F489273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1060 | 518 | 920 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10083025|Ga0307406_100830252 |
| Length | 331 |
| Sequence | MTAQHSAAPGQDTREPGRARIRVGSAPDSWGVWFPDDPEQVPWQRFLDEVSACGYEWIELGPYGYLPTDPAQLSDELAARSLRVSAGTVFEHLHRPNSWDAVWRQVDDVAALTQAVGGTHVVVIPDTFRDQKTGSDVESRELTAEQWQAKTSGVDRLARAIREEYGLSIAYHPHAESHVGWQRDIERFLADTDPALVPLCLDTGHVSYYRGDNLDLIRRYPERIGYLHLKQVDPAVIDEVLEKDVTWPDAVRMNAFVEPPNGVPAYPPLFEAIEELGLDVFAIVEQDMYPCPPDQPFPIAQRTHRHIASCQLPSLQIGAPTTRATGSEVQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 2 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 3 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 4 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 5 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 6 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 7 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 8 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 9 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 10 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 11 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 12 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 13 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 14 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 15 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 16 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 17 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 18 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 19 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 20 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 21 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 22 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 23 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 24 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 25 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 26 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 27 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 28 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 29 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 30 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 31 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 32 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 33 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 34 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 35 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 36 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 37 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 38 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 39 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 40 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 41 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 42 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 43 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 44 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 45 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 46 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 47 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 48 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 49 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 50 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 51 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 52 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 53 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 54 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 55 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 56 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 57 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 58 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 59 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 60 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 61 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 62 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 63 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 64 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 65 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 66 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 67 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 68 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 69 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 70 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 71 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 72 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 73 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 74 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 75 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 76 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 77 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 78 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 79 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 80 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 81 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 82 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 83 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 84 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 85 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 86 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 87 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 88 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 89 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 90 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 91 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 92 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 93 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 94 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 95 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 96 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 97 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 98 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 99 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 100 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 101 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 102 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 103 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 104 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 106 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 107 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 108 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 109 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 112 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 113 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 116 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 118 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 126 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 139 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 142 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 148 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 149 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 150 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 152 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 153 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 154 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 155 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 156 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 157 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 158 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 159 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 160 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 161 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 162 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 163 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 164 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 165 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 166 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 167 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 168 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 169 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 171 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 172 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 174 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 175 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 176 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 177 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 178 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 179 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 180 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 181 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 182 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 184 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 185 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 198 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 209 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 213 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 214 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 215 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 217 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 218 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 266 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 271 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 272 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 273 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 274 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 275 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 276 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 277 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 278 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 279 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 280 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 281 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 283 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 284 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 285 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 286 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 287 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 289 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 290 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 291 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 292 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 293 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 294 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 295 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 302 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 303 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 304 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 305 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 306 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 307 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 308 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 310 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 311 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 312 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 313 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 314 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 315 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 316 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 317 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 318 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 319 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 320 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 321 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 322 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 323 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 324 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 325 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 326 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 327 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 328 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 329 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 330 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 331 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 332 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 333 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 334 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 335 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 336 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 337 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 414 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 415 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 416 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 417 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 418 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 419 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 422 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 423 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 424 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 425 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 426 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 429 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 432 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 437 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 463 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 484 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 486 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 489 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 490 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 491 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 492 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 493 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 494 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 496 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 497 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 498 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 499 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 501 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 502 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 503 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 504 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 505 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 506 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 507 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 508 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 509 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 510 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 511 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 512 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 513 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 514 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 515 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 516 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 517 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 518 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.79 |
| Metatranscriptomes | 0 |
| Isolates | 13.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 6.7 |
| Nodule | 0.57 |
| Rhizoplane | 6.42 |
| Rhizosphere | 75.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10005135 | 3300001991 | Bacteria | 2171 |
| 2 | JGI24738J21930_10012736 | 3300002075 | Bacteria | 1833 |
| 3 | JGI24744J21845_10001322 | 3300002077 | Bacteria | 4893 |
| 4 | JGI24744J21845_10004246 | 3300002077 | Bacteria | 2957 |
| 5 | JGI24034J26672_10010430 | 3300002239 | Bacteria | 1380 |
| 6 | JGI25406J46586_10002006 | 3300003203 | Bacteria | 9620 |
| 7 | rootH1_10030847 | 3300003316 | Bacteria | 1884 |
| 8 | rootH1_10039924 | 3300003316 | Bacteria | 6529 |
| 9 | rootH2_10002244 | 3300003320 | Bacteria | 2298 |
| 10 | rootH2_10015356 | 3300003320 | Bacteria | 7338 |
| 11 | JGI25160J50197_1007423 | 3300003354 | Bacteria | 4290 |
| 12 | JGI25160J50197_1019006 | 3300003354 | Bacteria | 2122 |
| 13 | JGI25407J50210_10014559 | 3300003373 | Bacteria | 2027 |
| 14 | JGI25404J52841_10001019 | 3300003659 | Bacteria | 4630 |
| 15 | Ga0070676_10013125 | 3300005328 | Bacteria | 4538 |
| 16 | Ga0070676_10199641 | 3300005328 | Bacteria | 1310 |
| 17 | Ga0070690_100118651 | 3300005330 | Bacteria | 1774 |
| 18 | Ga0068869_100058741 | 3300005334 | Bacteria | 2814 |
| 19 | Ga0068869_100463230 | 3300005334 | Bacteria | 1053 |
| 20 | Ga0070666_10329768 | 3300005335 | Bacteria | 1090 |
| 21 | Ga0070682_100023784 | 3300005337 | Bacteria | 3640 |
| 22 | Ga0070682_100025193 | 3300005337 | Bacteria | 3548 |
| 23 | Ga0070682_100062857 | 3300005337 | Bacteria | 2352 |
| 24 | Ga0070682_100069467 | 3300005337 | Bacteria | 2249 |
| 25 | Ga0070682_100089163 | 3300005337 | Bacteria | 2014 |
| 26 | Ga0070682_100172079 | 3300005337 | Bacteria | 1506 |
| 27 | Ga0070682_100271185 | 3300005337 | Bacteria | 1233 |
| 28 | Ga0068868_100021572 | 3300005338 | Bacteria | 4851 |
| 29 | Ga0070660_100223742 | 3300005339 | Bacteria | 1530 |
| 30 | Ga0070689_100052755 | 3300005340 | Bacteria | 3146 |
| 31 | Ga0070687_100091510 | 3300005343 | Bacteria | 1684 |
| 32 | Ga0070692_10086442 | 3300005345 | Bacteria | 1697 |
| 33 | Ga0070668_100000258 | 3300005347 | Bacteria | 35205 |
| 34 | Ga0070668_100032029 | 3300005347 | Bacteria | 4000 |
| 35 | Ga0070668_100252826 | 3300005347 | Bacteria | 1463 |
| 36 | Ga0070668_100331507 | 3300005347 | Bacteria | 1283 |
| 37 | Ga0070669_100021773 | 3300005353 | Bacteria | 4584 |
| 38 | Ga0070669_100104510 | 3300005353 | Bacteria | 2141 |
| 39 | Ga0070671_100109400 | 3300005355 | Bacteria | 2321 |
| 40 | Ga0070674_100014431 | 3300005356 | Bacteria | 4912 |
| 41 | Ga0070673_100377266 | 3300005364 | Bacteria | 1264 |
| 42 | Ga0070688_100027997 | 3300005365 | Bacteria | 3359 |
| 43 | Ga0070688_100128638 | 3300005365 | Bacteria | 1705 |
| 44 | Ga0070659_100063986 | 3300005366 | Bacteria | 2910 |
| 45 | Ga0070659_100102195 | 3300005366 | Bacteria | 2307 |
| 46 | Ga0070659_100197470 | 3300005366 | Bacteria | 1655 |
| 47 | Ga0070659_100368251 | 3300005366 | Bacteria | 1208 |
| 48 | Ga0070667_100000077 | 3300005367 | Bacteria | 120245 |
| 49 | Ga0070667_100059707 | 3300005367 | Bacteria | 3226 |
| 50 | Ga0070667_100108548 | 3300005367 | Bacteria | 2404 |
| 51 | Ga0070714_100178474 | 3300005435 | Bacteria | 1931 |
| 52 | Ga0070710_10003297 | 3300005437 | Bacteria | 7650 |
| 53 | Ga0070710_10016525 | 3300005437 | Bacteria | 3758 |
| 54 | Ga0070701_10001956 | 3300005438 | Bacteria | 7804 |
| 55 | Ga0070711_100003805 | 3300005439 | Bacteria | 8861 |
| 56 | Ga0070711_100013123 | 3300005439 | Bacteria | 5196 |
| 57 | Ga0070700_100011281 | 3300005441 | Bacteria | 4946 |
| 58 | Ga0070700_100040024 | 3300005441 | Bacteria | 2867 |
| 59 | Ga0070700_100040381 | 3300005441 | Bacteria | 2856 |
| 60 | Ga0070694_100331705 | 3300005444 | Bacteria | 1174 |
| 61 | Ga0070708_100136177 | 3300005445 | Bacteria | 2275 |
| 62 | Ga0070663_100029769 | 3300005455 | Bacteria | 3735 |
| 63 | Ga0070663_100141789 | 3300005455 | Bacteria | 1835 |
| 64 | Ga0070663_100155109 | 3300005455 | Bacteria | 1759 |
| 65 | Ga0070678_100036168 | 3300005456 | Bacteria | 3454 |
| 66 | Ga0070678_100037113 | 3300005456 | Bacteria | 3418 |
| 67 | Ga0070678_100069532 | 3300005456 | Bacteria | 2629 |
| 68 | Ga0070662_100014744 | 3300005457 | Bacteria | 5223 |
| 69 | Ga0068867_100014648 | 3300005459 | Bacteria | 5557 |
| 70 | Ga0068867_100145593 | 3300005459 | Bacteria | 1856 |
| 71 | Ga0070685_10031004 | 3300005466 | Bacteria | 2983 |
| 72 | Ga0070685_10205411 | 3300005466 | Bacteria | 1283 |
| 73 | Ga0070706_100491982 | 3300005467 | Unclassified | 1141 |
| 74 | Ga0068853_100035405 | 3300005539 | Bacteria | 4240 |
| 75 | Ga0068853_100094468 | 3300005539 | Bacteria | 2635 |
| 76 | Ga0068853_100107742 | 3300005539 | Bacteria | 2471 |
| 77 | Ga0070695_100071099 | 3300005545 | Bacteria | 2278 |
| 78 | Ga0070696_100014519 | 3300005546 | Bacteria | 5285 |
| 79 | Ga0070696_100087772 | 3300005546 | Bacteria | 2209 |
| 80 | Ga0070693_100014604 | 3300005547 | Bacteria | 4027 |
| 81 | Ga0070665_100007324 | 3300005548 | Bacteria | 11225 |
| 82 | Ga0070665_100030094 | 3300005548 | Bacteria | 5464 |
| 83 | Ga0070665_100041694 | 3300005548 | Bacteria | 4615 |
| 84 | Ga0070704_100032574 | 3300005549 | Bacteria | 3517 |
| 85 | Ga0068855_100244810 | 3300005563 | Bacteria | 2002 |
| 86 | Ga0068854_100013941 | 3300005578 | Bacteria | 5288 |
| 87 | Ga0068854_100015472 | 3300005578 | Bacteria | 5055 |
| 88 | Ga0068854_100237154 | 3300005578 | Bacteria | 1451 |
| 89 | Ga0068854_100291283 | 3300005578 | Bacteria | 1317 |
| 90 | Ga0068856_100128145 | 3300005614 | Bacteria | 2541 |
| 91 | Ga0070702_100014396 | 3300005615 | Bacteria | 4012 |
| 92 | Ga0070702_100107025 | 3300005615 | Bacteria | 1726 |
| 93 | Ga0070702_100111447 | 3300005615 | Bacteria | 1697 |
| 94 | Ga0070702_100121378 | 3300005615 | Bacteria | 1637 |
| 95 | Ga0070702_100265205 | 3300005615 | Bacteria | 1171 |
| 96 | Ga0068859_100000438 | 3300005617 | Bacteria | 41832 |
| 97 | Ga0068859_100042006 | 3300005617 | Bacteria | 4592 |
| 98 | Ga0068859_100117895 | 3300005617 | Bacteria | 2720 |
| 99 | Ga0068859_100248357 | 3300005617 | Bacteria | 1869 |
| 100 | Ga0068866_10005609 | 3300005718 | Bacteria | 5194 |
| 101 | Ga0068866_10005802 | 3300005718 | Bacteria | 5123 |
| 102 | Ga0068866_10022932 | 3300005718 | Bacteria | 2896 |
| 103 | Ga0068861_100038820 | 3300005719 | Bacteria | 3550 |
| 104 | Ga0068861_100063709 | 3300005719 | Bacteria | 2834 |
| 105 | Ga0068861_100139583 | 3300005719 | Bacteria | 1977 |
| 106 | Ga0068863_100000777 | 3300005841 | Bacteria | 32074 |
| 107 | Ga0068863_100011776 | 3300005841 | Bacteria | 8454 |
| 108 | Ga0068863_100161053 | 3300005841 | Bacteria | 2150 |
| 109 | Ga0068863_100173859 | 3300005841 | Bacteria | 2066 |
| 110 | Ga0068858_100008639 | 3300005842 | Bacteria | 9781 |
| 111 | Ga0068858_100034036 | 3300005842 | Bacteria | 4726 |
| 112 | Ga0068858_100100702 | 3300005842 | Bacteria | 2694 |
| 113 | Ga0068860_100000010 | 3300005843 | Bacteria | 359114 |
| 114 | Ga0068860_100025586 | 3300005843 | Bacteria | 5692 |
| 115 | Ga0068860_100439666 | 3300005843 | Bacteria | 1295 |
| 116 | Ga0068862_100000008 | 3300005844 | Bacteria | 305510 |
| 117 | Ga0068862_100030155 | 3300005844 | Bacteria | 4570 |
| 118 | Ga0081455_10025168 | 3300005937 | Bacteria | 5498 |
| 119 | Ga0081455_10032407 | 3300005937 | Bacteria | 4708 |
| 120 | Ga0081455_10034638 | 3300005937 | Bacteria | 4522 |
| 121 | Ga0081455_10067116 | 3300005937 | Bacteria | 2991 |
| 122 | Ga0081455_10093426 | 3300005937 | Bacteria | 2432 |
| 123 | Ga0081538_10000186 | 3300005981 | Bacteria | 68308 |
| 124 | Ga0081538_10096580 | 3300005981 | Bacteria | 1505 |
| 125 | Ga0081540_1001044 | 3300005983 | Bacteria | 24757 |
| 126 | Ga0081540_1043683 | 3300005983 | Bacteria | 2295 |
| 127 | Ga0081539_10000208 | 3300005985 | Bacteria | 136941 |
| 128 | Ga0081539_10003746 | 3300005985 | Bacteria | 18071 |
| 129 | Ga0075365_10006361 | 3300006038 | Bacteria | 6491 |
| 130 | Ga0075365_10088968 | 3300006038 | Bacteria | 2102 |
| 131 | Ga0075365_10197601 | 3300006038 | Bacteria | 1408 |
| 132 | Ga0075368_10030260 | 3300006042 | Bacteria | 2096 |
| 133 | Ga0075368_10035580 | 3300006042 | Bacteria | 1944 |
| 134 | Ga0075363_100008072 | 3300006048 | Bacteria | 4882 |
| 135 | Ga0075363_100012279 | 3300006048 | Bacteria | 4125 |
| 136 | Ga0075363_100020295 | 3300006048 | Bacteria | 3331 |
| 137 | Ga0075363_100032995 | 3300006048 | Bacteria | 2693 |
| 138 | Ga0075363_100053836 | 3300006048 | Bacteria | 2151 |
| 139 | Ga0075364_10002441 | 3300006051 | Bacteria | 10412 |
| 140 | Ga0075364_10024121 | 3300006051 | Bacteria | 3858 |
| 141 | Ga0075364_10051528 | 3300006051 | Bacteria | 2688 |
| 142 | Ga0075364_10105783 | 3300006051 | Bacteria | 1875 |
| 143 | Ga0075364_10309002 | 3300006051 | Bacteria | 1077 |
| 144 | Ga0075432_10000861 | 3300006058 | Bacteria | 9564 |
| 145 | Ga0075432_10013820 | 3300006058 | Bacteria | 2746 |
| 146 | Ga0070715_10018460 | 3300006163 | Bacteria | 2658 |
| 147 | Ga0070716_100013793 | 3300006173 | Bacteria | 4126 |
| 148 | Ga0070712_100018992 | 3300006175 | Bacteria | 4474 |
| 149 | Ga0070712_100021410 | 3300006175 | Bacteria | 4247 |
| 150 | Ga0075367_10001716 | 3300006178 | Bacteria | 9597 |
| 151 | Ga0075367_10024385 | 3300006178 | Bacteria | 3411 |
| 152 | Ga0075367_10056257 | 3300006178 | Bacteria | 2336 |
| 153 | Ga0075369_10000277 | 3300006186 | Bacteria | 15336 |
| 154 | Ga0075369_10012034 | 3300006186 | Bacteria | 3413 |
| 155 | Ga0097621_100071607 | 3300006237 | Bacteria | 2865 |
| 156 | Ga0075370_10014632 | 3300006353 | Bacteria | 4189 |
| 157 | Ga0075370_10017296 | 3300006353 | Bacteria | 3894 |
| 158 | Ga0075370_10271461 | 3300006353 | Bacteria | 1007 |
| 159 | Ga0068871_100051699 | 3300006358 | Bacteria | 3327 |
| 160 | Ga0075428_100002077 | 3300006844 | Bacteria | 21610 |
| 161 | Ga0075428_100011650 | 3300006844 | Bacteria | 9785 |
| 162 | Ga0075428_100198703 | 3300006844 | Bacteria | 2168 |
| 163 | Ga0075430_100008157 | 3300006846 | Bacteria | 8851 |
| 164 | Ga0075431_100085932 | 3300006847 | Bacteria | 3247 |
| 165 | Ga0075431_100661636 | 3300006847 | Bacteria | 1024 |
| 166 | Ga0075434_100000386 | 3300006871 | Bacteria | 32198 |
| 167 | Ga0075434_100001823 | 3300006871 | Bacteria | 18395 |
| 168 | Ga0075429_100044631 | 3300006880 | Bacteria | 3855 |
| 169 | Ga0068865_100004289 | 3300006881 | Bacteria | 8606 |
| 170 | Ga0068865_100056712 | 3300006881 | Bacteria | 2730 |
| 171 | Ga0075436_100000338 | 3300006914 | Bacteria | 29991 |
| 172 | Ga0097620_100000438 | 3300006931 | Bacteria | 41832 |
| 173 | Ga0097620_100042004 | 3300006931 | Bacteria | 4592 |
| 174 | Ga0097620_100117893 | 3300006931 | Bacteria | 2720 |
| 175 | Ga0097620_100248356 | 3300006931 | Bacteria | 1869 |
| 176 | Ga0099826_10054431 | 3300006948 | Bacteria | 2656 |
| 177 | Ga0099826_10060166 | 3300006948 | Bacteria | 2477 |
| 178 | Ga0075435_100002397 | 3300007076 | Bacteria | 12431 |
| 179 | Ga0075435_100002693 | 3300007076 | Bacteria | 11865 |
| 180 | Ga0105244_10041691 | 3300009036 | Bacteria | 2378 |
| 181 | Ga0105250_10008787 | 3300009092 | Bacteria | 4279 |
| 182 | Ga0111539_10001835 | 3300009094 | Bacteria | 28239 |
| 183 | Ga0111539_10072056 | 3300009094 | Bacteria | 4075 |
| 184 | Ga0111539_10134313 | 3300009094 | Bacteria | 2897 |
| 185 | Ga0111539_10294889 | 3300009094 | Bacteria | 1887 |
| 186 | Ga0105245_10029615 | 3300009098 | Bacteria | 4838 |
| 187 | Ga0105245_10066600 | 3300009098 | Bacteria | 3260 |
| 188 | Ga0105245_10223280 | 3300009098 | Bacteria | 1819 |
| 189 | Ga0105247_10004190 | 3300009101 | Bacteria | 9253 |
| 190 | Ga0105247_10086458 | 3300009101 | Bacteria | 1984 |
| 191 | Ga0105247_10321876 | 3300009101 | Bacteria | 1079 |
| 192 | Ga0114129_10037098 | 3300009147 | Bacteria | 6881 |
| 193 | Ga0114129_10096472 | 3300009147 | Bacteria | 4093 |
| 194 | Ga0114129_10777883 | 3300009147 | Bacteria | 1223 |
| 195 | Ga0105243_10007430 | 3300009148 | Bacteria | 8420 |
| 196 | Ga0105243_10017855 | 3300009148 | Bacteria | 5366 |
| 197 | Ga0105243_10023025 | 3300009148 | Bacteria | 4738 |
| 198 | Ga0105243_10053826 | 3300009148 | Bacteria | 3193 |
| 199 | Ga0105242_10011766 | 3300009176 | Bacteria | 6733 |
| 200 | Ga0105242_10057869 | 3300009176 | Bacteria | 3176 |
| 201 | Ga0105248_10000093 | 3300009177 | Bacteria | 98669 |
| 202 | Ga0105248_10016994 | 3300009177 | Bacteria | 8013 |
| 203 | Ga0105248_10029565 | 3300009177 | Bacteria | 6113 |
| 204 | Ga0105248_10223629 | 3300009177 | Bacteria | 2119 |
| 205 | Ga0105237_10064180 | 3300009545 | Bacteria | 3669 |
| 206 | Ga0105237_10079500 | 3300009545 | Bacteria | 3269 |
| 207 | Ga0105237_10211240 | 3300009545 | Bacteria | 1941 |
| 208 | Ga0105238_10029299 | 3300009551 | Bacteria | 5608 |
| 209 | Ga0105238_10260762 | 3300009551 | Bacteria | 1712 |
| 210 | Ga0105249_10000019 | 3300009553 | Bacteria | 273807 |
| 211 | Ga0105249_10028056 | 3300009553 | Bacteria | 5081 |
| 212 | Ga0105249_10036561 | 3300009553 | Bacteria | 4455 |
| 213 | Ga0105249_10140623 | 3300009553 | Bacteria | 2314 |
| 214 | Ga0105033_105012 | 3300009986 | Bacteria | 1134 |
| 215 | Ga0105239_10050997 | 3300010375 | Bacteria | 4537 |
| 216 | Ga0105239_10222177 | 3300010375 | Bacteria | 2118 |
| 217 | Ga0105239_10369296 | 3300010375 | Bacteria | 1621 |
| 218 | Ga0105246_10002782 | 3300011119 | Bacteria | 10593 |
| 219 | Ga0105246_10082859 | 3300011119 | Bacteria | 2290 |
| 220 | Ga0105246_10126553 | 3300011119 | Bacteria | 1902 |
| 221 | Ga0105246_10261548 | 3300011119 | Bacteria | 1379 |
| 222 | Ga0157369_10521648 | 3300013105 | Bacteria | 1229 |
| 223 | Ga0157369_10733294 | 3300013105 | Bacteria | 1017 |
| 224 | Ga0157374_10012755 | 3300013296 | Bacteria | 7323 |
| 225 | Ga0157378_10035989 | 3300013297 | Bacteria | 4381 |
| 226 | Ga0157378_10053432 | 3300013297 | Bacteria | 3596 |
| 227 | Ga0157378_10268423 | 3300013297 | Bacteria | 1640 |
| 228 | Ga0163162_10009988 | 3300013306 | Bacteria | 9231 |
| 229 | Ga0163162_10031792 | 3300013306 | Bacteria | 5237 |
| 230 | Ga0163162_10092950 | 3300013306 | Bacteria | 3101 |
| 231 | Ga0157372_10037234 | 3300013307 | Bacteria | 5364 |
| 232 | Ga0157372_10044562 | 3300013307 | Bacteria | 4916 |
| 233 | Ga0157372_10147659 | 3300013307 | Bacteria | 2712 |
| 234 | Ga0157372_10316851 | 3300013307 | Bacteria | 1816 |
| 235 | Ga0157372_10566810 | 3300013307 | Bacteria | 1324 |
| 236 | Ga0157375_10026309 | 3300013308 | Bacteria | 5419 |
| 237 | Ga0157375_10157551 | 3300013308 | Bacteria | 2410 |
| 238 | Ga0157375_10495625 | 3300013308 | Bacteria | 1386 |
| 239 | Ga0163163_10172731 | 3300014325 | Bacteria | 2208 |
| 240 | Ga0163163_10205773 | 3300014325 | Bacteria | 2016 |
| 241 | Ga0157380_10013449 | 3300014326 | Bacteria | 5966 |
| 242 | Ga0182008_10001253 | 3300014497 | Bacteria | 17425 |
| 243 | Ga0182008_10001941 | 3300014497 | Bacteria | 13349 |
| 244 | Ga0157377_10096844 | 3300014745 | Bacteria | 1751 |
| 245 | Ga0157379_10026709 | 3300014968 | Bacteria | 5139 |
| 246 | Ga0157379_10148111 | 3300014968 | Bacteria | 2117 |
| 247 | Ga0157376_10121431 | 3300014969 | Bacteria | 2316 |
| 248 | Ga0182006_1054255 | 3300015261 | Bacteria | 1534 |
| 249 | Ga0182007_10001202 | 3300015262 | Bacteria | 14061 |
| 250 | Ga0182007_10001318 | 3300015262 | Bacteria | 13405 |
| 251 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 252 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 253 | Ga0183367_1021 | 3300015688 | Bacteria | 82913 |
| 254 | Ga0163161_10018886 | 3300017792 | Bacteria | 4833 |
| 255 | Ga0163161_10034890 | 3300017792 | Bacteria | 3599 |
| 256 | Ga0163161_10038680 | 3300017792 | Bacteria | 3422 |
| 257 | Ga0213872_10124712 | 3300021361 | Bacteria | 1137 |
| 258 | Ga0213875_10012871 | 3300021388 | Bacteria | 4122 |
| 259 | Ga0209758_1004873 | 3300025297 | Bacteria | 10804 |
| 260 | Ga0207426_1000790 | 3300025302 | Bacteria | 34458 |
| 261 | Ga0207426_1007251 | 3300025302 | Bacteria | 4669 |
| 262 | Ga0207692_10034037 | 3300025898 | Bacteria | 2464 |
| 263 | Ga0207642_10001150 | 3300025899 | Bacteria | 8183 |
| 264 | Ga0207642_10003227 | 3300025899 | Bacteria | 5118 |
| 265 | Ga0207710_10000036 | 3300025900 | Bacteria | 245176 |
| 266 | Ga0207710_10004865 | 3300025900 | Bacteria | 5822 |
| 267 | Ga0207688_10004821 | 3300025901 | Bacteria | 7350 |
| 268 | Ga0207688_10009339 | 3300025901 | Bacteria | 5347 |
| 269 | Ga0207688_10011084 | 3300025901 | Bacteria | 4904 |
| 270 | Ga0207688_10011102 | 3300025901 | Bacteria | 4901 |
| 271 | Ga0207680_10028654 | 3300025903 | Bacteria | 3118 |
| 272 | Ga0207647_10004145 | 3300025904 | Bacteria | 10756 |
| 273 | Ga0207647_10006210 | 3300025904 | Bacteria | 8709 |
| 274 | Ga0207645_10024618 | 3300025907 | Bacteria | 3900 |
| 275 | Ga0207643_10123462 | 3300025908 | Bacteria | 1536 |
| 276 | Ga0207671_10082828 | 3300025914 | Bacteria | 2408 |
| 277 | Ga0207671_10161455 | 3300025914 | Bacteria | 1736 |
| 278 | Ga0207671_10182227 | 3300025914 | Bacteria | 1635 |
| 279 | Ga0207693_10000907 | 3300025915 | Bacteria | 26588 |
| 280 | Ga0207693_10031555 | 3300025915 | Bacteria | 4187 |
| 281 | Ga0207663_10008831 | 3300025916 | Bacteria | 5296 |
| 282 | Ga0207662_10169293 | 3300025918 | Bacteria | 1400 |
| 283 | Ga0207657_10217836 | 3300025919 | Bacteria | 1530 |
| 284 | Ga0207681_10000911 | 3300025923 | Bacteria | 19299 |
| 285 | Ga0207681_10113069 | 3300025923 | Bacteria | 1979 |
| 286 | Ga0207659_10094965 | 3300025926 | Bacteria | 2235 |
| 287 | Ga0207687_10022173 | 3300025927 | Bacteria | 4224 |
| 288 | Ga0207687_10066500 | 3300025927 | Bacteria | 2562 |
| 289 | Ga0207687_10132478 | 3300025927 | Bacteria | 1881 |
| 290 | Ga0207687_10194766 | 3300025927 | Bacteria | 1580 |
| 291 | Ga0207687_10220284 | 3300025927 | Bacteria | 1494 |
| 292 | Ga0207664_10268312 | 3300025929 | Bacteria | 1494 |
| 293 | Ga0207644_10039998 | 3300025931 | Bacteria | 3312 |
| 294 | Ga0207690_10024822 | 3300025932 | Bacteria | 3758 |
| 295 | Ga0207706_10009858 | 3300025933 | Bacteria | 8764 |
| 296 | Ga0207706_10011561 | 3300025933 | Bacteria | 8037 |
| 297 | Ga0207706_10025627 | 3300025933 | Bacteria | 5283 |
| 298 | Ga0207686_10014368 | 3300025934 | Bacteria | 4405 |
| 299 | Ga0207686_10157011 | 3300025934 | Bacteria | 1590 |
| 300 | Ga0207709_10081196 | 3300025935 | Bacteria | 2090 |
| 301 | Ga0207709_10231279 | 3300025935 | Bacteria | 1339 |
| 302 | Ga0207670_10153795 | 3300025936 | Bacteria | 1709 |
| 303 | Ga0207670_10319645 | 3300025936 | Bacteria | 1221 |
| 304 | Ga0207669_10005203 | 3300025937 | Bacteria | 5811 |
| 305 | Ga0207704_10003456 | 3300025938 | Bacteria | 7181 |
| 306 | Ga0207704_10017139 | 3300025938 | Bacteria | 3746 |
| 307 | Ga0207665_10015075 | 3300025939 | Bacteria | 5075 |
| 308 | Ga0207665_10085837 | 3300025939 | Bacteria | 2173 |
| 309 | Ga0207711_10000102 | 3300025941 | Bacteria | 90198 |
| 310 | Ga0207711_10053321 | 3300025941 | Bacteria | 3468 |
| 311 | Ga0207689_10038617 | 3300025942 | Bacteria | 3954 |
| 312 | Ga0207689_10119135 | 3300025942 | Bacteria | 2171 |
| 313 | Ga0207651_10037994 | 3300025960 | Bacteria | 3159 |
| 314 | Ga0207712_10000025 | 3300025961 | Bacteria | 274015 |
| 315 | Ga0207712_10007451 | 3300025961 | Bacteria | 6910 |
| 316 | Ga0207712_10015268 | 3300025961 | Bacteria | 4951 |
| 317 | Ga0207712_10030682 | 3300025961 | Bacteria | 3616 |
| 318 | Ga0207668_10000858 | 3300025972 | Bacteria | 18305 |
| 319 | Ga0207668_10012838 | 3300025972 | Bacteria | 5139 |
| 320 | Ga0207640_10016612 | 3300025981 | Bacteria | 4286 |
| 321 | Ga0207640_10209288 | 3300025981 | Bacteria | 1484 |
| 322 | Ga0207658_10000593 | 3300025986 | Bacteria | 32472 |
| 323 | Ga0207658_10018718 | 3300025986 | Bacteria | 4787 |
| 324 | Ga0207658_10021481 | 3300025986 | Bacteria | 4482 |
| 325 | Ga0207658_10063322 | 3300025986 | Bacteria | 2771 |
| 326 | Ga0207677_10004981 | 3300026023 | Bacteria | 7173 |
| 327 | Ga0207703_10034863 | 3300026035 | Bacteria | 3996 |
| 328 | Ga0207703_10082270 | 3300026035 | Bacteria | 2686 |
| 329 | Ga0207639_10005386 | 3300026041 | Bacteria | 8652 |
| 330 | Ga0207639_10018925 | 3300026041 | Bacteria | 4903 |
| 331 | Ga0207639_10096026 | 3300026041 | Bacteria | 2384 |
| 332 | Ga0207678_10007984 | 3300026067 | Bacteria | 9331 |
| 333 | Ga0207678_10008236 | 3300026067 | Bacteria | 9187 |
| 334 | Ga0207708_10020348 | 3300026075 | Bacteria | 5005 |
| 335 | Ga0207708_10058034 | 3300026075 | Bacteria | 2953 |
| 336 | Ga0207702_10068447 | 3300026078 | Bacteria | 3050 |
| 337 | Ga0207641_10010691 | 3300026088 | Bacteria | 7528 |
| 338 | Ga0207648_10019145 | 3300026089 | Bacteria | 6178 |
| 339 | Ga0207648_10050267 | 3300026089 | Bacteria | 3646 |
| 340 | Ga0207676_10261604 | 3300026095 | Bacteria | 1563 |
| 341 | Ga0207676_10375334 | 3300026095 | Bacteria | 1322 |
| 342 | Ga0207675_100004805 | 3300026118 | Bacteria | 13013 |
| 343 | Ga0207675_100017465 | 3300026118 | Bacteria | 6697 |
| 344 | Ga0207683_10002324 | 3300026121 | Bacteria | 16678 |
| 345 | Ga0207683_10022246 | 3300026121 | Bacteria | 5440 |
| 346 | Ga0207683_10118424 | 3300026121 | Bacteria | 2376 |
| 347 | Ga0207683_10214896 | 3300026121 | Bacteria | 1751 |
| 348 | Ga0207698_10073838 | 3300026142 | Bacteria | 2717 |
| 349 | Ga0207698_10308578 | 3300026142 | Bacteria | 1476 |
| 350 | Ga0207698_10326190 | 3300026142 | Bacteria | 1440 |
| 351 | Ga0209282_1052640 | 3300027666 | Bacteria | 2322 |
| 352 | Ga0207428_10001237 | 3300027907 | Bacteria | 27357 |
| 353 | Ga0207428_10009580 | 3300027907 | Bacteria | 8675 |
| 354 | Ga0207428_10102957 | 3300027907 | Bacteria | 2204 |
| 355 | Ga0268266_10013583 | 3300028379 | Bacteria | 7014 |
| 356 | Ga0268266_10034979 | 3300028379 | Bacteria | 4273 |
| 357 | Ga0268266_10078584 | 3300028379 | Bacteria | 2871 |
| 358 | Ga0268266_10549082 | 3300028379 | Bacteria | 1107 |
| 359 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 360 | Ga0268265_10013185 | 3300028380 | Bacteria | 5615 |
| 361 | Ga0268265_10193758 | 3300028380 | Bacteria | 1757 |
| 362 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 363 | Ga0268264_10024292 | 3300028381 | Bacteria | 4948 |
| 364 | Ga0268264_10252950 | 3300028381 | Bacteria | 1638 |
| 365 | Ga0268264_10258421 | 3300028381 | Bacteria | 1621 |
| 366 | Ga0268264_10384548 | 3300028381 | Bacteria | 1345 |
| 367 | Ga0307517_10004208 | 3300028786 | Bacteria | 22182 |
| 368 | Ga0307515_10000046 | 3300028794 | Bacteria | 293319 |
| 369 | Ga0307515_10034314 | 3300028794 | Bacteria | 8314 |
| 370 | Ga0307515_10106091 | 3300028794 | Bacteria | 3337 |
| 371 | Ga0307515_10150583 | 3300028794 | Bacteria | 2434 |
| 372 | Ga0268256_1020506 | 3300030500 | Bacteria | 1781 |
| 373 | Ga0307511_10002260 | 3300030521 | Bacteria | 20135 |
| 374 | Ga0307511_10049337 | 3300030521 | Bacteria | 3409 |
| 375 | Ga0307511_10155770 | 3300030521 | Bacteria | 1297 |
| 376 | Ga0307512_10043807 | 3300030522 | Bacteria | 3686 |
| 377 | Ga0307513_10015302 | 3300031456 | Bacteria | 9306 |
| 378 | Ga0307513_10019716 | 3300031456 | Bacteria | 8016 |
| 379 | Ga0307509_10039748 | 3300031507 | Bacteria | 5122 |
| 380 | Ga0307509_10193474 | 3300031507 | Bacteria | 1881 |
| 381 | Ga0307408_100025439 | 3300031548 | Bacteria | 4055 |
| 382 | Ga0307508_10005047 | 3300031616 | Bacteria | 12676 |
| 383 | Ga0307508_10012343 | 3300031616 | Bacteria | 7811 |
| 384 | Ga0307508_10015165 | 3300031616 | Bacteria | 7023 |
| 385 | Ga0307508_10023014 | 3300031616 | Bacteria | 5660 |
| 386 | Ga0307508_10130526 | 3300031616 | Bacteria | 2116 |
| 387 | Ga0307514_10003992 | 3300031649 | Bacteria | 13772 |
| 388 | Ga0307514_10069990 | 3300031649 | Bacteria | 2636 |
| 389 | Ga0307514_10079829 | 3300031649 | Bacteria | 2423 |
| 390 | Ga0307516_10014667 | 3300031730 | Bacteria | 8280 |
| 391 | Ga0307405_10010297 | 3300031731 | Bacteria | 4835 |
| 392 | Ga0307405_10011336 | 3300031731 | Bacteria | 4666 |
| 393 | Ga0307405_10050903 | 3300031731 | Bacteria | 2568 |
| 394 | Ga0307413_10006809 | 3300031824 | Bacteria | 5252 |
| 395 | Ga0307413_10027077 | 3300031824 | Bacteria | 3170 |
| 396 | Ga0307413_10094073 | 3300031824 | Bacteria | 1961 |
| 397 | Ga0307413_10133366 | 3300031824 | Bacteria | 1704 |
| 398 | Ga0307518_10048604 | 3300031838 | Bacteria | 3084 |
| 399 | Ga0307410_10000186 | 3300031852 | Bacteria | 22976 |
| 400 | Ga0307410_10004749 | 3300031852 | Bacteria | 7083 |
| 401 | Ga0307410_10006417 | 3300031852 | Bacteria | 6344 |
| 402 | Ga0307410_10006476 | 3300031852 | Bacteria | 6322 |
| 403 | Ga0307410_10014259 | 3300031852 | Bacteria | 4670 |
| 404 | Ga0307410_10373282 | 3300031852 | Bacteria | 1146 |
| 405 | Ga0307406_10000071 | 3300031901 | Bacteria | 56611 |
| 406 | Ga0307406_10008812 | 3300031901 | Bacteria | 5638 |
| 407 | Ga0307406_10015056 | 3300031901 | Bacteria | 4466 |
| 408 | Ga0307406_10083025 | 3300031901 | Bacteria | 2136 |
| 409 | Ga0307406_10090558 | 3300031901 | Bacteria | 2058 |
| 410 | Ga0307407_10004883 | 3300031903 | Bacteria | 5754 |
| 411 | Ga0307407_10023459 | 3300031903 | Bacteria | 3220 |
| 412 | Ga0307407_10051314 | 3300031903 | Bacteria | 2364 |
| 413 | Ga0307407_10064946 | 3300031903 | Bacteria | 2147 |
| 414 | Ga0307407_10089121 | 3300031903 | Bacteria | 1886 |
| 415 | Ga0307407_10194601 | 3300031903 | Bacteria | 1354 |
| 416 | Ga0307407_10240326 | 3300031903 | Bacteria | 1235 |
| 417 | Ga0307412_10292644 | 3300031911 | Bacteria | 1283 |
| 418 | Ga0307409_100000106 | 3300031995 | Bacteria | 30264 |
| 419 | Ga0307409_100002886 | 3300031995 | Bacteria | 9115 |
| 420 | Ga0307409_100003055 | 3300031995 | Bacteria | 8948 |
| 421 | Ga0307409_100024232 | 3300031995 | Bacteria | 4227 |
| 422 | Ga0307409_100029134 | 3300031995 | Bacteria | 3946 |
| 423 | Ga0307409_100076346 | 3300031995 | Bacteria | 2686 |
| 424 | Ga0307409_100210805 | 3300031995 | Bacteria | 1746 |
| 425 | Ga0307409_100280006 | 3300031995 | Bacteria | 1541 |
| 426 | Ga0307416_100000850 | 3300032002 | Bacteria | 16062 |
| 427 | Ga0307416_100017280 | 3300032002 | Bacteria | 5041 |
| 428 | Ga0307416_100049737 | 3300032002 | Bacteria | 3335 |
| 429 | Ga0307416_100066381 | 3300032002 | Bacteria | 2970 |
| 430 | Ga0307416_100176833 | 3300032002 | Bacteria | 1995 |
| 431 | Ga0307416_100229361 | 3300032002 | Bacteria | 1789 |
| 432 | Ga0307416_100443581 | 3300032002 | Bacteria | 1349 |
| 433 | Ga0307414_10010360 | 3300032004 | Bacteria | 5405 |
| 434 | Ga0307414_10020775 | 3300032004 | Bacteria | 4101 |
| 435 | Ga0307414_10026408 | 3300032004 | Bacteria | 3737 |
| 436 | Ga0307414_10081940 | 3300032004 | Bacteria | 2364 |
| 437 | Ga0307414_10083907 | 3300032004 | Bacteria | 2341 |
| 438 | Ga0307414_10184653 | 3300032004 | Bacteria | 1681 |
| 439 | Ga0307414_10218668 | 3300032004 | Bacteria | 1562 |
| 440 | Ga0307411_10009357 | 3300032005 | Bacteria | 5146 |
| 441 | Ga0307411_10011519 | 3300032005 | Bacteria | 4778 |
| 442 | Ga0307411_10042548 | 3300032005 | Bacteria | 2899 |
| 443 | Ga0307411_10098100 | 3300032005 | Bacteria | 2064 |
| 444 | Ga0307415_100002560 | 3300032126 | Bacteria | 9096 |
| 445 | Ga0307415_100005844 | 3300032126 | Bacteria | 6579 |
| 446 | Ga0307415_100013305 | 3300032126 | Bacteria | 4798 |
| 447 | Ga0307415_100021903 | 3300032126 | Bacteria | 3936 |
| 448 | Ga0307415_100060321 | 3300032126 | Bacteria | 2621 |
| 449 | Ga0307415_100160352 | 3300032126 | Bacteria | 1742 |
| 450 | Ga0307415_100306451 | 3300032126 | Bacteria | 1318 |
| 451 | Ga0307507_10014232 | 3300033179 | Bacteria | 9511 |
| 452 | Ga0307507_10015481 | 3300033179 | Bacteria | 8966 |
| 453 | Ga0307507_10208544 | 3300033179 | Bacteria | 1337 |
| 454 | Ga0307510_10158611 | 3300033180 | Bacteria | 1864 |
| 455 | Ga0373940_0037846 | 3300035088 | Bacteria | 1315 |
| 456 | Ga0373931_0039646 | 3300035691 | Bacteria | 2468 |
| 457 | Ga0373925_0196960 | 3300037068 | Bacteria | 1601 |
| 458 | Ga0395900_0083875 | 3300037418 | Bacteria | 3274 |
| 459 | Ga0395900_0256237 | 3300037418 | Bacteria | 1749 |
| 460 | Ga0395900_0319301 | 3300037418 | Bacteria | 1534 |
| 461 | Ga0395898_0015241 | 3300037466 | Bacteria | 7891 |
| 462 | Ga0395898_0042453 | 3300037466 | Bacteria | 4486 |
| 463 | Ga0395898_0073677 | 3300037466 | Bacteria | 3299 |
| 464 | Ga0395905_0421335 | 3300037471 | Bacteria | 1231 |
| 465 | Ga0436364_0370574 | 3300037853 | Bacteria | 6351 |
| 466 | Ga0436364_1016041 | 3300037853 | Bacteria | 1583 |
| 467 | Ga0436365_0664968 | 3300039437 | Bacteria | 3008 |
| 468 | Ga0436361_0713294 | 3300039447 | Bacteria | 6790 |
| 469 | Ga0439436_0007597 | 3300041404 | Bacteria | 3336 |
| 470 | Ga0439436_0024059 | 3300041404 | Bacteria | 1799 |
| 471 | Ga0439461_0000622 | 3300041410 | Bacteria | 5113 |
| 472 | Ga0439466_0010203 | 3300041411 | Bacteria | 3493 |
| 473 | Ga0439465_0004933 | 3300041413 | Bacteria | 4288 |
| 474 | Ga0451795_0177854 | 3300041456 | Bacteria | 5771 |
| 475 | Ga0451853_0186994 | 3300041512 | Bacteria | 3429 |
| 476 | Ga0439431_0004964 | 3300041997 | Bacteria | 2931 |
| 477 | Ga0439433_0001850 | 3300041999 | Bacteria | 4416 |
| 478 | Ga0439448_0007193 | 3300042005 | Bacteria | 3218 |
| 479 | Ga0439448_0018547 | 3300042005 | Bacteria | 2134 |
| 480 | Ga0439449_0002442 | 3300042007 | Bacteria | 7266 |
| 481 | Ga0439449_0003409 | 3300042007 | Bacteria | 6184 |
| 482 | Ga0439449_0033212 | 3300042007 | Bacteria | 1922 |
| 483 | Ga0439449_0040692 | 3300042007 | Bacteria | 1728 |
| 484 | Ga0439455_0003289 | 3300042012 | Bacteria | 3066 |
| 485 | Ga0439455_0006433 | 3300042012 | Bacteria | 2438 |
| 486 | Ga0439455_0028684 | 3300042012 | Bacteria | 1372 |
| 487 | Ga0439457_000977 | 3300042014 | Bacteria | 8596 |
| 488 | Ga0439457_002741 | 3300042014 | Bacteria | 4951 |
| 489 | Ga0439462_0002522 | 3300042015 | Bacteria | 4266 |
| 490 | Ga0450894_002382 | 3300042131 | Bacteria | 2533 |
| 491 | Ga0450900_002018 | 3300042136 | Bacteria | 2092 |
| 492 | Ga0450903_000575 | 3300042138 | Bacteria | 7531 |
| 493 | Ga0450903_001095 | 3300042138 | Bacteria | 5155 |
| 494 | Ga0439458_0000722 | 3300042157 | Bacteria | 8508 |
| 495 | Ga0439434_0003247 | 3300042435 | Bacteria | 4771 |
| 496 | Ga0439434_0045611 | 3300042435 | Bacteria | 1352 |
| 497 | Ga0439440_0013027 | 3300042993 | Bacteria | 1777 |
| 498 | Ga0466969_0045354 | 3300044656 | Bacteria | 2183 |
| 499 | Ga0466972_0001755 | 3300044658 | Bacteria | 10637 |
| 500 | Ga0466972_0002060 | 3300044658 | Bacteria | 9850 |
| 501 | Ga0466972_0011100 | 3300044658 | Bacteria | 4521 |
| 502 | Ga0466972_0020443 | 3300044658 | Bacteria | 3308 |
| 503 | Ga0466972_0039617 | 3300044658 | Bacteria | 2299 |
| 504 | Ga0466972_0057811 | 3300044658 | Bacteria | 1862 |
| 505 | Ga0466972_0127922 | 3300044658 | Bacteria | 1197 |
| 506 | Ga0466965_0000288 | 3300044683 | Bacteria | 16687 |
| 507 | Ga0466965_0000502 | 3300044683 | Bacteria | 13930 |
| 508 | Ga0466965_0126935 | 3300044683 | Bacteria | 1320 |
| 509 | Ga0466966_0002830 | 3300044684 | Bacteria | 11416 |
| 510 | Ga0466966_0004237 | 3300044684 | Bacteria | 9467 |
| 511 | Ga0466966_0258692 | 3300044684 | Bacteria | 1048 |
| 512 | Ga0466961_0054195 | 3300044693 | Bacteria | 2558 |
| 513 | Ga0466963_0001177 | 3300044694 | Bacteria | 13738 |
| 514 | Ga0466963_0008746 | 3300044694 | Bacteria | 6080 |
| 515 | Ga0466963_0057579 | 3300044694 | Bacteria | 2588 |
| 516 | Ga0466964_0001884 | 3300044706 | Bacteria | 7323 |
| 517 | Ga0466971_0003539 | 3300044719 | Bacteria | 6674 |
| 518 | Ga0466971_0007148 | 3300044719 | Bacteria | 4859 |
| 519 | Ga0466971_0025437 | 3300044719 | Bacteria | 2644 |
| 520 | Ga0466970_0005387 | 3300044765 | Bacteria | 6349 |
| 521 | Ga0466970_0008602 | 3300044765 | Bacteria | 5141 |
| 522 | Ga0466970_0010797 | 3300044765 | Bacteria | 4644 |
| 523 | Ga0466970_0025003 | 3300044765 | Bacteria | 3125 |
| 524 | Ga0466970_0037802 | 3300044765 | Bacteria | 2560 |
| 525 | Ga0466970_0160682 | 3300044765 | Bacteria | 1242 |
| 526 | Ga0466957_0009571 | 3300044842 | Bacteria | 5534 |
| 527 | Ga0466957_0025969 | 3300044842 | Bacteria | 3473 |
| 528 | Ga0466957_0040330 | 3300044842 | Bacteria | 2819 |
| 529 | Ga0466957_0063553 | 3300044842 | Bacteria | 2269 |
| 530 | Ga0466957_0090970 | 3300044842 | Bacteria | 1912 |
| 531 | Ga0466960_0000313 | 3300044901 | Bacteria | 16642 |
| 532 | Ga0466960_0001508 | 3300044901 | Bacteria | 8476 |
| 533 | Ga0466960_0016305 | 3300044901 | Bacteria | 3219 |
| 534 | Ga0466960_0090547 | 3300044901 | Bacteria | 1558 |
| 535 | Ga0466959_0008657 | 3300045049 | Bacteria | 7203 |
| 536 | Ga0466958_0001015 | 3300045836 | Bacteria | 12747 |
| 537 | Ga0466958_0243816 | 3300045836 | Bacteria | 1148 |
| 538 | Ga0466967_0000412 | 3300045976 | Bacteria | 20240 |
| 539 | Ga0466967_0017691 | 3300045976 | Bacteria | 5670 |
| 540 | Ga0466967_0053051 | 3300045976 | Bacteria | 3563 |
| 541 | Ga0466967_0061221 | 3300045976 | Bacteria | 3339 |
| 542 | Ga0466967_0090540 | 3300045976 | Bacteria | 2779 |
| 543 | Ga0466967_0125089 | 3300045976 | Bacteria | 2381 |
| 544 | Ga0466967_0349201 | 3300045976 | Bacteria | 1431 |
| 545 | Ga0466967_0496111 | 3300045976 | Bacteria | 1198 |
| 546 | Ga0495617_025457 | 3300046452 | Bacteria | 1994 |
| 547 | Ga0495627_017353 | 3300046453 | Bacteria | 2448 |
| 548 | Ga0495592_0088282 | 3300046454 | Bacteria | 2229 |
| 549 | Ga0495603_0007354 | 3300046455 | Bacteria | 6624 |
| 550 | Ga0495603_0009121 | 3300046455 | Bacteria | 5997 |
| 551 | Ga0495603_0019345 | 3300046455 | Bacteria | 4121 |
| 552 | Ga0495603_0033670 | 3300046455 | Bacteria | 3082 |
| 553 | Ga0495603_0058650 | 3300046455 | Bacteria | 2275 |
| 554 | Ga0495590_0048739 | 3300046457 | Bacteria | 1478 |
| 555 | Ga0495629_0001933 | 3300046459 | Bacteria | 16145 |
| 556 | Ga0495629_0011063 | 3300046459 | Bacteria | 6556 |
| 557 | Ga0495629_0012494 | 3300046459 | Bacteria | 6150 |
| 558 | Ga0495629_0015172 | 3300046459 | Bacteria | 5536 |
| 559 | Ga0495629_0072468 | 3300046459 | Bacteria | 2404 |
| 560 | Ga0495629_0136970 | 3300046459 | Bacteria | 1704 |
| 561 | Ga0495638_0008024 | 3300046460 | Bacteria | 7519 |
| 562 | Ga0495638_0008071 | 3300046460 | Bacteria | 7494 |
| 563 | Ga0495638_0026620 | 3300046460 | Bacteria | 3747 |
| 564 | Ga0495638_0183262 | 3300046460 | Bacteria | 1193 |
| 565 | Ga0495651_0001558 | 3300046462 | Bacteria | 17724 |
| 566 | Ga0495605_0003611 | 3300046474 | Bacteria | 9178 |
| 567 | Ga0495639_0014741 | 3300046475 | Bacteria | 3387 |
| 568 | Ga0495662_0000305 | 3300046476 | Bacteria | 21349 |
| 569 | Ga0495662_0016026 | 3300046476 | Bacteria | 3636 |
| 570 | Ga0495662_0090269 | 3300046476 | Bacteria | 1493 |
| 571 | Ga0495664_0067571 | 3300046477 | Bacteria | 2132 |
| 572 | Ga0495664_0146605 | 3300046477 | Bacteria | 1431 |
| 573 | Ga0495585_0088955 | 3300046492 | Bacteria | 1665 |
| 574 | Ga0495594_0003881 | 3300046499 | Bacteria | 7687 |
| 575 | Ga0495594_0024219 | 3300046499 | Bacteria | 3258 |
| 576 | Ga0495594_0121465 | 3300046499 | Bacteria | 1477 |
| 577 | Ga0495594_0148271 | 3300046499 | Bacteria | 1331 |
| 578 | Ga0495607_0020887 | 3300046501 | Bacteria | 4128 |
| 579 | Ga0495607_0069572 | 3300046501 | Bacteria | 1969 |
| 580 | Ga0495583_0020416 | 3300046506 | Bacteria | 3432 |
| 581 | Ga0495583_0031590 | 3300046506 | Bacteria | 2565 |
| 582 | Ga0495583_0050471 | 3300046506 | Bacteria | 1901 |
| 583 | Ga0495606_0007016 | 3300046507 | Bacteria | 10221 |
| 584 | Ga0495606_0007166 | 3300046507 | Bacteria | 10066 |
| 585 | Ga0495606_0029891 | 3300046507 | Bacteria | 3818 |
| 586 | Ga0495610_0046548 | 3300046512 | Bacteria | 2139 |
| 587 | Ga0495610_0122337 | 3300046512 | Bacteria | 1139 |
| 588 | Ga0495616_0001426 | 3300046513 | Bacteria | 16636 |
| 589 | Ga0495616_0030023 | 3300046513 | Bacteria | 2862 |
| 590 | Ga0495618_0017879 | 3300046514 | Bacteria | 4351 |
| 591 | Ga0495618_0059889 | 3300046514 | Bacteria | 2413 |
| 592 | Ga0495620_0001023 | 3300046515 | Bacteria | 17198 |
| 593 | Ga0495620_0012144 | 3300046515 | Bacteria | 4464 |
| 594 | Ga0495628_0090038 | 3300046516 | Bacteria | 2375 |
| 595 | Ga0495628_0176393 | 3300046516 | Bacteria | 1618 |
| 596 | Ga0495630_0032749 | 3300046517 | Bacteria | 3875 |
| 597 | Ga0495630_0085244 | 3300046517 | Bacteria | 2385 |
| 598 | Ga0495631_0005052 | 3300046518 | Bacteria | 6950 |
| 599 | Ga0495643_0004195 | 3300046522 | Bacteria | 10208 |
| 600 | Ga0495643_0021076 | 3300046522 | Bacteria | 3745 |
| 601 | Ga0495648_0006495 | 3300046524 | Bacteria | 9535 |
| 602 | Ga0495648_0073713 | 3300046524 | Bacteria | 1969 |
| 603 | Ga0495648_0087811 | 3300046524 | Bacteria | 1749 |
| 604 | Ga0495648_0149596 | 3300046524 | Bacteria | 1219 |
| 605 | Ga0495666_0023421 | 3300046526 | Bacteria | 3053 |
| 606 | Ga0495652_0104742 | 3300046529 | Bacteria | 2287 |
| 607 | Ga0495652_0341063 | 3300046529 | Bacteria | 1076 |
| 608 | Ga0495654_0039660 | 3300046530 | Bacteria | 2350 |
| 609 | Ga0495654_0089547 | 3300046530 | Bacteria | 1430 |
| 610 | Ga0495640_0259776 | 3300046533 | Bacteria | 1085 |
| 611 | Ga0495586_0062897 | 3300046535 | Bacteria | 2021 |
| 612 | Ga0495587_0011507 | 3300046536 | Bacteria | 5604 |
| 613 | Ga0495609_0012613 | 3300046538 | Bacteria | 4007 |
| 614 | Ga0495609_0018220 | 3300046538 | Bacteria | 3254 |
| 615 | Ga0495621_0036286 | 3300046539 | Bacteria | 1711 |
| 616 | Ga0495597_0009742 | 3300046542 | Bacteria | 4731 |
| 617 | Ga0495645_0084185 | 3300046543 | Bacteria | 2278 |
| 618 | Ga0495645_0129952 | 3300046543 | Bacteria | 1766 |
| 619 | Ga0495622_0092011 | 3300046557 | Bacteria | 1393 |
| 620 | Ga0495633_0045335 | 3300046558 | Bacteria | 2082 |
| 621 | Ga0495633_0068545 | 3300046558 | Bacteria | 1656 |
| 622 | Ga0495667_0223730 | 3300046559 | Bacteria | 1201 |
| 623 | Ga0495656_0021881 | 3300046615 | Bacteria | 2496 |
| 624 | Ga0495656_0196795 | 3300046615 | Bacteria | 998 |
| 625 | Ga0495668_0000128 | 3300046616 | Bacteria | 113090 |
| 626 | Ga0495668_0010814 | 3300046616 | Bacteria | 5501 |
| 627 | Ga0495668_0029453 | 3300046616 | Bacteria | 3101 |
| 628 | Ga0495634_0008925 | 3300046642 | Bacteria | 7425 |
| 629 | Ga0495634_0084145 | 3300046642 | Bacteria | 2074 |
| 630 | Ga0495611_0076347 | 3300046648 | Bacteria | 1536 |
| 631 | Ga0495625_0037842 | 3300046660 | Bacteria | 3535 |
| 632 | Ga0495635_0006889 | 3300046663 | Bacteria | 7940 |
| 633 | Ga0495661_0035615 | 3300046665 | Bacteria | 3121 |
| 634 | Ga0495661_0049946 | 3300046665 | Bacteria | 2534 |
| 635 | Ga0495588_0003822 | 3300046674 | Bacteria | 6598 |
| 636 | Ga0495588_0019104 | 3300046674 | Bacteria | 3353 |
| 637 | Ga0495657_0006337 | 3300046675 | Bacteria | 9267 |
| 638 | Ga0495657_0008870 | 3300046675 | Bacteria | 7654 |
| 639 | Ga0495657_0045638 | 3300046675 | Bacteria | 2972 |
| 640 | Ga0495646_0001231 | 3300046680 | Bacteria | 15030 |
| 641 | Ga0495646_0035636 | 3300046680 | Bacteria | 3086 |
| 642 | Ga0495658_0008137 | 3300046683 | Bacteria | 5192 |
| 643 | Ga0495613_0001211 | 3300046689 | Bacteria | 19746 |
| 644 | Ga0495613_0038091 | 3300046689 | Bacteria | 3564 |
| 645 | Ga0495613_0047649 | 3300046689 | Bacteria | 3165 |
| 646 | Ga0495613_0051651 | 3300046689 | Bacteria | 3029 |
| 647 | Ga0495671_0012968 | 3300046692 | Bacteria | 4534 |
| 648 | Ga0495649_0058036 | 3300046694 | Bacteria | 2086 |
| 649 | Ga0495649_0130421 | 3300046694 | Bacteria | 1326 |
| 650 | Ga0495649_0167204 | 3300046694 | Bacteria | 1152 |
| 651 | Ga0495649_0176746 | 3300046694 | Bacteria | 1115 |
| 652 | Ga0495589_0006883 | 3300046794 | Bacteria | 5976 |
| 653 | Ga0495589_0011982 | 3300046794 | Bacteria | 4495 |
| 654 | Ga0495589_0012127 | 3300046794 | Bacteria | 4469 |
| 655 | Ga0495589_0012562 | 3300046794 | Bacteria | 4382 |
| 656 | Ga0495589_0016490 | 3300046794 | Bacteria | 3798 |
| 657 | Ga0495600_0032445 | 3300046809 | Bacteria | 3389 |
| 658 | Ga0495600_0125174 | 3300046809 | Bacteria | 1671 |
| 659 | Ga0495581_0037673 | 3300047315 | Bacteria | 2799 |
| 660 | Ga0495581_0105974 | 3300047315 | Bacteria | 1634 |
| 661 | Ga0495604_0000811 | 3300047317 | Bacteria | 26210 |
| 662 | Ga0495636_0000665 | 3300047318 | Bacteria | 12599 |
| 663 | Ga0495636_0019787 | 3300047318 | Bacteria | 2708 |
| 664 | Ga0495636_0026473 | 3300047318 | Bacteria | 2359 |
| 665 | Ga0495636_0033723 | 3300047318 | Bacteria | 2105 |
| 666 | Ga0495636_0067816 | 3300047318 | Bacteria | 1518 |
| 667 | Ga0495674_0240708 | 3300047319 | Bacteria | 1491 |
| 668 | Ga0495672_0005364 | 3300047320 | Bacteria | 10195 |
| 669 | Ga0495676_0009915 | 3300047321 | Bacteria | 8652 |
| 670 | Ga0495676_0010110 | 3300047321 | Bacteria | 8568 |
| 671 | Ga0495676_0012589 | 3300047321 | Bacteria | 7617 |
| 672 | Ga0495676_0015081 | 3300047321 | Bacteria | 6899 |
| 673 | Ga0495676_0023642 | 3300047321 | Bacteria | 5328 |
| 674 | Ga0495676_0045065 | 3300047321 | Bacteria | 3593 |
| 675 | Ga0495680_0012497 | 3300047322 | Bacteria | 7467 |
| 676 | Ga0495683_0098886 | 3300047323 | Bacteria | 1405 |
| 677 | Ga0495687_001148 | 3300047443 | Bacteria | 25640 |
| 678 | Ga0495687_036096 | 3300047443 | Bacteria | 2215 |
| 679 | Ga0495687_054907 | 3300047443 | Bacteria | 1668 |
| 680 | Ga0495687_065986 | 3300047443 | Bacteria | 1471 |
| 681 | Ga0495687_068286 | 3300047443 | Bacteria | 1435 |
| 682 | Ga0495675_0047407 | 3300047444 | Bacteria | 2734 |
| 683 | Ga0495675_0248015 | 3300047444 | Bacteria | 1070 |
| 684 | Ga0495677_0016191 | 3300047445 | Bacteria | 2706 |
| 685 | Ga0495685_001061 | 3300047447 | Bacteria | 8390 |
| 686 | Ga0495685_001209 | 3300047447 | Bacteria | 7914 |
| 687 | Ga0495685_001477 | 3300047447 | Bacteria | 7204 |
| 688 | Ga0495685_004930 | 3300047447 | Bacteria | 4335 |
| 689 | Ga0495685_007409 | 3300047447 | Bacteria | 3621 |
| 690 | Ga0495673_0001153 | 3300047469 | Bacteria | 22442 |
| 691 | Ga0495681_0048299 | 3300047470 | Bacteria | 2018 |
| 692 | Ga0495681_0091638 | 3300047470 | Bacteria | 1341 |
| 693 | Ga0495686_0048992 | 3300047472 | Bacteria | 2661 |
| 694 | Ga0495593_0034697 | 3300047673 | Bacteria | 2742 |
| 695 | Ga0495593_0204005 | 3300047673 | Bacteria | 993 |
| 696 | Ga0495602_0142074 | 3300048088 | Bacteria | 1899 |
| 697 | Ga0495614_0022354 | 3300048089 | Bacteria | 2729 |
| 698 | Ga0495626_0059545 | 3300048091 | Bacteria | 1742 |
| 699 | Ga0496100_0001703 | 3300048903 | Bacteria | 10932 |
| 700 | Ga0496100_0006454 | 3300048903 | Bacteria | 6397 |
| 701 | Ga0496100_0006878 | 3300048903 | Bacteria | 6228 |
| 702 | Ga0496100_0028605 | 3300048903 | Bacteria | 3439 |
| 703 | Ga0496100_0046275 | 3300048903 | Bacteria | 2797 |
| 704 | Ga0496100_0105229 | 3300048903 | Bacteria | 1951 |
| 705 | Ga0496100_0118346 | 3300048903 | Bacteria | 1851 |
| 706 | Ga0496100_0285904 | 3300048903 | Bacteria | 1231 |
| 707 | Ga0496101_0000030 | 3300048904 | Bacteria | 198447 |
| 708 | Ga0496101_0001379 | 3300048904 | Bacteria | 14555 |
| 709 | Ga0496101_0011975 | 3300048904 | Bacteria | 5778 |
| 710 | Ga0496101_0072796 | 3300048904 | Bacteria | 2523 |
| 711 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 712 | Ga0496102_0000112 | 3300048905 | Bacteria | 116902 |
| 713 | Ga0496102_0017128 | 3300048905 | Bacteria | 6344 |
| 714 | Ga0496102_0062223 | 3300048905 | Bacteria | 3418 |
| 715 | Ga0496102_0078104 | 3300048905 | Bacteria | 3047 |
| 716 | Ga0496102_0079513 | 3300048905 | Bacteria | 3020 |
| 717 | Ga0496102_0626825 | 3300048905 | Bacteria | 998 |
| 718 | Ga0496103_0000003 | 3300048906 | Bacteria | 603967 |
| 719 | Ga0496103_0002476 | 3300048906 | Bacteria | 11582 |
| 720 | Ga0496103_0129948 | 3300048906 | Bacteria | 1608 |
| 721 | Ga0496104_0137999 | 3300048907 | Bacteria | 2343 |
| 722 | Ga0496104_0141043 | 3300048907 | Bacteria | 2315 |
| 723 | Ga0496104_0217930 | 3300048907 | Bacteria | 1821 |
| 724 | Ga0496105_0038689 | 3300048908 | Bacteria | 3930 |
| 725 | Ga0496105_0065002 | 3300048908 | Bacteria | 3011 |
| 726 | Ga0496106_0009358 | 3300048909 | Bacteria | 7243 |
| 727 | Ga0496106_0014688 | 3300048909 | Bacteria | 5788 |
| 728 | Ga0496106_0021410 | 3300048909 | Bacteria | 4801 |
| 729 | Ga0496106_0021710 | 3300048909 | Bacteria | 4768 |
| 730 | Ga0496106_0141029 | 3300048909 | Bacteria | 1896 |
| 731 | Ga0496106_0163844 | 3300048909 | Bacteria | 1759 |
| 732 | Ga0496107_0012120 | 3300048910 | Bacteria | 6013 |
| 733 | Ga0496107_0027547 | 3300048910 | Bacteria | 4035 |
| 734 | Ga0496107_0100178 | 3300048910 | Bacteria | 2124 |
| 735 | Ga0496108_0000589 | 3300048911 | Bacteria | 28452 |
| 736 | Ga0496108_0002063 | 3300048911 | Bacteria | 16082 |
| 737 | Ga0496108_0012853 | 3300048911 | Bacteria | 6819 |
| 738 | Ga0496108_0175780 | 3300048911 | Bacteria | 1853 |
| 739 | Ga0496108_0187444 | 3300048911 | Bacteria | 1792 |
| 740 | Ga0496108_0313349 | 3300048911 | Bacteria | 1367 |
| 741 | Ga0496108_0524909 | 3300048911 | Bacteria | 1034 |
| 742 | Ga0496109_0004292 | 3300048912 | Bacteria | 11905 |
| 743 | Ga0496109_0007158 | 3300048912 | Bacteria | 9428 |
| 744 | Ga0496109_0014192 | 3300048912 | Bacteria | 6928 |
| 745 | Ga0496109_0068561 | 3300048912 | Bacteria | 3251 |
| 746 | Ga0496109_0115824 | 3300048912 | Bacteria | 2494 |
| 747 | Ga0496109_0355675 | 3300048912 | Bacteria | 1383 |
| 748 | Ga0496110_0189785 | 3300048913 | Bacteria | 1866 |
| 749 | Ga0496110_0256744 | 3300048913 | Bacteria | 1591 |
| 750 | Ga0496111_0056368 | 3300048914 | Bacteria | 2843 |
| 751 | Ga0496112_0028927 | 3300048915 | Bacteria | 5355 |
| 752 | Ga0496112_0057653 | 3300048915 | Bacteria | 3824 |
| 753 | Ga0496112_0105055 | 3300048915 | Bacteria | 2794 |
| 754 | Ga0496112_0112943 | 3300048915 | Bacteria | 2687 |
| 755 | Ga0496112_0213834 | 3300048915 | Bacteria | 1885 |
| 756 | Ga0496113_0021756 | 3300048916 | Bacteria | 4528 |
| 757 | Ga0496113_0043182 | 3300048916 | Bacteria | 3335 |
| 758 | Ga0496113_0070881 | 3300048916 | Bacteria | 2650 |
| 759 | Ga0496114_0003564 | 3300048917 | Bacteria | 11954 |
| 760 | Ga0496114_0016475 | 3300048917 | Bacteria | 5957 |
| 761 | Ga0496114_0160515 | 3300048917 | Bacteria | 1954 |
| 762 | Ga0496114_0208575 | 3300048917 | Unclassified | 1713 |
| 763 | Ga0496115_0004692 | 3300048918 | Bacteria | 9906 |
| 764 | Ga0496115_0014973 | 3300048918 | Bacteria | 5879 |
| 765 | Ga0496116_0000013 | 3300048919 | Bacteria | 603993 |
| 766 | Ga0496116_0021964 | 3300048919 | Bacteria | 4798 |
| 767 | Ga0496117_0000013 | 3300048920 | Bacteria | 603995 |
| 768 | Ga0496117_0000719 | 3300048920 | Bacteria | 52226 |
| 769 | Ga0496118_0000011 | 3300048921 | Bacteria | 603995 |
| 770 | Ga0496118_0003063 | 3300048921 | Bacteria | 21476 |
| 771 | Ga0496119_0000076 | 3300048922 | Bacteria | 143663 |
| 772 | Ga0496119_0014589 | 3300048922 | Bacteria | 6129 |
| 773 | Ga0496120_0001268 | 3300048923 | Bacteria | 31644 |
| 774 | Ga0496120_0052426 | 3300048923 | Bacteria | 2324 |
| 775 | Ga0496120_0060791 | 3300048923 | Bacteria | 2112 |
| 776 | Ga0496121_0014867 | 3300048924 | Bacteria | 8209 |
| 777 | Ga0496123_0029954 | 3300048926 | Bacteria | 3994 |
| 778 | Ga0496124_0056202 | 3300048927 | Bacteria | 3320 |
| 779 | Ga0496125_0037277 | 3300048928 | Bacteria | 4228 |
| 780 | Ga0496126_0002163 | 3300048929 | Bacteria | 27351 |
| 781 | Ga0495678_056138 | 3300049459 | Bacteria | 1499 |
| 782 | Ga0495682_0038634 | 3300049460 | Bacteria | 1754 |
| 783 | Ga0501031_0021971 | 3300049568 | Bacteria | 4157 |
| 784 | Ga0501031_0084751 | 3300049568 | Bacteria | 2066 |
| 785 | Ga0501031_0122287 | 3300049568 | Bacteria | 1700 |
| 786 | Ga0501032_0001058 | 3300049569 | Bacteria | 21998 |
| 787 | Ga0501032_0001487 | 3300049569 | Bacteria | 18697 |
| 788 | Ga0501032_0025037 | 3300049569 | Bacteria | 4115 |
| 789 | Ga0501033_0007160 | 3300049570 | Bacteria | 8703 |
| 790 | Ga0501033_0045356 | 3300049570 | Bacteria | 3271 |
| 791 | Ga0501033_0057629 | 3300049570 | Bacteria | 2870 |
| 792 | Ga0501033_0232612 | 3300049570 | Bacteria | 1309 |
| 793 | Ga0501034_0006804 | 3300049571 | Bacteria | 12228 |
| 794 | Ga0501034_0016674 | 3300049571 | Bacteria | 7530 |
| 795 | Ga0501034_0031681 | 3300049571 | Bacteria | 5371 |
| 796 | Ga0501034_0046795 | 3300049571 | Bacteria | 4371 |
| 797 | Ga0501034_0100512 | 3300049571 | Bacteria | 2886 |
| 798 | Ga0501036_0009792 | 3300049572 | Bacteria | 7892 |
| 799 | Ga0501036_0009835 | 3300049572 | Bacteria | 7874 |
| 800 | Ga0501036_0017920 | 3300049572 | Bacteria | 5928 |
| 801 | Ga0501036_0018504 | 3300049572 | Bacteria | 5839 |
| 802 | Ga0501036_0033678 | 3300049572 | Bacteria | 4332 |
| 803 | Ga0501037_0000846 | 3300049573 | Bacteria | 22835 |
| 804 | Ga0501037_0003465 | 3300049573 | Bacteria | 11452 |
| 805 | Ga0501037_0031766 | 3300049573 | Bacteria | 3898 |
| 806 | Ga0501038_0002496 | 3300049574 | Bacteria | 17130 |
| 807 | Ga0501038_0012232 | 3300049574 | Bacteria | 7836 |
| 808 | Ga0501038_0018635 | 3300049574 | Bacteria | 6269 |
| 809 | Ga0501038_0041961 | 3300049574 | Bacteria | 3987 |
| 810 | Ga0501038_0043522 | 3300049574 | Bacteria | 3903 |
| 811 | Ga0501038_0104210 | 3300049574 | Bacteria | 2357 |
| 812 | Ga0501039_0000413 | 3300049575 | Bacteria | 30667 |
| 813 | Ga0501039_0004087 | 3300049575 | Bacteria | 10975 |
| 814 | Ga0501039_0033422 | 3300049575 | Bacteria | 3965 |
| 815 | Ga0501039_0140183 | 3300049575 | Bacteria | 1899 |
| 816 | Ga0501039_0222091 | 3300049575 | Bacteria | 1485 |
| 817 | Ga0501040_0025389 | 3300049576 | Bacteria | 3983 |
| 818 | Ga0501041_0011160 | 3300049577 | Bacteria | 5306 |
| 819 | Ga0501042_0007681 | 3300049578 | Bacteria | 7079 |
| 820 | Ga0501042_0022676 | 3300049578 | Bacteria | 4386 |
| 821 | Ga0501043_0000710 | 3300049579 | Bacteria | 29515 |
| 822 | Ga0501043_0002340 | 3300049579 | Bacteria | 16062 |
| 823 | Ga0501043_0037168 | 3300049579 | Bacteria | 3830 |
| 824 | Ga0501043_0076802 | 3300049579 | Bacteria | 2624 |
| 825 | Ga0501046_0013365 | 3300049580 | Bacteria | 6953 |
| 826 | Ga0501046_0013758 | 3300049580 | Bacteria | 6840 |
| 827 | Ga0501046_0070356 | 3300049580 | Bacteria | 2720 |
| 828 | Ga0501047_0019290 | 3300049581 | Bacteria | 6542 |
| 829 | Ga0501047_0065802 | 3300049581 | Bacteria | 3493 |
| 830 | Ga0501048_0032054 | 3300049582 | Bacteria | 3799 |
| 831 | Ga0501067_0100241 | 3300049583 | Bacteria | 1609 |
| 832 | Ga0501068_0008717 | 3300049584 | Bacteria | 5656 |
| 833 | Ga0501068_0135296 | 3300049584 | Bacteria | 1543 |
| 834 | Ga0501070_0000301 | 3300049586 | Bacteria | 45769 |
| 835 | Ga0501070_0001683 | 3300049586 | Bacteria | 19591 |
| 836 | Ga0501070_0154194 | 3300049586 | Bacteria | 1895 |
| 837 | Ga0501070_0484822 | 3300049586 | Bacteria | 994 |
| 838 | Ga0501071_0008152 | 3300049587 | Bacteria | 6910 |
| 839 | Ga0501072_0010719 | 3300049588 | Bacteria | 6982 |
| 840 | Ga0501073_0046919 | 3300049589 | Bacteria | 3037 |
| 841 | Ga0501073_0148989 | 3300049589 | Bacteria | 1622 |
| 842 | Ga0501074_0011845 | 3300049590 | Bacteria | 6341 |
| 843 | Ga0501074_0031457 | 3300049590 | Bacteria | 3844 |
| 844 | Ga0501076_0007496 | 3300049592 | Bacteria | 7943 |
| 845 | Ga0501243_019330 | 3300049675 | Bacteria | 1116 |
| 846 | Ga0501080_0025716 | 3300049742 | Bacteria | 5467 |
| 847 | Ga0501083_0152710 | 3300049744 | Bacteria | 1512 |
| 848 | Ga0501035_0096585 | 3300049822 | Bacteria | 2596 |
| 849 | Ga0501035_0178639 | 3300049822 | Bacteria | 1830 |
| 850 | Ga0501035_0181611 | 3300049822 | Bacteria | 1812 |
| 851 | Ga0501044_0001741 | 3300049823 | Bacteria | 25406 |
| 852 | Ga0501044_0013221 | 3300049823 | Bacteria | 8938 |
| 853 | Ga0501044_0013974 | 3300049823 | Bacteria | 8673 |
| 854 | Ga0501044_0066259 | 3300049823 | Bacteria | 3683 |
| 855 | Ga0501044_0094263 | 3300049823 | Bacteria | 3019 |
| 856 | Ga0501044_0118192 | 3300049823 | Bacteria | 2654 |
| 857 | Ga0501044_0222544 | 3300049823 | Bacteria | 1837 |
| 858 | Ga0501045_0020185 | 3300049824 | Bacteria | 4757 |
| 859 | nmdc:mga03n38_10969_c1 | 3300050490 | Bacteria | 3359 |
| 860 | nmdc:mga03n38_15033_c1 | 3300050490 | Bacteria | 2981 |
| 861 | nmdc:mga03n38_188677_c1 | 3300050490 | Bacteria | 1061 |
| 862 | nmdc:mga03n38_19000_c1 | 3300050490 | Bacteria | 2721 |
| 863 | nmdc:mga03n38_5500_c1 | 3300050490 | Bacteria | 4319 |
| 864 | nmdc:mga00v17_14060_c1 | 3300050491 | Bacteria | 4460 |
| 865 | nmdc:mga00v17_151372_c1 | 3300050491 | Bacteria | 1491 |
| 866 | nmdc:mga00v17_16277_c1 | 3300050491 | Bacteria | 4191 |
| 867 | nmdc:mga00v17_7507_c1 | 3300050491 | Bacteria | 5820 |
| 868 | nmdc:mga0yw44_207032_c1 | 3300050492 | Bacteria | 1297 |
| 869 | nmdc:mga0yw44_22077_c1 | 3300050492 | Bacteria | 3562 |
| 870 | nmdc:mga0yw44_339099_c1 | 3300050492 | Bacteria | 1011 |
| 871 | nmdc:mga0yw44_52184_c1 | 3300050492 | Bacteria | 2478 |
| 872 | nmdc:mga06z11_15221_c1 | 3300050494 | Bacteria | 3429 |
| 873 | nmdc:mga06z11_39550_c1 | 3300050494 | Bacteria | 2348 |
| 874 | nmdc:mga04h51_5954_c1 | 3300050495 | Bacteria | 2187 |
| 875 | nmdc:mga04h51_9671_c1 | 3300050495 | Bacteria | 2624 |
| 876 | nmdc:mga07m45_13721_c1 | 3300050496 | Bacteria | 4302 |
| 877 | nmdc:mga07m45_146616_c1 | 3300050496 | Bacteria | 1368 |
| 878 | nmdc:mga07m45_38352_c1 | 3300050496 | Bacteria | 2673 |
| 879 | nmdc:mga07m45_46733_c1 | 3300050496 | Bacteria | 2432 |
| 880 | nmdc:mga07m45_92094_c1 | 3300050496 | Bacteria | 1737 |
| 881 | nmdc:mga05p37_3169_c1 | 3300050507 | Bacteria | 19142 |
| 882 | nmdc:mga05p37_88589_c1 | 3300050507 | Bacteria | 3815 |
| 883 | nmdc:mga09592_106048_c1 | 3300050508 | Bacteria | 2410 |
| 884 | nmdc:mga0qj67_15554_c1 | 3300050509 | Bacteria | 5761 |
| 885 | nmdc:mga06r32_403866_c1 | 3300050510 | Unclassified | 1348 |
| 886 | nmdc:mga08y16_199381_c1 | 3300050511 | Bacteria | 2074 |
| 887 | nmdc:mga0n895_320_c1 | 3300050512 | Bacteria | 31928 |
| 888 | nmdc:mga0n895_46863_c1 | 3300050512 | Bacteria | 4225 |
| 889 | nmdc:mga0rr50_25073_c1 | 3300050513 | Bacteria | 4142 |
| 890 | nmdc:mga08x19_3141_c1 | 3300050514 | Bacteria | 9919 |
| 891 | nmdc:mga0a205_213796_c1 | 3300050515 | Bacteria | 1816 |
| 892 | nmdc:mga0a205_5899_c1 | 3300050515 | Bacteria | 11032 |
| 893 | nmdc:mga0sz30_16128_c3 | 3300050516 | Bacteria | 1971 |
| 894 | nmdc:mga0sz30_1724_c1 | 3300050516 | Bacteria | 7755 |
| 895 | nmdc:mga0sz30_3342_c1 | 3300050516 | Bacteria | 5766 |
| 896 | nmdc:mga0sz30_3484_c2 | 3300050516 | Bacteria | 3533 |
| 897 | nmdc:mga0sz30_483_c1 | 3300050516 | Bacteria | 14954 |
| 898 | Ga0495612_0118723 | 3300053078 | Bacteria | 1136 |
| 899 | Ga0500610_0046814 | 3300053079 | Bacteria | 2247 |
| 900 | Ga0495655_0012580 | 3300053083 | Bacteria | 1729 |
| 901 | Ga0495655_0052742 | 3300053083 | Bacteria | 1082 |
| 902 | Ga0500644_0050462 | 3300053088 | Bacteria | 1424 |
| 903 | Ga0500640_044138 | 3300053095 | Bacteria | 1956 |
| 904 | Ga0500660_028431 | 3300053100 | Bacteria | 2935 |
| 905 | Ga0500553_088478 | 3300053101 | Bacteria | 1369 |
| 906 | Ga0500553_104864 | 3300053101 | Bacteria | 1207 |
| 907 | Ga0500560_079931 | 3300053107 | Bacteria | 1085 |
| 908 | Ga0500580_089720 | 3300053113 | Bacteria | 1230 |
| 909 | Ga0500608_055772 | 3300053122 | Bacteria | 1894 |
| 910 | Ga0500618_000612 | 3300053125 | Bacteria | 21789 |
| 911 | Ga0500559_0085812 | 3300053136 | Bacteria | 1436 |
| 912 | Ga0500573_0191670 | 3300053140 | Bacteria | 1091 |
| 913 | Ga0500616_0033532 | 3300053153 | Bacteria | 2801 |
| 914 | Ga0500616_0073659 | 3300053153 | Bacteria | 1733 |
| 915 | Ga0500645_000565 | 3300053730 | Bacteria | 24250 |
| 916 | Ga0500645_036164 | 3300053730 | Bacteria | 1470 |
| 917 | Ga0501084_0010469 | 3300054114 | Bacteria | 7665 |
| 918 | Ga0466962_0021927 | 3300061719 | Bacteria | 3067 |
| 919 | Ga0466962_0053549 | 3300061719 | Bacteria | 1928 |
| 920 | Ga0530510_0167183 | 3300061734 | Bacteria | 1628 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_100023784 | Ga0070682_1000237842 | 236 |
| 2 | 3300005441 | Ga0070700_100040381 | Ga0070700_1000403814 | 236 |
| 3 | 3300005617 | Ga0068859_100248357 | Ga0068859_1002483572 | 236 |
| 4 | 3300006931 | Ga0097620_100248356 | Ga0097620_1002483562 | 236 |
| 5 | 3300009098 | Ga0105245_10223280 | Ga0105245_102232802 | 236 |
| 6 | 3300011119 | Ga0105246_10126553 | Ga0105246_101265533 | 236 |
| 7 | 3300014968 | Ga0157379_10148111 | Ga0157379_101481112 | 236 |
| 8 | 3300025927 | Ga0207687_10220284 | Ga0207687_102202842 | 236 |
| 9 | 3300025936 | Ga0207670_10153795 | Ga0207670_101537952 | 236 |
| 10 | 3300026075 | Ga0207708_10058034 | Ga0207708_100580344 | 236 |
| 11 | 3300028380 | Ga0268265_10193758 | Ga0268265_101937582 | 236 |
| 12 | 3300048911 | Ga0496108_0002063 | Ga0496108_0002063_8310_9068 | 236 |
| 13 | 3300046455 | Ga0495603_0009121 | Ga0495603_0009121_1623_2417 | 250 |
| 14 | 3300046475 | Ga0495639_0014741 | Ga0495639_0014741_627_1421 | 250 |
| 15 | 3300025927 | Ga0207687_10194766 | Ga0207687_101947662 | 253 |
| 16 | 3300053122 | Ga0500608_055772 | Ga0500608_055772_119_994 | 260 |
| 17 | 3300053136 | Ga0500559_0085812 | Ga0500559_0085812_174_1049 | 260 |
| 18 | 3300013308 | Ga0157375_10495625 | Ga0157375_104956252 | 261 |
| 19 | 3300049569 | Ga0501032_0001058 | Ga0501032_0001058_3302_4168 | 262 |
| 20 | 3300049572 | Ga0501036_0018504 | Ga0501036_0018504_3855_4721 | 262 |
| 21 | 3300049573 | Ga0501037_0003465 | Ga0501037_0003465_8558_9424 | 262 |
| 22 | 3300049574 | Ga0501038_0012232 | Ga0501038_0012232_160_1026 | 262 |
| 23 | 3300049575 | Ga0501039_0000413 | Ga0501039_0000413_19520_20386 | 262 |
| 24 | 3300049579 | Ga0501043_0002340 | Ga0501043_0002340_11837_12703 | 262 |
| 25 | 3300049586 | Ga0501070_0000301 | Ga0501070_0000301_15374_16240 | 262 |
| 26 | 3300049589 | Ga0501073_0046919 | Ga0501073_0046919_1113_1979 | 262 |
| 27 | 3300049823 | Ga0501044_0013974 | Ga0501044_0013974_3586_4452 | 262 |
| 28 | 3300028379 | Ga0268266_10549082 | Ga0268266_105490821 | 266 |
| 29 | 3300037068 | Ga0373925_0196960 | Ga0373925_0196960_81_923 | 266 |
| 30 | 3300009036 | Ga0105244_10041691 | Ga0105244_100416912 | 268 |
| 31 | 3300011119 | Ga0105246_10002782 | Ga0105246_100027828 | 268 |
| 32 | 3300046809 | Ga0495600_0125174 | Ga0495600_0125174_788_1636 | 268 |
| 33 | 3300049568 | Ga0501031_0084751 | Ga0501031_0084751_1150_1998 | 268 |
| 34 | 3300049586 | Ga0501070_0484822 | Ga0501070_0484822_25_873 | 268 |
| 35 | 3300050490 | nmdc:mga03n38_5500_c1 | nmdc:mga03n38_5500_c1_1823_2671 | 268 |
| 36 | 3300050496 | nmdc:mga07m45_46733_c1 | nmdc:mga07m45_46733_c1_489_1337 | 268 |
| 37 | 3300014325 | Ga0163163_10172731 | Ga0163163_101727312 | 269 |
| 38 | 3300009545 | Ga0105237_10079500 | Ga0105237_100795003 | 271 |
| 39 | 3300013297 | Ga0157378_10053432 | Ga0157378_100534322 | 271 |
| 40 | 3300046524 | Ga0495648_0006495 | Ga0495648_0006495_1995_2858 | 271 |
| 41 | 3300047320 | Ga0495672_0005364 | Ga0495672_0005364_1288_2151 | 271 |
| 42 | 3300047469 | Ga0495673_0001153 | Ga0495673_0001153_5728_6591 | 271 |
| 43 | 3300048903 | Ga0496100_0285904 | Ga0496100_0285904_12_887 | 271 |
| 44 | 3300048905 | Ga0496102_0062223 | Ga0496102_0062223_563_1426 | 271 |
| 45 | 3300048907 | Ga0496104_0137999 | Ga0496104_0137999_718_1578 | 271 |
| 46 | 3300048909 | Ga0496106_0163844 | Ga0496106_0163844_159_1019 | 271 |
| 47 | 3300048923 | Ga0496120_0060791 | Ga0496120_0060791_1198_2076 | 271 |
| 48 | 3300044684 | Ga0466966_0258692 | Ga0466966_0258692_29_970 | 272 |
| 49 | 3300044842 | Ga0466957_0063553 | Ga0466957_0063553_356_1249 | 272 |
| 50 | 3300045836 | Ga0466958_0243816 | Ga0466958_0243816_209_1102 | 272 |
| 51 | iso_pu_bacteria | 2643221607 | 2644051420 | 272 |
| 52 | iso_pu_bacteria | 2643221636 | 2644201092 | 272 |
| 53 | iso_pu_bacteria | 2643221686 | 2644484324 | 272 |
| 54 | 3300045976 | Ga0466967_0000412 | Ga0466967_0000412_173_1135 | 273 |
| 55 | 3300045976 | Ga0466967_0090540 | Ga0466967_0090540_62_940 | 273 |
| 56 | 3300049823 | Ga0501044_0066259 | Ga0501044_0066259_41_919 | 273 |
| 57 | 3300013296 | Ga0157374_10012755 | Ga0157374_100127555 | 274 |
| 58 | 3300025931 | Ga0207644_10039998 | Ga0207644_100399982 | 274 |
| 59 | 3300053125 | Ga0500618_000612 | Ga0500618_000612_18082_18954 | 274 |
| 60 | 3300053153 | Ga0500616_0033532 | Ga0500616_0033532_235_1107 | 274 |
| 61 | 3300053730 | Ga0500645_036164 | Ga0500645_036164_129_1031 | 274 |
| 62 | 3300005466 | Ga0070685_10031004 | Ga0070685_100310042 | 275 |
| 63 | 3300046616 | Ga0495668_0000128 | Ga0495668_0000128_35003_35908 | 276 |
| 64 | 3300037853 | Ga0436364_1016041 | Ga0436364_1016041_681_1568 | 277 |
| 65 | 3300039437 | Ga0436365_0664968 | Ga0436365_0664968_2061_2948 | 277 |
| 66 | 3300044901 | Ga0466960_0016305 | Ga0466960_0016305_2038_2979 | 277 |
| 67 | 3300046460 | Ga0495638_0008071 | Ga0495638_0008071_2259_3161 | 277 |
| 68 | 3300049823 | Ga0501044_0094263 | Ga0501044_0094263_2069_2944 | 277 |
| 69 | 3300050492 | nmdc:mga0yw44_52184_c1 | nmdc:mga0yw44_52184_c1_1116_2033 | 277 |
| 70 | 3300053730 | Ga0500645_000565 | Ga0500645_000565_13435_14337 | 277 |
| 71 | iso_pu_bacteria | 2867346516 | 2867350104 | 277 |
| 72 | iso_pu_bacteria | 2997600082 | 2997606925 | 277 |
| 73 | 3300005445 | Ga0070708_100136177 | Ga0070708_1001361772 | 278 |
| 74 | 3300006844 | Ga0075428_100198703 | Ga0075428_1001987032 | 278 |
| 75 | 3300006847 | Ga0075431_100661636 | Ga0075431_1006616361 | 278 |
| 76 | 3300050510 | nmdc:mga06r32_403866_c1 | nmdc:mga06r32_403866_c1_411_1298 | 278 |
| 77 | 3300050516 | nmdc:mga0sz30_1724_c1 | nmdc:mga0sz30_1724_c1_4370_5272 | 278 |
| 78 | 3300005615 | Ga0070702_100107025 | Ga0070702_1001070252 | 279 |
| 79 | 3300021361 | Ga0213872_10124712 | Ga0213872_101247122 | 279 |
| 80 | 3300039447 | Ga0436361_0713294 | Ga0436361_0713294_1408_2316 | 279 |
| 81 | iso_pu_bacteria | 8056447290 | 8056451483 | 279 |
| 82 | 3300005467 | Ga0070706_100491982 | Ga0070706_1004919821 | 280 |
| 83 | 3300005985 | Ga0081539_10003746 | Ga0081539_1000374611 | 280 |
| 84 | 3300006051 | Ga0075364_10309002 | Ga0075364_103090021 | 280 |
| 85 | 3300048911 | Ga0496108_0313349 | Ga0496108_0313349_343_1248 | 280 |
| 86 | 3300048911 | Ga0496108_0524909 | Ga0496108_0524909_32_949 | 280 |
| 87 | 3300048928 | Ga0496125_0037277 | Ga0496125_0037277_2185_3090 | 280 |
| 88 | 3300050490 | nmdc:mga03n38_188677_c1 | nmdc:mga03n38_188677_c1_25_930 | 280 |
| 89 | 3300050496 | nmdc:mga07m45_13721_c1 | nmdc:mga07m45_13721_c1_1743_2648 | 280 |
| 90 | iso_pu_bacteria | 2643221673 | 2644409136 | 280 |
| 91 | iso_pu_bacteria | 2862290372 | 2862296635 | 280 |
| 92 | iso_pu_bacteria | 2523231044 | 2523386742 | 281 |
| 93 | iso_pu_bacteria | 2565956761 | 2566992043 | 281 |
| 94 | iso_pu_bacteria | 2643221687 | 2644486604 | 281 |
| 95 | iso_pu_bacteria | 2643221715 | 2644638330 | 281 |
| 96 | iso_pu_bacteria | 2738541274 | 2738705949 | 281 |
| 97 | iso_pu_bacteria | 2738543028 | 2739330429 | 281 |
| 98 | iso_pu_bacteria | 2767802112 | 2768646986 | 281 |
| 99 | iso_pu_bacteria | 2862281513 | 2862282994 | 281 |
| 100 | iso_pu_bacteria | 2873151551 | 2873156458 | 281 |
| 101 | iso_pu_bacteria | 2902792274 | 2902796701 | 281 |
| 102 | iso_pu_bacteria | 2902799365 | 2902801728 | 281 |
| 103 | iso_pu_bacteria | 2902810491 | 2902812242 | 281 |
| 104 | iso_pu_bacteria | 2904535858 | 2904538555 | 281 |
| 105 | iso_pu_bacteria | 2922554459 | 2922559286 | 281 |
| 106 | iso_pu_bacteria | 2939582691 | 2939588657 | 281 |
| 107 | iso_pu_bacteria | 2984523437 | 2984524954 | 281 |
| 108 | 3300003659 | JGI25404J52841_10001019 | JGI25404J52841_100010193 | 282 |
| 109 | 3300005983 | Ga0081540_1001044 | Ga0081540_100104419 | 282 |
| 110 | 3300009148 | Ga0105243_10023025 | Ga0105243_100230253 | 282 |
| 111 | 3300009986 | Ga0105033_105012 | Ga0105033_1050121 | 282 |
| 112 | 3300013105 | Ga0157369_10521648 | Ga0157369_105216482 | 282 |
| 113 | 3300046455 | Ga0495603_0058650 | Ga0495603_0058650_252_1154 | 282 |
| 114 | 3300046499 | Ga0495594_0121465 | Ga0495594_0121465_420_1322 | 282 |
| 115 | 3300046794 | Ga0495589_0012127 | Ga0495589_0012127_157_1059 | 282 |
| 116 | 3300046794 | Ga0495589_0012562 | Ga0495589_0012562_157_1059 | 282 |
| 117 | 3300047318 | Ga0495636_0033723 | Ga0495636_0033723_40_942 | 282 |
| 118 | 3300047323 | Ga0495683_0098886 | Ga0495683_0098886_478_1380 | 282 |
| 119 | 3300047447 | Ga0495685_004930 | Ga0495685_004930_3293_4195 | 282 |
| 120 | 3300050492 | nmdc:mga0yw44_207032_c1 | nmdc:mga0yw44_207032_c1_364_1284 | 282 |
| 121 | 3300053140 | Ga0500573_0191670 | Ga0500573_0191670_128_1027 | 282 |
| 122 | iso_pu_bacteria | 2515154129 | 2515721523 | 282 |
| 123 | iso_pu_bacteria | 2515154202 | 2516086162 | 282 |
| 124 | iso_pu_bacteria | 2547132111 | 2547412330 | 282 |
| 125 | iso_pu_bacteria | 2582581313 | 2585304187 | 282 |
| 126 | iso_pu_bacteria | 2616644814 | 2616693623 | 282 |
| 127 | iso_pu_bacteria | 2643221647 | 2644270407 | 282 |
| 128 | iso_pu_bacteria | 2643221678 | 2644440920 | 282 |
| 129 | iso_pu_bacteria | 2775506925 | 2776374876 | 282 |
| 130 | iso_pu_bacteria | 2784132148 | 2784591994 | 282 |
| 131 | iso_pu_bacteria | 2784746768 | 2785373251 | 282 |
| 132 | iso_pu_bacteria | 2786546132 | 2786674732 | 282 |
| 133 | iso_pu_bacteria | 2808606375 | 2808915108 | 282 |
| 134 | iso_pu_bacteria | 2808606448 | 2809235630 | 282 |
| 135 | iso_pu_bacteria | 2808606982 | 2811848376 | 282 |
| 136 | iso_pu_bacteria | 2811994879 | 2812354328 | 282 |
| 137 | iso_pu_bacteria | 2811994917 | 2812482855 | 282 |
| 138 | iso_pu_bacteria | 2852635781 | 2852635948 | 282 |
| 139 | iso_pu_bacteria | 2862178590 | 2862184782 | 282 |
| 140 | iso_pu_bacteria | 2862507626 | 2862507678 | 282 |
| 141 | iso_pu_bacteria | 2862574272 | 2862579866 | 282 |
| 142 | iso_pu_bacteria | 2863067949 | 2863074827 | 282 |
| 143 | iso_pu_bacteria | 2867428634 | 2867430009 | 282 |
| 144 | iso_pu_bacteria | 2877676314 | 2877677660 | 282 |
| 145 | iso_pu_bacteria | 2912723979 | 2912728916 | 282 |
| 146 | iso_pu_bacteria | 2912757875 | 2912760049 | 282 |
| 147 | iso_pu_bacteria | 2946064051 | 2946071373 | 282 |
| 148 | iso_pu_bacteria | 2947224130 | 2947225363 | 282 |
| 149 | iso_pu_bacteria | 2954380949 | 2954382419 | 282 |
| 150 | iso_pu_bacteria | 2954673503 | 2954680670 | 282 |
| 151 | iso_pu_bacteria | 2954682443 | 2954683483 | 282 |
| 152 | iso_pu_bacteria | 2954691527 | 2954693224 | 282 |
| 153 | iso_pu_bacteria | 2954701450 | 2954708321 | 282 |
| 154 | iso_pu_bacteria | 2954711539 | 2954712898 | 282 |
| 155 | iso_pu_bacteria | 2954721474 | 2954722856 | 282 |
| 156 | iso_pu_bacteria | 2954731030 | 2954738973 | 282 |
| 157 | iso_pu_bacteria | 2954740390 | 2954741767 | 282 |
| 158 | iso_pu_bacteria | 2954749733 | 2954757831 | 282 |
| 159 | iso_pu_bacteria | 2954759201 | 2954760746 | 282 |
| 160 | iso_pu_bacteria | 3006493962 | 3006494565 | 282 |
| 161 | iso_pu_bacteria | 8023623736 | 8023624176 | 282 |
| 162 | iso_pu_bacteria | 8025530807 | 8025536923 | 282 |
| 163 | 3300025297 | Ga0209758_1004873 | Ga0209758_10048735 | 283 |
| 164 | 3300042007 | Ga0439449_0003409 | Ga0439449_0003409_3430_4326 | 283 |
| 165 | iso_pu_bacteria | 2582581314 | 2585319069 | 283 |
| 166 | iso_pu_bacteria | 2912715099 | 2912715868 | 283 |
| 167 | iso_pu_bacteria | 2929212328 | 2929216598 | 283 |
| 168 | iso_pu_bacteria | 2954002825 | 2954003414 | 283 |
| 169 | iso_pu_bacteria | 3006393351 | 3006395457 | 283 |
| 170 | iso_pu_bacteria | 8008574985 | 8008575825 | 283 |
| 171 | iso_pu_bacteria | 8025478263 | 8025481752 | 283 |
| 172 | iso_pu_bacteria | 8056829672 | 8056836148 | 283 |
| 173 | 3300002075 | JGI24738J21930_10012736 | JGI24738J21930_100127361 | 284 |
| 174 | 3300003316 | rootH1_10030847 | rootH1_100308472 | 284 |
| 175 | 3300003316 | rootH1_10039924 | rootH1_100399242 | 284 |
| 176 | 3300003320 | rootH2_10015356 | rootH2_100153566 | 284 |
| 177 | 3300003354 | JGI25160J50197_1007423 | JGI25160J50197_10074231 | 284 |
| 178 | 3300003354 | JGI25160J50197_1019006 | JGI25160J50197_10190062 | 284 |
| 179 | 3300005539 | Ga0068853_100107742 | Ga0068853_1001077422 | 284 |
| 180 | 3300005614 | Ga0068856_100128145 | Ga0068856_1001281453 | 284 |
| 181 | 3300005937 | Ga0081455_10067116 | Ga0081455_100671163 | 284 |
| 182 | 3300005937 | Ga0081455_10093426 | Ga0081455_100934262 | 284 |
| 183 | 3300006038 | Ga0075365_10088968 | Ga0075365_100889682 | 284 |
| 184 | 3300006042 | Ga0075368_10030260 | Ga0075368_100302602 | 284 |
| 185 | 3300006042 | Ga0075368_10035580 | Ga0075368_100355802 | 284 |
| 186 | 3300006048 | Ga0075363_100008072 | Ga0075363_1000080725 | 284 |
| 187 | 3300006048 | Ga0075363_100020295 | Ga0075363_1000202954 | 284 |
| 188 | 3300006058 | Ga0075432_10013820 | Ga0075432_100138202 | 284 |
| 189 | 3300006178 | Ga0075367_10024385 | Ga0075367_100243852 | 284 |
| 190 | 3300006178 | Ga0075367_10056257 | Ga0075367_100562573 | 284 |
| 191 | 3300006353 | Ga0075370_10017296 | Ga0075370_100172962 | 284 |
| 192 | 3300006948 | Ga0099826_10054431 | Ga0099826_100544313 | 284 |
| 193 | 3300006948 | Ga0099826_10060166 | Ga0099826_100601662 | 284 |
| 194 | 3300009094 | Ga0111539_10001835 | Ga0111539_1000183516 | 284 |
| 195 | 3300009147 | Ga0114129_10777883 | Ga0114129_107778832 | 284 |
| 196 | 3300009148 | Ga0105243_10053826 | Ga0105243_100538263 | 284 |
| 197 | 3300011119 | Ga0105246_10082859 | Ga0105246_100828592 | 284 |
| 198 | 3300011119 | Ga0105246_10261548 | Ga0105246_102615481 | 284 |
| 199 | 3300013307 | Ga0157372_10147659 | Ga0157372_101476592 | 284 |
| 200 | 3300014497 | Ga0182008_10001253 | Ga0182008_100012534 | 284 |
| 201 | 3300014497 | Ga0182008_10001941 | Ga0182008_100019417 | 284 |
| 202 | 3300015261 | Ga0182006_1054255 | Ga0182006_10542552 | 284 |
| 203 | 3300015262 | Ga0182007_10001202 | Ga0182007_100012022 | 284 |
| 204 | 3300015262 | Ga0182007_10001318 | Ga0182007_100013184 | 284 |
| 205 | 3300015688 | Ga0183367_1001 | Ga0183367_1001978 | 284 |
| 206 | 3300015688 | Ga0183367_1006 | Ga0183367_1006337 | 284 |
| 207 | 3300015688 | Ga0183367_1021 | Ga0183367_102153 | 284 |
| 208 | 3300021388 | Ga0213875_10012871 | Ga0213875_100128714 | 284 |
| 209 | 3300025302 | Ga0207426_1000790 | Ga0207426_100079017 | 284 |
| 210 | 3300025302 | Ga0207426_1007251 | Ga0207426_10072514 | 284 |
| 211 | 3300025904 | Ga0207647_10004145 | Ga0207647_100041458 | 284 |
| 212 | 3300025904 | Ga0207647_10006210 | Ga0207647_100062107 | 284 |
| 213 | 3300026041 | Ga0207639_10096026 | Ga0207639_100960262 | 284 |
| 214 | 3300026078 | Ga0207702_10068447 | Ga0207702_100684473 | 284 |
| 215 | 3300027666 | Ga0209282_1052640 | Ga0209282_10526402 | 284 |
| 216 | 3300028786 | Ga0307517_10004208 | Ga0307517_1000420815 | 284 |
| 217 | 3300028794 | Ga0307515_10000046 | Ga0307515_10000046314 | 284 |
| 218 | 3300028794 | Ga0307515_10034314 | Ga0307515_100343145 | 284 |
| 219 | 3300028794 | Ga0307515_10106091 | Ga0307515_101060913 | 284 |
| 220 | 3300028794 | Ga0307515_10150583 | Ga0307515_101505832 | 284 |
| 221 | 3300030500 | Ga0268256_1020506 | Ga0268256_10205062 | 284 |
| 222 | 3300030521 | Ga0307511_10049337 | Ga0307511_100493373 | 284 |
| 223 | 3300030521 | Ga0307511_10155770 | Ga0307511_101557702 | 284 |
| 224 | 3300030522 | Ga0307512_10043807 | Ga0307512_100438072 | 284 |
| 225 | 3300031456 | Ga0307513_10015302 | Ga0307513_100153023 | 284 |
| 226 | 3300031456 | Ga0307513_10019716 | Ga0307513_100197168 | 284 |
| 227 | 3300031507 | Ga0307509_10039748 | Ga0307509_100397484 | 284 |
| 228 | 3300031507 | Ga0307509_10193474 | Ga0307509_101934742 | 284 |
| 229 | 3300031616 | Ga0307508_10005047 | Ga0307508_100050472 | 284 |
| 230 | 3300031616 | Ga0307508_10012343 | Ga0307508_100123436 | 284 |
| 231 | 3300031616 | Ga0307508_10015165 | Ga0307508_100151655 | 284 |
| 232 | 3300031616 | Ga0307508_10023014 | Ga0307508_100230145 | 284 |
| 233 | 3300031616 | Ga0307508_10130526 | Ga0307508_101305262 | 284 |
| 234 | 3300031649 | Ga0307514_10003992 | Ga0307514_100039927 | 284 |
| 235 | 3300031649 | Ga0307514_10069990 | Ga0307514_100699902 | 284 |
| 236 | 3300031649 | Ga0307514_10079829 | Ga0307514_100798292 | 284 |
| 237 | 3300031730 | Ga0307516_10014667 | Ga0307516_100146676 | 284 |
| 238 | 3300031838 | Ga0307518_10048604 | Ga0307518_100486042 | 284 |
| 239 | 3300032002 | Ga0307416_100066381 | Ga0307416_1000663813 | 284 |
| 240 | 3300033179 | Ga0307507_10014232 | Ga0307507_100142327 | 284 |
| 241 | 3300033179 | Ga0307507_10015481 | Ga0307507_100154817 | 284 |
| 242 | 3300033179 | Ga0307507_10208544 | Ga0307507_102085442 | 284 |
| 243 | 3300033180 | Ga0307510_10158611 | Ga0307510_101586112 | 284 |
| 244 | 3300037418 | Ga0395900_0083875 | Ga0395900_0083875_1286_2203 | 284 |
| 245 | 3300037418 | Ga0395900_0256237 | Ga0395900_0256237_68_982 | 284 |
| 246 | 3300037418 | Ga0395900_0319301 | Ga0395900_0319301_91_999 | 284 |
| 247 | 3300037466 | Ga0395898_0015241 | Ga0395898_0015241_2620_3537 | 284 |
| 248 | 3300037466 | Ga0395898_0042453 | Ga0395898_0042453_2821_3729 | 284 |
| 249 | 3300037466 | Ga0395898_0073677 | Ga0395898_0073677_1345_2247 | 284 |
| 250 | 3300037471 | Ga0395905_0421335 | Ga0395905_0421335_218_1126 | 284 |
| 251 | 3300037853 | Ga0436364_0370574 | Ga0436364_0370574_4560_5498 | 284 |
| 252 | 3300041404 | Ga0439436_0007597 | Ga0439436_0007597_578_1522 | 284 |
| 253 | 3300041404 | Ga0439436_0024059 | Ga0439436_0024059_523_1425 | 284 |
| 254 | 3300041512 | Ga0451853_0186994 | Ga0451853_0186994_1119_2021 | 284 |
| 255 | 3300041999 | Ga0439433_0001850 | Ga0439433_0001850_47_949 | 284 |
| 256 | 3300042005 | Ga0439448_0007193 | Ga0439448_0007193_1040_1942 | 284 |
| 257 | 3300042005 | Ga0439448_0018547 | Ga0439448_0018547_130_1074 | 284 |
| 258 | 3300042007 | Ga0439449_0002442 | Ga0439449_0002442_6195_7112 | 284 |
| 259 | 3300042007 | Ga0439449_0033212 | Ga0439449_0033212_780_1682 | 284 |
| 260 | 3300042007 | Ga0439449_0040692 | Ga0439449_0040692_724_1668 | 284 |
| 261 | 3300042012 | Ga0439455_0003289 | Ga0439455_0003289_15_917 | 284 |
| 262 | 3300042012 | Ga0439455_0006433 | Ga0439455_0006433_1217_2161 | 284 |
| 263 | 3300042014 | Ga0439457_000977 | Ga0439457_000977_6277_7221 | 284 |
| 264 | 3300042014 | Ga0439457_002741 | Ga0439457_002741_1609_2511 | 284 |
| 265 | 3300042015 | Ga0439462_0002522 | Ga0439462_0002522_226_1128 | 284 |
| 266 | 3300042131 | Ga0450894_002382 | Ga0450894_002382_1586_2512 | 284 |
| 267 | 3300042136 | Ga0450900_002018 | Ga0450900_002018_82_990 | 284 |
| 268 | 3300042138 | Ga0450903_000575 | Ga0450903_000575_2093_2995 | 284 |
| 269 | 3300042138 | Ga0450903_001095 | Ga0450903_001095_3050_3994 | 284 |
| 270 | 3300042157 | Ga0439458_0000722 | Ga0439458_0000722_1440_2342 | 284 |
| 271 | 3300042993 | Ga0439440_0013027 | Ga0439440_0013027_385_1293 | 284 |
| 272 | 3300044656 | Ga0466969_0045354 | Ga0466969_0045354_832_1740 | 284 |
| 273 | 3300044658 | Ga0466972_0002060 | Ga0466972_0002060_7107_8009 | 284 |
| 274 | 3300044658 | Ga0466972_0011100 | Ga0466972_0011100_1731_2633 | 284 |
| 275 | 3300044658 | Ga0466972_0127922 | Ga0466972_0127922_36_953 | 284 |
| 276 | 3300044683 | Ga0466965_0000288 | Ga0466965_0000288_5690_6592 | 284 |
| 277 | 3300044683 | Ga0466965_0126935 | Ga0466965_0126935_280_1182 | 284 |
| 278 | 3300044684 | Ga0466966_0002830 | Ga0466966_0002830_5473_6375 | 284 |
| 279 | 3300044684 | Ga0466966_0004237 | Ga0466966_0004237_2190_3098 | 284 |
| 280 | 3300044694 | Ga0466963_0001177 | Ga0466963_0001177_5473_6375 | 284 |
| 281 | 3300044694 | Ga0466963_0008746 | Ga0466963_0008746_472_1392 | 284 |
| 282 | 3300044706 | Ga0466964_0001884 | Ga0466964_0001884_1925_2827 | 284 |
| 283 | 3300044719 | Ga0466971_0003539 | Ga0466971_0003539_4829_5731 | 284 |
| 284 | 3300044719 | Ga0466971_0025437 | Ga0466971_0025437_662_1570 | 284 |
| 285 | 3300044765 | Ga0466970_0008602 | Ga0466970_0008602_1094_2011 | 284 |
| 286 | 3300044765 | Ga0466970_0010797 | Ga0466970_0010797_2543_3445 | 284 |
| 287 | 3300044842 | Ga0466957_0009571 | Ga0466957_0009571_4423_5325 | 284 |
| 288 | 3300044842 | Ga0466957_0090970 | Ga0466957_0090970_548_1450 | 284 |
| 289 | 3300044901 | Ga0466960_0001508 | Ga0466960_0001508_57_959 | 284 |
| 290 | 3300045049 | Ga0466959_0008657 | Ga0466959_0008657_5473_6375 | 284 |
| 291 | 3300045836 | Ga0466958_0001015 | Ga0466958_0001015_7039_7941 | 284 |
| 292 | 3300045976 | Ga0466967_0017691 | Ga0466967_0017691_4528_5430 | 284 |
| 293 | 3300045976 | Ga0466967_0053051 | Ga0466967_0053051_1178_2080 | 284 |
| 294 | 3300045976 | Ga0466967_0349201 | Ga0466967_0349201_462_1379 | 284 |
| 295 | 3300046453 | Ga0495627_017353 | Ga0495627_017353_726_1655 | 284 |
| 296 | 3300046454 | Ga0495592_0088282 | Ga0495592_0088282_1136_2038 | 284 |
| 297 | 3300046455 | Ga0495603_0019345 | Ga0495603_0019345_2576_3553 | 284 |
| 298 | 3300046457 | Ga0495590_0048739 | Ga0495590_0048739_263_1165 | 284 |
| 299 | 3300046459 | Ga0495629_0011063 | Ga0495629_0011063_2945_3853 | 284 |
| 300 | 3300046459 | Ga0495629_0012494 | Ga0495629_0012494_4520_5428 | 284 |
| 301 | 3300046459 | Ga0495629_0072468 | Ga0495629_0072468_273_1250 | 284 |
| 302 | 3300046460 | Ga0495638_0183262 | Ga0495638_0183262_144_1052 | 284 |
| 303 | 3300046462 | Ga0495651_0001558 | Ga0495651_0001558_14411_15319 | 284 |
| 304 | 3300046476 | Ga0495662_0000305 | Ga0495662_0000305_14470_15378 | 284 |
| 305 | 3300046476 | Ga0495662_0016026 | Ga0495662_0016026_667_1644 | 284 |
| 306 | 3300046476 | Ga0495662_0090269 | Ga0495662_0090269_465_1442 | 284 |
| 307 | 3300046477 | Ga0495664_0146605 | Ga0495664_0146605_426_1328 | 284 |
| 308 | 3300046499 | Ga0495594_0003881 | Ga0495594_0003881_5075_6052 | 284 |
| 309 | 3300046501 | Ga0495607_0069572 | Ga0495607_0069572_218_1120 | 284 |
| 310 | 3300046507 | Ga0495606_0007166 | Ga0495606_0007166_8262_9164 | 284 |
| 311 | 3300046512 | Ga0495610_0122337 | Ga0495610_0122337_107_1009 | 284 |
| 312 | 3300046513 | Ga0495616_0030023 | Ga0495616_0030023_483_1385 | 284 |
| 313 | 3300046514 | Ga0495618_0017879 | Ga0495618_0017879_3215_4123 | 284 |
| 314 | 3300046516 | Ga0495628_0090038 | Ga0495628_0090038_556_1464 | 284 |
| 315 | 3300046516 | Ga0495628_0176393 | Ga0495628_0176393_511_1413 | 284 |
| 316 | 3300046517 | Ga0495630_0032749 | Ga0495630_0032749_1071_1979 | 284 |
| 317 | 3300046517 | Ga0495630_0085244 | Ga0495630_0085244_1162_2145 | 284 |
| 318 | 3300046518 | Ga0495631_0005052 | Ga0495631_0005052_610_1512 | 284 |
| 319 | 3300046522 | Ga0495643_0021076 | Ga0495643_0021076_2519_3421 | 284 |
| 320 | 3300046524 | Ga0495648_0073713 | Ga0495648_0073713_727_1629 | 284 |
| 321 | 3300046526 | Ga0495666_0023421 | Ga0495666_0023421_1835_2737 | 284 |
| 322 | 3300046529 | Ga0495652_0104742 | Ga0495652_0104742_158_1066 | 284 |
| 323 | 3300046529 | Ga0495652_0341063 | Ga0495652_0341063_108_1010 | 284 |
| 324 | 3300046530 | Ga0495654_0089547 | Ga0495654_0089547_12_914 | 284 |
| 325 | 3300046533 | Ga0495640_0259776 | Ga0495640_0259776_133_1041 | 284 |
| 326 | 3300046535 | Ga0495586_0062897 | Ga0495586_0062897_202_1131 | 284 |
| 327 | 3300046536 | Ga0495587_0011507 | Ga0495587_0011507_3481_4389 | 284 |
| 328 | 3300046538 | Ga0495609_0018220 | Ga0495609_0018220_2132_3034 | 284 |
| 329 | 3300046543 | Ga0495645_0084185 | Ga0495645_0084185_1102_2010 | 284 |
| 330 | 3300046557 | Ga0495622_0092011 | Ga0495622_0092011_458_1369 | 284 |
| 331 | 3300046558 | Ga0495633_0045335 | Ga0495633_0045335_507_1409 | 284 |
| 332 | 3300046558 | Ga0495633_0068545 | Ga0495633_0068545_183_1160 | 284 |
| 333 | 3300046559 | Ga0495667_0223730 | Ga0495667_0223730_117_1019 | 284 |
| 334 | 3300046615 | Ga0495656_0021881 | Ga0495656_0021881_542_1519 | 284 |
| 335 | 3300046616 | Ga0495668_0010814 | Ga0495668_0010814_2915_3817 | 284 |
| 336 | 3300046642 | Ga0495634_0008925 | Ga0495634_0008925_1068_1976 | 284 |
| 337 | 3300046660 | Ga0495625_0037842 | Ga0495625_0037842_2464_3366 | 284 |
| 338 | 3300046663 | Ga0495635_0006889 | Ga0495635_0006889_6245_7153 | 284 |
| 339 | 3300046665 | Ga0495661_0035615 | Ga0495661_0035615_170_1072 | 284 |
| 340 | 3300046674 | Ga0495588_0019104 | Ga0495588_0019104_1624_2532 | 284 |
| 341 | 3300046675 | Ga0495657_0006337 | Ga0495657_0006337_2406_3314 | 284 |
| 342 | 3300046675 | Ga0495657_0008870 | Ga0495657_0008870_354_1337 | 284 |
| 343 | 3300046675 | Ga0495657_0045638 | Ga0495657_0045638_475_1377 | 284 |
| 344 | 3300046680 | Ga0495646_0001231 | Ga0495646_0001231_206_1114 | 284 |
| 345 | 3300046683 | Ga0495658_0008137 | Ga0495658_0008137_3116_4027 | 284 |
| 346 | 3300046689 | Ga0495613_0038091 | Ga0495613_0038091_2541_3524 | 284 |
| 347 | 3300046689 | Ga0495613_0047649 | Ga0495613_0047649_1470_2372 | 284 |
| 348 | 3300046689 | Ga0495613_0051651 | Ga0495613_0051651_1057_1965 | 284 |
| 349 | 3300046692 | Ga0495671_0012968 | Ga0495671_0012968_397_1305 | 284 |
| 350 | 3300046694 | Ga0495649_0176746 | Ga0495649_0176746_188_1090 | 284 |
| 351 | 3300046794 | Ga0495589_0006883 | Ga0495589_0006883_2546_3505 | 284 |
| 352 | 3300046794 | Ga0495589_0016490 | Ga0495589_0016490_2597_3499 | 284 |
| 353 | 3300046809 | Ga0495600_0032445 | Ga0495600_0032445_638_1540 | 284 |
| 354 | 3300047315 | Ga0495581_0037673 | Ga0495581_0037673_827_1735 | 284 |
| 355 | 3300047315 | Ga0495581_0105974 | Ga0495581_0105974_440_1417 | 284 |
| 356 | 3300047317 | Ga0495604_0000811 | Ga0495604_0000811_14688_15596 | 284 |
| 357 | 3300047318 | Ga0495636_0000665 | Ga0495636_0000665_8883_9800 | 284 |
| 358 | 3300047318 | Ga0495636_0019787 | Ga0495636_0019787_1202_2161 | 284 |
| 359 | 3300047318 | Ga0495636_0026473 | Ga0495636_0026473_38_1015 | 284 |
| 360 | 3300047319 | Ga0495674_0240708 | Ga0495674_0240708_492_1394 | 284 |
| 361 | 3300047321 | Ga0495676_0009915 | Ga0495676_0009915_6739_7647 | 284 |
| 362 | 3300047321 | Ga0495676_0010110 | Ga0495676_0010110_943_1845 | 284 |
| 363 | 3300047321 | Ga0495676_0023642 | Ga0495676_0023642_4277_5179 | 284 |
| 364 | 3300047443 | Ga0495687_001148 | Ga0495687_001148_16611_17528 | 284 |
| 365 | 3300047443 | Ga0495687_036096 | Ga0495687_036096_268_1170 | 284 |
| 366 | 3300047443 | Ga0495687_054907 | Ga0495687_054907_487_1395 | 284 |
| 367 | 3300047443 | Ga0495687_068286 | Ga0495687_068286_234_1145 | 284 |
| 368 | 3300047444 | Ga0495675_0248015 | Ga0495675_0248015_22_1005 | 284 |
| 369 | 3300047445 | Ga0495677_0016191 | Ga0495677_0016191_303_1205 | 284 |
| 370 | 3300047447 | Ga0495685_001061 | Ga0495685_001061_37_939 | 284 |
| 371 | 3300047447 | Ga0495685_001209 | Ga0495685_001209_6730_7689 | 284 |
| 372 | 3300047447 | Ga0495685_001477 | Ga0495685_001477_4230_5132 | 284 |
| 373 | 3300047470 | Ga0495681_0091638 | Ga0495681_0091638_337_1263 | 284 |
| 374 | 3300047472 | Ga0495686_0048992 | Ga0495686_0048992_1023_1925 | 284 |
| 375 | 3300047673 | Ga0495593_0034697 | Ga0495593_0034697_793_1701 | 284 |
| 376 | 3300048088 | Ga0495602_0142074 | Ga0495602_0142074_762_1670 | 284 |
| 377 | 3300048089 | Ga0495614_0022354 | Ga0495614_0022354_1174_2082 | 284 |
| 378 | 3300048091 | Ga0495626_0059545 | Ga0495626_0059545_828_1730 | 284 |
| 379 | 3300049459 | Ga0495678_056138 | Ga0495678_056138_114_1016 | 284 |
| 380 | 3300049460 | Ga0495682_0038634 | Ga0495682_0038634_154_1056 | 284 |
| 381 | 3300049568 | Ga0501031_0122287 | Ga0501031_0122287_561_1481 | 284 |
| 382 | 3300049569 | Ga0501032_0025037 | Ga0501032_0025037_550_1470 | 284 |
| 383 | 3300049570 | Ga0501033_0007160 | Ga0501033_0007160_366_1274 | 284 |
| 384 | 3300049570 | Ga0501033_0045356 | Ga0501033_0045356_2216_3118 | 284 |
| 385 | 3300049570 | Ga0501033_0057629 | Ga0501033_0057629_1466_2386 | 284 |
| 386 | 3300049570 | Ga0501033_0232612 | Ga0501033_0232612_381_1283 | 284 |
| 387 | 3300049571 | Ga0501034_0006804 | Ga0501034_0006804_5090_5992 | 284 |
| 388 | 3300049571 | Ga0501034_0031681 | Ga0501034_0031681_680_1582 | 284 |
| 389 | 3300049571 | Ga0501034_0046795 | Ga0501034_0046795_1157_2077 | 284 |
| 390 | 3300049571 | Ga0501034_0100512 | Ga0501034_0100512_1570_2496 | 284 |
| 391 | 3300049572 | Ga0501036_0009835 | Ga0501036_0009835_154_1056 | 284 |
| 392 | 3300049572 | Ga0501036_0017920 | Ga0501036_0017920_4350_5252 | 284 |
| 393 | 3300049572 | Ga0501036_0033678 | Ga0501036_0033678_2893_3813 | 284 |
| 394 | 3300049573 | Ga0501037_0031766 | Ga0501037_0031766_2565_3485 | 284 |
| 395 | 3300049574 | Ga0501038_0002496 | Ga0501038_0002496_2054_2980 | 284 |
| 396 | 3300049574 | Ga0501038_0041961 | Ga0501038_0041961_148_1050 | 284 |
| 397 | 3300049574 | Ga0501038_0043522 | Ga0501038_0043522_2425_3345 | 284 |
| 398 | 3300049574 | Ga0501038_0104210 | Ga0501038_0104210_602_1504 | 284 |
| 399 | 3300049575 | Ga0501039_0140183 | Ga0501039_0140183_532_1452 | 284 |
| 400 | 3300049575 | Ga0501039_0222091 | Ga0501039_0222091_431_1333 | 284 |
| 401 | 3300049578 | Ga0501042_0007681 | Ga0501042_0007681_894_1814 | 284 |
| 402 | 3300049579 | Ga0501043_0037168 | Ga0501043_0037168_663_1583 | 284 |
| 403 | 3300049579 | Ga0501043_0076802 | Ga0501043_0076802_1026_1952 | 284 |
| 404 | 3300049580 | Ga0501046_0013758 | Ga0501046_0013758_5302_6222 | 284 |
| 405 | 3300049580 | Ga0501046_0070356 | Ga0501046_0070356_1092_2012 | 284 |
| 406 | 3300049581 | Ga0501047_0019290 | Ga0501047_0019290_3176_4102 | 284 |
| 407 | 3300049581 | Ga0501047_0065802 | Ga0501047_0065802_606_1526 | 284 |
| 408 | 3300049582 | Ga0501048_0032054 | Ga0501048_0032054_195_1115 | 284 |
| 409 | 3300049583 | Ga0501067_0100241 | Ga0501067_0100241_603_1547 | 284 |
| 410 | 3300049586 | Ga0501070_0001683 | Ga0501070_0001683_8051_8953 | 284 |
| 411 | 3300049586 | Ga0501070_0154194 | Ga0501070_0154194_648_1550 | 284 |
| 412 | 3300049589 | Ga0501073_0148989 | Ga0501073_0148989_90_992 | 284 |
| 413 | 3300049590 | Ga0501074_0011845 | Ga0501074_0011845_2804_3706 | 284 |
| 414 | 3300049742 | Ga0501080_0025716 | Ga0501080_0025716_197_1123 | 284 |
| 415 | 3300049744 | Ga0501083_0152710 | Ga0501083_0152710_503_1423 | 284 |
| 416 | 3300049822 | Ga0501035_0096585 | Ga0501035_0096585_1237_2145 | 284 |
| 417 | 3300049822 | Ga0501035_0178639 | Ga0501035_0178639_867_1769 | 284 |
| 418 | 3300049822 | Ga0501035_0181611 | Ga0501035_0181611_575_1495 | 284 |
| 419 | 3300049823 | Ga0501044_0001741 | Ga0501044_0001741_2014_2916 | 284 |
| 420 | 3300049823 | Ga0501044_0013221 | Ga0501044_0013221_7739_8665 | 284 |
| 421 | 3300049823 | Ga0501044_0118192 | Ga0501044_0118192_653_1573 | 284 |
| 422 | 3300049823 | Ga0501044_0222544 | Ga0501044_0222544_318_1238 | 284 |
| 423 | 3300050490 | nmdc:mga03n38_15033_c1 | nmdc:mga03n38_15033_c1_1533_2432 | 284 |
| 424 | 3300050492 | nmdc:mga0yw44_339099_c1 | nmdc:mga0yw44_339099_c1_76_978 | 284 |
| 425 | 3300050494 | nmdc:mga06z11_15221_c1 | nmdc:mga06z11_15221_c1_1037_1981 | 284 |
| 426 | 3300050494 | nmdc:mga06z11_39550_c1 | nmdc:mga06z11_39550_c1_279_1181 | 284 |
| 427 | 3300050495 | nmdc:mga04h51_5954_c1 | nmdc:mga04h51_5954_c1_1102_2046 | 284 |
| 428 | 3300050495 | nmdc:mga04h51_9671_c1 | nmdc:mga04h51_9671_c1_776_1678 | 284 |
| 429 | 3300050496 | nmdc:mga07m45_146616_c1 | nmdc:mga07m45_146616_c1_260_1162 | 284 |
| 430 | 3300050512 | nmdc:mga0n895_320_c1 | nmdc:mga0n895_320_c1_16235_17143 | 284 |
| 431 | 3300050513 | nmdc:mga0rr50_25073_c1 | nmdc:mga0rr50_25073_c1_1379_2287 | 284 |
| 432 | 3300050514 | nmdc:mga08x19_3141_c1 | nmdc:mga08x19_3141_c1_4826_5734 | 284 |
| 433 | 3300050515 | nmdc:mga0a205_5899_c1 | nmdc:mga0a205_5899_c1_4965_5873 | 284 |
| 434 | 3300053078 | Ga0495612_0118723 | Ga0495612_0118723_106_1014 | 284 |
| 435 | 3300053083 | Ga0495655_0052742 | Ga0495655_0052742_72_980 | 284 |
| 436 | 3300053088 | Ga0500644_0050462 | Ga0500644_0050462_229_1137 | 284 |
| 437 | 3300053095 | Ga0500640_044138 | Ga0500640_044138_249_1157 | 284 |
| 438 | 3300053100 | Ga0500660_028431 | Ga0500660_028431_1259_2170 | 284 |
| 439 | 3300053101 | Ga0500553_088478 | Ga0500553_088478_244_1155 | 284 |
| 440 | 3300053101 | Ga0500553_104864 | Ga0500553_104864_203_1111 | 284 |
| 441 | 3300053107 | Ga0500560_079931 | Ga0500560_079931_30_941 | 284 |
| 442 | 3300053113 | Ga0500580_089720 | Ga0500580_089720_58_969 | 284 |
| 443 | 3300061719 | Ga0466962_0021927 | Ga0466962_0021927_1888_2796 | 284 |
| 444 | 3300061719 | Ga0466962_0053549 | Ga0466962_0053549_816_1718 | 284 |
| 445 | iso_pu_bacteria | 2554235005 | 2554260022 | 284 |
| 446 | iso_pu_bacteria | 2582581313 | 2585309201 | 284 |
| 447 | iso_pu_bacteria | 2582581314 | 2585319810 | 284 |
| 448 | iso_pu_bacteria | 2643221548 | 2643759848 | 284 |
| 449 | iso_pu_bacteria | 2643221578 | 2643897991 | 284 |
| 450 | iso_pu_bacteria | 2643221587 | 2643944567 | 284 |
| 451 | iso_pu_bacteria | 2643221647 | 2644263217 | 284 |
| 452 | iso_pu_bacteria | 2643221670 | 2644385505 | 284 |
| 453 | iso_pu_bacteria | 2643221677 | 2644431465 | 284 |
| 454 | iso_pu_bacteria | 2643221678 | 2644436520 | 284 |
| 455 | iso_pu_bacteria | 2643221682 | 2644462733 | 284 |
| 456 | iso_pu_bacteria | 2643221714 | 2644625635 | 284 |
| 457 | iso_pu_bacteria | 2784746763 | 2785344158 | 284 |
| 458 | iso_pu_bacteria | 2784746768 | 2785368738 | 284 |
| 459 | iso_pu_bacteria | 2786546132 | 2786669845 | 284 |
| 460 | iso_pu_bacteria | 2791355406 | 2793978115 | 284 |
| 461 | iso_pu_bacteria | 2802429296 | 2804844991 | 284 |
| 462 | iso_pu_bacteria | 2808606359 | 2808841409 | 284 |
| 463 | iso_pu_bacteria | 2808606375 | 2808919975 | 284 |
| 464 | iso_pu_bacteria | 2818991463 | 2819693564 | 284 |
| 465 | iso_pu_bacteria | 2862281513 | 2862287978 | 284 |
| 466 | iso_pu_bacteria | 2862382967 | 2862383137 | 284 |
| 467 | iso_pu_bacteria | 2863404153 | 2863405414 | 284 |
| 468 | iso_pu_bacteria | 2867369537 | 2867371281 | 284 |
| 469 | iso_pu_bacteria | 2867428634 | 2867431481 | 284 |
| 470 | iso_pu_bacteria | 2867475112 | 2867480495 | 284 |
| 471 | iso_pu_bacteria | 2875391855 | 2875393889 | 284 |
| 472 | iso_pu_bacteria | 2877676314 | 2877681775 | 284 |
| 473 | iso_pu_bacteria | 2918501144 | 2918503938 | 284 |
| 474 | iso_pu_bacteria | 2919468124 | 2919468802 | 284 |
| 475 | iso_pu_bacteria | 2935390628 | 2935394594 | 284 |
| 476 | iso_pu_bacteria | 2946045630 | 2946050752 | 284 |
| 477 | iso_pu_bacteria | 2946072368 | 2946075342 | 284 |
| 478 | iso_pu_bacteria | 2954380949 | 2954386922 | 284 |
| 479 | iso_pu_bacteria | 2954673503 | 2954676274 | 284 |
| 480 | iso_pu_bacteria | 2954682443 | 2954687895 | 284 |
| 481 | iso_pu_bacteria | 2954691527 | 2954697734 | 284 |
| 482 | iso_pu_bacteria | 2954701450 | 2954704482 | 284 |
| 483 | iso_pu_bacteria | 2954711539 | 2954716863 | 284 |
| 484 | iso_pu_bacteria | 2954721474 | 2954726811 | 284 |
| 485 | iso_pu_bacteria | 2954731030 | 2954734984 | 284 |
| 486 | iso_pu_bacteria | 2954740390 | 2954745734 | 284 |
| 487 | iso_pu_bacteria | 2954749733 | 2954753856 | 284 |
| 488 | iso_pu_bacteria | 2954759201 | 2954764708 | 284 |
| 489 | iso_pu_bacteria | 2966598605 | 2966603190 | 284 |
| 490 | iso_pu_bacteria | 2990059506 | 2990065815 | 284 |
| 491 | iso_pu_bacteria | 2990088156 | 2990091159 | 284 |
| 492 | iso_pu_bacteria | 2997451912 | 2997456656 | 284 |
| 493 | iso_pu_bacteria | 2997600082 | 2997608068 | 284 |
| 494 | iso_pu_bacteria | 3006425503 | 3006426837 | 284 |
| 495 | iso_pu_bacteria | 3006486233 | 3006493698 | 284 |
| 496 | iso_pu_bacteria | 8008558824 | 8008559665 | 284 |
| 497 | iso_pu_bacteria | 8025413630 | 8025418953 | 284 |
| 498 | iso_pu_bacteria | 8047893842 | 8047898779 | 284 |
| 499 | iso_pu_bacteria | 8048127548 | 8048131568 | 284 |
| 500 | iso_pu_bacteria | 8048356638 | 8048360140 | 284 |
| 501 | iso_pu_bacteria | 8048369669 | 8048375739 | 284 |
| 502 | iso_pu_bacteria | 8048379754 | 8048382466 | 284 |
| 503 | iso_pu_bacteria | 8048406513 | 8048409334 | 284 |
| 504 | iso_pu_bacteria | 8054160619 | 8054162900 | 284 |
| 505 | iso_pu_bacteria | 8056667051 | 8056672425 | 284 |
| 506 | iso_pu_bacteria | 8056829672 | 8056830184 | 284 |
| 507 | 3300002077 | JGI24744J21845_10004246 | JGI24744J21845_100042462 | 285 |
| 508 | 3300002239 | JGI24034J26672_10010430 | JGI24034J26672_100104302 | 285 |
| 509 | 3300005328 | Ga0070676_10013125 | Ga0070676_100131253 | 285 |
| 510 | 3300005330 | Ga0070690_100118651 | Ga0070690_1001186512 | 285 |
| 511 | 3300005334 | Ga0068869_100463230 | Ga0068869_1004632301 | 285 |
| 512 | 3300005335 | Ga0070666_10329768 | Ga0070666_103297681 | 285 |
| 513 | 3300005337 | Ga0070682_100025193 | Ga0070682_1000251932 | 285 |
| 514 | 3300005337 | Ga0070682_100069467 | Ga0070682_1000694672 | 285 |
| 515 | 3300005337 | Ga0070682_100271185 | Ga0070682_1002711851 | 285 |
| 516 | 3300005338 | Ga0068868_100021572 | Ga0068868_1000215722 | 285 |
| 517 | 3300005339 | Ga0070660_100223742 | Ga0070660_1002237422 | 285 |
| 518 | 3300005340 | Ga0070689_100052755 | Ga0070689_1000527552 | 285 |
| 519 | 3300005347 | Ga0070668_100000258 | Ga0070668_10000025831 | 285 |
| 520 | 3300005347 | Ga0070668_100032029 | Ga0070668_1000320293 | 285 |
| 521 | 3300005347 | Ga0070668_100331507 | Ga0070668_1003315071 | 285 |
| 522 | 3300005353 | Ga0070669_100021773 | Ga0070669_1000217733 | 285 |
| 523 | 3300005355 | Ga0070671_100109400 | Ga0070671_1001094002 | 285 |
| 524 | 3300005356 | Ga0070674_100014431 | Ga0070674_1000144313 | 285 |
| 525 | 3300005364 | Ga0070673_100377266 | Ga0070673_1003772661 | 285 |
| 526 | 3300005365 | Ga0070688_100027997 | Ga0070688_1000279972 | 285 |
| 527 | 3300005366 | Ga0070659_100102195 | Ga0070659_1001021952 | 285 |
| 528 | 3300005366 | Ga0070659_100197470 | Ga0070659_1001974702 | 285 |
| 529 | 3300005366 | Ga0070659_100368251 | Ga0070659_1003682511 | 285 |
| 530 | 3300005367 | Ga0070667_100000077 | Ga0070667_10000007794 | 285 |
| 531 | 3300005367 | Ga0070667_100059707 | Ga0070667_1000597072 | 285 |
| 532 | 3300005367 | Ga0070667_100108548 | Ga0070667_1001085482 | 285 |
| 533 | 3300005435 | Ga0070714_100178474 | Ga0070714_1001784741 | 285 |
| 534 | 3300005437 | Ga0070710_10016525 | Ga0070710_100165252 | 285 |
| 535 | 3300005438 | Ga0070701_10001956 | Ga0070701_100019564 | 285 |
| 536 | 3300005439 | Ga0070711_100003805 | Ga0070711_1000038054 | 285 |
| 537 | 3300005441 | Ga0070700_100011281 | Ga0070700_1000112812 | 285 |
| 538 | 3300005455 | Ga0070663_100029769 | Ga0070663_1000297693 | 285 |
| 539 | 3300005455 | Ga0070663_100155109 | Ga0070663_1001551092 | 285 |
| 540 | 3300005456 | Ga0070678_100036168 | Ga0070678_1000361683 | 285 |
| 541 | 3300005456 | Ga0070678_100037113 | Ga0070678_1000371132 | 285 |
| 542 | 3300005456 | Ga0070678_100069532 | Ga0070678_1000695322 | 285 |
| 543 | 3300005457 | Ga0070662_100014744 | Ga0070662_1000147442 | 285 |
| 544 | 3300005459 | Ga0068867_100014648 | Ga0068867_1000146484 | 285 |
| 545 | 3300005466 | Ga0070685_10205411 | Ga0070685_102054111 | 285 |
| 546 | 3300005539 | Ga0068853_100035405 | Ga0068853_1000354053 | 285 |
| 547 | 3300005545 | Ga0070695_100071099 | Ga0070695_1000710992 | 285 |
| 548 | 3300005546 | Ga0070696_100014519 | Ga0070696_1000145193 | 285 |
| 549 | 3300005547 | Ga0070693_100014604 | Ga0070693_1000146044 | 285 |
| 550 | 3300005548 | Ga0070665_100007324 | Ga0070665_1000073248 | 285 |
| 551 | 3300005548 | Ga0070665_100030094 | Ga0070665_1000300942 | 285 |
| 552 | 3300005548 | Ga0070665_100041694 | Ga0070665_1000416944 | 285 |
| 553 | 3300005549 | Ga0070704_100032574 | Ga0070704_1000325742 | 285 |
| 554 | 3300005563 | Ga0068855_100244810 | Ga0068855_1002448101 | 285 |
| 555 | 3300005578 | Ga0068854_100015472 | Ga0068854_1000154724 | 285 |
| 556 | 3300005578 | Ga0068854_100237154 | Ga0068854_1002371542 | 285 |
| 557 | 3300005615 | Ga0070702_100014396 | Ga0070702_1000143962 | 285 |
| 558 | 3300005615 | Ga0070702_100111447 | Ga0070702_1001114472 | 285 |
| 559 | 3300005615 | Ga0070702_100265205 | Ga0070702_1002652052 | 285 |
| 560 | 3300005617 | Ga0068859_100000438 | Ga0068859_1000004386 | 285 |
| 561 | 3300005617 | Ga0068859_100042006 | Ga0068859_1000420064 | 285 |
| 562 | 3300005617 | Ga0068859_100117895 | Ga0068859_1001178952 | 285 |
| 563 | 3300005718 | Ga0068866_10005609 | Ga0068866_100056094 | 285 |
| 564 | 3300005719 | Ga0068861_100038820 | Ga0068861_1000388202 | 285 |
| 565 | 3300005719 | Ga0068861_100063709 | Ga0068861_1000637092 | 285 |
| 566 | 3300005841 | Ga0068863_100000777 | Ga0068863_10000077730 | 285 |
| 567 | 3300005841 | Ga0068863_100011776 | Ga0068863_1000117767 | 285 |
| 568 | 3300005841 | Ga0068863_100173859 | Ga0068863_1001738592 | 285 |
| 569 | 3300005842 | Ga0068858_100008639 | Ga0068858_1000086395 | 285 |
| 570 | 3300005842 | Ga0068858_100034036 | Ga0068858_1000340362 | 285 |
| 571 | 3300005843 | Ga0068860_100000010 | Ga0068860_100000010254 | 285 |
| 572 | 3300005843 | Ga0068860_100025586 | Ga0068860_1000255864 | 285 |
| 573 | 3300005843 | Ga0068860_100439666 | Ga0068860_1004396662 | 285 |
| 574 | 3300005844 | Ga0068862_100000008 | Ga0068862_10000000869 | 285 |
| 575 | 3300005844 | Ga0068862_100030155 | Ga0068862_1000301554 | 285 |
| 576 | 3300005937 | Ga0081455_10025168 | Ga0081455_100251683 | 285 |
| 577 | 3300005983 | Ga0081540_1043683 | Ga0081540_10436832 | 285 |
| 578 | 3300006038 | Ga0075365_10006361 | Ga0075365_100063614 | 285 |
| 579 | 3300006038 | Ga0075365_10197601 | Ga0075365_101976012 | 285 |
| 580 | 3300006048 | Ga0075363_100012279 | Ga0075363_1000122792 | 285 |
| 581 | 3300006048 | Ga0075363_100053836 | Ga0075363_1000538362 | 285 |
| 582 | 3300006051 | Ga0075364_10002441 | Ga0075364_100024417 | 285 |
| 583 | 3300006051 | Ga0075364_10024121 | Ga0075364_100241212 | 285 |
| 584 | 3300006173 | Ga0070716_100013793 | Ga0070716_1000137932 | 285 |
| 585 | 3300006175 | Ga0070712_100018992 | Ga0070712_1000189923 | 285 |
| 586 | 3300006186 | Ga0075369_10000277 | Ga0075369_100002772 | 285 |
| 587 | 3300006186 | Ga0075369_10012034 | Ga0075369_100120342 | 285 |
| 588 | 3300006237 | Ga0097621_100071607 | Ga0097621_1000716072 | 285 |
| 589 | 3300006353 | Ga0075370_10014632 | Ga0075370_100146324 | 285 |
| 590 | 3300006353 | Ga0075370_10271461 | Ga0075370_102714611 | 285 |
| 591 | 3300006358 | Ga0068871_100051699 | Ga0068871_1000516994 | 285 |
| 592 | 3300006844 | Ga0075428_100002077 | Ga0075428_10000207719 | 285 |
| 593 | 3300006846 | Ga0075430_100008157 | Ga0075430_1000081576 | 285 |
| 594 | 3300006847 | Ga0075431_100085932 | Ga0075431_1000859322 | 285 |
| 595 | 3300006881 | Ga0068865_100004289 | Ga0068865_1000042895 | 285 |
| 596 | 3300006931 | Ga0097620_100000438 | Ga0097620_1000004386 | 285 |
| 597 | 3300006931 | Ga0097620_100042004 | Ga0097620_1000420044 | 285 |
| 598 | 3300006931 | Ga0097620_100117893 | Ga0097620_1001178932 | 285 |
| 599 | 3300009092 | Ga0105250_10008787 | Ga0105250_100087872 | 285 |
| 600 | 3300009094 | Ga0111539_10294889 | Ga0111539_102948892 | 285 |
| 601 | 3300009098 | Ga0105245_10029615 | Ga0105245_100296153 | 285 |
| 602 | 3300009101 | Ga0105247_10004190 | Ga0105247_1000419010 | 285 |
| 603 | 3300009101 | Ga0105247_10086458 | Ga0105247_100864582 | 285 |
| 604 | 3300009147 | Ga0114129_10096472 | Ga0114129_100964722 | 285 |
| 605 | 3300009148 | Ga0105243_10017855 | Ga0105243_100178553 | 285 |
| 606 | 3300009176 | Ga0105242_10011766 | Ga0105242_100117662 | 285 |
| 607 | 3300009177 | Ga0105248_10000093 | Ga0105248_1000009362 | 285 |
| 608 | 3300009177 | Ga0105248_10016994 | Ga0105248_100169942 | 285 |
| 609 | 3300009177 | Ga0105248_10029565 | Ga0105248_100295653 | 285 |
| 610 | 3300009545 | Ga0105237_10064180 | Ga0105237_100641803 | 285 |
| 611 | 3300009551 | Ga0105238_10260762 | Ga0105238_102607622 | 285 |
| 612 | 3300009553 | Ga0105249_10000019 | Ga0105249_1000001967 | 285 |
| 613 | 3300009553 | Ga0105249_10028056 | Ga0105249_100280564 | 285 |
| 614 | 3300010375 | Ga0105239_10222177 | Ga0105239_102221772 | 285 |
| 615 | 3300010375 | Ga0105239_10369296 | Ga0105239_103692962 | 285 |
| 616 | 3300013297 | Ga0157378_10035989 | Ga0157378_100359892 | 285 |
| 617 | 3300013306 | Ga0163162_10009988 | Ga0163162_100099886 | 285 |
| 618 | 3300013306 | Ga0163162_10031792 | Ga0163162_100317924 | 285 |
| 619 | 3300013307 | Ga0157372_10044562 | Ga0157372_100445622 | 285 |
| 620 | 3300013308 | Ga0157375_10026309 | Ga0157375_100263094 | 285 |
| 621 | 3300014325 | Ga0163163_10205773 | Ga0163163_102057732 | 285 |
| 622 | 3300014326 | Ga0157380_10013449 | Ga0157380_100134494 | 285 |
| 623 | 3300014968 | Ga0157379_10026709 | Ga0157379_100267093 | 285 |
| 624 | 3300014969 | Ga0157376_10121431 | Ga0157376_101214311 | 285 |
| 625 | 3300017792 | Ga0163161_10018886 | Ga0163161_100188862 | 285 |
| 626 | 3300025898 | Ga0207692_10034037 | Ga0207692_100340371 | 285 |
| 627 | 3300025899 | Ga0207642_10001150 | Ga0207642_100011503 | 285 |
| 628 | 3300025900 | Ga0207710_10000036 | Ga0207710_1000003652 | 285 |
| 629 | 3300025900 | Ga0207710_10004865 | Ga0207710_100048653 | 285 |
| 630 | 3300025901 | Ga0207688_10009339 | Ga0207688_100093394 | 285 |
| 631 | 3300025901 | Ga0207688_10011084 | Ga0207688_100110844 | 285 |
| 632 | 3300025903 | Ga0207680_10028654 | Ga0207680_100286544 | 285 |
| 633 | 3300025907 | Ga0207645_10024618 | Ga0207645_100246184 | 285 |
| 634 | 3300025908 | Ga0207643_10123462 | Ga0207643_101234622 | 285 |
| 635 | 3300025914 | Ga0207671_10082828 | Ga0207671_100828282 | 285 |
| 636 | 3300025914 | Ga0207671_10161455 | Ga0207671_101614552 | 285 |
| 637 | 3300025915 | Ga0207693_10031555 | Ga0207693_100315554 | 285 |
| 638 | 3300025916 | Ga0207663_10008831 | Ga0207663_100088312 | 285 |
| 639 | 3300025918 | Ga0207662_10169293 | Ga0207662_101692932 | 285 |
| 640 | 3300025919 | Ga0207657_10217836 | Ga0207657_102178362 | 285 |
| 641 | 3300025923 | Ga0207681_10000911 | Ga0207681_1000091114 | 285 |
| 642 | 3300025926 | Ga0207659_10094965 | Ga0207659_100949652 | 285 |
| 643 | 3300025927 | Ga0207687_10022173 | Ga0207687_100221732 | 285 |
| 644 | 3300025929 | Ga0207664_10268312 | Ga0207664_102683122 | 285 |
| 645 | 3300025932 | Ga0207690_10024822 | Ga0207690_100248223 | 285 |
| 646 | 3300025933 | Ga0207706_10011561 | Ga0207706_100115614 | 285 |
| 647 | 3300025934 | Ga0207686_10014368 | Ga0207686_100143682 | 285 |
| 648 | 3300025935 | Ga0207709_10231279 | Ga0207709_102312792 | 285 |
| 649 | 3300025936 | Ga0207670_10319645 | Ga0207670_103196452 | 285 |
| 650 | 3300025937 | Ga0207669_10005203 | Ga0207669_100052034 | 285 |
| 651 | 3300025938 | Ga0207704_10003456 | Ga0207704_100034563 | 285 |
| 652 | 3300025939 | Ga0207665_10085837 | Ga0207665_100858372 | 285 |
| 653 | 3300025941 | Ga0207711_10000102 | Ga0207711_1000010221 | 285 |
| 654 | 3300025941 | Ga0207711_10053321 | Ga0207711_100533212 | 285 |
| 655 | 3300025942 | Ga0207689_10038617 | Ga0207689_100386174 | 285 |
| 656 | 3300025961 | Ga0207712_10000025 | Ga0207712_10000025184 | 285 |
| 657 | 3300025961 | Ga0207712_10030682 | Ga0207712_100306823 | 285 |
| 658 | 3300025972 | Ga0207668_10000858 | Ga0207668_100008589 | 285 |
| 659 | 3300025972 | Ga0207668_10012838 | Ga0207668_100128382 | 285 |
| 660 | 3300025981 | Ga0207640_10016612 | Ga0207640_100166122 | 285 |
| 661 | 3300025986 | Ga0207658_10000593 | Ga0207658_1000059317 | 285 |
| 662 | 3300025986 | Ga0207658_10018718 | Ga0207658_100187183 | 285 |
| 663 | 3300025986 | Ga0207658_10021481 | Ga0207658_100214814 | 285 |
| 664 | 3300025986 | Ga0207658_10063322 | Ga0207658_100633222 | 285 |
| 665 | 3300026023 | Ga0207677_10004981 | Ga0207677_100049815 | 285 |
| 666 | 3300026035 | Ga0207703_10034863 | Ga0207703_100348633 | 285 |
| 667 | 3300026035 | Ga0207703_10082270 | Ga0207703_100822703 | 285 |
| 668 | 3300026041 | Ga0207639_10005386 | Ga0207639_100053868 | 285 |
| 669 | 3300026041 | Ga0207639_10018925 | Ga0207639_100189252 | 285 |
| 670 | 3300026067 | Ga0207678_10007984 | Ga0207678_100079842 | 285 |
| 671 | 3300026075 | Ga0207708_10020348 | Ga0207708_100203482 | 285 |
| 672 | 3300026088 | Ga0207641_10010691 | Ga0207641_100106915 | 285 |
| 673 | 3300026089 | Ga0207648_10019145 | Ga0207648_100191454 | 285 |
| 674 | 3300026095 | Ga0207676_10261604 | Ga0207676_102616042 | 285 |
| 675 | 3300026095 | Ga0207676_10375334 | Ga0207676_103753342 | 285 |
| 676 | 3300026121 | Ga0207683_10022246 | Ga0207683_100222464 | 285 |
| 677 | 3300026121 | Ga0207683_10118424 | Ga0207683_101184243 | 285 |
| 678 | 3300026121 | Ga0207683_10214896 | Ga0207683_102148962 | 285 |
| 679 | 3300026142 | Ga0207698_10073838 | Ga0207698_100738383 | 285 |
| 680 | 3300026142 | Ga0207698_10308578 | Ga0207698_103085782 | 285 |
| 681 | 3300028379 | Ga0268266_10013583 | Ga0268266_100135832 | 285 |
| 682 | 3300028379 | Ga0268266_10034979 | Ga0268266_100349792 | 285 |
| 683 | 3300028379 | Ga0268266_10078584 | Ga0268266_100785842 | 285 |
| 684 | 3300028380 | Ga0268265_10000007 | Ga0268265_1000000767 | 285 |
| 685 | 3300028380 | Ga0268265_10013185 | Ga0268265_100131852 | 285 |
| 686 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007203 | 285 |
| 687 | 3300028381 | Ga0268264_10024292 | Ga0268264_100242923 | 285 |
| 688 | 3300028381 | Ga0268264_10258421 | Ga0268264_102584212 | 285 |
| 689 | 3300028381 | Ga0268264_10384548 | Ga0268264_103845482 | 285 |
| 690 | 3300031824 | Ga0307413_10094073 | Ga0307413_100940732 | 285 |
| 691 | 3300041410 | Ga0439461_0000622 | Ga0439461_0000622_3822_4727 | 285 |
| 692 | 3300041411 | Ga0439466_0010203 | Ga0439466_0010203_576_1481 | 285 |
| 693 | 3300041413 | Ga0439465_0004933 | Ga0439465_0004933_561_1463 | 285 |
| 694 | 3300041456 | Ga0451795_0177854 | Ga0451795_0177854_1993_2898 | 285 |
| 695 | 3300041997 | Ga0439431_0004964 | Ga0439431_0004964_251_1156 | 285 |
| 696 | 3300042435 | Ga0439434_0003247 | Ga0439434_0003247_2267_3172 | 285 |
| 697 | 3300042435 | Ga0439434_0045611 | Ga0439434_0045611_86_988 | 285 |
| 698 | 3300044658 | Ga0466972_0001755 | Ga0466972_0001755_9236_10141 | 285 |
| 699 | 3300044658 | Ga0466972_0020443 | Ga0466972_0020443_1041_1943 | 285 |
| 700 | 3300044683 | Ga0466965_0000502 | Ga0466965_0000502_1985_2890 | 285 |
| 701 | 3300044765 | Ga0466970_0005387 | Ga0466970_0005387_1966_2958 | 285 |
| 702 | 3300044765 | Ga0466970_0025003 | Ga0466970_0025003_350_1252 | 285 |
| 703 | 3300044765 | Ga0466970_0037802 | Ga0466970_0037802_573_1475 | 285 |
| 704 | 3300044765 | Ga0466970_0160682 | Ga0466970_0160682_290_1195 | 285 |
| 705 | 3300044842 | Ga0466957_0025969 | Ga0466957_0025969_1746_2648 | 285 |
| 706 | 3300044901 | Ga0466960_0090547 | Ga0466960_0090547_316_1275 | 285 |
| 707 | 3300045976 | Ga0466967_0061221 | Ga0466967_0061221_496_1401 | 285 |
| 708 | 3300046452 | Ga0495617_025457 | Ga0495617_025457_375_1304 | 285 |
| 709 | 3300046455 | Ga0495603_0033670 | Ga0495603_0033670_1663_2613 | 285 |
| 710 | 3300046459 | Ga0495629_0015172 | Ga0495629_0015172_1390_2340 | 285 |
| 711 | 3300046459 | Ga0495629_0136970 | Ga0495629_0136970_750_1679 | 285 |
| 712 | 3300046460 | Ga0495638_0008024 | Ga0495638_0008024_5491_6396 | 285 |
| 713 | 3300046460 | Ga0495638_0026620 | Ga0495638_0026620_2155_3084 | 285 |
| 714 | 3300046474 | Ga0495605_0003611 | Ga0495605_0003611_6084_7013 | 285 |
| 715 | 3300046477 | Ga0495664_0067571 | Ga0495664_0067571_1132_2061 | 285 |
| 716 | 3300046492 | Ga0495585_0088955 | Ga0495585_0088955_638_1588 | 285 |
| 717 | 3300046499 | Ga0495594_0024219 | Ga0495594_0024219_876_1826 | 285 |
| 718 | 3300046499 | Ga0495594_0148271 | Ga0495594_0148271_39_968 | 285 |
| 719 | 3300046501 | Ga0495607_0020887 | Ga0495607_0020887_1709_2638 | 285 |
| 720 | 3300046506 | Ga0495583_0020416 | Ga0495583_0020416_22_951 | 285 |
| 721 | 3300046506 | Ga0495583_0031590 | Ga0495583_0031590_431_1360 | 285 |
| 722 | 3300046506 | Ga0495583_0050471 | Ga0495583_0050471_101_1006 | 285 |
| 723 | 3300046507 | Ga0495606_0007016 | Ga0495606_0007016_2999_3928 | 285 |
| 724 | 3300046507 | Ga0495606_0029891 | Ga0495606_0029891_2210_3115 | 285 |
| 725 | 3300046512 | Ga0495610_0046548 | Ga0495610_0046548_390_1319 | 285 |
| 726 | 3300046513 | Ga0495616_0001426 | Ga0495616_0001426_14116_15045 | 285 |
| 727 | 3300046514 | Ga0495618_0059889 | Ga0495618_0059889_842_1771 | 285 |
| 728 | 3300046515 | Ga0495620_0001023 | Ga0495620_0001023_16121_17050 | 285 |
| 729 | 3300046515 | Ga0495620_0012144 | Ga0495620_0012144_899_1828 | 285 |
| 730 | 3300046522 | Ga0495643_0004195 | Ga0495643_0004195_365_1294 | 285 |
| 731 | 3300046524 | Ga0495648_0087811 | Ga0495648_0087811_150_1079 | 285 |
| 732 | 3300046524 | Ga0495648_0149596 | Ga0495648_0149596_144_1073 | 285 |
| 733 | 3300046530 | Ga0495654_0039660 | Ga0495654_0039660_1236_2165 | 285 |
| 734 | 3300046538 | Ga0495609_0012613 | Ga0495609_0012613_2306_3235 | 285 |
| 735 | 3300046542 | Ga0495597_0009742 | Ga0495597_0009742_1727_2656 | 285 |
| 736 | 3300046616 | Ga0495668_0029453 | Ga0495668_0029453_872_1801 | 285 |
| 737 | 3300046642 | Ga0495634_0084145 | Ga0495634_0084145_790_1719 | 285 |
| 738 | 3300046648 | Ga0495611_0076347 | Ga0495611_0076347_471_1388 | 285 |
| 739 | 3300046665 | Ga0495661_0049946 | Ga0495661_0049946_719_1648 | 285 |
| 740 | 3300046674 | Ga0495588_0003822 | Ga0495588_0003822_4929_5879 | 285 |
| 741 | 3300046680 | Ga0495646_0035636 | Ga0495646_0035636_1531_2460 | 285 |
| 742 | 3300046694 | Ga0495649_0058036 | Ga0495649_0058036_153_1082 | 285 |
| 743 | 3300046694 | Ga0495649_0130421 | Ga0495649_0130421_152_1081 | 285 |
| 744 | 3300046694 | Ga0495649_0167204 | Ga0495649_0167204_75_977 | 285 |
| 745 | 3300046794 | Ga0495589_0011982 | Ga0495589_0011982_1407_2336 | 285 |
| 746 | 3300047318 | Ga0495636_0067816 | Ga0495636_0067816_376_1305 | 285 |
| 747 | 3300047321 | Ga0495676_0015081 | Ga0495676_0015081_3486_4436 | 285 |
| 748 | 3300047321 | Ga0495676_0045065 | Ga0495676_0045065_2513_3442 | 285 |
| 749 | 3300047322 | Ga0495680_0012497 | Ga0495680_0012497_1154_2083 | 285 |
| 750 | 3300047443 | Ga0495687_065986 | Ga0495687_065986_391_1320 | 285 |
| 751 | 3300047444 | Ga0495675_0047407 | Ga0495675_0047407_535_1464 | 285 |
| 752 | 3300047447 | Ga0495685_007409 | Ga0495685_007409_1504_2433 | 285 |
| 753 | 3300047470 | Ga0495681_0048299 | Ga0495681_0048299_812_1741 | 285 |
| 754 | 3300047673 | Ga0495593_0204005 | Ga0495593_0204005_47_976 | 285 |
| 755 | 3300048903 | Ga0496100_0001703 | Ga0496100_0001703_4625_5530 | 285 |
| 756 | 3300048903 | Ga0496100_0006454 | Ga0496100_0006454_2763_3683 | 285 |
| 757 | 3300048903 | Ga0496100_0006878 | Ga0496100_0006878_1885_2811 | 285 |
| 758 | 3300048903 | Ga0496100_0028605 | Ga0496100_0028605_642_1544 | 285 |
| 759 | 3300048903 | Ga0496100_0046275 | Ga0496100_0046275_1306_2208 | 285 |
| 760 | 3300048903 | Ga0496100_0105229 | Ga0496100_0105229_448_1368 | 285 |
| 761 | 3300048903 | Ga0496100_0118346 | Ga0496100_0118346_129_1046 | 285 |
| 762 | 3300048904 | Ga0496101_0000030 | Ga0496101_0000030_47884_48804 | 285 |
| 763 | 3300048904 | Ga0496101_0001379 | Ga0496101_0001379_9208_10113 | 285 |
| 764 | 3300048904 | Ga0496101_0011975 | Ga0496101_0011975_1859_2761 | 285 |
| 765 | 3300048905 | Ga0496102_0000001 | Ga0496102_0000001_627712_628632 | 285 |
| 766 | 3300048905 | Ga0496102_0000112 | Ga0496102_0000112_20129_21055 | 285 |
| 767 | 3300048905 | Ga0496102_0017128 | Ga0496102_0017128_3972_4874 | 285 |
| 768 | 3300048905 | Ga0496102_0078104 | Ga0496102_0078104_1542_2459 | 285 |
| 769 | 3300048905 | Ga0496102_0079513 | Ga0496102_0079513_231_1133 | 285 |
| 770 | 3300048906 | Ga0496103_0000003 | Ga0496103_0000003_358774_359694 | 285 |
| 771 | 3300048906 | Ga0496103_0002476 | Ga0496103_0002476_7820_8722 | 285 |
| 772 | 3300048906 | Ga0496103_0129948 | Ga0496103_0129948_223_1140 | 285 |
| 773 | 3300048907 | Ga0496104_0217930 | Ga0496104_0217930_617_1534 | 285 |
| 774 | 3300048908 | Ga0496105_0038689 | Ga0496105_0038689_894_1799 | 285 |
| 775 | 3300048908 | Ga0496105_0065002 | Ga0496105_0065002_1982_2899 | 285 |
| 776 | 3300048909 | Ga0496106_0009358 | Ga0496106_0009358_349_1254 | 285 |
| 777 | 3300048909 | Ga0496106_0014688 | Ga0496106_0014688_2281_3201 | 285 |
| 778 | 3300048909 | Ga0496106_0021410 | Ga0496106_0021410_1311_2213 | 285 |
| 779 | 3300048910 | Ga0496107_0012120 | Ga0496107_0012120_151_1056 | 285 |
| 780 | 3300048910 | Ga0496107_0027547 | Ga0496107_0027547_2780_3700 | 285 |
| 781 | 3300048911 | Ga0496108_0000589 | Ga0496108_0000589_24639_25556 | 285 |
| 782 | 3300048911 | Ga0496108_0012853 | Ga0496108_0012853_5602_6507 | 285 |
| 783 | 3300048911 | Ga0496108_0175780 | Ga0496108_0175780_499_1404 | 285 |
| 784 | 3300048912 | Ga0496109_0004292 | Ga0496109_0004292_1295_2212 | 285 |
| 785 | 3300048912 | Ga0496109_0068561 | Ga0496109_0068561_526_1428 | 285 |
| 786 | 3300048912 | Ga0496109_0115824 | Ga0496109_0115824_313_1218 | 285 |
| 787 | 3300048912 | Ga0496109_0355675 | Ga0496109_0355675_403_1305 | 285 |
| 788 | 3300048915 | Ga0496112_0028927 | Ga0496112_0028927_3233_4135 | 285 |
| 789 | 3300048915 | Ga0496112_0057653 | Ga0496112_0057653_1530_2447 | 285 |
| 790 | 3300048915 | Ga0496112_0105055 | Ga0496112_0105055_1482_2402 | 285 |
| 791 | 3300048915 | Ga0496112_0112943 | Ga0496112_0112943_567_1472 | 285 |
| 792 | 3300048916 | Ga0496113_0021756 | Ga0496113_0021756_2314_3219 | 285 |
| 793 | 3300048916 | Ga0496113_0070881 | Ga0496113_0070881_563_1483 | 285 |
| 794 | 3300048917 | Ga0496114_0003564 | Ga0496114_0003564_865_1770 | 285 |
| 795 | 3300048917 | Ga0496114_0016475 | Ga0496114_0016475_2251_3153 | 285 |
| 796 | 3300048918 | Ga0496115_0004692 | Ga0496115_0004692_5548_6453 | 285 |
| 797 | 3300048918 | Ga0496115_0014973 | Ga0496115_0014973_2785_3687 | 285 |
| 798 | 3300048919 | Ga0496116_0000013 | Ga0496116_0000013_244300_245220 | 285 |
| 799 | 3300048919 | Ga0496116_0021964 | Ga0496116_0021964_1632_2537 | 285 |
| 800 | 3300048920 | Ga0496117_0000013 | Ga0496117_0000013_358774_359694 | 285 |
| 801 | 3300048920 | Ga0496117_0000719 | Ga0496117_0000719_17927_18853 | 285 |
| 802 | 3300048921 | Ga0496118_0000011 | Ga0496118_0000011_244302_245222 | 285 |
| 803 | 3300048921 | Ga0496118_0003063 | Ga0496118_0003063_7915_8841 | 285 |
| 804 | 3300048922 | Ga0496119_0000076 | Ga0496119_0000076_4591_5511 | 285 |
| 805 | 3300048922 | Ga0496119_0014589 | Ga0496119_0014589_4405_5331 | 285 |
| 806 | 3300048923 | Ga0496120_0001268 | Ga0496120_0001268_4445_5365 | 285 |
| 807 | 3300048923 | Ga0496120_0052426 | Ga0496120_0052426_494_1420 | 285 |
| 808 | 3300048924 | Ga0496121_0014867 | Ga0496121_0014867_3325_4251 | 285 |
| 809 | 3300048926 | Ga0496123_0029954 | Ga0496123_0029954_2321_3241 | 285 |
| 810 | 3300048927 | Ga0496124_0056202 | Ga0496124_0056202_1435_2361 | 285 |
| 811 | 3300048929 | Ga0496126_0002163 | Ga0496126_0002163_7016_7936 | 285 |
| 812 | 3300050490 | nmdc:mga03n38_10969_c1 | nmdc:mga03n38_10969_c1_2099_3004 | 285 |
| 813 | 3300050490 | nmdc:mga03n38_19000_c1 | nmdc:mga03n38_19000_c1_1063_1965 | 285 |
| 814 | 3300050491 | nmdc:mga00v17_14060_c1 | nmdc:mga00v17_14060_c1_1133_2035 | 285 |
| 815 | 3300050491 | nmdc:mga00v17_151372_c1 | nmdc:mga00v17_151372_c1_483_1388 | 285 |
| 816 | 3300050491 | nmdc:mga00v17_7507_c1 | nmdc:mga00v17_7507_c1_3695_4597 | 285 |
| 817 | 3300050492 | nmdc:mga0yw44_22077_c1 | nmdc:mga0yw44_22077_c1_1548_2450 | 285 |
| 818 | 3300050496 | nmdc:mga07m45_38352_c1 | nmdc:mga07m45_38352_c1_817_1719 | 285 |
| 819 | 3300050496 | nmdc:mga07m45_92094_c1 | nmdc:mga07m45_92094_c1_169_1071 | 285 |
| 820 | 3300050507 | nmdc:mga05p37_3169_c1 | nmdc:mga05p37_3169_c1_16389_17291 | 285 |
| 821 | 3300050509 | nmdc:mga0qj67_15554_c1 | nmdc:mga0qj67_15554_c1_537_1439 | 285 |
| 822 | 3300050516 | nmdc:mga0sz30_16128_c3 | nmdc:mga0sz30_16128_c3_36_938 | 285 |
| 823 | 3300050516 | nmdc:mga0sz30_3342_c1 | nmdc:mga0sz30_3342_c1_2698_3600 | 285 |
| 824 | 3300050516 | nmdc:mga0sz30_3484_c2 | nmdc:mga0sz30_3484_c2_2065_2967 | 285 |
| 825 | 3300050516 | nmdc:mga0sz30_483_c1 | nmdc:mga0sz30_483_c1_1198_2100 | 285 |
| 826 | 3300053079 | Ga0500610_0046814 | Ga0500610_0046814_983_1888 | 285 |
| 827 | 3300053153 | Ga0500616_0073659 | Ga0500616_0073659_21_926 | 285 |
| 828 | iso_pu_bacteria | 2616644814 | 2616697702 | 285 |
| 829 | iso_pu_bacteria | 2616644941 | 2616905574 | 285 |
| 830 | 3300003203 | JGI25406J46586_10002006 | JGI25406J46586_100020067 | 286 |
| 831 | 3300003373 | JGI25407J50210_10014559 | JGI25407J50210_100145591 | 286 |
| 832 | 3300005334 | Ga0068869_100058741 | Ga0068869_1000587412 | 286 |
| 833 | 3300005337 | Ga0070682_100089163 | Ga0070682_1000891633 | 286 |
| 834 | 3300005337 | Ga0070682_100172079 | Ga0070682_1001720791 | 286 |
| 835 | 3300005345 | Ga0070692_10086442 | Ga0070692_100864422 | 286 |
| 836 | 3300005347 | Ga0070668_100252826 | Ga0070668_1002528262 | 286 |
| 837 | 3300005353 | Ga0070669_100104510 | Ga0070669_1001045102 | 286 |
| 838 | 3300005441 | Ga0070700_100040024 | Ga0070700_1000400242 | 286 |
| 839 | 3300005459 | Ga0068867_100145593 | Ga0068867_1001455931 | 286 |
| 840 | 3300005539 | Ga0068853_100094468 | Ga0068853_1000944682 | 286 |
| 841 | 3300005578 | Ga0068854_100013941 | Ga0068854_1000139417 | 286 |
| 842 | 3300005718 | Ga0068866_10005802 | Ga0068866_100058022 | 286 |
| 843 | 3300005719 | Ga0068861_100139583 | Ga0068861_1001395832 | 286 |
| 844 | 3300005937 | Ga0081455_10032407 | Ga0081455_100324074 | 286 |
| 845 | 3300005937 | Ga0081455_10034638 | Ga0081455_100346384 | 286 |
| 846 | 3300005981 | Ga0081538_10000186 | Ga0081538_1000018653 | 286 |
| 847 | 3300005981 | Ga0081538_10096580 | Ga0081538_100965802 | 286 |
| 848 | 3300005985 | Ga0081539_10000208 | Ga0081539_1000020845 | 286 |
| 849 | 3300006058 | Ga0075432_10000861 | Ga0075432_100008615 | 286 |
| 850 | 3300006844 | Ga0075428_100011650 | Ga0075428_10001165011 | 286 |
| 851 | 3300006871 | Ga0075434_100000386 | Ga0075434_10000038616 | 286 |
| 852 | 3300006871 | Ga0075434_100001823 | Ga0075434_1000018233 | 286 |
| 853 | 3300006880 | Ga0075429_100044631 | Ga0075429_1000446313 | 286 |
| 854 | 3300006914 | Ga0075436_100000338 | Ga0075436_10000033813 | 286 |
| 855 | 3300007076 | Ga0075435_100002397 | Ga0075435_10000239710 | 286 |
| 856 | 3300007076 | Ga0075435_100002693 | Ga0075435_1000026937 | 286 |
| 857 | 3300009094 | Ga0111539_10072056 | Ga0111539_100720562 | 286 |
| 858 | 3300009098 | Ga0105245_10066600 | Ga0105245_100666004 | 286 |
| 859 | 3300009147 | Ga0114129_10037098 | Ga0114129_100370983 | 286 |
| 860 | 3300009148 | Ga0105243_10007430 | Ga0105243_100074306 | 286 |
| 861 | 3300009176 | Ga0105242_10057869 | Ga0105242_100578694 | 286 |
| 862 | 3300009551 | Ga0105238_10029299 | Ga0105238_100292993 | 286 |
| 863 | 3300009553 | Ga0105249_10036561 | Ga0105249_100365612 | 286 |
| 864 | 3300009553 | Ga0105249_10140623 | Ga0105249_101406232 | 286 |
| 865 | 3300010375 | Ga0105239_10050997 | Ga0105239_100509972 | 286 |
| 866 | 3300013105 | Ga0157369_10733294 | Ga0157369_107332941 | 286 |
| 867 | 3300013306 | Ga0163162_10092950 | Ga0163162_100929502 | 286 |
| 868 | 3300013307 | Ga0157372_10037234 | Ga0157372_100372347 | 286 |
| 869 | 3300013307 | Ga0157372_10316851 | Ga0157372_103168511 | 286 |
| 870 | 3300013307 | Ga0157372_10566810 | Ga0157372_105668102 | 286 |
| 871 | 3300017792 | Ga0163161_10034890 | Ga0163161_100348902 | 286 |
| 872 | 3300017792 | Ga0163161_10038680 | Ga0163161_100386802 | 286 |
| 873 | 3300025899 | Ga0207642_10003227 | Ga0207642_100032272 | 286 |
| 874 | 3300025901 | Ga0207688_10004821 | Ga0207688_100048214 | 286 |
| 875 | 3300025923 | Ga0207681_10113069 | Ga0207681_101130692 | 286 |
| 876 | 3300025927 | Ga0207687_10066500 | Ga0207687_100665002 | 286 |
| 877 | 3300025927 | Ga0207687_10132478 | Ga0207687_101324782 | 286 |
| 878 | 3300025933 | Ga0207706_10025627 | Ga0207706_100256276 | 286 |
| 879 | 3300025934 | Ga0207686_10157011 | Ga0207686_101570111 | 286 |
| 880 | 3300025935 | Ga0207709_10081196 | Ga0207709_100811962 | 286 |
| 881 | 3300025938 | Ga0207704_10017139 | Ga0207704_100171392 | 286 |
| 882 | 3300025961 | Ga0207712_10007451 | Ga0207712_100074517 | 286 |
| 883 | 3300025961 | Ga0207712_10015268 | Ga0207712_100152681 | 286 |
| 884 | 3300026118 | Ga0207675_100004805 | Ga0207675_1000048056 | 286 |
| 885 | 3300027907 | Ga0207428_10001237 | Ga0207428_1000123710 | 286 |
| 886 | 3300027907 | Ga0207428_10009580 | Ga0207428_100095808 | 286 |
| 887 | 3300028381 | Ga0268264_10252950 | Ga0268264_102529502 | 286 |
| 888 | 3300031548 | Ga0307408_100025439 | Ga0307408_1000254393 | 286 |
| 889 | 3300031731 | Ga0307405_10010297 | Ga0307405_100102975 | 286 |
| 890 | 3300031731 | Ga0307405_10011336 | Ga0307405_100113364 | 286 |
| 891 | 3300031731 | Ga0307405_10050903 | Ga0307405_100509032 | 286 |
| 892 | 3300031824 | Ga0307413_10006809 | Ga0307413_100068093 | 286 |
| 893 | 3300031824 | Ga0307413_10027077 | Ga0307413_100270773 | 286 |
| 894 | 3300031824 | Ga0307413_10133366 | Ga0307413_101333662 | 286 |
| 895 | 3300031852 | Ga0307410_10000186 | Ga0307410_100001865 | 286 |
| 896 | 3300031852 | Ga0307410_10006417 | Ga0307410_100064174 | 286 |
| 897 | 3300031852 | Ga0307410_10006476 | Ga0307410_100064764 | 286 |
| 898 | 3300031852 | Ga0307410_10014259 | Ga0307410_100142593 | 286 |
| 899 | 3300031901 | Ga0307406_10000071 | Ga0307406_1000007137 | 286 |
| 900 | 3300031901 | Ga0307406_10008812 | Ga0307406_100088125 | 286 |
| 901 | 3300031903 | Ga0307407_10004883 | Ga0307407_100048835 | 286 |
| 902 | 3300031903 | Ga0307407_10023459 | Ga0307407_100234592 | 286 |
| 903 | 3300031903 | Ga0307407_10240326 | Ga0307407_102403262 | 286 |
| 904 | 3300031911 | Ga0307412_10292644 | Ga0307412_102926442 | 286 |
| 905 | 3300031995 | Ga0307409_100000106 | Ga0307409_1000001067 | 286 |
| 906 | 3300031995 | Ga0307409_100002886 | Ga0307409_1000028864 | 286 |
| 907 | 3300031995 | Ga0307409_100003055 | Ga0307409_1000030555 | 286 |
| 908 | 3300031995 | Ga0307409_100029134 | Ga0307409_1000291343 | 286 |
| 909 | 3300032002 | Ga0307416_100000850 | Ga0307416_1000008502 | 286 |
| 910 | 3300032002 | Ga0307416_100017280 | Ga0307416_1000172802 | 286 |
| 911 | 3300032002 | Ga0307416_100049737 | Ga0307416_1000497372 | 286 |
| 912 | 3300032002 | Ga0307416_100176833 | Ga0307416_1001768332 | 286 |
| 913 | 3300032004 | Ga0307414_10010360 | Ga0307414_100103602 | 286 |
| 914 | 3300032004 | Ga0307414_10026408 | Ga0307414_100264082 | 286 |
| 915 | 3300032004 | Ga0307414_10081940 | Ga0307414_100819403 | 286 |
| 916 | 3300032004 | Ga0307414_10218668 | Ga0307414_102186682 | 286 |
| 917 | 3300032005 | Ga0307411_10011519 | Ga0307411_100115192 | 286 |
| 918 | 3300032005 | Ga0307411_10042548 | Ga0307411_100425482 | 286 |
| 919 | 3300032005 | Ga0307411_10098100 | Ga0307411_100981002 | 286 |
| 920 | 3300032126 | Ga0307415_100002560 | Ga0307415_1000025607 | 286 |
| 921 | 3300032126 | Ga0307415_100013305 | Ga0307415_1000133052 | 286 |
| 922 | 3300032126 | Ga0307415_100021903 | Ga0307415_1000219033 | 286 |
| 923 | 3300032126 | Ga0307415_100160352 | Ga0307415_1001603522 | 286 |
| 924 | 3300032126 | Ga0307415_100306451 | Ga0307415_1003064512 | 286 |
| 925 | 3300042012 | Ga0439455_0028684 | Ga0439455_0028684_302_1219 | 286 |
| 926 | 3300045976 | Ga0466967_0125089 | Ga0466967_0125089_982_1899 | 286 |
| 927 | 3300046615 | Ga0495656_0196795 | Ga0495656_0196795_57_974 | 286 |
| 928 | 3300048905 | Ga0496102_0626825 | Ga0496102_0626825_33_947 | 286 |
| 929 | 3300048911 | Ga0496108_0187444 | Ga0496108_0187444_544_1458 | 286 |
| 930 | 3300048912 | Ga0496109_0014192 | Ga0496109_0014192_5641_6564 | 286 |
| 931 | 3300048913 | Ga0496110_0189785 | Ga0496110_0189785_186_1109 | 286 |
| 932 | 3300048914 | Ga0496111_0056368 | Ga0496111_0056368_199_1113 | 286 |
| 933 | 3300048917 | Ga0496114_0160515 | Ga0496114_0160515_174_1088 | 286 |
| 934 | 3300048917 | Ga0496114_0208575 | Ga0496114_0208575_425_1348 | 286 |
| 935 | 3300049675 | Ga0501243_019330 | Ga0501243_019330_186_1100 | 286 |
| 936 | 3300050507 | nmdc:mga05p37_88589_c1 | nmdc:mga05p37_88589_c1_2876_3790 | 286 |
| 937 | 3300050508 | nmdc:mga09592_106048_c1 | nmdc:mga09592_106048_c1_95_1009 | 286 |
| 938 | 3300050512 | nmdc:mga0n895_46863_c1 | nmdc:mga0n895_46863_c1_2643_3557 | 286 |
| 939 | 3300050515 | nmdc:mga0a205_213796_c1 | nmdc:mga0a205_213796_c1_838_1752 | 286 |
| 940 | 3300053083 | Ga0495655_0012580 | Ga0495655_0012580_69_986 | 286 |
| 941 | iso_pu_bacteria | 2582581312 | 2585299880 | 286 |
| 942 | 3300003320 | rootH2_10002244 | rootH2_100022443 | 287 |
| 943 | 3300006048 | Ga0075363_100032995 | Ga0075363_1000329952 | 287 |
| 944 | 3300006051 | Ga0075364_10051528 | Ga0075364_100515282 | 287 |
| 945 | 3300006051 | Ga0075364_10105783 | Ga0075364_101057832 | 287 |
| 946 | 3300009094 | Ga0111539_10134313 | Ga0111539_101343132 | 287 |
| 947 | 3300027907 | Ga0207428_10102957 | Ga0207428_101029572 | 287 |
| 948 | 3300031852 | Ga0307410_10004749 | Ga0307410_100047493 | 287 |
| 949 | 3300031903 | Ga0307407_10089121 | Ga0307407_100891212 | 287 |
| 950 | 3300031995 | Ga0307409_100024232 | Ga0307409_1000242324 | 287 |
| 951 | 3300031995 | Ga0307409_100210805 | Ga0307409_1002108052 | 287 |
| 952 | 3300032004 | Ga0307414_10184653 | Ga0307414_101846532 | 287 |
| 953 | 3300032005 | Ga0307411_10009357 | Ga0307411_100093572 | 287 |
| 954 | 3300032126 | Ga0307415_100005844 | Ga0307415_1000058445 | 287 |
| 955 | 3300044658 | Ga0466972_0039617 | Ga0466972_0039617_1052_1978 | 287 |
| 956 | 3300044901 | Ga0466960_0000313 | Ga0466960_0000313_6901_7830 | 287 |
| 957 | 3300045976 | Ga0466967_0496111 | Ga0466967_0496111_181_1095 | 287 |
| 958 | 3300046455 | Ga0495603_0007354 | Ga0495603_0007354_1249_2211 | 287 |
| 959 | 3300046459 | Ga0495629_0001933 | Ga0495629_0001933_6352_7314 | 287 |
| 960 | 3300046689 | Ga0495613_0001211 | Ga0495613_0001211_960_1922 | 287 |
| 961 | 3300047321 | Ga0495676_0012589 | Ga0495676_0012589_5487_6449 | 287 |
| 962 | 3300048909 | Ga0496106_0021710 | Ga0496106_0021710_1172_2134 | 287 |
| 963 | 3300048909 | Ga0496106_0141029 | Ga0496106_0141029_24_944 | 287 |
| 964 | 3300049568 | Ga0501031_0021971 | Ga0501031_0021971_2770_3687 | 287 |
| 965 | 3300049569 | Ga0501032_0001487 | Ga0501032_0001487_13669_14589 | 287 |
| 966 | 3300049571 | Ga0501034_0016674 | Ga0501034_0016674_3244_4164 | 287 |
| 967 | 3300049572 | Ga0501036_0009792 | Ga0501036_0009792_4778_5695 | 287 |
| 968 | 3300049573 | Ga0501037_0000846 | Ga0501037_0000846_6974_7894 | 287 |
| 969 | 3300049574 | Ga0501038_0018635 | Ga0501038_0018635_2923_3843 | 287 |
| 970 | 3300049575 | Ga0501039_0004087 | Ga0501039_0004087_6689_7609 | 287 |
| 971 | 3300049575 | Ga0501039_0033422 | Ga0501039_0033422_3025_3942 | 287 |
| 972 | 3300049576 | Ga0501040_0025389 | Ga0501040_0025389_96_1013 | 287 |
| 973 | 3300049577 | Ga0501041_0011160 | Ga0501041_0011160_948_1865 | 287 |
| 974 | 3300049578 | Ga0501042_0022676 | Ga0501042_0022676_3084_4001 | 287 |
| 975 | 3300049579 | Ga0501043_0000710 | Ga0501043_0000710_23462_24382 | 287 |
| 976 | 3300049580 | Ga0501046_0013365 | Ga0501046_0013365_1701_2618 | 287 |
| 977 | 3300049584 | Ga0501068_0008717 | Ga0501068_0008717_2547_3464 | 287 |
| 978 | 3300049584 | Ga0501068_0135296 | Ga0501068_0135296_506_1426 | 287 |
| 979 | 3300049587 | Ga0501071_0008152 | Ga0501071_0008152_4893_5810 | 287 |
| 980 | 3300049588 | Ga0501072_0010719 | Ga0501072_0010719_3452_4369 | 287 |
| 981 | 3300049590 | Ga0501074_0031457 | Ga0501074_0031457_2647_3564 | 287 |
| 982 | 3300049592 | Ga0501076_0007496 | Ga0501076_0007496_3124_4041 | 287 |
| 983 | 3300049824 | Ga0501045_0020185 | Ga0501045_0020185_2971_3888 | 287 |
| 984 | 3300050491 | nmdc:mga00v17_16277_c1 | nmdc:mga00v17_16277_c1_2856_3776 | 287 |
| 985 | 3300050511 | nmdc:mga08y16_199381_c1 | nmdc:mga08y16_199381_c1_729_1649 | 287 |
| 986 | 3300054114 | Ga0501084_0010469 | Ga0501084_0010469_4126_5043 | 287 |
| 987 | 3300061734 | Ga0530510_0167183 | Ga0530510_0167183_537_1454 | 287 |
| 988 | 3300005337 | Ga0070682_100062857 | Ga0070682_1000628574 | 288 |
| 989 | 3300006178 | Ga0075367_10001716 | Ga0075367_1000171611 | 288 |
| 990 | 3300014745 | Ga0157377_10096844 | Ga0157377_100968441 | 288 |
| 991 | 3300030521 | Ga0307511_10002260 | Ga0307511_1000226014 | 288 |
| 992 | 3300031852 | Ga0307410_10373282 | Ga0307410_103732821 | 288 |
| 993 | 3300031901 | Ga0307406_10090558 | Ga0307406_100905582 | 288 |
| 994 | 3300031903 | Ga0307407_10051314 | Ga0307407_100513143 | 288 |
| 995 | 3300031903 | Ga0307407_10194601 | Ga0307407_101946011 | 288 |
| 996 | 3300032004 | Ga0307414_10020775 | Ga0307414_100207753 | 288 |
| 997 | 3300044693 | Ga0466961_0054195 | Ga0466961_0054195_1087_2067 | 288 |
| 998 | 3300044694 | Ga0466963_0057579 | Ga0466963_0057579_1384_2364 | 288 |
| 999 | 3300044719 | Ga0466971_0007148 | Ga0466971_0007148_2338_3318 | 288 |
| 1000 | 3300044842 | Ga0466957_0040330 | Ga0466957_0040330_1164_2144 | 288 |
| 1001 | 3300046539 | Ga0495621_0036286 | Ga0495621_0036286_276_1256 | 288 |
| 1002 | iso_pu_bacteria | 8054472261 | 8054477001 | 288 |
| 1003 | 3300005615 | Ga0070702_100121378 | Ga0070702_1001213782 | 289 |
| 1004 | 3300009101 | Ga0105247_10321876 | Ga0105247_103218761 | 289 |
| 1005 | 3300031901 | Ga0307406_10015056 | Ga0307406_100150564 | 289 |
| 1006 | 3300031901 | Ga0307406_10083025 | Ga0307406_100830252 | 289 |
| 1007 | 3300031903 | Ga0307407_10064946 | Ga0307407_100649462 | 289 |
| 1008 | 3300031995 | Ga0307409_100076346 | Ga0307409_1000763462 | 289 |
| 1009 | 3300031995 | Ga0307409_100280006 | Ga0307409_1002800062 | 289 |
| 1010 | 3300032002 | Ga0307416_100229361 | Ga0307416_1002293612 | 289 |
| 1011 | 3300032002 | Ga0307416_100443581 | Ga0307416_1004435811 | 289 |
| 1012 | 3300032004 | Ga0307414_10083907 | Ga0307414_100839072 | 289 |
| 1013 | 3300032126 | Ga0307415_100060321 | Ga0307415_1000603212 | 289 |
| 1014 | 3300044658 | Ga0466972_0057811 | Ga0466972_0057811_885_1838 | 289 |
| 1015 | 3300046543 | Ga0495645_0129952 | Ga0495645_0129952_641_1582 | 289 |
| 1016 | iso_pu_bacteria | 2622736605 | 2623497875 | 289 |
| 1017 | 3300001991 | JGI24743J22301_10005135 | JGI24743J22301_100051352 | 290 |
| 1018 | 3300002077 | JGI24744J21845_10001322 | JGI24744J21845_100013223 | 290 |
| 1019 | 3300005328 | Ga0070676_10199641 | Ga0070676_101996412 | 290 |
| 1020 | 3300005343 | Ga0070687_100091510 | Ga0070687_1000915102 | 290 |
| 1021 | 3300005365 | Ga0070688_100128638 | Ga0070688_1001286382 | 290 |
| 1022 | 3300005366 | Ga0070659_100063986 | Ga0070659_1000639863 | 290 |
| 1023 | 3300005437 | Ga0070710_10003297 | Ga0070710_1000329711 | 290 |
| 1024 | 3300005439 | Ga0070711_100013123 | Ga0070711_1000131234 | 290 |
| 1025 | 3300005444 | Ga0070694_100331705 | Ga0070694_1003317052 | 290 |
| 1026 | 3300005455 | Ga0070663_100141789 | Ga0070663_1001417893 | 290 |
| 1027 | 3300005546 | Ga0070696_100087772 | Ga0070696_1000877722 | 290 |
| 1028 | 3300005578 | Ga0068854_100291283 | Ga0068854_1002912832 | 290 |
| 1029 | 3300005718 | Ga0068866_10022932 | Ga0068866_100229322 | 290 |
| 1030 | 3300005841 | Ga0068863_100161053 | Ga0068863_1001610532 | 290 |
| 1031 | 3300005842 | Ga0068858_100100702 | Ga0068858_1001007023 | 290 |
| 1032 | 3300006163 | Ga0070715_10018460 | Ga0070715_100184602 | 290 |
| 1033 | 3300006175 | Ga0070712_100021410 | Ga0070712_1000214106 | 290 |
| 1034 | 3300006881 | Ga0068865_100056712 | Ga0068865_1000567124 | 290 |
| 1035 | 3300009177 | Ga0105248_10223629 | Ga0105248_102236293 | 290 |
| 1036 | 3300009545 | Ga0105237_10211240 | Ga0105237_102112402 | 290 |
| 1037 | 3300013297 | Ga0157378_10268423 | Ga0157378_102684232 | 290 |
| 1038 | 3300013308 | Ga0157375_10157551 | Ga0157375_101575513 | 290 |
| 1039 | 3300025901 | Ga0207688_10011102 | Ga0207688_100111023 | 290 |
| 1040 | 3300025914 | Ga0207671_10182227 | Ga0207671_101822272 | 290 |
| 1041 | 3300025915 | Ga0207693_10000907 | Ga0207693_1000090714 | 290 |
| 1042 | 3300025933 | Ga0207706_10009858 | Ga0207706_100098587 | 290 |
| 1043 | 3300025939 | Ga0207665_10015075 | Ga0207665_100150753 | 290 |
| 1044 | 3300025942 | Ga0207689_10119135 | Ga0207689_101191351 | 290 |
| 1045 | 3300025960 | Ga0207651_10037994 | Ga0207651_100379942 | 290 |
| 1046 | 3300025981 | Ga0207640_10209288 | Ga0207640_102092882 | 290 |
| 1047 | 3300026067 | Ga0207678_10008236 | Ga0207678_100082364 | 290 |
| 1048 | 3300026089 | Ga0207648_10050267 | Ga0207648_100502674 | 290 |
| 1049 | 3300026118 | Ga0207675_100017465 | Ga0207675_1000174654 | 290 |
| 1050 | 3300026121 | Ga0207683_10002324 | Ga0207683_1000232413 | 290 |
| 1051 | 3300026142 | Ga0207698_10326190 | Ga0207698_103261903 | 290 |
| 1052 | 3300035088 | Ga0373940_0037846 | Ga0373940_0037846_97_1011 | 290 |
| 1053 | 3300035691 | Ga0373931_0039646 | Ga0373931_0039646_1478_2392 | 290 |
| 1054 | 3300048904 | Ga0496101_0072796 | Ga0496101_0072796_1387_2301 | 290 |
| 1055 | 3300048907 | Ga0496104_0141043 | Ga0496104_0141043_992_1906 | 290 |
| 1056 | 3300048910 | Ga0496107_0100178 | Ga0496107_0100178_944_1858 | 290 |
| 1057 | 3300048912 | Ga0496109_0007158 | Ga0496109_0007158_2661_3575 | 290 |
| 1058 | 3300048913 | Ga0496110_0256744 | Ga0496110_0256744_23_937 | 290 |
| 1059 | 3300048915 | Ga0496112_0213834 | Ga0496112_0213834_853_1767 | 290 |
| 1060 | 3300048916 | Ga0496113_0043182 | Ga0496113_0043182_928_1842 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cny-assembly2.cif.gz_B | crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution | 0.8295 | 3 | 277 |
| 3cny-assembly2.cif.gz_B | crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution | 0.7905 | 3 | 277 |
| 3wqo-assembly1.cif.gz_B | crystal structure of d-tagatose 3-epimerase-like protein | 0.7164 | 8 | 282 |
| 3cqh-assembly1.cif.gz_B | crystal structure of l-xylulose-5-phosphate 3-epimerase ulae from the anaerobic l-ascorbate utilization pathway of escherichia coli | 0.7152 | 8 | 283 |
| 3cqj-assembly1.cif.gz_B | crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ | 0.7135 | 7 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cnyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.834 | 3 | 277 | 3.20.20.150 |
| 3cnyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7947 | 3 | 277 | 3.20.20.150 |
| 3lmzA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.729 | 1 | 286 | 3.20.20.150 |
| af_P45541_1_270_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7169 | 8 | 281 | 3.20.20.150 |
| af_P45541_1_270_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7098 | 8 | 281 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8MRC4-F1-model_v4 | deleted | 0.9787 | 8 | 75 |
|
| AF-A0A7Y5NMG5-F1-model_v4 | TIM barrel protein | 0.9769 | 165 | 286 |
|
| AF-A0A6P0QQ53-F1-model_v4 | deleted | 0.9768 | 166 | 284 |
|
| AF-A0A7Y5T6H7-F1-model_v4 | TIM barrel protein | 0.9758 | 1 | 289 |
|
| AF-A0A7K3H676-F1-model_v4 | TIM barrel protein | 0.9746 | 4 | 285 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar