ga0209966_1004940 | |||
| 1579 | Ga0209998_10003532 | |||
| 1580 | Ga0209813_10005381 | |||
| 1581 | Ga0207428_10000250 | |||
| 1582 | Ga0268266_10037165 | |||
| 1583 | Ga0268266_10041167 | |||
| 1584 | Ga0268265_10010594 | |||
| 1585 | Ga0268265_10254927 | |||
| 1586 | Ga0268264_10000065 | |||
| 1587 | Ga0268264_10020914 | |||
| 1588 | Ga0265337_1019953 | |||
| 1589 | Ga0265334_10007602 | |||
| 1590 | Ga0265323_10000702 | |||
| 1591 | Ga0265336_10000093 | |||
| 1592 | Ga0307517_10000008 | |||
| 1593 | Ga0307515_10084914 | |||
| 1594 | Ga0265338_10000078 | |||
| 1595 | Ga0307511_10002494 | |||
| 1596 | Ga0265330_10010510 | |||
| 1597 | Ga0265325_10010203 | |||
| 1598 | Ga0265340_10001286 | |||
| 1599 | Ga0265340_10046614 | |||
| 1600 | Ga0265316_10240283 | |||
| 1601 | Ga0307513_10099720 | |||
| 1602 | Ga0307513_10219462 | |||
| 1603 | Ga0307509_10053610 | |||
| 1604 | Ga0307509_10157872 | |||
| 1605 | Ga0307509_10251340 | |||
| 1606 | Ga0307408_100005905 | |||
| 1607 | Ga0265313_10036962 | |||
| 1608 | Ga0307508_10050977 | |||
| 1609 | Ga0307508_10230610 | |||
| 1610 | Ga0265314_10054879 | |||
| 1611 | Ga0265342_10055531 | |||
| 1612 | Ga0307516_10006838 | |||
| 1613 | Ga0307516_10039241 | |||
| 1614 | Ga0307516_10039797 | |||
| 1615 | Ga0307516_10113185 | |||
| 1616 | Ga0307413_10107504 | |||
| 1617 | Ga0307411_10067629 | |||
| 1618 | Ga0307507_10033808 | |||
| 1619 | Ga0307510_10218629 | |||
| 1620 | Ga0316215_1002301 | |||
| 1621 | Ga0373954_0006616 | |||
| 1622 | Ga0373954_0010673 | |||
| 1623 | Ga0373956_0035765 | |||
| 1624 | Ga0373957_0002096 | |||
| 1625 | Ga0373957_0051780 | |||
| 1626 | Ga0373943_0003155 | |||
| 1627 | Ga0373943_0103415 | |||
| 1628 | Ga0373943_0140132 | |||
| 1629 | Ga0373946_0022128 | |||
| 1630 | Ga0373924_0082010 | |||
| 1631 | Ga0373931_0019954 | |||
| 1632 | Ga0373931_0036922 | |||
| 1633 | Ga0373935_0032432 | |||
| 1634 | Ga0373935_0117915 | |||
| 1635 | Ga0373927_0000488 | |||
| 1636 | Ga0373927_0031206 | |||
| 1637 | Ga0373927_0091899 | |||
| 1638 | Ga0373927_0094294 | |||
| 1639 | Ga0373933_0000728 | |||
| 1640 | Ga0373933_0012963 | |||
| 1641 | Ga0373933_0018325 | |||
| 1642 | Ga0373933_0031533 | |||
| 1643 | Ga0373933_0046558 | |||
| 1644 | Ga0373947_0000909 | |||
| 1645 | Ga0373947_0160671 | |||
| 1646 | Ga0373937_0019708 | |||
| 1647 | Ga0373937_0073161 | |||
| 1648 | Ga0373925_0009396 | |||
| 1649 | Ga0373925_0025709 | |||
| 1650 | Ga0373925_0070259 | |||
| 1651 | Ga0373925_0117310 | |||
| 1652 | Ga0373925_0327603 | |||
| 1653 | Ga0395899_0039532 | |||
| 1654 | Ga0395900_0001158 | |||
| 1655 | Ga0395900_0110847 | |||
| 1656 | Ga0395898_0003218 | |||
| 1657 | Ga0395898_0013915 | |||
| 1658 | Ga0395898_0066538 | |||
| 1659 | Ga0395898_0087922 | |||
| 1660 | Ga0395898_0181749 | |||
| 1661 | Ga0395905_0058197 | |||
| 1662 | Ga0436364_0818702 | |||
| 1663 | Ga0436364_1189605 | |||
| 1664 | Ga0395901_0029555 | |||
| 1665 | Ga0395901_0105934 | |||
| 1666 | Ga0395901_0384694 | |||
| 1667 | Ga0436365_0250762 | |||
| 1668 | Ga0436360_0912462 | |||
| 1669 | Ga0436360_1310166 | |||
| 1670 | Ga0436361_0882993 | |||
| 1671 | Ga0436363_0939093 | |||
| 1672 | Ga0436362_0825905 | |||
| 1673 | Ga0466969_0014903 | |||
| 1674 | Ga0466972_0000776 | |||
| 1675 | Ga0466972_0008969 | |||
| 1676 | Ga0466966_0034451 | |||
| 1677 | Ga0466966_0084518 | |||
| 1678 | Ga0466961_0000008 | |||
| 1679 | Ga0466968_0003144 | |||
| 1680 | Ga0466957_0050583 | |||
| 1681 | Ga0466960_0065511 | |||
| 1682 | Ga0466959_0039720 | |||
| 1683 | Ga0466967_0033513 | |||
| 1684 | Ga0466967_0085556 | |||
| 1685 | Ga0466967_0139080 | |||
| 1686 | Ga0466967_0141031 | |||
| 1687 | Ga0495592_0000975 | |||
| 1688 | Ga0495592_0007754 | |||
| 1689 | Ga0495592_0012082 | |||
| 1690 | Ga0495592_0035103 | |||
| 1691 | Ga0495592_0200136 | |||
| 1692 | Ga0495603_0006651 | |||
| 1693 | Ga0495603_0035149 | |||
| 1694 | Ga0495603_0035443 | |||
| 1695 | Ga0495603_0073905 | |||
| 1696 | Ga0495629_0000483 | |||
| 1697 | Ga0495629_0009417 | |||
| 1698 | Ga0495629_0041234 | |||
| 1699 | Ga0495629_0071148 | |||
| 1700 | Ga0495629_0075816 | |||
| 1701 | Ga0495638_0000114 | |||
| 1702 | Ga0495638_0054695 | |||
| 1703 | Ga0495638_0129453 | |||
| 1704 | Ga0495651_0001882 | |||
| 1705 | Ga0495651_0018721 | |||
| 1706 | Ga0495651_0025732 | |||
| 1707 | Ga0495651_0031740 | |||
| 1708 | Ga0495653_0002189 | |||
| 1709 | Ga0495653_0010887 | |||
| 1710 | Ga0495580_0000574 | |||
| 1711 | Ga0495580_0149532 | |||
| 1712 | Ga0495582_0000221 | |||
| 1713 | Ga0495605_0070215 | |||
| 1714 | Ga0495639_0000308 | |||
| 1715 | Ga0495662_0001537 | |||
| 1716 | Ga0495664_0005425 | |||
| 1717 | Ga0495664_0005911 | |||
| 1718 | Ga0495664_0023288 | |||
| 1719 | Ga0495584_0117897 | |||
| 1720 | Ga0495585_0137170 | |||
| 1721 | Ga0495594_0000259 | |||
| 1722 | Ga0495607_0076461 | |||
| 1723 | Ga0495583_0000468 | |||
| 1724 | Ga0495583_0012425 | |||
| 1725 | Ga0495606_0002401 | |||
| 1726 | Ga0495606_0015832 | |||
| 1727 | Ga0495606_0023441 | |||
| 1728 | Ga0495606_0047252 | |||
| 1729 | Ga0495608_0000491 | |||
| 1730 | Ga0495608_0013169 | |||
| 1731 | Ga0495608_0049281 | |||
| 1732 | Ga0495608_0113769 | |||
| 1733 | Ga0495616_0045555 | |||
| 1734 | Ga0495618_0014263 | |||
| 1735 | Ga0495618_0023456 | |||
| 1736 | Ga0495618_0219364 | |||
| 1737 | Ga0495628_0002686 | |||
| 1738 | Ga0495628_0084129 | |||
| 1739 | Ga0495630_0003908 | |||
| 1740 | Ga0495630_0080669 | |||
| 1741 | Ga0495630_0119663 | |||
| 1742 | Ga0495630_0147923 | |||
| 1743 | Ga0495631_0047883 | |||
| 1744 | Ga0495643_0024772 | |||
| 1745 | Ga0495643_0034765 | |||
| 1746 | Ga0495648_0000035 | |||
| 1747 | Ga0495663_0054015 | |||
| 1748 | Ga0495642_0008573 | |||
| 1749 | Ga0495652_0001609 | |||
| 1750 | Ga0495652_0012482 | |||
| 1751 | Ga0495652_0028565 | |||
| 1752 | Ga0495652_0033341 | |||
| 1753 | Ga0495665_0000153 | |||
| 1754 | Ga0495640_0000198 | |||
| 1755 | Ga0495640_0005502 | |||
| 1756 | Ga0495640_0035847 | |||
| 1757 | Ga0495640_0058512 | |||
| 1758 | Ga0495640_0142942 | |||
| 1759 | Ga0495586_0011964 | |||
| 1760 | Ga0495587_0007333 | |||
| 1761 | Ga0495587_0027522 | |||
| 1762 | Ga0495609_0004740 | |||
| 1763 | Ga0495609_0089026 | |||
| 1764 | Ga0495597_0008936 | |||
| 1765 | Ga0495597_0010944 | |||
| 1766 | Ga0495597_0017474 | |||
| 1767 | Ga0495645_0008945 | |||
| 1768 | Ga0495645_0018654 | |||
| 1769 | Ga0495645_0022931 | |||
| 1770 | Ga0495645_0032593 | |||
| 1771 | Ga0495645_0037758 | |||
| 1772 | Ga0495645_0146269 | |||
| 1773 | Ga0495622_0000258 | |||
| 1774 | Ga0495622_0004435 | |||
| 1775 | Ga0495622_0035457 | |||
| 1776 | Ga0495622_0039298 | |||
| 1777 | Ga0495622_0059919 | |||
| 1778 | Ga0495633_0000224 | |||
| 1779 | Ga0495633_0034756 | |||
| 1780 | Ga0495667_0008032 | |||
| 1781 | Ga0495667_0014322 | |||
| 1782 | Ga0495667_0023264 | |||
| 1783 | Ga0495656_0021268 | |||
| 1784 | Ga0495656_0041372 | |||
| 1785 | Ga0495668_0000462 | |||
| 1786 | Ga0495668_0048144 | |||
| 1787 | Ga0495668_0059875 | |||
| 1788 | Ga0495668_0066077 | |||
| 1789 | Ga0495668_0097256 | |||
| 1790 | Ga0495634_0001034 | |||
| 1791 | Ga0495634_0017351 | |||
| 1792 | Ga0495634_0033492 | |||
| 1793 | Ga0495634_0035820 | |||
| 1794 | Ga0495625_0000481 | |||
| 1795 | Ga0495625_0005750 | |||
| 1796 | Ga0495625_0013861 | |||
| 1797 | Ga0495635_0007557 | |||
| 1798 | Ga0495635_0011150 | |||
| 1799 | Ga0495635_0018033 | |||
| 1800 | Ga0495635_0035860 | |||
| 1801 | Ga0495659_0033546 | |||
| 1802 | Ga0495661_0032846 | |||
| 1803 | Ga0495661_0123667 | |||
| 1804 | Ga0495588_0006694 | |||
| 1805 | Ga0495588_0019358 | |||
| 1806 | Ga0495657_0000620 | |||
| 1807 | Ga0495657_0010901 | |||
| 1808 | Ga0495657_0031369 | |||
| 1809 | Ga0495599_0003016 | |||
| 1810 | Ga0495599_0006700 | |||
| 1811 | Ga0495599_0033743 | |||
| 1812 | Ga0495599_0059124 | |||
| 1813 | Ga0495599_0076515 | |||
| 1814 | Ga0495623_0001651 | |||
| 1815 | Ga0495623_0004884 | |||
| 1816 | Ga0495623_0098240 | |||
| 1817 | Ga0495646_0004029 | |||
| 1818 | Ga0495646_0005528 | |||
| 1819 | Ga0495658_0000722 | |||
| 1820 | Ga0495669_0018573 | |||
| 1821 | Ga0495669_0059799 | |||
| 1822 | Ga0495669_0080980 | |||
| 1823 | Ga0495613_0000393 | |||
| 1824 | Ga0495613_0251195 | |||
| 1825 | Ga0495624_0000182 | |||
| 1826 | Ga0495670_0042884 | |||
| 1827 | Ga0495649_0049325 | |||
| 1828 | Ga0495589_0059640 | |||
| 1829 | Ga0495600_0001979 | |||
| 1830 | Ga0495600_0006648 | |||
| 1831 | Ga0495600_0023137 | |||
| 1832 | Ga0495600_0024698 | |||
| 1833 | Ga0495600_0032723 | |||
| 1834 | Ga0495660_0000420 | |||
| 1835 | Ga0495660_0012335 | |||
| 1836 | Ga0495660_0039324 | |||
| 1837 | Ga0495581_0000502 | |||
| 1838 | Ga0495604_0000700 | |||
| 1839 | Ga0495604_0002824 | |||
| 1840 | Ga0495604_0025288 | |||
| 1841 | Ga0495604_0026093 | |||
| 1842 | Ga0495604_0232233 | |||
| 1843 | Ga0495674_0001836 | |||
| 1844 | Ga0495674_0032998 | |||
| 1845 | Ga0495674_0048074 | |||
| 1846 | Ga0495674_0065924 | |||
| 1847 | Ga0495674_0075371 | |||
| 1848 | Ga0495672_0042847 | |||
| 1849 | Ga0495676_0027914 | |||
| 1850 | Ga0495676_0129834 | |||
| 1851 | Ga0495680_0011172 | |||
| 1852 | Ga0495680_0011988 | |||
| 1853 | Ga0495680_0012924 | |||
| 1854 | Ga0495680_0013853 | |||
| 1855 | Ga0495680_0029336 | |||
| 1856 | Ga0495680_0036395 | |||
| 1857 | Ga0495680_0232486 | |||
| 1858 | Ga0495687_022234 | |||
| 1859 | Ga0495675_0015303 | |||
| 1860 | Ga0495675_0044857 | |||
| 1861 | Ga0495677_0008053 | |||
| 1862 | Ga0495679_026621 | |||
| 1863 | Ga0495685_003761 | |||
| 1864 | Ga0495681_0064311 | |||
| 1865 | Ga0495684_0026202 | |||
| 1866 | Ga0495684_0076386 | |||
| 1867 | Ga0495686_0136459 | |||
| 1868 | Ga0495593_0000477 | |||
| 1869 | Ga0495593_0019236 | |||
| 1870 | Ga0495593_0043823 | |||
| 1871 | Ga0495602_0002073 | |||
| 1872 | Ga0495602_0006751 | |||
| 1873 | Ga0495602_0024308 | |||
| 1874 | Ga0495614_0015945 | |||
| 1875 | Ga0496100_0003627 | |||
| 1876 | Ga0496101_0002421 | |||
| 1877 | Ga0496101_0011583 | |||
| 1878 | Ga0496101_0025657 | |||
| 1879 | Ga0496101_0028886 | |||
| 1880 | Ga0496101_0079839 | |||
| 1881 | Ga0496102_0010164 | |||
| 1882 | Ga0496102_0022662 | |||
| 1883 | Ga0496102_0217499 | |||
| 1884 | Ga0496102_0282882 | |||
| 1885 | Ga0496102_0388913 | |||
| 1886 | Ga0496103_0002137 | |||
| 1887 | Ga0496103_0006589 | |||
| 1888 | Ga0496103_0038771 | |||
| 1889 | Ga0496103_0039473 | |||
| 1890 | Ga0496103_0051312 | |||
| 1891 | Ga0496103_0075815 | |||
| 1892 | Ga0496104_0005077 | |||
| 1893 | Ga0496104_0023984 | |||
| 1894 | Ga0496104_0064111 | |||
| 1895 | Ga0496104_0073509 | |||
| 1896 | Ga0496104_0115804 | |||
| 1897 | Ga0496104_0174631 | |||
| 1898 | Ga0496105_0026517 | |||
| 1899 | Ga0496105_0034654 | |||
| 1900 | Ga0496105_0040202 | |||
| 1901 | Ga0496105_0068330 | |||
| 1902 | Ga0496105_0174075 | |||
| 1903 | Ga0496106_0004280 | |||
| 1904 | Ga0496106_0011700 | |||
| 1905 | Ga0496106_0053413 | |||
| 1906 | Ga0496106_0075080 | |||
| 1907 | Ga0496106_0110857 | |||
| 1908 | Ga0496106_0137054 | |||
| 1909 | Ga0496107_0036075 | |||
| 1910 | Ga0496107_0103021 | |||
| 1911 | Ga0496108_0064995 | |||
| 1912 | Ga0496108_0128333 | |||
| 1913 | Ga0496109_0014667 | |||
| 1914 | Ga0496109_0014714 | |||
| 1915 | Ga0496109_0076059 | |||
| 1916 | Ga0496109_0214390 | |||
| 1917 | Ga0496109_0279442 | |||
| 1918 | Ga0496110_0001620 | |||
| 1919 | Ga0496110_0041677 | |||
| 1920 | Ga0496110_0052012 | |||
| 1921 | Ga0496110_0134216 | |||
| 1922 | Ga0496111_0001911 | |||
| 1923 | Ga0496111_0076819 | |||
| 1924 | Ga0496111_0214751 | |||
| 1925 | Ga0496112_0000004 | |||
| 1926 | Ga0496112_0010712 | |||
| 1927 | Ga0496112_0051627 | |||
| 1928 | Ga0496112_0060412 | |||
| 1929 | Ga0496112_0102386 | |||
| 1930 | Ga0496112_0145600 | |||
| 1931 | Ga0496112_0255667 | |||
| 1932 | Ga0496113_0000558 | |||
| 1933 | Ga0496113_0002228 | |||
| 1934 | Ga0496113_0036089 | |||
| 1935 | Ga0496113_0043982 | |||
| 1936 | Ga0496113_0110239 | |||
| 1937 | Ga0496113_0298297 | |||
| 1938 | Ga0496114_0052188 | |||
| 1939 | Ga0496115_0024630 | |||
| 1940 | Ga0496115_0031403 | |||
| 1941 | Ga0496115_0046964 | |||
| 1942 | Ga0496115_0054671 | |||
| 1943 | Ga0496115_0064567 | |||
| 1944 | Ga0496115_0125659 | |||
| 1945 | Ga0496115_0146855 | |||
| 1946 | Ga0496117_0100305 | |||
| 1947 | Ga0496117_0134157 | |||
| 1948 | Ga0496118_0011127 | |||
| 1949 | Ga0496118_0014948 | |||
| 1950 | Ga0496119_0007084 | |||
| 1951 | Ga0496119_0063654 | |||
| 1952 | Ga0496120_0021911 | |||
| 1953 | Ga0496121_0001081 | |||
| 1954 | Ga0496121_0002560 | |||
| 1955 | Ga0496121_0022929 | |||
| 1956 | Ga0496121_0039695 | |||
| 1957 | Ga0496121_0156738 | |||
| 1958 | Ga0496121_0263100 | |||
| 1959 | Ga0496122_0052992 | |||
| 1960 | Ga0496124_0000722 | |||
| 1961 | Ga0496124_0033338 | |||
| 1962 | Ga0496125_0023066 | |||
| 1963 | Ga0496125_0037171 | |||
| 1964 | Ga0496125_0062071 | |||
| 1965 | Ga0496125_0161836 | |||
| 1966 | Ga0496126_0010006 | |||
| 1967 | Ga0496126_0012727 | |||
| 1968 | Ga0496126_0023351 | |||
| 1969 | Ga0496126_0029780 | |||
| 1970 | Ga0496126_0037510 | |||
| 1971 | Ga0496126_0084504 | |||
| 1972 | Ga0496126_0096389 | |||
| 1973 | Ga0496126_0098033 | |||
| 1974 | Ga0496126_0186097 | |||
| 1975 | Ga0495682_0010974 | |||
| 1976 | Ga0501032_0000216 | |||
| 1977 | Ga0501033_0000344 | |||
| 1978 | Ga0501034_0000100 | |||
| 1979 | Ga0501034_0004118 | |||
| 1980 | Ga0501034_0004422 | |||
| 1981 | Ga0501036_0000010 | |||
| 1982 | Ga0501036_0010773 | |||
| 1983 | Ga0501037_0000183 | |||
| 1984 | Ga0501037_0002727 | |||
| 1985 | Ga0501038_0000054 | |||
| 1986 | Ga0501039_0026215 | |||
| 1987 | Ga0501043_0000106 | |||
| 1988 | Ga0501046_0000742 | |||
| 1989 | Ga0501046_0034319 | |||
| 1990 | Ga0501047_0000493 | |||
| 1991 | Ga0501047_0015277 | |||
| 1992 | Ga0501048_0001189 | |||
| 1993 | Ga0501067_0000098 | |||
| 1994 | Ga0501068_0004912 | |||
| 1995 | Ga0501068_0008768 | |||
| 1996 | Ga0501068_0129291 | |||
| 1997 | Ga0501069_0004988 | |||
| 1998 | Ga0501070_0005534 | |||
| 1999 | Ga0501070_0008632 | |||
| 2000 | Ga0501070_0009508 | |||
| 2001 | Ga0501070_0181488 | |||
| 2002 | Ga0501072_0002739 | |||
| 2003 | Ga0501073_0000330 | |||
| 2004 | Ga0501074_0112501 | |||
| 2005 | Ga0501238_000704 | |||
| 2006 | Ga0501080_0001470 | |||
| 2007 | Ga0501080_0025001 | |||
| 2008 | Ga0501083_0000116 | |||
| 2009 | Ga0501083_0045253 | |||
| 2010 | Ga0501035_0000817 | |||
| 2011 | Ga0501035_0029501 | |||
| 2012 | Ga0501044_0019620 | |||
| 2013 | Ga0501044_0020178 | |||
| 2014 | Ga0501045_0066977 | |||
| 2015 | nmdc:mga03683_12761_c1 | |||
| 2016 | nmdc:mga03683_15237_c1 | |||
| 2017 | nmdc:mga03683_24889_c1 | |||
| 2018 | nmdc:mga03683_85699_c1 | |||
| 2019 | nmdc:mga03n38_2017_c1 | |||
| 2020 | nmdc:mga00v17_17429_c1 | |||
| 2021 | nmdc:mga00v17_44107_c1 | |||
| 2022 | nmdc:mga0yw44_193543_c1 | |||
| 2023 | nmdc:mga0yw44_50592_c1 | |||
| 2024 | nmdc:mga0yw44_7155_c1 | |||
| 2025 | nmdc:mga0yw44_91144_c1 | |||
| 2026 | nmdc:mga0k408_29996_c1 | |||
| 2027 | nmdc:mga0k408_82217_c1 | |||
| 2028 | nmdc:mga0k408_9138_c1 | |||
| 2029 | nmdc:mga06z11_14434_c1 | |||
| 2030 | nmdc:mga06z11_3255_c1 | |||
| 2031 | nmdc:mga06z11_8432_c1 | |||
| 2032 | nmdc:mga04h51_1861_c1 | |||
| 2033 | nmdc:mga07m45_75572_c1 | |||
| 2034 | nmdc:mga07m45_89051_c1 | |||
| 2035 | nmdc:mga05p37_354_c1 | |||
| 2036 | nmdc:mga05p37_38822_c1 | |||
| 2037 | nmdc:mga05p37_497181_c1 | |||
| 2038 | nmdc:mga09592_1311_c1 | |||
| 2039 | nmdc:mga0qj67_1940_c1 | |||
| 2040 | nmdc:mga0qj67_75906_c1 | |||
| 2041 | nmdc:mga06r32_147_c1 | |||
| 2042 | nmdc:mga06r32_41028_c1 | |||
| 2043 | nmdc:mga08y16_1264_c1 | |||
| 2044 | nmdc:mga08y16_226168_c1 | |||
| 2045 | nmdc:mga08y16_361604_c1 | |||
| 2046 | nmdc:mga08y16_388635_c1 | |||
| 2047 | nmdc:mga0n895_121956_c1 | |||
| 2048 | nmdc:mga0n895_141675_c1 | |||
| 2049 | nmdc:mga0n895_202621_c1 | |||
| 2050 | nmdc:mga0n895_4541_c1 | |||
| 2051 | nmdc:mga0rr50_273_c1 | |||
| 2052 | nmdc:mga0rr50_29015_c1 | |||
| 2053 | nmdc:mga0rr50_37015_c1 | |||
| 2054 | nmdc:mga0a205_60_c1 | |||
| 2055 | nmdc:mga0sz30_26549_c1 | |||
| 2056 | nmdc:mga0sz30_28641_c1 | |||
| 2057 | nmdc:mga0sz30_34769_c1 | |||
| 2058 | nmdc:mga0sz30_6454_c1 | |||
| 2059 | Ga0495601_0000068 | |||
| 2060 | Ga0495601_0005787 | |||
| 2061 | Ga0495601_0031642 | |||
| 2062 | Ga0495601_0040459 | |||
| 2063 | Ga0495612_0007426 | |||
| 2064 | Ga0495612_0009322 | |||
| 2065 | Ga0495612_0056836 | |||
| 2066 | Ga0500635_0063860 | |||
| 2067 | Ga0495595_0002320 | |||
| 2068 | Ga0495595_0025813 | |||
| 2069 | Ga0495595_0038103 | |||
| 2070 | Ga0495619_0000154 | |||
| 2071 | Ga0495619_0001079 | |||
| 2072 | Ga0495619_0003930 | |||
| 2073 | Ga0495619_0008147 | |||
| 2074 | Ga0495619_0043731 | |||
| 2075 | Ga0500646_0003943 | |||
| 2076 | Ga0500583_0041093 | |||
| 2077 | Ga0500566_0004572 | |||
| 2078 | Ga0500566_0050049 | |||
| 2079 | Ga0500640_007663 | |||
| 2080 | Ga0500554_000760 | |||
| 2081 | Ga0500557_000013 | |||
| 2082 | Ga0500572_000518 | |||
| 2083 | Ga0500595_000418 | |||
| 2084 | Ga0500595_003759 | |||
| 2085 | Ga0500595_012532 | |||
| 2086 | Ga0500614_000454 | |||
| 2087 | Ga0500642_0000031 | |||
| 2088 | Ga0500642_0014551 | |||
| 2089 | Ga0500658_0041454 | |||
| 2090 | Ga0500559_0016265 | |||
| 2091 | Ga0500559_0045245 | |||
| 2092 | Ga0500561_0002283 | |||
| 2093 | Ga0500568_0096067 | |||
| 2094 | Ga0500573_0083294 | |||
| 2095 | Ga0500603_002366 | |||
| 2096 | Ga0500604_0001167 | |||
| 2097 | Ga0500616_0001491 | |||
| 2098 | Ga0500620_009559 | |||
| 2099 | Ga0500627_0056410 | |||
| 2100 | Ga0500630_014273 | |||
| 2101 | Ga0500634_0063644 | |||
| 2102 | Ga0500638_064571 | |||
| 2103 | Ga0500639_000020 | |||
| 2104 | Ga0500637_0042676 | |||
| 2105 | Ga0500637_0081892 | |||
| 2106 | Ga0500596_002299 | |||
| 2107 | Ga0587085_010762 | |||
| 2108 | Ga0501082_0044817 | |||
| 2109 | Ga0466962_0090053 | |||
| 2110 | 2513703064 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hzl-assembly1.cif.gz_A | crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms | 0.9829 | 32 | 355 |
| 4yzz-assembly1.cif.gz_A | crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site | 0.9789 | 30 | 356 |
| 7ug8-assembly1.cif.gz_A | crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium | 0.9688 | 28 | 352 |
| 4pet-assembly1.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate | 0.9676 | 31 | 352 |
| 5cm6-assembly1.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate | 0.9569 | 31 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9738 | 30 | 356 | 3.40.190.170 |
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9653 | 32 | 357 | 3.40.190.170 |
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9564 | 32 | 357 | 3.40.190.170 |
| 4yicB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9549 | 155 | 321 | 3.40.190.10 |
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9518 | 30 | 356 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658ABT6-F1-model_v4 | deleted | 0.9904 | 31 | 360 |
|
| AF-A0A0D7EEV2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9893 | 32 | 359 |
GO:0015849
GO:0031317 GO:0043177 GO:0046872 GO:0055085 |
| AF-A0A537VVV0-F1-model_v4 | ABC transporter substrate-binding protein | 0.9815 | 74 | 360 |
GO:0055085
|
| AF-A0A3N5FTX4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9793 | 50 | 360 |
GO:0055085
|
| AF-A0A348SSK1-F1-model_v4 | deleted | 0.9773 | 98 | 356 |
|