F489273

General Info

Members Datasets Scaffolds Average Seq Length
1060 518 920 301

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10083025|Ga0307406_100830252
Length 331
Sequence MTAQHSAAPGQDTREPGRARIRVGSAPDSWGVWFPDDPEQVPWQRFLDEVSACGYEWIELGPYGYLPTDPAQLSDELAARSLRVSAGTVFEHLHRPNSWDAVWRQVDDVAALTQAVGGTHVVVIPDTFRDQKTGSDVESRELTAEQWQAKTSGVDRLARAIREEYGLSIAYHPHAESHVGWQRDIERFLADTDPALVPLCLDTGHVSYYRGDNLDLIRRYPERIGYLHLKQVDPAVIDEVLEKDVTWPDAVRMNAFVEPPNGVPAYPPLFEAIEELGLDVFAIVEQDMYPCPPDQPFPIAQRTHRHIASCQLPSLQIGAPTTRATGSEVQA

Samples

Sample ID Description Type Environment
1 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
2 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
3 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
4 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
5 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
6 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
7 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
8 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
9 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
10 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
11 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
12 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
13 2643221548 Streptomyces sp. Root55 Isolate Unclassified
14 2643221578 Streptomyces sp. Root63 Isolate Unclassified
15 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
16 2643221607 Rhizobium sp. Root73 Isolate Unclassified
17 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
18 2643221647 Streptomyces sp. Root369 Isolate Unclassified
19 2643221670 Streptomyces sp. Root431 Isolate Unclassified
20 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
21 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
22 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
23 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
24 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
25 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
26 2643221714 Streptomyces sp. Root264 Isolate Unclassified
27 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
28 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
29 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
30 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
31 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
32 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
33 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
34 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
35 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
36 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
37 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
38 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
39 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
40 2808606448 Streptomyces sp. 193411 Isolate Unclassified
41 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
42 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
43 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
44 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
45 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
46 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
47 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
48 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
49 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
50 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
51 2862574272 Streptomyces sp. AcE210 Isolate Nodule
52 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
53 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
54 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
55 2867369537 Streptomyces sp. Z26 Isolate Unclassified
56 2867428634 Streptomyces sp. RP5T Isolate Unclassified
57 2867475112 Streptomyces sp. TM32 Isolate Unclassified
58 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
59 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
60 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
61 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
62 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
63 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
64 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
65 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
66 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
67 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
68 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
69 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
70 2922554459 Rhodococcus sp. 66b Isolate Unclassified
71 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
72 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
73 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
74 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
75 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
76 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
77 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
78 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
79 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
80 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
81 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
82 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
83 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
84 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
85 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
86 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
87 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
88 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
89 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
90 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
91 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
92 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
93 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
94 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
95 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
96 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
97 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
98 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
99 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
100 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
101 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
102 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
103 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
104 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
106 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
107 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
108 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
109 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
111 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
112 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
113 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
114 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
115 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
116 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
117 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
118 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
119 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
120 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
121 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
122 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
123 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
124 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
125 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
126 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
127 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
128 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
129 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
130 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
131 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
132 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
133 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
134 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
135 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
136 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
137 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
138 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
139 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
140 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
141 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
142 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
143 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
144 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
145 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
146 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
147 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
148 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
149 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
150 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
151 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
152 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
153 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
154 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
155 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
156 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
157 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
158 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
159 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
160 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
161 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
162 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
163 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
164 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
165 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
166 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
167 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
168 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
169 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
170 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
171 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
172 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
173 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
174 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
175 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
176 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
177 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
178 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
179 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
180 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
181 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
182 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
184 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
185 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
186 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
193 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
194 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
195 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
196 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
197 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
198 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
199 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
202 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
203 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
204 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
205 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
206 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
207 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
208 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
209 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
210 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
211 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
212 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
213 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
214 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
215 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
216 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
217 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
218 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
219 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
266 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
271 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
272 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
273 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
274 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
275 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
276 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
277 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
278 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
279 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
280 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
281 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
282 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
283 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
284 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
285 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
286 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
287 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
288 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
289 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
290 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
291 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
292 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
293 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
294 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
295 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
302 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
303 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
304 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
305 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
306 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
307 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
308 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
309 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
310 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
311 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
312 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
313 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
314 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
315 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
316 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
317 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
318 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
319 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
320 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
321 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
322 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
323 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
324 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
325 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
336 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
337 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
338 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
339 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
340 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
341 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
344 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
345 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
346 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
347 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
348 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
349 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
350 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
351 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
352 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
353 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
354 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
355 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
363 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
370 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
371 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
375 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
376 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
377 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
378 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
379 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
380 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
381 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
382 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
389 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
390 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
391 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
395 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
396 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
397 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
398 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
399 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
400 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
401 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
402 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
403 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
404 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
405 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
411 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
416 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
417 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
418 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
419 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
420 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
421 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
422 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
423 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
424 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
425 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
426 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
429 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
434 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
435 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
436 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
437 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
455 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
456 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
457 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
458 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
459 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
460 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
461 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
462 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
463 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
464 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
468 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
469 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
470 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
476 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
477 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
480 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
481 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
484 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
485 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
486 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
487 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
488 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
489 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
490 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
491 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
492 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
493 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
494 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
495 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
496 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
497 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
498 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
501 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
502 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
503 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
504 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
505 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
506 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
507 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
508 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
509 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
510 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
511 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
512 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
513 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
514 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
515 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
516 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
517 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
518 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.79
Metatranscriptomes 0
Isolates 13.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 6.7
Nodule 0.57
Rhizoplane 6.42
Rhizosphere 75.94
Stem 0
Stem Tuber 0
Unclassified 10.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10005135 3300001991 Bacteria 2171
2 JGI24738J21930_10012736 3300002075 Bacteria 1833
3 JGI24744J21845_10001322 3300002077 Bacteria 4893
4 JGI24744J21845_10004246 3300002077 Bacteria 2957
5 JGI24034J26672_10010430 3300002239 Bacteria 1380
6 JGI25406J46586_10002006 3300003203 Bacteria 9620
7 rootH1_10030847 3300003316 Bacteria 1884
8 rootH1_10039924 3300003316 Bacteria 6529
9 rootH2_10002244 3300003320 Bacteria 2298
10 rootH2_10015356 3300003320 Bacteria 7338
11 JGI25160J50197_1007423 3300003354 Bacteria 4290
12 JGI25160J50197_1019006 3300003354 Bacteria 2122
13 JGI25407J50210_10014559 3300003373 Bacteria 2027
14 JGI25404J52841_10001019 3300003659 Bacteria 4630
15 Ga0070676_10013125 3300005328 Bacteria 4538
16 Ga0070676_10199641 3300005328 Bacteria 1310
17 Ga0070690_100118651 3300005330 Bacteria 1774
18 Ga0068869_100058741 3300005334 Bacteria 2814
19 Ga0068869_100463230 3300005334 Bacteria 1053
20 Ga0070666_10329768 3300005335 Bacteria 1090
21 Ga0070682_100023784 3300005337 Bacteria 3640
22 Ga0070682_100025193 3300005337 Bacteria 3548
23 Ga0070682_100062857 3300005337 Bacteria 2352
24 Ga0070682_100069467 3300005337 Bacteria 2249
25 Ga0070682_100089163 3300005337 Bacteria 2014
26 Ga0070682_100172079 3300005337 Bacteria 1506
27 Ga0070682_100271185 3300005337 Bacteria 1233
28 Ga0068868_100021572 3300005338 Bacteria 4851
29 Ga0070660_100223742 3300005339 Bacteria 1530
30 Ga0070689_100052755 3300005340 Bacteria 3146
31 Ga0070687_100091510 3300005343 Bacteria 1684
32 Ga0070692_10086442 3300005345 Bacteria 1697
33 Ga0070668_100000258 3300005347 Bacteria 35205
34 Ga0070668_100032029 3300005347 Bacteria 4000
35 Ga0070668_100252826 3300005347 Bacteria 1463
36 Ga0070668_100331507 3300005347 Bacteria 1283
37 Ga0070669_100021773 3300005353 Bacteria 4584
38 Ga0070669_100104510 3300005353 Bacteria 2141
39 Ga0070671_100109400 3300005355 Bacteria 2321
40 Ga0070674_100014431 3300005356 Bacteria 4912
41 Ga0070673_100377266 3300005364 Bacteria 1264
42 Ga0070688_100027997 3300005365 Bacteria 3359
43 Ga0070688_100128638 3300005365 Bacteria 1705
44 Ga0070659_100063986 3300005366 Bacteria 2910
45 Ga0070659_100102195 3300005366 Bacteria 2307
46 Ga0070659_100197470 3300005366 Bacteria 1655
47 Ga0070659_100368251 3300005366 Bacteria 1208
48 Ga0070667_100000077 3300005367 Bacteria 120245
49 Ga0070667_100059707 3300005367 Bacteria 3226
50 Ga0070667_100108548 3300005367 Bacteria 2404
51 Ga0070714_100178474 3300005435 Bacteria 1931
52 Ga0070710_10003297 3300005437 Bacteria 7650
53 Ga0070710_10016525 3300005437 Bacteria 3758
54 Ga0070701_10001956 3300005438 Bacteria 7804
55 Ga0070711_100003805 3300005439 Bacteria 8861
56 Ga0070711_100013123 3300005439 Bacteria 5196
57 Ga0070700_100011281 3300005441 Bacteria 4946
58 Ga0070700_100040024 3300005441 Bacteria 2867
59 Ga0070700_100040381 3300005441 Bacteria 2856
60 Ga0070694_100331705 3300005444 Bacteria 1174
61 Ga0070708_100136177 3300005445 Bacteria 2275
62 Ga0070663_100029769 3300005455 Bacteria 3735
63 Ga0070663_100141789 3300005455 Bacteria 1835
64 Ga0070663_100155109 3300005455 Bacteria 1759
65 Ga0070678_100036168 3300005456 Bacteria 3454
66 Ga0070678_100037113 3300005456 Bacteria 3418
67 Ga0070678_100069532 3300005456 Bacteria 2629
68 Ga0070662_100014744 3300005457 Bacteria 5223
69 Ga0068867_100014648 3300005459 Bacteria 5557
70 Ga0068867_100145593 3300005459 Bacteria 1856
71 Ga0070685_10031004 3300005466 Bacteria 2983
72 Ga0070685_10205411 3300005466 Bacteria 1283
73 Ga0070706_100491982 3300005467 Unclassified 1141
74 Ga0068853_100035405 3300005539 Bacteria 4240
75 Ga0068853_100094468 3300005539 Bacteria 2635
76 Ga0068853_100107742 3300005539 Bacteria 2471
77 Ga0070695_100071099 3300005545 Bacteria 2278
78 Ga0070696_100014519 3300005546 Bacteria 5285
79 Ga0070696_100087772 3300005546 Bacteria 2209
80 Ga0070693_100014604 3300005547 Bacteria 4027
81 Ga0070665_100007324 3300005548 Bacteria 11225
82 Ga0070665_100030094 3300005548 Bacteria 5464
83 Ga0070665_100041694 3300005548 Bacteria 4615
84 Ga0070704_100032574 3300005549 Bacteria 3517
85 Ga0068855_100244810 3300005563 Bacteria 2002
86 Ga0068854_100013941 3300005578 Bacteria 5288
87 Ga0068854_100015472 3300005578 Bacteria 5055
88 Ga0068854_100237154 3300005578 Bacteria 1451
89 Ga0068854_100291283 3300005578 Bacteria 1317
90 Ga0068856_100128145 3300005614 Bacteria 2541
91 Ga0070702_100014396 3300005615 Bacteria 4012
92 Ga0070702_100107025 3300005615 Bacteria 1726
93 Ga0070702_100111447 3300005615 Bacteria 1697
94 Ga0070702_100121378 3300005615 Bacteria 1637
95 Ga0070702_100265205 3300005615 Bacteria 1171
96 Ga0068859_100000438 3300005617 Bacteria 41832
97 Ga0068859_100042006 3300005617 Bacteria 4592
98 Ga0068859_100117895 3300005617 Bacteria 2720
99 Ga0068859_100248357 3300005617 Bacteria 1869
100 Ga0068866_10005609 3300005718 Bacteria 5194
101 Ga0068866_10005802 3300005718 Bacteria 5123
102 Ga0068866_10022932 3300005718 Bacteria 2896
103 Ga0068861_100038820 3300005719 Bacteria 3550
104 Ga0068861_100063709 3300005719 Bacteria 2834
105 Ga0068861_100139583 3300005719 Bacteria 1977
106 Ga0068863_100000777 3300005841 Bacteria 32074
107 Ga0068863_100011776 3300005841 Bacteria 8454
108 Ga0068863_100161053 3300005841 Bacteria 2150
109 Ga0068863_100173859 3300005841 Bacteria 2066
110 Ga0068858_100008639 3300005842 Bacteria 9781
111 Ga0068858_100034036 3300005842 Bacteria 4726
112 Ga0068858_100100702 3300005842 Bacteria 2694
113 Ga0068860_100000010 3300005843 Bacteria 359114
114 Ga0068860_100025586 3300005843 Bacteria 5692
115 Ga0068860_100439666 3300005843 Bacteria 1295
116 Ga0068862_100000008 3300005844 Bacteria 305510
117 Ga0068862_100030155 3300005844 Bacteria 4570
118 Ga0081455_10025168 3300005937 Bacteria 5498
119 Ga0081455_10032407 3300005937 Bacteria 4708
120 Ga0081455_10034638 3300005937 Bacteria 4522
121 Ga0081455_10067116 3300005937 Bacteria 2991
122 Ga0081455_10093426 3300005937 Bacteria 2432
123 Ga0081538_10000186 3300005981 Bacteria 68308
124 Ga0081538_10096580 3300005981 Bacteria 1505
125 Ga0081540_1001044 3300005983 Bacteria 24757
126 Ga0081540_1043683 3300005983 Bacteria 2295
127 Ga0081539_10000208 3300005985 Bacteria 136941
128 Ga0081539_10003746 3300005985 Bacteria 18071
129 Ga0075365_10006361 3300006038 Bacteria 6491
130 Ga0075365_10088968 3300006038 Bacteria 2102
131 Ga0075365_10197601 3300006038 Bacteria 1408
132 Ga0075368_10030260 3300006042 Bacteria 2096
133 Ga0075368_10035580 3300006042 Bacteria 1944
134 Ga0075363_100008072 3300006048 Bacteria 4882
135 Ga0075363_100012279 3300006048 Bacteria 4125
136 Ga0075363_100020295 3300006048 Bacteria 3331
137 Ga0075363_100032995 3300006048 Bacteria 2693
138 Ga0075363_100053836 3300006048 Bacteria 2151
139 Ga0075364_10002441 3300006051 Bacteria 10412
140 Ga0075364_10024121 3300006051 Bacteria 3858
141 Ga0075364_10051528 3300006051 Bacteria 2688
142 Ga0075364_10105783 3300006051 Bacteria 1875
143 Ga0075364_10309002 3300006051 Bacteria 1077
144 Ga0075432_10000861 3300006058 Bacteria 9564
145 Ga0075432_10013820 3300006058 Bacteria 2746
146 Ga0070715_10018460 3300006163 Bacteria 2658
147 Ga0070716_100013793 3300006173 Bacteria 4126
148 Ga0070712_100018992 3300006175 Bacteria 4474
149 Ga0070712_100021410 3300006175 Bacteria 4247
150 Ga0075367_10001716 3300006178 Bacteria 9597
151 Ga0075367_10024385 3300006178 Bacteria 3411
152 Ga0075367_10056257 3300006178 Bacteria 2336
153 Ga0075369_10000277 3300006186 Bacteria 15336
154 Ga0075369_10012034 3300006186 Bacteria 3413
155 Ga0097621_100071607 3300006237 Bacteria 2865
156 Ga0075370_10014632 3300006353 Bacteria 4189
157 Ga0075370_10017296 3300006353 Bacteria 3894
158 Ga0075370_10271461 3300006353 Bacteria 1007
159 Ga0068871_100051699 3300006358 Bacteria 3327
160 Ga0075428_100002077 3300006844 Bacteria 21610
161 Ga0075428_100011650 3300006844 Bacteria 9785
162 Ga0075428_100198703 3300006844 Bacteria 2168
163 Ga0075430_100008157 3300006846 Bacteria 8851
164 Ga0075431_100085932 3300006847 Bacteria 3247
165 Ga0075431_100661636 3300006847 Bacteria 1024
166 Ga0075434_100000386 3300006871 Bacteria 32198
167 Ga0075434_100001823 3300006871 Bacteria 18395
168 Ga0075429_100044631 3300006880 Bacteria 3855
169 Ga0068865_100004289 3300006881 Bacteria 8606
170 Ga0068865_100056712 3300006881 Bacteria 2730
171 Ga0075436_100000338 3300006914 Bacteria 29991
172 Ga0097620_100000438 3300006931 Bacteria 41832
173 Ga0097620_100042004 3300006931 Bacteria 4592
174 Ga0097620_100117893 3300006931 Bacteria 2720
175 Ga0097620_100248356 3300006931 Bacteria 1869
176 Ga0099826_10054431 3300006948 Bacteria 2656
177 Ga0099826_10060166 3300006948 Bacteria 2477
178 Ga0075435_100002397 3300007076 Bacteria 12431
179 Ga0075435_100002693 3300007076 Bacteria 11865
180 Ga0105244_10041691 3300009036 Bacteria 2378
181 Ga0105250_10008787 3300009092 Bacteria 4279
182 Ga0111539_10001835 3300009094 Bacteria 28239
183 Ga0111539_10072056 3300009094 Bacteria 4075
184 Ga0111539_10134313 3300009094 Bacteria 2897
185 Ga0111539_10294889 3300009094 Bacteria 1887
186 Ga0105245_10029615 3300009098 Bacteria 4838
187 Ga0105245_10066600 3300009098 Bacteria 3260
188 Ga0105245_10223280 3300009098 Bacteria 1819
189 Ga0105247_10004190 3300009101 Bacteria 9253
190 Ga0105247_10086458 3300009101 Bacteria 1984
191 Ga0105247_10321876 3300009101 Bacteria 1079
192 Ga0114129_10037098 3300009147 Bacteria 6881
193 Ga0114129_10096472 3300009147 Bacteria 4093
194 Ga0114129_10777883 3300009147 Bacteria 1223
195 Ga0105243_10007430 3300009148 Bacteria 8420
196 Ga0105243_10017855 3300009148 Bacteria 5366
197 Ga0105243_10023025 3300009148 Bacteria 4738
198 Ga0105243_10053826 3300009148 Bacteria 3193
199 Ga0105242_10011766 3300009176 Bacteria 6733
200 Ga0105242_10057869 3300009176 Bacteria 3176
201 Ga0105248_10000093 3300009177 Bacteria 98669
202 Ga0105248_10016994 3300009177 Bacteria 8013
203 Ga0105248_10029565 3300009177 Bacteria 6113
204 Ga0105248_10223629 3300009177 Bacteria 2119
205 Ga0105237_10064180 3300009545 Bacteria 3669
206 Ga0105237_10079500 3300009545 Bacteria 3269
207 Ga0105237_10211240 3300009545 Bacteria 1941
208 Ga0105238_10029299 3300009551 Bacteria 5608
209 Ga0105238_10260762 3300009551 Bacteria 1712
210 Ga0105249_10000019 3300009553 Bacteria 273807
211 Ga0105249_10028056 3300009553 Bacteria 5081
212 Ga0105249_10036561 3300009553 Bacteria 4455
213 Ga0105249_10140623 3300009553 Bacteria 2314
214 Ga0105033_105012 3300009986 Bacteria 1134
215 Ga0105239_10050997 3300010375 Bacteria 4537
216 Ga0105239_10222177 3300010375 Bacteria 2118
217 Ga0105239_10369296 3300010375 Bacteria 1621
218 Ga0105246_10002782 3300011119 Bacteria 10593
219 Ga0105246_10082859 3300011119 Bacteria 2290
220 Ga0105246_10126553 3300011119 Bacteria 1902
221 Ga0105246_10261548 3300011119 Bacteria 1379
222 Ga0157369_10521648 3300013105 Bacteria 1229
223 Ga0157369_10733294 3300013105 Bacteria 1017
224 Ga0157374_10012755 3300013296 Bacteria 7323
225 Ga0157378_10035989 3300013297 Bacteria 4381
226 Ga0157378_10053432 3300013297 Bacteria 3596
227 Ga0157378_10268423 3300013297 Bacteria 1640
228 Ga0163162_10009988 3300013306 Bacteria 9231
229 Ga0163162_10031792 3300013306 Bacteria 5237
230 Ga0163162_10092950 3300013306 Bacteria 3101
231 Ga0157372_10037234 3300013307 Bacteria 5364
232 Ga0157372_10044562 3300013307 Bacteria 4916
233 Ga0157372_10147659 3300013307 Bacteria 2712
234 Ga0157372_10316851 3300013307 Bacteria 1816
235 Ga0157372_10566810 3300013307 Bacteria 1324
236 Ga0157375_10026309 3300013308 Bacteria 5419
237 Ga0157375_10157551 3300013308 Bacteria 2410
238 Ga0157375_10495625 3300013308 Bacteria 1386
239 Ga0163163_10172731 3300014325 Bacteria 2208
240 Ga0163163_10205773 3300014325 Bacteria 2016
241 Ga0157380_10013449 3300014326 Bacteria 5966
242 Ga0182008_10001253 3300014497 Bacteria 17425
243 Ga0182008_10001941 3300014497 Bacteria 13349
244 Ga0157377_10096844 3300014745 Bacteria 1751
245 Ga0157379_10026709 3300014968 Bacteria 5139
246 Ga0157379_10148111 3300014968 Bacteria 2117
247 Ga0157376_10121431 3300014969 Bacteria 2316
248 Ga0182006_1054255 3300015261 Bacteria 1534
249 Ga0182007_10001202 3300015262 Bacteria 14061
250 Ga0182007_10001318 3300015262 Bacteria 13405
251 Ga0183367_1001 3300015688 Bacteria 1225545
252 Ga0183367_1006 3300015688 Bacteria 648044
253 Ga0183367_1021 3300015688 Bacteria 82913
254 Ga0163161_10018886 3300017792 Bacteria 4833
255 Ga0163161_10034890 3300017792 Bacteria 3599
256 Ga0163161_10038680 3300017792 Bacteria 3422
257 Ga0213872_10124712 3300021361 Bacteria 1137
258 Ga0213875_10012871 3300021388 Bacteria 4122
259 Ga0209758_1004873 3300025297 Bacteria 10804
260 Ga0207426_1000790 3300025302 Bacteria 34458
261 Ga0207426_1007251 3300025302 Bacteria 4669
262 Ga0207692_10034037 3300025898 Bacteria 2464
263 Ga0207642_10001150 3300025899 Bacteria 8183
264 Ga0207642_10003227 3300025899 Bacteria 5118
265 Ga0207710_10000036 3300025900 Bacteria 245176
266 Ga0207710_10004865 3300025900 Bacteria 5822
267 Ga0207688_10004821 3300025901 Bacteria 7350
268 Ga0207688_10009339 3300025901 Bacteria 5347
269 Ga0207688_10011084 3300025901 Bacteria 4904
270 Ga0207688_10011102 3300025901 Bacteria 4901
271 Ga0207680_10028654 3300025903 Bacteria 3118
272 Ga0207647_10004145 3300025904 Bacteria 10756
273 Ga0207647_10006210 3300025904 Bacteria 8709
274 Ga0207645_10024618 3300025907 Bacteria 3900
275 Ga0207643_10123462 3300025908 Bacteria 1536
276 Ga0207671_10082828 3300025914 Bacteria 2408
277 Ga0207671_10161455 3300025914 Bacteria 1736
278 Ga0207671_10182227 3300025914 Bacteria 1635
279 Ga0207693_10000907 3300025915 Bacteria 26588
280 Ga0207693_10031555 3300025915 Bacteria 4187
281 Ga0207663_10008831 3300025916 Bacteria 5296
282 Ga0207662_10169293 3300025918 Bacteria 1400
283 Ga0207657_10217836 3300025919 Bacteria 1530
284 Ga0207681_10000911 3300025923 Bacteria 19299
285 Ga0207681_10113069 3300025923 Bacteria 1979
286 Ga0207659_10094965 3300025926 Bacteria 2235
287 Ga0207687_10022173 3300025927 Bacteria 4224
288 Ga0207687_10066500 3300025927 Bacteria 2562
289 Ga0207687_10132478 3300025927 Bacteria 1881
290 Ga0207687_10194766 3300025927 Bacteria 1580
291 Ga0207687_10220284 3300025927 Bacteria 1494
292 Ga0207664_10268312 3300025929 Bacteria 1494
293 Ga0207644_10039998 3300025931 Bacteria 3312
294 Ga0207690_10024822 3300025932 Bacteria 3758
295 Ga0207706_10009858 3300025933 Bacteria 8764
296 Ga0207706_10011561 3300025933 Bacteria 8037
297 Ga0207706_10025627 3300025933 Bacteria 5283
298 Ga0207686_10014368 3300025934 Bacteria 4405
299 Ga0207686_10157011 3300025934 Bacteria 1590
300 Ga0207709_10081196 3300025935 Bacteria 2090
301 Ga0207709_10231279 3300025935 Bacteria 1339
302 Ga0207670_10153795 3300025936 Bacteria 1709
303 Ga0207670_10319645 3300025936 Bacteria 1221
304 Ga0207669_10005203 3300025937 Bacteria 5811
305 Ga0207704_10003456 3300025938 Bacteria 7181
306 Ga0207704_10017139 3300025938 Bacteria 3746
307 Ga0207665_10015075 3300025939 Bacteria 5075
308 Ga0207665_10085837 3300025939 Bacteria 2173
309 Ga0207711_10000102 3300025941 Bacteria 90198
310 Ga0207711_10053321 3300025941 Bacteria 3468
311 Ga0207689_10038617 3300025942 Bacteria 3954
312 Ga0207689_10119135 3300025942 Bacteria 2171
313 Ga0207651_10037994 3300025960 Bacteria 3159
314 Ga0207712_10000025 3300025961 Bacteria 274015
315 Ga0207712_10007451 3300025961 Bacteria 6910
316 Ga0207712_10015268 3300025961 Bacteria 4951
317 Ga0207712_10030682 3300025961 Bacteria 3616
318 Ga0207668_10000858 3300025972 Bacteria 18305
319 Ga0207668_10012838 3300025972 Bacteria 5139
320 Ga0207640_10016612 3300025981 Bacteria 4286
321 Ga0207640_10209288 3300025981 Bacteria 1484
322 Ga0207658_10000593 3300025986 Bacteria 32472
323 Ga0207658_10018718 3300025986 Bacteria 4787
324 Ga0207658_10021481 3300025986 Bacteria 4482
325 Ga0207658_10063322 3300025986 Bacteria 2771
326 Ga0207677_10004981 3300026023 Bacteria 7173
327 Ga0207703_10034863 3300026035 Bacteria 3996
328 Ga0207703_10082270 3300026035 Bacteria 2686
329 Ga0207639_10005386 3300026041 Bacteria 8652
330 Ga0207639_10018925 3300026041 Bacteria 4903
331 Ga0207639_10096026 3300026041 Bacteria 2384
332 Ga0207678_10007984 3300026067 Bacteria 9331
333 Ga0207678_10008236 3300026067 Bacteria 9187
334 Ga0207708_10020348 3300026075 Bacteria 5005
335 Ga0207708_10058034 3300026075 Bacteria 2953
336 Ga0207702_10068447 3300026078 Bacteria 3050
337 Ga0207641_10010691 3300026088 Bacteria 7528
338 Ga0207648_10019145 3300026089 Bacteria 6178
339 Ga0207648_10050267 3300026089 Bacteria 3646
340 Ga0207676_10261604 3300026095 Bacteria 1563
341 Ga0207676_10375334 3300026095 Bacteria 1322
342 Ga0207675_100004805 3300026118 Bacteria 13013
343 Ga0207675_100017465 3300026118 Bacteria 6697
344 Ga0207683_10002324 3300026121 Bacteria 16678
345 Ga0207683_10022246 3300026121 Bacteria 5440
346 Ga0207683_10118424 3300026121 Bacteria 2376
347 Ga0207683_10214896 3300026121 Bacteria 1751
348 Ga0207698_10073838 3300026142 Bacteria 2717
349 Ga0207698_10308578 3300026142 Bacteria 1476
350 Ga0207698_10326190 3300026142 Bacteria 1440
351 Ga0209282_1052640 3300027666 Bacteria 2322
352 Ga0207428_10001237 3300027907 Bacteria 27357
353 Ga0207428_10009580 3300027907 Bacteria 8675
354 Ga0207428_10102957 3300027907 Bacteria 2204
355 Ga0268266_10013583 3300028379 Bacteria 7014
356 Ga0268266_10034979 3300028379 Bacteria 4273
357 Ga0268266_10078584 3300028379 Bacteria 2871
358 Ga0268266_10549082 3300028379 Bacteria 1107
359 Ga0268265_10000007 3300028380 Bacteria 431817
360 Ga0268265_10013185 3300028380 Bacteria 5615
361 Ga0268265_10193758 3300028380 Bacteria 1757
362 Ga0268264_10000007 3300028381 Bacteria 815790
363 Ga0268264_10024292 3300028381 Bacteria 4948
364 Ga0268264_10252950 3300028381 Bacteria 1638
365 Ga0268264_10258421 3300028381 Bacteria 1621
366 Ga0268264_10384548 3300028381 Bacteria 1345
367 Ga0307517_10004208 3300028786 Bacteria 22182
368 Ga0307515_10000046 3300028794 Bacteria 293319
369 Ga0307515_10034314 3300028794 Bacteria 8314
370 Ga0307515_10106091 3300028794 Bacteria 3337
371 Ga0307515_10150583 3300028794 Bacteria 2434
372 Ga0268256_1020506 3300030500 Bacteria 1781
373 Ga0307511_10002260 3300030521 Bacteria 20135
374 Ga0307511_10049337 3300030521 Bacteria 3409
375 Ga0307511_10155770 3300030521 Bacteria 1297
376 Ga0307512_10043807 3300030522 Bacteria 3686
377 Ga0307513_10015302 3300031456 Bacteria 9306
378 Ga0307513_10019716 3300031456 Bacteria 8016
379 Ga0307509_10039748 3300031507 Bacteria 5122
380 Ga0307509_10193474 3300031507 Bacteria 1881
381 Ga0307408_100025439 3300031548 Bacteria 4055
382 Ga0307508_10005047 3300031616 Bacteria 12676
383 Ga0307508_10012343 3300031616 Bacteria 7811
384 Ga0307508_10015165 3300031616 Bacteria 7023
385 Ga0307508_10023014 3300031616 Bacteria 5660
386 Ga0307508_10130526 3300031616 Bacteria 2116
387 Ga0307514_10003992 3300031649 Bacteria 13772
388 Ga0307514_10069990 3300031649 Bacteria 2636
389 Ga0307514_10079829 3300031649 Bacteria 2423
390 Ga0307516_10014667 3300031730 Bacteria 8280
391 Ga0307405_10010297 3300031731 Bacteria 4835
392 Ga0307405_10011336 3300031731 Bacteria 4666
393 Ga0307405_10050903 3300031731 Bacteria 2568
394 Ga0307413_10006809 3300031824 Bacteria 5252
395 Ga0307413_10027077 3300031824 Bacteria 3170
396 Ga0307413_10094073 3300031824 Bacteria 1961
397 Ga0307413_10133366 3300031824 Bacteria 1704
398 Ga0307518_10048604 3300031838 Bacteria 3084
399 Ga0307410_10000186 3300031852 Bacteria 22976
400 Ga0307410_10004749 3300031852 Bacteria 7083
401 Ga0307410_10006417 3300031852 Bacteria 6344
402 Ga0307410_10006476 3300031852 Bacteria 6322
403 Ga0307410_10014259 3300031852 Bacteria 4670
404 Ga0307410_10373282 3300031852 Bacteria 1146
405 Ga0307406_10000071 3300031901 Bacteria 56611
406 Ga0307406_10008812 3300031901 Bacteria 5638
407 Ga0307406_10015056 3300031901 Bacteria 4466
408 Ga0307406_10083025 3300031901 Bacteria 2136
409 Ga0307406_10090558 3300031901 Bacteria 2058
410 Ga0307407_10004883 3300031903 Bacteria 5754
411 Ga0307407_10023459 3300031903 Bacteria 3220
412 Ga0307407_10051314 3300031903 Bacteria 2364
413 Ga0307407_10064946 3300031903 Bacteria 2147
414 Ga0307407_10089121 3300031903 Bacteria 1886
415 Ga0307407_10194601 3300031903 Bacteria 1354
416 Ga0307407_10240326 3300031903 Bacteria 1235
417 Ga0307412_10292644 3300031911 Bacteria 1283
418 Ga0307409_100000106 3300031995 Bacteria 30264
419 Ga0307409_100002886 3300031995 Bacteria 9115
420 Ga0307409_100003055 3300031995 Bacteria 8948
421 Ga0307409_100024232 3300031995 Bacteria 4227
422 Ga0307409_100029134 3300031995 Bacteria 3946
423 Ga0307409_100076346 3300031995 Bacteria 2686
424 Ga0307409_100210805 3300031995 Bacteria 1746
425 Ga0307409_100280006 3300031995 Bacteria 1541
426 Ga0307416_100000850 3300032002 Bacteria 16062
427 Ga0307416_100017280 3300032002 Bacteria 5041
428 Ga0307416_100049737 3300032002 Bacteria 3335
429 Ga0307416_100066381 3300032002 Bacteria 2970
430 Ga0307416_100176833 3300032002 Bacteria 1995
431 Ga0307416_100229361 3300032002 Bacteria 1789
432 Ga0307416_100443581 3300032002 Bacteria 1349
433 Ga0307414_10010360 3300032004 Bacteria 5405
434 Ga0307414_10020775 3300032004 Bacteria 4101
435 Ga0307414_10026408 3300032004 Bacteria 3737
436 Ga0307414_10081940 3300032004 Bacteria 2364
437 Ga0307414_10083907 3300032004 Bacteria 2341
438 Ga0307414_10184653 3300032004 Bacteria 1681
439 Ga0307414_10218668 3300032004 Bacteria 1562
440 Ga0307411_10009357 3300032005 Bacteria 5146
441 Ga0307411_10011519 3300032005 Bacteria 4778
442 Ga0307411_10042548 3300032005 Bacteria 2899
443 Ga0307411_10098100 3300032005 Bacteria 2064
444 Ga0307415_100002560 3300032126 Bacteria 9096
445 Ga0307415_100005844 3300032126 Bacteria 6579
446 Ga0307415_100013305 3300032126 Bacteria 4798
447 Ga0307415_100021903 3300032126 Bacteria 3936
448 Ga0307415_100060321 3300032126 Bacteria 2621
449 Ga0307415_100160352 3300032126 Bacteria 1742
450 Ga0307415_100306451 3300032126 Bacteria 1318
451 Ga0307507_10014232 3300033179 Bacteria 9511
452 Ga0307507_10015481 3300033179 Bacteria 8966
453 Ga0307507_10208544 3300033179 Bacteria 1337
454 Ga0307510_10158611 3300033180 Bacteria 1864
455 Ga0373940_0037846 3300035088 Bacteria 1315
456 Ga0373931_0039646 3300035691 Bacteria 2468
457 Ga0373925_0196960 3300037068 Bacteria 1601
458 Ga0395900_0083875 3300037418 Bacteria 3274
459 Ga0395900_0256237 3300037418 Bacteria 1749
460 Ga0395900_0319301 3300037418 Bacteria 1534
461 Ga0395898_0015241 3300037466 Bacteria 7891
462 Ga0395898_0042453 3300037466 Bacteria 4486
463 Ga0395898_0073677 3300037466 Bacteria 3299
464 Ga0395905_0421335 3300037471 Bacteria 1231
465 Ga0436364_0370574 3300037853 Bacteria 6351
466 Ga0436364_1016041 3300037853 Bacteria 1583
467 Ga0436365_0664968 3300039437 Bacteria 3008
468 Ga0436361_0713294 3300039447 Bacteria 6790
469 Ga0439436_0007597 3300041404 Bacteria 3336
470 Ga0439436_0024059 3300041404 Bacteria 1799
471 Ga0439461_0000622 3300041410 Bacteria 5113
472 Ga0439466_0010203 3300041411 Bacteria 3493
473 Ga0439465_0004933 3300041413 Bacteria 4288
474 Ga0451795_0177854 3300041456 Bacteria 5771
475 Ga0451853_0186994 3300041512 Bacteria 3429
476 Ga0439431_0004964 3300041997 Bacteria 2931
477 Ga0439433_0001850 3300041999 Bacteria 4416
478 Ga0439448_0007193 3300042005 Bacteria 3218
479 Ga0439448_0018547 3300042005 Bacteria 2134
480 Ga0439449_0002442 3300042007 Bacteria 7266
481 Ga0439449_0003409 3300042007 Bacteria 6184
482 Ga0439449_0033212 3300042007 Bacteria 1922
483 Ga0439449_0040692 3300042007 Bacteria 1728
484 Ga0439455_0003289 3300042012 Bacteria 3066
485 Ga0439455_0006433 3300042012 Bacteria 2438
486 Ga0439455_0028684 3300042012 Bacteria 1372
487 Ga0439457_000977 3300042014 Bacteria 8596
488 Ga0439457_002741 3300042014 Bacteria 4951
489 Ga0439462_0002522 3300042015 Bacteria 4266
490 Ga0450894_002382 3300042131 Bacteria 2533
491 Ga0450900_002018 3300042136 Bacteria 2092
492 Ga0450903_000575 3300042138 Bacteria 7531
493 Ga0450903_001095 3300042138 Bacteria 5155
494 Ga0439458_0000722 3300042157 Bacteria 8508
495 Ga0439434_0003247 3300042435 Bacteria 4771
496 Ga0439434_0045611 3300042435 Bacteria 1352
497 Ga0439440_0013027 3300042993 Bacteria 1777
498 Ga0466969_0045354 3300044656 Bacteria 2183
499 Ga0466972_0001755 3300044658 Bacteria 10637
500 Ga0466972_0002060 3300044658 Bacteria 9850
501 Ga0466972_0011100 3300044658 Bacteria 4521
502 Ga0466972_0020443 3300044658 Bacteria 3308
503 Ga0466972_0039617 3300044658 Bacteria 2299
504 Ga0466972_0057811 3300044658 Bacteria 1862
505 Ga0466972_0127922 3300044658 Bacteria 1197
506 Ga0466965_0000288 3300044683 Bacteria 16687
507 Ga0466965_0000502 3300044683 Bacteria 13930
508 Ga0466965_0126935 3300044683 Bacteria 1320
509 Ga0466966_0002830 3300044684 Bacteria 11416
510 Ga0466966_0004237 3300044684 Bacteria 9467
511 Ga0466966_0258692 3300044684 Bacteria 1048
512 Ga0466961_0054195 3300044693 Bacteria 2558
513 Ga0466963_0001177 3300044694 Bacteria 13738
514 Ga0466963_0008746 3300044694 Bacteria 6080
515 Ga0466963_0057579 3300044694 Bacteria 2588
516 Ga0466964_0001884 3300044706 Bacteria 7323
517 Ga0466971_0003539 3300044719 Bacteria 6674
518 Ga0466971_0007148 3300044719 Bacteria 4859
519 Ga0466971_0025437 3300044719 Bacteria 2644
520 Ga0466970_0005387 3300044765 Bacteria 6349
521 Ga0466970_0008602 3300044765 Bacteria 5141
522 Ga0466970_0010797 3300044765 Bacteria 4644
523 Ga0466970_0025003 3300044765 Bacteria 3125
524 Ga0466970_0037802 3300044765 Bacteria 2560
525 Ga0466970_0160682 3300044765 Bacteria 1242
526 Ga0466957_0009571 3300044842 Bacteria 5534
527 Ga0466957_0025969 3300044842 Bacteria 3473
528 Ga0466957_0040330 3300044842 Bacteria 2819
529 Ga0466957_0063553 3300044842 Bacteria 2269
530 Ga0466957_0090970 3300044842 Bacteria 1912
531 Ga0466960_0000313 3300044901 Bacteria 16642
532 Ga0466960_0001508 3300044901 Bacteria 8476
533 Ga0466960_0016305 3300044901 Bacteria 3219
534 Ga0466960_0090547 3300044901 Bacteria 1558
535 Ga0466959_0008657 3300045049 Bacteria 7203
536 Ga0466958_0001015 3300045836 Bacteria 12747
537 Ga0466958_0243816 3300045836 Bacteria 1148
538 Ga0466967_0000412 3300045976 Bacteria 20240
539 Ga0466967_0017691 3300045976 Bacteria 5670
540 Ga0466967_0053051 3300045976 Bacteria 3563
541 Ga0466967_0061221 3300045976 Bacteria 3339
542 Ga0466967_0090540 3300045976 Bacteria 2779
543 Ga0466967_0125089 3300045976 Bacteria 2381
544 Ga0466967_0349201 3300045976 Bacteria 1431
545 Ga0466967_0496111 3300045976 Bacteria 1198
546 Ga0495617_025457 3300046452 Bacteria 1994
547 Ga0495627_017353 3300046453 Bacteria 2448
548 Ga0495592_0088282 3300046454 Bacteria 2229
549 Ga0495603_0007354 3300046455 Bacteria 6624
550 Ga0495603_0009121 3300046455 Bacteria 5997
551 Ga0495603_0019345 3300046455 Bacteria 4121
552 Ga0495603_0033670 3300046455 Bacteria 3082
553 Ga0495603_0058650 3300046455 Bacteria 2275
554 Ga0495590_0048739 3300046457 Bacteria 1478
555 Ga0495629_0001933 3300046459 Bacteria 16145
556 Ga0495629_0011063 3300046459 Bacteria 6556
557 Ga0495629_0012494 3300046459 Bacteria 6150
558 Ga0495629_0015172 3300046459 Bacteria 5536
559 Ga0495629_0072468 3300046459 Bacteria 2404
560 Ga0495629_0136970 3300046459 Bacteria 1704
561 Ga0495638_0008024 3300046460 Bacteria 7519
562 Ga0495638_0008071 3300046460 Bacteria 7494
563 Ga0495638_0026620 3300046460 Bacteria 3747
564 Ga0495638_0183262 3300046460 Bacteria 1193
565 Ga0495651_0001558 3300046462 Bacteria 17724
566 Ga0495605_0003611 3300046474 Bacteria 9178
567 Ga0495639_0014741 3300046475 Bacteria 3387
568 Ga0495662_0000305 3300046476 Bacteria 21349
569 Ga0495662_0016026 3300046476 Bacteria 3636
570 Ga0495662_0090269 3300046476 Bacteria 1493
571 Ga0495664_0067571 3300046477 Bacteria 2132
572 Ga0495664_0146605 3300046477 Bacteria 1431
573 Ga0495585_0088955 3300046492 Bacteria 1665
574 Ga0495594_0003881 3300046499 Bacteria 7687
575 Ga0495594_0024219 3300046499 Bacteria 3258
576 Ga0495594_0121465 3300046499 Bacteria 1477
577 Ga0495594_0148271 3300046499 Bacteria 1331
578 Ga0495607_0020887 3300046501 Bacteria 4128
579 Ga0495607_0069572 3300046501 Bacteria 1969
580 Ga0495583_0020416 3300046506 Bacteria 3432
581 Ga0495583_0031590 3300046506 Bacteria 2565
582 Ga0495583_0050471 3300046506 Bacteria 1901
583 Ga0495606_0007016 3300046507 Bacteria 10221
584 Ga0495606_0007166 3300046507 Bacteria 10066
585 Ga0495606_0029891 3300046507 Bacteria 3818
586 Ga0495610_0046548 3300046512 Bacteria 2139
587 Ga0495610_0122337 3300046512 Bacteria 1139
588 Ga0495616_0001426 3300046513 Bacteria 16636
589 Ga0495616_0030023 3300046513 Bacteria 2862
590 Ga0495618_0017879 3300046514 Bacteria 4351
591 Ga0495618_0059889 3300046514 Bacteria 2413
592 Ga0495620_0001023 3300046515 Bacteria 17198
593 Ga0495620_0012144 3300046515 Bacteria 4464
594 Ga0495628_0090038 3300046516 Bacteria 2375
595 Ga0495628_0176393 3300046516 Bacteria 1618
596 Ga0495630_0032749 3300046517 Bacteria 3875
597 Ga0495630_0085244 3300046517 Bacteria 2385
598 Ga0495631_0005052 3300046518 Bacteria 6950
599 Ga0495643_0004195 3300046522 Bacteria 10208
600 Ga0495643_0021076 3300046522 Bacteria 3745
601 Ga0495648_0006495 3300046524 Bacteria 9535
602 Ga0495648_0073713 3300046524 Bacteria 1969
603 Ga0495648_0087811 3300046524 Bacteria 1749
604 Ga0495648_0149596 3300046524 Bacteria 1219
605 Ga0495666_0023421 3300046526 Bacteria 3053
606 Ga0495652_0104742 3300046529 Bacteria 2287
607 Ga0495652_0341063 3300046529 Bacteria 1076
608 Ga0495654_0039660 3300046530 Bacteria 2350
609 Ga0495654_0089547 3300046530 Bacteria 1430
610 Ga0495640_0259776 3300046533 Bacteria 1085
611 Ga0495586_0062897 3300046535 Bacteria 2021
612 Ga0495587_0011507 3300046536 Bacteria 5604
613 Ga0495609_0012613 3300046538 Bacteria 4007
614 Ga0495609_0018220 3300046538 Bacteria 3254
615 Ga0495621_0036286 3300046539 Bacteria 1711
616 Ga0495597_0009742 3300046542 Bacteria 4731
617 Ga0495645_0084185 3300046543 Bacteria 2278
618 Ga0495645_0129952 3300046543 Bacteria 1766
619 Ga0495622_0092011 3300046557 Bacteria 1393
620 Ga0495633_0045335 3300046558 Bacteria 2082
621 Ga0495633_0068545 3300046558 Bacteria 1656
622 Ga0495667_0223730 3300046559 Bacteria 1201
623 Ga0495656_0021881 3300046615 Bacteria 2496
624 Ga0495656_0196795 3300046615 Bacteria 998
625 Ga0495668_0000128 3300046616 Bacteria 113090
626 Ga0495668_0010814 3300046616 Bacteria 5501
627 Ga0495668_0029453 3300046616 Bacteria 3101
628 Ga0495634_0008925 3300046642 Bacteria 7425
629 Ga0495634_0084145 3300046642 Bacteria 2074
630 Ga0495611_0076347 3300046648 Bacteria 1536
631 Ga0495625_0037842 3300046660 Bacteria 3535
632 Ga0495635_0006889 3300046663 Bacteria 7940
633 Ga0495661_0035615 3300046665 Bacteria 3121
634 Ga0495661_0049946 3300046665 Bacteria 2534
635 Ga0495588_0003822 3300046674 Bacteria 6598
636 Ga0495588_0019104 3300046674 Bacteria 3353
637 Ga0495657_0006337 3300046675 Bacteria 9267
638 Ga0495657_0008870 3300046675 Bacteria 7654
639 Ga0495657_0045638 3300046675 Bacteria 2972
640 Ga0495646_0001231 3300046680 Bacteria 15030
641 Ga0495646_0035636 3300046680 Bacteria 3086
642 Ga0495658_0008137 3300046683 Bacteria 5192
643 Ga0495613_0001211 3300046689 Bacteria 19746
644 Ga0495613_0038091 3300046689 Bacteria 3564
645 Ga0495613_0047649 3300046689 Bacteria 3165
646 Ga0495613_0051651 3300046689 Bacteria 3029
647 Ga0495671_0012968 3300046692 Bacteria 4534
648 Ga0495649_0058036 3300046694 Bacteria 2086
649 Ga0495649_0130421 3300046694 Bacteria 1326
650 Ga0495649_0167204 3300046694 Bacteria 1152
651 Ga0495649_0176746 3300046694 Bacteria 1115
652 Ga0495589_0006883 3300046794 Bacteria 5976
653 Ga0495589_0011982 3300046794 Bacteria 4495
654 Ga0495589_0012127 3300046794 Bacteria 4469
655 Ga0495589_0012562 3300046794 Bacteria 4382
656 Ga0495589_0016490 3300046794 Bacteria 3798
657 Ga0495600_0032445 3300046809 Bacteria 3389
658 Ga0495600_0125174 3300046809 Bacteria 1671
659 Ga0495581_0037673 3300047315 Bacteria 2799
660 Ga0495581_0105974 3300047315 Bacteria 1634
661 Ga0495604_0000811 3300047317 Bacteria 26210
662 Ga0495636_0000665 3300047318 Bacteria 12599
663 Ga0495636_0019787 3300047318 Bacteria 2708
664 Ga0495636_0026473 3300047318 Bacteria 2359
665 Ga0495636_0033723 3300047318 Bacteria 2105
666 Ga0495636_0067816 3300047318 Bacteria 1518
667 Ga0495674_0240708 3300047319 Bacteria 1491
668 Ga0495672_0005364 3300047320 Bacteria 10195
669 Ga0495676_0009915 3300047321 Bacteria 8652
670 Ga0495676_0010110 3300047321 Bacteria 8568
671 Ga0495676_0012589 3300047321 Bacteria 7617
672 Ga0495676_0015081 3300047321 Bacteria 6899
673 Ga0495676_0023642 3300047321 Bacteria 5328
674 Ga0495676_0045065 3300047321 Bacteria 3593
675 Ga0495680_0012497 3300047322 Bacteria 7467
676 Ga0495683_0098886 3300047323 Bacteria 1405
677 Ga0495687_001148 3300047443 Bacteria 25640
678 Ga0495687_036096 3300047443 Bacteria 2215
679 Ga0495687_054907 3300047443 Bacteria 1668
680 Ga0495687_065986 3300047443 Bacteria 1471
681 Ga0495687_068286 3300047443 Bacteria 1435
682 Ga0495675_0047407 3300047444 Bacteria 2734
683 Ga0495675_0248015 3300047444 Bacteria 1070
684 Ga0495677_0016191 3300047445 Bacteria 2706
685 Ga0495685_001061 3300047447 Bacteria 8390
686 Ga0495685_001209 3300047447 Bacteria 7914
687 Ga0495685_001477 3300047447 Bacteria 7204
688 Ga0495685_004930 3300047447 Bacteria 4335
689 Ga0495685_007409 3300047447 Bacteria 3621
690 Ga0495673_0001153 3300047469 Bacteria 22442
691 Ga0495681_0048299 3300047470 Bacteria 2018
692 Ga0495681_0091638 3300047470 Bacteria 1341
693 Ga0495686_0048992 3300047472 Bacteria 2661
694 Ga0495593_0034697 3300047673 Bacteria 2742
695 Ga0495593_0204005 3300047673 Bacteria 993
696 Ga0495602_0142074 3300048088 Bacteria 1899
697 Ga0495614_0022354 3300048089 Bacteria 2729
698 Ga0495626_0059545 3300048091 Bacteria 1742
699 Ga0496100_0001703 3300048903 Bacteria 10932
700 Ga0496100_0006454 3300048903 Bacteria 6397
701 Ga0496100_0006878 3300048903 Bacteria 6228
702 Ga0496100_0028605 3300048903 Bacteria 3439
703 Ga0496100_0046275 3300048903 Bacteria 2797
704 Ga0496100_0105229 3300048903 Bacteria 1951
705 Ga0496100_0118346 3300048903 Bacteria 1851
706 Ga0496100_0285904 3300048903 Bacteria 1231
707 Ga0496101_0000030 3300048904 Bacteria 198447
708 Ga0496101_0001379 3300048904 Bacteria 14555
709 Ga0496101_0011975 3300048904 Bacteria 5778
710 Ga0496101_0072796 3300048904 Bacteria 2523
711 Ga0496102_0000001 3300048905 Bacteria 873433
712 Ga0496102_0000112 3300048905 Bacteria 116902
713 Ga0496102_0017128 3300048905 Bacteria 6344
714 Ga0496102_0062223 3300048905 Bacteria 3418
715 Ga0496102_0078104 3300048905 Bacteria 3047
716 Ga0496102_0079513 3300048905 Bacteria 3020
717 Ga0496102_0626825 3300048905 Bacteria 998
718 Ga0496103_0000003 3300048906 Bacteria 603967
719 Ga0496103_0002476 3300048906 Bacteria 11582
720 Ga0496103_0129948 3300048906 Bacteria 1608
721 Ga0496104_0137999 3300048907 Bacteria 2343
722 Ga0496104_0141043 3300048907 Bacteria 2315
723 Ga0496104_0217930 3300048907 Bacteria 1821
724 Ga0496105_0038689 3300048908 Bacteria 3930
725 Ga0496105_0065002 3300048908 Bacteria 3011
726 Ga0496106_0009358 3300048909 Bacteria 7243
727 Ga0496106_0014688 3300048909 Bacteria 5788
728 Ga0496106_0021410 3300048909 Bacteria 4801
729 Ga0496106_0021710 3300048909 Bacteria 4768
730 Ga0496106_0141029 3300048909 Bacteria 1896
731 Ga0496106_0163844 3300048909 Bacteria 1759
732 Ga0496107_0012120 3300048910 Bacteria 6013
733 Ga0496107_0027547 3300048910 Bacteria 4035
734 Ga0496107_0100178 3300048910 Bacteria 2124
735 Ga0496108_0000589 3300048911 Bacteria 28452
736 Ga0496108_0002063 3300048911 Bacteria 16082
737 Ga0496108_0012853 3300048911 Bacteria 6819
738 Ga0496108_0175780 3300048911 Bacteria 1853
739 Ga0496108_0187444 3300048911 Bacteria 1792
740 Ga0496108_0313349 3300048911 Bacteria 1367
741 Ga0496108_0524909 3300048911 Bacteria 1034
742 Ga0496109_0004292 3300048912 Bacteria 11905
743 Ga0496109_0007158 3300048912 Bacteria 9428
744 Ga0496109_0014192 3300048912 Bacteria 6928
745 Ga0496109_0068561 3300048912 Bacteria 3251
746 Ga0496109_0115824 3300048912 Bacteria 2494
747 Ga0496109_0355675 3300048912 Bacteria 1383
748 Ga0496110_0189785 3300048913 Bacteria 1866
749 Ga0496110_0256744 3300048913 Bacteria 1591
750 Ga0496111_0056368 3300048914 Bacteria 2843
751 Ga0496112_0028927 3300048915 Bacteria 5355
752 Ga0496112_0057653 3300048915 Bacteria 3824
753 Ga0496112_0105055 3300048915 Bacteria 2794
754 Ga0496112_0112943 3300048915 Bacteria 2687
755 Ga0496112_0213834 3300048915 Bacteria 1885
756 Ga0496113_0021756 3300048916 Bacteria 4528
757 Ga0496113_0043182 3300048916 Bacteria 3335
758 Ga0496113_0070881 3300048916 Bacteria 2650
759 Ga0496114_0003564 3300048917 Bacteria 11954
760 Ga0496114_0016475 3300048917 Bacteria 5957
761 Ga0496114_0160515 3300048917 Bacteria 1954
762 Ga0496114_0208575 3300048917 Unclassified 1713
763 Ga0496115_0004692 3300048918 Bacteria 9906
764 Ga0496115_0014973 3300048918 Bacteria 5879
765 Ga0496116_0000013 3300048919 Bacteria 603993
766 Ga0496116_0021964 3300048919 Bacteria 4798
767 Ga0496117_0000013 3300048920 Bacteria 603995
768 Ga0496117_0000719 3300048920 Bacteria 52226
769 Ga0496118_0000011 3300048921 Bacteria 603995
770 Ga0496118_0003063 3300048921 Bacteria 21476
771 Ga0496119_0000076 3300048922 Bacteria 143663
772 Ga0496119_0014589 3300048922 Bacteria 6129
773 Ga0496120_0001268 3300048923 Bacteria 31644
774 Ga0496120_0052426 3300048923 Bacteria 2324
775 Ga0496120_0060791 3300048923 Bacteria 2112
776 Ga0496121_0014867 3300048924 Bacteria 8209
777 Ga0496123_0029954 3300048926 Bacteria 3994
778 Ga0496124_0056202 3300048927 Bacteria 3320
779 Ga0496125_0037277 3300048928 Bacteria 4228
780 Ga0496126_0002163 3300048929 Bacteria 27351
781 Ga0495678_056138 3300049459 Bacteria 1499
782 Ga0495682_0038634 3300049460 Bacteria 1754
783 Ga0501031_0021971 3300049568 Bacteria 4157
784 Ga0501031_0084751 3300049568 Bacteria 2066
785 Ga0501031_0122287 3300049568 Bacteria 1700
786 Ga0501032_0001058 3300049569 Bacteria 21998
787 Ga0501032_0001487 3300049569 Bacteria 18697
788 Ga0501032_0025037 3300049569 Bacteria 4115
789 Ga0501033_0007160 3300049570 Bacteria 8703
790 Ga0501033_0045356 3300049570 Bacteria 3271
791 Ga0501033_0057629 3300049570 Bacteria 2870
792 Ga0501033_0232612 3300049570 Bacteria 1309
793 Ga0501034_0006804 3300049571 Bacteria 12228
794 Ga0501034_0016674 3300049571 Bacteria 7530
795 Ga0501034_0031681 3300049571 Bacteria 5371
796 Ga0501034_0046795 3300049571 Bacteria 4371
797 Ga0501034_0100512 3300049571 Bacteria 2886
798 Ga0501036_0009792 3300049572 Bacteria 7892
799 Ga0501036_0009835 3300049572 Bacteria 7874
800 Ga0501036_0017920 3300049572 Bacteria 5928
801 Ga0501036_0018504 3300049572 Bacteria 5839
802 Ga0501036_0033678 3300049572 Bacteria 4332
803 Ga0501037_0000846 3300049573 Bacteria 22835
804 Ga0501037_0003465 3300049573 Bacteria 11452
805 Ga0501037_0031766 3300049573 Bacteria 3898
806 Ga0501038_0002496 3300049574 Bacteria 17130
807 Ga0501038_0012232 3300049574 Bacteria 7836
808 Ga0501038_0018635 3300049574 Bacteria 6269
809 Ga0501038_0041961 3300049574 Bacteria 3987
810 Ga0501038_0043522 3300049574 Bacteria 3903
811 Ga0501038_0104210 3300049574 Bacteria 2357
812 Ga0501039_0000413 3300049575 Bacteria 30667
813 Ga0501039_0004087 3300049575 Bacteria 10975
814 Ga0501039_0033422 3300049575 Bacteria 3965
815 Ga0501039_0140183 3300049575 Bacteria 1899
816 Ga0501039_0222091 3300049575 Bacteria 1485
817 Ga0501040_0025389 3300049576 Bacteria 3983
818 Ga0501041_0011160 3300049577 Bacteria 5306
819 Ga0501042_0007681 3300049578 Bacteria 7079
820 Ga0501042_0022676 3300049578 Bacteria 4386
821 Ga0501043_0000710 3300049579 Bacteria 29515
822 Ga0501043_0002340 3300049579 Bacteria 16062
823 Ga0501043_0037168 3300049579 Bacteria 3830
824 Ga0501043_0076802 3300049579 Bacteria 2624
825 Ga0501046_0013365 3300049580 Bacteria 6953
826 Ga0501046_0013758 3300049580 Bacteria 6840
827 Ga0501046_0070356 3300049580 Bacteria 2720
828 Ga0501047_0019290 3300049581 Bacteria 6542
829 Ga0501047_0065802 3300049581 Bacteria 3493
830 Ga0501048_0032054 3300049582 Bacteria 3799
831 Ga0501067_0100241 3300049583 Bacteria 1609
832 Ga0501068_0008717 3300049584 Bacteria 5656
833 Ga0501068_0135296 3300049584 Bacteria 1543
834 Ga0501070_0000301 3300049586 Bacteria 45769
835 Ga0501070_0001683 3300049586 Bacteria 19591
836 Ga0501070_0154194 3300049586 Bacteria 1895
837 Ga0501070_0484822 3300049586 Bacteria 994
838 Ga0501071_0008152 3300049587 Bacteria 6910
839 Ga0501072_0010719 3300049588 Bacteria 6982
840 Ga0501073_0046919 3300049589 Bacteria 3037
841 Ga0501073_0148989 3300049589 Bacteria 1622
842 Ga0501074_0011845 3300049590 Bacteria 6341
843 Ga0501074_0031457 3300049590 Bacteria 3844
844 Ga0501076_0007496 3300049592 Bacteria 7943
845 Ga0501243_019330 3300049675 Bacteria 1116
846 Ga0501080_0025716 3300049742 Bacteria 5467
847 Ga0501083_0152710 3300049744 Bacteria 1512
848 Ga0501035_0096585 3300049822 Bacteria 2596
849 Ga0501035_0178639 3300049822 Bacteria 1830
850 Ga0501035_0181611 3300049822 Bacteria 1812
851 Ga0501044_0001741 3300049823 Bacteria 25406
852 Ga0501044_0013221 3300049823 Bacteria 8938
853 Ga0501044_0013974 3300049823 Bacteria 8673
854 Ga0501044_0066259 3300049823 Bacteria 3683
855 Ga0501044_0094263 3300049823 Bacteria 3019
856 Ga0501044_0118192 3300049823 Bacteria 2654
857 Ga0501044_0222544 3300049823 Bacteria 1837
858 Ga0501045_0020185 3300049824 Bacteria 4757
859 nmdc:mga03n38_10969_c1 3300050490 Bacteria 3359
860 nmdc:mga03n38_15033_c1 3300050490 Bacteria 2981
861 nmdc:mga03n38_188677_c1 3300050490 Bacteria 1061
862 nmdc:mga03n38_19000_c1 3300050490 Bacteria 2721
863 nmdc:mga03n38_5500_c1 3300050490 Bacteria 4319
864 nmdc:mga00v17_14060_c1 3300050491 Bacteria 4460
865 nmdc:mga00v17_151372_c1 3300050491 Bacteria 1491
866 nmdc:mga00v17_16277_c1 3300050491 Bacteria 4191
867 nmdc:mga00v17_7507_c1 3300050491 Bacteria 5820
868 nmdc:mga0yw44_207032_c1 3300050492 Bacteria 1297
869 nmdc:mga0yw44_22077_c1 3300050492 Bacteria 3562
870 nmdc:mga0yw44_339099_c1 3300050492 Bacteria 1011
871 nmdc:mga0yw44_52184_c1 3300050492 Bacteria 2478
872 nmdc:mga06z11_15221_c1 3300050494 Bacteria 3429
873 nmdc:mga06z11_39550_c1 3300050494 Bacteria 2348
874 nmdc:mga04h51_5954_c1 3300050495 Bacteria 2187
875 nmdc:mga04h51_9671_c1 3300050495 Bacteria 2624
876 nmdc:mga07m45_13721_c1 3300050496 Bacteria 4302
877 nmdc:mga07m45_146616_c1 3300050496 Bacteria 1368
878 nmdc:mga07m45_38352_c1 3300050496 Bacteria 2673
879 nmdc:mga07m45_46733_c1 3300050496 Bacteria 2432
880 nmdc:mga07m45_92094_c1 3300050496 Bacteria 1737
881 nmdc:mga05p37_3169_c1 3300050507 Bacteria 19142
882 nmdc:mga05p37_88589_c1 3300050507 Bacteria 3815
883 nmdc:mga09592_106048_c1 3300050508 Bacteria 2410
884 nmdc:mga0qj67_15554_c1 3300050509 Bacteria 5761
885 nmdc:mga06r32_403866_c1 3300050510 Unclassified 1348
886 nmdc:mga08y16_199381_c1 3300050511 Bacteria 2074
887 nmdc:mga0n895_320_c1 3300050512 Bacteria 31928
888 nmdc:mga0n895_46863_c1 3300050512 Bacteria 4225
889 nmdc:mga0rr50_25073_c1 3300050513 Bacteria 4142
890 nmdc:mga08x19_3141_c1 3300050514 Bacteria 9919
891 nmdc:mga0a205_213796_c1 3300050515 Bacteria 1816
892 nmdc:mga0a205_5899_c1 3300050515 Bacteria 11032
893 nmdc:mga0sz30_16128_c3 3300050516 Bacteria 1971
894 nmdc:mga0sz30_1724_c1 3300050516 Bacteria 7755
895 nmdc:mga0sz30_3342_c1 3300050516 Bacteria 5766
896 nmdc:mga0sz30_3484_c2 3300050516 Bacteria 3533
897 nmdc:mga0sz30_483_c1 3300050516 Bacteria 14954
898 Ga0495612_0118723 3300053078 Bacteria 1136
899 Ga0500610_0046814 3300053079 Bacteria 2247
900 Ga0495655_0012580 3300053083 Bacteria 1729
901 Ga0495655_0052742 3300053083 Bacteria 1082
902 Ga0500644_0050462 3300053088 Bacteria 1424
903 Ga0500640_044138 3300053095 Bacteria 1956
904 Ga0500660_028431 3300053100 Bacteria 2935
905 Ga0500553_088478 3300053101 Bacteria 1369
906 Ga0500553_104864 3300053101 Bacteria 1207
907 Ga0500560_079931 3300053107 Bacteria 1085
908 Ga0500580_089720 3300053113 Bacteria 1230
909 Ga0500608_055772 3300053122 Bacteria 1894
910 Ga0500618_000612 3300053125 Bacteria 21789
911 Ga0500559_0085812 3300053136 Bacteria 1436
912 Ga0500573_0191670 3300053140 Bacteria 1091
913 Ga0500616_0033532 3300053153 Bacteria 2801
914 Ga0500616_0073659 3300053153 Bacteria 1733
915 Ga0500645_000565 3300053730 Bacteria 24250
916 Ga0500645_036164 3300053730 Bacteria 1470
917 Ga0501084_0010469 3300054114 Bacteria 7665
918 Ga0466962_0021927 3300061719 Bacteria 3067
919 Ga0466962_0053549 3300061719 Bacteria 1928
920 Ga0530510_0167183 3300061734 Bacteria 1628

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100023784 Ga0070682_1000237842 236
2 3300005441 Ga0070700_100040381 Ga0070700_1000403814 236
3 3300005617 Ga0068859_100248357 Ga0068859_1002483572 236
4 3300006931 Ga0097620_100248356 Ga0097620_1002483562 236
5 3300009098 Ga0105245_10223280 Ga0105245_102232802 236
6 3300011119 Ga0105246_10126553 Ga0105246_101265533 236
7 3300014968 Ga0157379_10148111 Ga0157379_101481112 236
8 3300025927 Ga0207687_10220284 Ga0207687_102202842 236
9 3300025936 Ga0207670_10153795 Ga0207670_101537952 236
10 3300026075 Ga0207708_10058034 Ga0207708_100580344 236
11 3300028380 Ga0268265_10193758 Ga0268265_101937582 236
12 3300048911 Ga0496108_0002063 Ga0496108_0002063_8310_9068 236
13 3300046455 Ga0495603_0009121 Ga0495603_0009121_1623_2417 250
14 3300046475 Ga0495639_0014741 Ga0495639_0014741_627_1421 250
15 3300025927 Ga0207687_10194766 Ga0207687_101947662 253
16 3300053122 Ga0500608_055772 Ga0500608_055772_119_994 260
17 3300053136 Ga0500559_0085812 Ga0500559_0085812_174_1049 260
18 3300013308 Ga0157375_10495625 Ga0157375_104956252 261
19 3300049569 Ga0501032_0001058 Ga0501032_0001058_3302_4168 262
20 3300049572 Ga0501036_0018504 Ga0501036_0018504_3855_4721 262
21 3300049573 Ga0501037_0003465 Ga0501037_0003465_8558_9424 262
22 3300049574 Ga0501038_0012232 Ga0501038_0012232_160_1026 262
23 3300049575 Ga0501039_0000413 Ga0501039_0000413_19520_20386 262
24 3300049579 Ga0501043_0002340 Ga0501043_0002340_11837_12703 262
25 3300049586 Ga0501070_0000301 Ga0501070_0000301_15374_16240 262
26 3300049589 Ga0501073_0046919 Ga0501073_0046919_1113_1979 262
27 3300049823 Ga0501044_0013974 Ga0501044_0013974_3586_4452 262
28 3300028379 Ga0268266_10549082 Ga0268266_105490821 266
29 3300037068 Ga0373925_0196960 Ga0373925_0196960_81_923 266
30 3300009036 Ga0105244_10041691 Ga0105244_100416912 268
31 3300011119 Ga0105246_10002782 Ga0105246_100027828 268
32 3300046809 Ga0495600_0125174 Ga0495600_0125174_788_1636 268
33 3300049568 Ga0501031_0084751 Ga0501031_0084751_1150_1998 268
34 3300049586 Ga0501070_0484822 Ga0501070_0484822_25_873 268
35 3300050490 nmdc:mga03n38_5500_c1 nmdc:mga03n38_5500_c1_1823_2671 268
36 3300050496 nmdc:mga07m45_46733_c1 nmdc:mga07m45_46733_c1_489_1337 268
37 3300014325 Ga0163163_10172731 Ga0163163_101727312 269
38 3300009545 Ga0105237_10079500 Ga0105237_100795003 271
39 3300013297 Ga0157378_10053432 Ga0157378_100534322 271
40 3300046524 Ga0495648_0006495 Ga0495648_0006495_1995_2858 271
41 3300047320 Ga0495672_0005364 Ga0495672_0005364_1288_2151 271
42 3300047469 Ga0495673_0001153 Ga0495673_0001153_5728_6591 271
43 3300048903 Ga0496100_0285904 Ga0496100_0285904_12_887 271
44 3300048905 Ga0496102_0062223 Ga0496102_0062223_563_1426 271
45 3300048907 Ga0496104_0137999 Ga0496104_0137999_718_1578 271
46 3300048909 Ga0496106_0163844 Ga0496106_0163844_159_1019 271
47 3300048923 Ga0496120_0060791 Ga0496120_0060791_1198_2076 271
48 3300044684 Ga0466966_0258692 Ga0466966_0258692_29_970 272
49 3300044842 Ga0466957_0063553 Ga0466957_0063553_356_1249 272
50 3300045836 Ga0466958_0243816 Ga0466958_0243816_209_1102 272
51 iso_pu_bacteria 2643221607 2644051420 272
52 iso_pu_bacteria 2643221636 2644201092 272
53 iso_pu_bacteria 2643221686 2644484324 272
54 3300045976 Ga0466967_0000412 Ga0466967_0000412_173_1135 273
55 3300045976 Ga0466967_0090540 Ga0466967_0090540_62_940 273
56 3300049823 Ga0501044_0066259 Ga0501044_0066259_41_919 273
57 3300013296 Ga0157374_10012755 Ga0157374_100127555 274
58 3300025931 Ga0207644_10039998 Ga0207644_100399982 274
59 3300053125 Ga0500618_000612 Ga0500618_000612_18082_18954 274
60 3300053153 Ga0500616_0033532 Ga0500616_0033532_235_1107 274
61 3300053730 Ga0500645_036164 Ga0500645_036164_129_1031 274
62 3300005466 Ga0070685_10031004 Ga0070685_100310042 275
63 3300046616 Ga0495668_0000128 Ga0495668_0000128_35003_35908 276
64 3300037853 Ga0436364_1016041 Ga0436364_1016041_681_1568 277
65 3300039437 Ga0436365_0664968 Ga0436365_0664968_2061_2948 277
66 3300044901 Ga0466960_0016305 Ga0466960_0016305_2038_2979 277
67 3300046460 Ga0495638_0008071 Ga0495638_0008071_2259_3161 277
68 3300049823 Ga0501044_0094263 Ga0501044_0094263_2069_2944 277
69 3300050492 nmdc:mga0yw44_52184_c1 nmdc:mga0yw44_52184_c1_1116_2033 277
70 3300053730 Ga0500645_000565 Ga0500645_000565_13435_14337 277
71 iso_pu_bacteria 2867346516 2867350104 277
72 iso_pu_bacteria 2997600082 2997606925 277
73 3300005445 Ga0070708_100136177 Ga0070708_1001361772 278
74 3300006844 Ga0075428_100198703 Ga0075428_1001987032 278
75 3300006847 Ga0075431_100661636 Ga0075431_1006616361 278
76 3300050510 nmdc:mga06r32_403866_c1 nmdc:mga06r32_403866_c1_411_1298 278
77 3300050516 nmdc:mga0sz30_1724_c1 nmdc:mga0sz30_1724_c1_4370_5272 278
78 3300005615 Ga0070702_100107025 Ga0070702_1001070252 279
79 3300021361 Ga0213872_10124712 Ga0213872_101247122 279
80 3300039447 Ga0436361_0713294 Ga0436361_0713294_1408_2316 279
81 iso_pu_bacteria 8056447290 8056451483 279
82 3300005467 Ga0070706_100491982 Ga0070706_1004919821 280
83 3300005985 Ga0081539_10003746 Ga0081539_1000374611 280
84 3300006051 Ga0075364_10309002 Ga0075364_103090021 280
85 3300048911 Ga0496108_0313349 Ga0496108_0313349_343_1248 280
86 3300048911 Ga0496108_0524909 Ga0496108_0524909_32_949 280
87 3300048928 Ga0496125_0037277 Ga0496125_0037277_2185_3090 280
88 3300050490 nmdc:mga03n38_188677_c1 nmdc:mga03n38_188677_c1_25_930 280
89 3300050496 nmdc:mga07m45_13721_c1 nmdc:mga07m45_13721_c1_1743_2648 280
90 iso_pu_bacteria 2643221673 2644409136 280
91 iso_pu_bacteria 2862290372 2862296635 280
92 iso_pu_bacteria 2523231044 2523386742 281
93 iso_pu_bacteria 2565956761 2566992043 281
94 iso_pu_bacteria 2643221687 2644486604 281
95 iso_pu_bacteria 2643221715 2644638330 281
96 iso_pu_bacteria 2738541274 2738705949 281
97 iso_pu_bacteria 2738543028 2739330429 281
98 iso_pu_bacteria 2767802112 2768646986 281
99 iso_pu_bacteria 2862281513 2862282994 281
100 iso_pu_bacteria 2873151551 2873156458 281
101 iso_pu_bacteria 2902792274 2902796701 281
102 iso_pu_bacteria 2902799365 2902801728 281
103 iso_pu_bacteria 2902810491 2902812242 281
104 iso_pu_bacteria 2904535858 2904538555 281
105 iso_pu_bacteria 2922554459 2922559286 281
106 iso_pu_bacteria 2939582691 2939588657 281
107 iso_pu_bacteria 2984523437 2984524954 281
108 3300003659 JGI25404J52841_10001019 JGI25404J52841_100010193 282
109 3300005983 Ga0081540_1001044 Ga0081540_100104419 282
110 3300009148 Ga0105243_10023025 Ga0105243_100230253 282
111 3300009986 Ga0105033_105012 Ga0105033_1050121 282
112 3300013105 Ga0157369_10521648 Ga0157369_105216482 282
113 3300046455 Ga0495603_0058650 Ga0495603_0058650_252_1154 282
114 3300046499 Ga0495594_0121465 Ga0495594_0121465_420_1322 282
115 3300046794 Ga0495589_0012127 Ga0495589_0012127_157_1059 282
116 3300046794 Ga0495589_0012562 Ga0495589_0012562_157_1059 282
117 3300047318 Ga0495636_0033723 Ga0495636_0033723_40_942 282
118 3300047323 Ga0495683_0098886 Ga0495683_0098886_478_1380 282
119 3300047447 Ga0495685_004930 Ga0495685_004930_3293_4195 282
120 3300050492 nmdc:mga0yw44_207032_c1 nmdc:mga0yw44_207032_c1_364_1284 282
121 3300053140 Ga0500573_0191670 Ga0500573_0191670_128_1027 282
122 iso_pu_bacteria 2515154129 2515721523 282
123 iso_pu_bacteria 2515154202 2516086162 282
124 iso_pu_bacteria 2547132111 2547412330 282
125 iso_pu_bacteria 2582581313 2585304187 282
126 iso_pu_bacteria 2616644814 2616693623 282
127 iso_pu_bacteria 2643221647 2644270407 282
128 iso_pu_bacteria 2643221678 2644440920 282
129 iso_pu_bacteria 2775506925 2776374876 282
130 iso_pu_bacteria 2784132148 2784591994 282
131 iso_pu_bacteria 2784746768 2785373251 282
132 iso_pu_bacteria 2786546132 2786674732 282
133 iso_pu_bacteria 2808606375 2808915108 282
134 iso_pu_bacteria 2808606448 2809235630 282
135 iso_pu_bacteria 2808606982 2811848376 282
136 iso_pu_bacteria 2811994879 2812354328 282
137 iso_pu_bacteria 2811994917 2812482855 282
138 iso_pu_bacteria 2852635781 2852635948 282
139 iso_pu_bacteria 2862178590 2862184782 282
140 iso_pu_bacteria 2862507626 2862507678 282
141 iso_pu_bacteria 2862574272 2862579866 282
142 iso_pu_bacteria 2863067949 2863074827 282
143 iso_pu_bacteria 2867428634 2867430009 282
144 iso_pu_bacteria 2877676314 2877677660 282
145 iso_pu_bacteria 2912723979 2912728916 282
146 iso_pu_bacteria 2912757875 2912760049 282
147 iso_pu_bacteria 2946064051 2946071373 282
148 iso_pu_bacteria 2947224130 2947225363 282
149 iso_pu_bacteria 2954380949 2954382419 282
150 iso_pu_bacteria 2954673503 2954680670 282
151 iso_pu_bacteria 2954682443 2954683483 282
152 iso_pu_bacteria 2954691527 2954693224 282
153 iso_pu_bacteria 2954701450 2954708321 282
154 iso_pu_bacteria 2954711539 2954712898 282
155 iso_pu_bacteria 2954721474 2954722856 282
156 iso_pu_bacteria 2954731030 2954738973 282
157 iso_pu_bacteria 2954740390 2954741767 282
158 iso_pu_bacteria 2954749733 2954757831 282
159 iso_pu_bacteria 2954759201 2954760746 282
160 iso_pu_bacteria 3006493962 3006494565 282
161 iso_pu_bacteria 8023623736 8023624176 282
162 iso_pu_bacteria 8025530807 8025536923 282
163 3300025297 Ga0209758_1004873 Ga0209758_10048735 283
164 3300042007 Ga0439449_0003409 Ga0439449_0003409_3430_4326 283
165 iso_pu_bacteria 2582581314 2585319069 283
166 iso_pu_bacteria 2912715099 2912715868 283
167 iso_pu_bacteria 2929212328 2929216598 283
168 iso_pu_bacteria 2954002825 2954003414 283
169 iso_pu_bacteria 3006393351 3006395457 283
170 iso_pu_bacteria 8008574985 8008575825 283
171 iso_pu_bacteria 8025478263 8025481752 283
172 iso_pu_bacteria 8056829672 8056836148 283
173 3300002075 JGI24738J21930_10012736 JGI24738J21930_100127361 284
174 3300003316 rootH1_10030847 rootH1_100308472 284
175 3300003316 rootH1_10039924 rootH1_100399242 284
176 3300003320 rootH2_10015356 rootH2_100153566 284
177 3300003354 JGI25160J50197_1007423 JGI25160J50197_10074231 284
178 3300003354 JGI25160J50197_1019006 JGI25160J50197_10190062 284
179 3300005539 Ga0068853_100107742 Ga0068853_1001077422 284
180 3300005614 Ga0068856_100128145 Ga0068856_1001281453 284
181 3300005937 Ga0081455_10067116 Ga0081455_100671163 284
182 3300005937 Ga0081455_10093426 Ga0081455_100934262 284
183 3300006038 Ga0075365_10088968 Ga0075365_100889682 284
184 3300006042 Ga0075368_10030260 Ga0075368_100302602 284
185 3300006042 Ga0075368_10035580 Ga0075368_100355802 284
186 3300006048 Ga0075363_100008072 Ga0075363_1000080725 284
187 3300006048 Ga0075363_100020295 Ga0075363_1000202954 284
188 3300006058 Ga0075432_10013820 Ga0075432_100138202 284
189 3300006178 Ga0075367_10024385 Ga0075367_100243852 284
190 3300006178 Ga0075367_10056257 Ga0075367_100562573 284
191 3300006353 Ga0075370_10017296 Ga0075370_100172962 284
192 3300006948 Ga0099826_10054431 Ga0099826_100544313 284
193 3300006948 Ga0099826_10060166 Ga0099826_100601662 284
194 3300009094 Ga0111539_10001835 Ga0111539_1000183516 284
195 3300009147 Ga0114129_10777883 Ga0114129_107778832 284
196 3300009148 Ga0105243_10053826 Ga0105243_100538263 284
197 3300011119 Ga0105246_10082859 Ga0105246_100828592 284
198 3300011119 Ga0105246_10261548 Ga0105246_102615481 284
199 3300013307 Ga0157372_10147659 Ga0157372_101476592 284
200 3300014497 Ga0182008_10001253 Ga0182008_100012534 284
201 3300014497 Ga0182008_10001941 Ga0182008_100019417 284
202 3300015261 Ga0182006_1054255 Ga0182006_10542552 284
203 3300015262 Ga0182007_10001202 Ga0182007_100012022 284
204 3300015262 Ga0182007_10001318 Ga0182007_100013184 284
205 3300015688 Ga0183367_1001 Ga0183367_1001978 284
206 3300015688 Ga0183367_1006 Ga0183367_1006337 284
207 3300015688 Ga0183367_1021 Ga0183367_102153 284
208 3300021388 Ga0213875_10012871 Ga0213875_100128714 284
209 3300025302 Ga0207426_1000790 Ga0207426_100079017 284
210 3300025302 Ga0207426_1007251 Ga0207426_10072514 284
211 3300025904 Ga0207647_10004145 Ga0207647_100041458 284
212 3300025904 Ga0207647_10006210 Ga0207647_100062107 284
213 3300026041 Ga0207639_10096026 Ga0207639_100960262 284
214 3300026078 Ga0207702_10068447 Ga0207702_100684473 284
215 3300027666 Ga0209282_1052640 Ga0209282_10526402 284
216 3300028786 Ga0307517_10004208 Ga0307517_1000420815 284
217 3300028794 Ga0307515_10000046 Ga0307515_10000046314 284
218 3300028794 Ga0307515_10034314 Ga0307515_100343145 284
219 3300028794 Ga0307515_10106091 Ga0307515_101060913 284
220 3300028794 Ga0307515_10150583 Ga0307515_101505832 284
221 3300030500 Ga0268256_1020506 Ga0268256_10205062 284
222 3300030521 Ga0307511_10049337 Ga0307511_100493373 284
223 3300030521 Ga0307511_10155770 Ga0307511_101557702 284
224 3300030522 Ga0307512_10043807 Ga0307512_100438072 284
225 3300031456 Ga0307513_10015302 Ga0307513_100153023 284
226 3300031456 Ga0307513_10019716 Ga0307513_100197168 284
227 3300031507 Ga0307509_10039748 Ga0307509_100397484 284
228 3300031507 Ga0307509_10193474 Ga0307509_101934742 284
229 3300031616 Ga0307508_10005047 Ga0307508_100050472 284
230 3300031616 Ga0307508_10012343 Ga0307508_100123436 284
231 3300031616 Ga0307508_10015165 Ga0307508_100151655 284
232 3300031616 Ga0307508_10023014 Ga0307508_100230145 284
233 3300031616 Ga0307508_10130526 Ga0307508_101305262 284
234 3300031649 Ga0307514_10003992 Ga0307514_100039927 284
235 3300031649 Ga0307514_10069990 Ga0307514_100699902 284
236 3300031649 Ga0307514_10079829 Ga0307514_100798292 284
237 3300031730 Ga0307516_10014667 Ga0307516_100146676 284
238 3300031838 Ga0307518_10048604 Ga0307518_100486042 284
239 3300032002 Ga0307416_100066381 Ga0307416_1000663813 284
240 3300033179 Ga0307507_10014232 Ga0307507_100142327 284
241 3300033179 Ga0307507_10015481 Ga0307507_100154817 284
242 3300033179 Ga0307507_10208544 Ga0307507_102085442 284
243 3300033180 Ga0307510_10158611 Ga0307510_101586112 284
244 3300037418 Ga0395900_0083875 Ga0395900_0083875_1286_2203 284
245 3300037418 Ga0395900_0256237 Ga0395900_0256237_68_982 284
246 3300037418 Ga0395900_0319301 Ga0395900_0319301_91_999 284
247 3300037466 Ga0395898_0015241 Ga0395898_0015241_2620_3537 284
248 3300037466 Ga0395898_0042453 Ga0395898_0042453_2821_3729 284
249 3300037466 Ga0395898_0073677 Ga0395898_0073677_1345_2247 284
250 3300037471 Ga0395905_0421335 Ga0395905_0421335_218_1126 284
251 3300037853 Ga0436364_0370574 Ga0436364_0370574_4560_5498 284
252 3300041404 Ga0439436_0007597 Ga0439436_0007597_578_1522 284
253 3300041404 Ga0439436_0024059 Ga0439436_0024059_523_1425 284
254 3300041512 Ga0451853_0186994 Ga0451853_0186994_1119_2021 284
255 3300041999 Ga0439433_0001850 Ga0439433_0001850_47_949 284
256 3300042005 Ga0439448_0007193 Ga0439448_0007193_1040_1942 284
257 3300042005 Ga0439448_0018547 Ga0439448_0018547_130_1074 284
258 3300042007 Ga0439449_0002442 Ga0439449_0002442_6195_7112 284
259 3300042007 Ga0439449_0033212 Ga0439449_0033212_780_1682 284
260 3300042007 Ga0439449_0040692 Ga0439449_0040692_724_1668 284
261 3300042012 Ga0439455_0003289 Ga0439455_0003289_15_917 284
262 3300042012 Ga0439455_0006433 Ga0439455_0006433_1217_2161 284
263 3300042014 Ga0439457_000977 Ga0439457_000977_6277_7221 284
264 3300042014 Ga0439457_002741 Ga0439457_002741_1609_2511 284
265 3300042015 Ga0439462_0002522 Ga0439462_0002522_226_1128 284
266 3300042131 Ga0450894_002382 Ga0450894_002382_1586_2512 284
267 3300042136 Ga0450900_002018 Ga0450900_002018_82_990 284
268 3300042138 Ga0450903_000575 Ga0450903_000575_2093_2995 284
269 3300042138 Ga0450903_001095 Ga0450903_001095_3050_3994 284
270 3300042157 Ga0439458_0000722 Ga0439458_0000722_1440_2342 284
271 3300042993 Ga0439440_0013027 Ga0439440_0013027_385_1293 284
272 3300044656 Ga0466969_0045354 Ga0466969_0045354_832_1740 284
273 3300044658 Ga0466972_0002060 Ga0466972_0002060_7107_8009 284
274 3300044658 Ga0466972_0011100 Ga0466972_0011100_1731_2633 284
275 3300044658 Ga0466972_0127922 Ga0466972_0127922_36_953 284
276 3300044683 Ga0466965_0000288 Ga0466965_0000288_5690_6592 284
277 3300044683 Ga0466965_0126935 Ga0466965_0126935_280_1182 284
278 3300044684 Ga0466966_0002830 Ga0466966_0002830_5473_6375 284
279 3300044684 Ga0466966_0004237 Ga0466966_0004237_2190_3098 284
280 3300044694 Ga0466963_0001177 Ga0466963_0001177_5473_6375 284
281 3300044694 Ga0466963_0008746 Ga0466963_0008746_472_1392 284
282 3300044706 Ga0466964_0001884 Ga0466964_0001884_1925_2827 284
283 3300044719 Ga0466971_0003539 Ga0466971_0003539_4829_5731 284
284 3300044719 Ga0466971_0025437 Ga0466971_0025437_662_1570 284
285 3300044765 Ga0466970_0008602 Ga0466970_0008602_1094_2011 284
286 3300044765 Ga0466970_0010797 Ga0466970_0010797_2543_3445 284
287 3300044842 Ga0466957_0009571 Ga0466957_0009571_4423_5325 284
288 3300044842 Ga0466957_0090970 Ga0466957_0090970_548_1450 284
289 3300044901 Ga0466960_0001508 Ga0466960_0001508_57_959 284
290 3300045049 Ga0466959_0008657 Ga0466959_0008657_5473_6375 284
291 3300045836 Ga0466958_0001015 Ga0466958_0001015_7039_7941 284
292 3300045976 Ga0466967_0017691 Ga0466967_0017691_4528_5430 284
293 3300045976 Ga0466967_0053051 Ga0466967_0053051_1178_2080 284
294 3300045976 Ga0466967_0349201 Ga0466967_0349201_462_1379 284
295 3300046453 Ga0495627_017353 Ga0495627_017353_726_1655 284
296 3300046454 Ga0495592_0088282 Ga0495592_0088282_1136_2038 284
297 3300046455 Ga0495603_0019345 Ga0495603_0019345_2576_3553 284
298 3300046457 Ga0495590_0048739 Ga0495590_0048739_263_1165 284
299 3300046459 Ga0495629_0011063 Ga0495629_0011063_2945_3853 284
300 3300046459 Ga0495629_0012494 Ga0495629_0012494_4520_5428 284
301 3300046459 Ga0495629_0072468 Ga0495629_0072468_273_1250 284
302 3300046460 Ga0495638_0183262 Ga0495638_0183262_144_1052 284
303 3300046462 Ga0495651_0001558 Ga0495651_0001558_14411_15319 284
304 3300046476 Ga0495662_0000305 Ga0495662_0000305_14470_15378 284
305 3300046476 Ga0495662_0016026 Ga0495662_0016026_667_1644 284
306 3300046476 Ga0495662_0090269 Ga0495662_0090269_465_1442 284
307 3300046477 Ga0495664_0146605 Ga0495664_0146605_426_1328 284
308 3300046499 Ga0495594_0003881 Ga0495594_0003881_5075_6052 284
309 3300046501 Ga0495607_0069572 Ga0495607_0069572_218_1120 284
310 3300046507 Ga0495606_0007166 Ga0495606_0007166_8262_9164 284
311 3300046512 Ga0495610_0122337 Ga0495610_0122337_107_1009 284
312 3300046513 Ga0495616_0030023 Ga0495616_0030023_483_1385 284
313 3300046514 Ga0495618_0017879 Ga0495618_0017879_3215_4123 284
314 3300046516 Ga0495628_0090038 Ga0495628_0090038_556_1464 284
315 3300046516 Ga0495628_0176393 Ga0495628_0176393_511_1413 284
316 3300046517 Ga0495630_0032749 Ga0495630_0032749_1071_1979 284
317 3300046517 Ga0495630_0085244 Ga0495630_0085244_1162_2145 284
318 3300046518 Ga0495631_0005052 Ga0495631_0005052_610_1512 284
319 3300046522 Ga0495643_0021076 Ga0495643_0021076_2519_3421 284
320 3300046524 Ga0495648_0073713 Ga0495648_0073713_727_1629 284
321 3300046526 Ga0495666_0023421 Ga0495666_0023421_1835_2737 284
322 3300046529 Ga0495652_0104742 Ga0495652_0104742_158_1066 284
323 3300046529 Ga0495652_0341063 Ga0495652_0341063_108_1010 284
324 3300046530 Ga0495654_0089547 Ga0495654_0089547_12_914 284
325 3300046533 Ga0495640_0259776 Ga0495640_0259776_133_1041 284
326 3300046535 Ga0495586_0062897 Ga0495586_0062897_202_1131 284
327 3300046536 Ga0495587_0011507 Ga0495587_0011507_3481_4389 284
328 3300046538 Ga0495609_0018220 Ga0495609_0018220_2132_3034 284
329 3300046543 Ga0495645_0084185 Ga0495645_0084185_1102_2010 284
330 3300046557 Ga0495622_0092011 Ga0495622_0092011_458_1369 284
331 3300046558 Ga0495633_0045335 Ga0495633_0045335_507_1409 284
332 3300046558 Ga0495633_0068545 Ga0495633_0068545_183_1160 284
333 3300046559 Ga0495667_0223730 Ga0495667_0223730_117_1019 284
334 3300046615 Ga0495656_0021881 Ga0495656_0021881_542_1519 284
335 3300046616 Ga0495668_0010814 Ga0495668_0010814_2915_3817 284
336 3300046642 Ga0495634_0008925 Ga0495634_0008925_1068_1976 284
337 3300046660 Ga0495625_0037842 Ga0495625_0037842_2464_3366 284
338 3300046663 Ga0495635_0006889 Ga0495635_0006889_6245_7153 284
339 3300046665 Ga0495661_0035615 Ga0495661_0035615_170_1072 284
340 3300046674 Ga0495588_0019104 Ga0495588_0019104_1624_2532 284
341 3300046675 Ga0495657_0006337 Ga0495657_0006337_2406_3314 284
342 3300046675 Ga0495657_0008870 Ga0495657_0008870_354_1337 284
343 3300046675 Ga0495657_0045638 Ga0495657_0045638_475_1377 284
344 3300046680 Ga0495646_0001231 Ga0495646_0001231_206_1114 284
345 3300046683 Ga0495658_0008137 Ga0495658_0008137_3116_4027 284
346 3300046689 Ga0495613_0038091 Ga0495613_0038091_2541_3524 284
347 3300046689 Ga0495613_0047649 Ga0495613_0047649_1470_2372 284
348 3300046689 Ga0495613_0051651 Ga0495613_0051651_1057_1965 284
349 3300046692 Ga0495671_0012968 Ga0495671_0012968_397_1305 284
350 3300046694 Ga0495649_0176746 Ga0495649_0176746_188_1090 284
351 3300046794 Ga0495589_0006883 Ga0495589_0006883_2546_3505 284
352 3300046794 Ga0495589_0016490 Ga0495589_0016490_2597_3499 284
353 3300046809 Ga0495600_0032445 Ga0495600_0032445_638_1540 284
354 3300047315 Ga0495581_0037673 Ga0495581_0037673_827_1735 284
355 3300047315 Ga0495581_0105974 Ga0495581_0105974_440_1417 284
356 3300047317 Ga0495604_0000811 Ga0495604_0000811_14688_15596 284
357 3300047318 Ga0495636_0000665 Ga0495636_0000665_8883_9800 284
358 3300047318 Ga0495636_0019787 Ga0495636_0019787_1202_2161 284
359 3300047318 Ga0495636_0026473 Ga0495636_0026473_38_1015 284
360 3300047319 Ga0495674_0240708 Ga0495674_0240708_492_1394 284
361 3300047321 Ga0495676_0009915 Ga0495676_0009915_6739_7647 284
362 3300047321 Ga0495676_0010110 Ga0495676_0010110_943_1845 284
363 3300047321 Ga0495676_0023642 Ga0495676_0023642_4277_5179 284
364 3300047443 Ga0495687_001148 Ga0495687_001148_16611_17528 284
365 3300047443 Ga0495687_036096 Ga0495687_036096_268_1170 284
366 3300047443 Ga0495687_054907 Ga0495687_054907_487_1395 284
367 3300047443 Ga0495687_068286 Ga0495687_068286_234_1145 284
368 3300047444 Ga0495675_0248015 Ga0495675_0248015_22_1005 284
369 3300047445 Ga0495677_0016191 Ga0495677_0016191_303_1205 284
370 3300047447 Ga0495685_001061 Ga0495685_001061_37_939 284
371 3300047447 Ga0495685_001209 Ga0495685_001209_6730_7689 284
372 3300047447 Ga0495685_001477 Ga0495685_001477_4230_5132 284
373 3300047470 Ga0495681_0091638 Ga0495681_0091638_337_1263 284
374 3300047472 Ga0495686_0048992 Ga0495686_0048992_1023_1925 284
375 3300047673 Ga0495593_0034697 Ga0495593_0034697_793_1701 284
376 3300048088 Ga0495602_0142074 Ga0495602_0142074_762_1670 284
377 3300048089 Ga0495614_0022354 Ga0495614_0022354_1174_2082 284
378 3300048091 Ga0495626_0059545 Ga0495626_0059545_828_1730 284
379 3300049459 Ga0495678_056138 Ga0495678_056138_114_1016 284
380 3300049460 Ga0495682_0038634 Ga0495682_0038634_154_1056 284
381 3300049568 Ga0501031_0122287 Ga0501031_0122287_561_1481 284
382 3300049569 Ga0501032_0025037 Ga0501032_0025037_550_1470 284
383 3300049570 Ga0501033_0007160 Ga0501033_0007160_366_1274 284
384 3300049570 Ga0501033_0045356 Ga0501033_0045356_2216_3118 284
385 3300049570 Ga0501033_0057629 Ga0501033_0057629_1466_2386 284
386 3300049570 Ga0501033_0232612 Ga0501033_0232612_381_1283 284
387 3300049571 Ga0501034_0006804 Ga0501034_0006804_5090_5992 284
388 3300049571 Ga0501034_0031681 Ga0501034_0031681_680_1582 284
389 3300049571 Ga0501034_0046795 Ga0501034_0046795_1157_2077 284
390 3300049571 Ga0501034_0100512 Ga0501034_0100512_1570_2496 284
391 3300049572 Ga0501036_0009835 Ga0501036_0009835_154_1056 284
392 3300049572 Ga0501036_0017920 Ga0501036_0017920_4350_5252 284
393 3300049572 Ga0501036_0033678 Ga0501036_0033678_2893_3813 284
394 3300049573 Ga0501037_0031766 Ga0501037_0031766_2565_3485 284
395 3300049574 Ga0501038_0002496 Ga0501038_0002496_2054_2980 284
396 3300049574 Ga0501038_0041961 Ga0501038_0041961_148_1050 284
397 3300049574 Ga0501038_0043522 Ga0501038_0043522_2425_3345 284
398 3300049574 Ga0501038_0104210 Ga0501038_0104210_602_1504 284
399 3300049575 Ga0501039_0140183 Ga0501039_0140183_532_1452 284
400 3300049575 Ga0501039_0222091 Ga0501039_0222091_431_1333 284
401 3300049578 Ga0501042_0007681 Ga0501042_0007681_894_1814 284
402 3300049579 Ga0501043_0037168 Ga0501043_0037168_663_1583 284
403 3300049579 Ga0501043_0076802 Ga0501043_0076802_1026_1952 284
404 3300049580 Ga0501046_0013758 Ga0501046_0013758_5302_6222 284
405 3300049580 Ga0501046_0070356 Ga0501046_0070356_1092_2012 284
406 3300049581 Ga0501047_0019290 Ga0501047_0019290_3176_4102 284
407 3300049581 Ga0501047_0065802 Ga0501047_0065802_606_1526 284
408 3300049582 Ga0501048_0032054 Ga0501048_0032054_195_1115 284
409 3300049583 Ga0501067_0100241 Ga0501067_0100241_603_1547 284
410 3300049586 Ga0501070_0001683 Ga0501070_0001683_8051_8953 284
411 3300049586 Ga0501070_0154194 Ga0501070_0154194_648_1550 284
412 3300049589 Ga0501073_0148989 Ga0501073_0148989_90_992 284
413 3300049590 Ga0501074_0011845 Ga0501074_0011845_2804_3706 284
414 3300049742 Ga0501080_0025716 Ga0501080_0025716_197_1123 284
415 3300049744 Ga0501083_0152710 Ga0501083_0152710_503_1423 284
416 3300049822 Ga0501035_0096585 Ga0501035_0096585_1237_2145 284
417 3300049822 Ga0501035_0178639 Ga0501035_0178639_867_1769 284
418 3300049822 Ga0501035_0181611 Ga0501035_0181611_575_1495 284
419 3300049823 Ga0501044_0001741 Ga0501044_0001741_2014_2916 284
420 3300049823 Ga0501044_0013221 Ga0501044_0013221_7739_8665 284
421 3300049823 Ga0501044_0118192 Ga0501044_0118192_653_1573 284
422 3300049823 Ga0501044_0222544 Ga0501044_0222544_318_1238 284
423 3300050490 nmdc:mga03n38_15033_c1 nmdc:mga03n38_15033_c1_1533_2432 284
424 3300050492 nmdc:mga0yw44_339099_c1 nmdc:mga0yw44_339099_c1_76_978 284
425 3300050494 nmdc:mga06z11_15221_c1 nmdc:mga06z11_15221_c1_1037_1981 284
426 3300050494 nmdc:mga06z11_39550_c1 nmdc:mga06z11_39550_c1_279_1181 284
427 3300050495 nmdc:mga04h51_5954_c1 nmdc:mga04h51_5954_c1_1102_2046 284
428 3300050495 nmdc:mga04h51_9671_c1 nmdc:mga04h51_9671_c1_776_1678 284
429 3300050496 nmdc:mga07m45_146616_c1 nmdc:mga07m45_146616_c1_260_1162 284
430 3300050512 nmdc:mga0n895_320_c1 nmdc:mga0n895_320_c1_16235_17143 284
431 3300050513 nmdc:mga0rr50_25073_c1 nmdc:mga0rr50_25073_c1_1379_2287 284
432 3300050514 nmdc:mga08x19_3141_c1 nmdc:mga08x19_3141_c1_4826_5734 284
433 3300050515 nmdc:mga0a205_5899_c1 nmdc:mga0a205_5899_c1_4965_5873 284
434 3300053078 Ga0495612_0118723 Ga0495612_0118723_106_1014 284
435 3300053083 Ga0495655_0052742 Ga0495655_0052742_72_980 284
436 3300053088 Ga0500644_0050462 Ga0500644_0050462_229_1137 284
437 3300053095 Ga0500640_044138 Ga0500640_044138_249_1157 284
438 3300053100 Ga0500660_028431 Ga0500660_028431_1259_2170 284
439 3300053101 Ga0500553_088478 Ga0500553_088478_244_1155 284
440 3300053101 Ga0500553_104864 Ga0500553_104864_203_1111 284
441 3300053107 Ga0500560_079931 Ga0500560_079931_30_941 284
442 3300053113 Ga0500580_089720 Ga0500580_089720_58_969 284
443 3300061719 Ga0466962_0021927 Ga0466962_0021927_1888_2796 284
444 3300061719 Ga0466962_0053549 Ga0466962_0053549_816_1718 284
445 iso_pu_bacteria 2554235005 2554260022 284
446 iso_pu_bacteria 2582581313 2585309201 284
447 iso_pu_bacteria 2582581314 2585319810 284
448 iso_pu_bacteria 2643221548 2643759848 284
449 iso_pu_bacteria 2643221578 2643897991 284
450 iso_pu_bacteria 2643221587 2643944567 284
451 iso_pu_bacteria 2643221647 2644263217 284
452 iso_pu_bacteria 2643221670 2644385505 284
453 iso_pu_bacteria 2643221677 2644431465 284
454 iso_pu_bacteria 2643221678 2644436520 284
455 iso_pu_bacteria 2643221682 2644462733 284
456 iso_pu_bacteria 2643221714 2644625635 284
457 iso_pu_bacteria 2784746763 2785344158 284
458 iso_pu_bacteria 2784746768 2785368738 284
459 iso_pu_bacteria 2786546132 2786669845 284
460 iso_pu_bacteria 2791355406 2793978115 284
461 iso_pu_bacteria 2802429296 2804844991 284
462 iso_pu_bacteria 2808606359 2808841409 284
463 iso_pu_bacteria 2808606375 2808919975 284
464 iso_pu_bacteria 2818991463 2819693564 284
465 iso_pu_bacteria 2862281513 2862287978 284
466 iso_pu_bacteria 2862382967 2862383137 284
467 iso_pu_bacteria 2863404153 2863405414 284
468 iso_pu_bacteria 2867369537 2867371281 284
469 iso_pu_bacteria 2867428634 2867431481 284
470 iso_pu_bacteria 2867475112 2867480495 284
471 iso_pu_bacteria 2875391855 2875393889 284
472 iso_pu_bacteria 2877676314 2877681775 284
473 iso_pu_bacteria 2918501144 2918503938 284
474 iso_pu_bacteria 2919468124 2919468802 284
475 iso_pu_bacteria 2935390628 2935394594 284
476 iso_pu_bacteria 2946045630 2946050752 284
477 iso_pu_bacteria 2946072368 2946075342 284
478 iso_pu_bacteria 2954380949 2954386922 284
479 iso_pu_bacteria 2954673503 2954676274 284
480 iso_pu_bacteria 2954682443 2954687895 284
481 iso_pu_bacteria 2954691527 2954697734 284
482 iso_pu_bacteria 2954701450 2954704482 284
483 iso_pu_bacteria 2954711539 2954716863 284
484 iso_pu_bacteria 2954721474 2954726811 284
485 iso_pu_bacteria 2954731030 2954734984 284
486 iso_pu_bacteria 2954740390 2954745734 284
487 iso_pu_bacteria 2954749733 2954753856 284
488 iso_pu_bacteria 2954759201 2954764708 284
489 iso_pu_bacteria 2966598605 2966603190 284
490 iso_pu_bacteria 2990059506 2990065815 284
491 iso_pu_bacteria 2990088156 2990091159 284
492 iso_pu_bacteria 2997451912 2997456656 284
493 iso_pu_bacteria 2997600082 2997608068 284
494 iso_pu_bacteria 3006425503 3006426837 284
495 iso_pu_bacteria 3006486233 3006493698 284
496 iso_pu_bacteria 8008558824 8008559665 284
497 iso_pu_bacteria 8025413630 8025418953 284
498 iso_pu_bacteria 8047893842 8047898779 284
499 iso_pu_bacteria 8048127548 8048131568 284
500 iso_pu_bacteria 8048356638 8048360140 284
501 iso_pu_bacteria 8048369669 8048375739 284
502 iso_pu_bacteria 8048379754 8048382466 284
503 iso_pu_bacteria 8048406513 8048409334 284
504 iso_pu_bacteria 8054160619 8054162900 284
505 iso_pu_bacteria 8056667051 8056672425 284
506 iso_pu_bacteria 8056829672 8056830184 284
507 3300002077 JGI24744J21845_10004246 JGI24744J21845_100042462 285
508 3300002239 JGI24034J26672_10010430 JGI24034J26672_100104302 285
509 3300005328 Ga0070676_10013125 Ga0070676_100131253 285
510 3300005330 Ga0070690_100118651 Ga0070690_1001186512 285
511 3300005334 Ga0068869_100463230 Ga0068869_1004632301 285
512 3300005335 Ga0070666_10329768 Ga0070666_103297681 285
513 3300005337 Ga0070682_100025193 Ga0070682_1000251932 285
514 3300005337 Ga0070682_100069467 Ga0070682_1000694672 285
515 3300005337 Ga0070682_100271185 Ga0070682_1002711851 285
516 3300005338 Ga0068868_100021572 Ga0068868_1000215722 285
517 3300005339 Ga0070660_100223742 Ga0070660_1002237422 285
518 3300005340 Ga0070689_100052755 Ga0070689_1000527552 285
519 3300005347 Ga0070668_100000258 Ga0070668_10000025831 285
520 3300005347 Ga0070668_100032029 Ga0070668_1000320293 285
521 3300005347 Ga0070668_100331507 Ga0070668_1003315071 285
522 3300005353 Ga0070669_100021773 Ga0070669_1000217733 285
523 3300005355 Ga0070671_100109400 Ga0070671_1001094002 285
524 3300005356 Ga0070674_100014431 Ga0070674_1000144313 285
525 3300005364 Ga0070673_100377266 Ga0070673_1003772661 285
526 3300005365 Ga0070688_100027997 Ga0070688_1000279972 285
527 3300005366 Ga0070659_100102195 Ga0070659_1001021952 285
528 3300005366 Ga0070659_100197470 Ga0070659_1001974702 285
529 3300005366 Ga0070659_100368251 Ga0070659_1003682511 285
530 3300005367 Ga0070667_100000077 Ga0070667_10000007794 285
531 3300005367 Ga0070667_100059707 Ga0070667_1000597072 285
532 3300005367 Ga0070667_100108548 Ga0070667_1001085482 285
533 3300005435 Ga0070714_100178474 Ga0070714_1001784741 285
534 3300005437 Ga0070710_10016525 Ga0070710_100165252 285
535 3300005438 Ga0070701_10001956 Ga0070701_100019564 285
536 3300005439 Ga0070711_100003805 Ga0070711_1000038054 285
537 3300005441 Ga0070700_100011281 Ga0070700_1000112812 285
538 3300005455 Ga0070663_100029769 Ga0070663_1000297693 285
539 3300005455 Ga0070663_100155109 Ga0070663_1001551092 285
540 3300005456 Ga0070678_100036168 Ga0070678_1000361683 285
541 3300005456 Ga0070678_100037113 Ga0070678_1000371132 285
542 3300005456 Ga0070678_100069532 Ga0070678_1000695322 285
543 3300005457 Ga0070662_100014744 Ga0070662_1000147442 285
544 3300005459 Ga0068867_100014648 Ga0068867_1000146484 285
545 3300005466 Ga0070685_10205411 Ga0070685_102054111 285
546 3300005539 Ga0068853_100035405 Ga0068853_1000354053 285
547 3300005545 Ga0070695_100071099 Ga0070695_1000710992 285
548 3300005546 Ga0070696_100014519 Ga0070696_1000145193 285
549 3300005547 Ga0070693_100014604 Ga0070693_1000146044 285
550 3300005548 Ga0070665_100007324 Ga0070665_1000073248 285
551 3300005548 Ga0070665_100030094 Ga0070665_1000300942 285
552 3300005548 Ga0070665_100041694 Ga0070665_1000416944 285
553 3300005549 Ga0070704_100032574 Ga0070704_1000325742 285
554 3300005563 Ga0068855_100244810 Ga0068855_1002448101 285
555 3300005578 Ga0068854_100015472 Ga0068854_1000154724 285
556 3300005578 Ga0068854_100237154 Ga0068854_1002371542 285
557 3300005615 Ga0070702_100014396 Ga0070702_1000143962 285
558 3300005615 Ga0070702_100111447 Ga0070702_1001114472 285
559 3300005615 Ga0070702_100265205 Ga0070702_1002652052 285
560 3300005617 Ga0068859_100000438 Ga0068859_1000004386 285
561 3300005617 Ga0068859_100042006 Ga0068859_1000420064 285
562 3300005617 Ga0068859_100117895 Ga0068859_1001178952 285
563 3300005718 Ga0068866_10005609 Ga0068866_100056094 285
564 3300005719 Ga0068861_100038820 Ga0068861_1000388202 285
565 3300005719 Ga0068861_100063709 Ga0068861_1000637092 285
566 3300005841 Ga0068863_100000777 Ga0068863_10000077730 285
567 3300005841 Ga0068863_100011776 Ga0068863_1000117767 285
568 3300005841 Ga0068863_100173859 Ga0068863_1001738592 285
569 3300005842 Ga0068858_100008639 Ga0068858_1000086395 285
570 3300005842 Ga0068858_100034036 Ga0068858_1000340362 285
571 3300005843 Ga0068860_100000010 Ga0068860_100000010254 285
572 3300005843 Ga0068860_100025586 Ga0068860_1000255864 285
573 3300005843 Ga0068860_100439666 Ga0068860_1004396662 285
574 3300005844 Ga0068862_100000008 Ga0068862_10000000869 285
575 3300005844 Ga0068862_100030155 Ga0068862_1000301554 285
576 3300005937 Ga0081455_10025168 Ga0081455_100251683 285
577 3300005983 Ga0081540_1043683 Ga0081540_10436832 285
578 3300006038 Ga0075365_10006361 Ga0075365_100063614 285
579 3300006038 Ga0075365_10197601 Ga0075365_101976012 285
580 3300006048 Ga0075363_100012279 Ga0075363_1000122792 285
581 3300006048 Ga0075363_100053836 Ga0075363_1000538362 285
582 3300006051 Ga0075364_10002441 Ga0075364_100024417 285
583 3300006051 Ga0075364_10024121 Ga0075364_100241212 285
584 3300006173 Ga0070716_100013793 Ga0070716_1000137932 285
585 3300006175 Ga0070712_100018992 Ga0070712_1000189923 285
586 3300006186 Ga0075369_10000277 Ga0075369_100002772 285
587 3300006186 Ga0075369_10012034 Ga0075369_100120342 285
588 3300006237 Ga0097621_100071607 Ga0097621_1000716072 285
589 3300006353 Ga0075370_10014632 Ga0075370_100146324 285
590 3300006353 Ga0075370_10271461 Ga0075370_102714611 285
591 3300006358 Ga0068871_100051699 Ga0068871_1000516994 285
592 3300006844 Ga0075428_100002077 Ga0075428_10000207719 285
593 3300006846 Ga0075430_100008157 Ga0075430_1000081576 285
594 3300006847 Ga0075431_100085932 Ga0075431_1000859322 285
595 3300006881 Ga0068865_100004289 Ga0068865_1000042895 285
596 3300006931 Ga0097620_100000438 Ga0097620_1000004386 285
597 3300006931 Ga0097620_100042004 Ga0097620_1000420044 285
598 3300006931 Ga0097620_100117893 Ga0097620_1001178932 285
599 3300009092 Ga0105250_10008787 Ga0105250_100087872 285
600 3300009094 Ga0111539_10294889 Ga0111539_102948892 285
601 3300009098 Ga0105245_10029615 Ga0105245_100296153 285
602 3300009101 Ga0105247_10004190 Ga0105247_1000419010 285
603 3300009101 Ga0105247_10086458 Ga0105247_100864582 285
604 3300009147 Ga0114129_10096472 Ga0114129_100964722 285
605 3300009148 Ga0105243_10017855 Ga0105243_100178553 285
606 3300009176 Ga0105242_10011766 Ga0105242_100117662 285
607 3300009177 Ga0105248_10000093 Ga0105248_1000009362 285
608 3300009177 Ga0105248_10016994 Ga0105248_100169942 285
609 3300009177 Ga0105248_10029565 Ga0105248_100295653 285
610 3300009545 Ga0105237_10064180 Ga0105237_100641803 285
611 3300009551 Ga0105238_10260762 Ga0105238_102607622 285
612 3300009553 Ga0105249_10000019 Ga0105249_1000001967 285
613 3300009553 Ga0105249_10028056 Ga0105249_100280564 285
614 3300010375 Ga0105239_10222177 Ga0105239_102221772 285
615 3300010375 Ga0105239_10369296 Ga0105239_103692962 285
616 3300013297 Ga0157378_10035989 Ga0157378_100359892 285
617 3300013306 Ga0163162_10009988 Ga0163162_100099886 285
618 3300013306 Ga0163162_10031792 Ga0163162_100317924 285
619 3300013307 Ga0157372_10044562 Ga0157372_100445622 285
620 3300013308 Ga0157375_10026309 Ga0157375_100263094 285
621 3300014325 Ga0163163_10205773 Ga0163163_102057732 285
622 3300014326 Ga0157380_10013449 Ga0157380_100134494 285
623 3300014968 Ga0157379_10026709 Ga0157379_100267093 285
624 3300014969 Ga0157376_10121431 Ga0157376_101214311 285
625 3300017792 Ga0163161_10018886 Ga0163161_100188862 285
626 3300025898 Ga0207692_10034037 Ga0207692_100340371 285
627 3300025899 Ga0207642_10001150 Ga0207642_100011503 285
628 3300025900 Ga0207710_10000036 Ga0207710_1000003652 285
629 3300025900 Ga0207710_10004865 Ga0207710_100048653 285
630 3300025901 Ga0207688_10009339 Ga0207688_100093394 285
631 3300025901 Ga0207688_10011084 Ga0207688_100110844 285
632 3300025903 Ga0207680_10028654 Ga0207680_100286544 285
633 3300025907 Ga0207645_10024618 Ga0207645_100246184 285
634 3300025908 Ga0207643_10123462 Ga0207643_101234622 285
635 3300025914 Ga0207671_10082828 Ga0207671_100828282 285
636 3300025914 Ga0207671_10161455 Ga0207671_101614552 285
637 3300025915 Ga0207693_10031555 Ga0207693_100315554 285
638 3300025916 Ga0207663_10008831 Ga0207663_100088312 285
639 3300025918 Ga0207662_10169293 Ga0207662_101692932 285
640 3300025919 Ga0207657_10217836 Ga0207657_102178362 285
641 3300025923 Ga0207681_10000911 Ga0207681_1000091114 285
642 3300025926 Ga0207659_10094965 Ga0207659_100949652 285
643 3300025927 Ga0207687_10022173 Ga0207687_100221732 285
644 3300025929 Ga0207664_10268312 Ga0207664_102683122 285
645 3300025932 Ga0207690_10024822 Ga0207690_100248223 285
646 3300025933 Ga0207706_10011561 Ga0207706_100115614 285
647 3300025934 Ga0207686_10014368 Ga0207686_100143682 285
648 3300025935 Ga0207709_10231279 Ga0207709_102312792 285
649 3300025936 Ga0207670_10319645 Ga0207670_103196452 285
650 3300025937 Ga0207669_10005203 Ga0207669_100052034 285
651 3300025938 Ga0207704_10003456 Ga0207704_100034563 285
652 3300025939 Ga0207665_10085837 Ga0207665_100858372 285
653 3300025941 Ga0207711_10000102 Ga0207711_1000010221 285
654 3300025941 Ga0207711_10053321 Ga0207711_100533212 285
655 3300025942 Ga0207689_10038617 Ga0207689_100386174 285
656 3300025961 Ga0207712_10000025 Ga0207712_10000025184 285
657 3300025961 Ga0207712_10030682 Ga0207712_100306823 285
658 3300025972 Ga0207668_10000858 Ga0207668_100008589 285
659 3300025972 Ga0207668_10012838 Ga0207668_100128382 285
660 3300025981 Ga0207640_10016612 Ga0207640_100166122 285
661 3300025986 Ga0207658_10000593 Ga0207658_1000059317 285
662 3300025986 Ga0207658_10018718 Ga0207658_100187183 285
663 3300025986 Ga0207658_10021481 Ga0207658_100214814 285
664 3300025986 Ga0207658_10063322 Ga0207658_100633222 285
665 3300026023 Ga0207677_10004981 Ga0207677_100049815 285
666 3300026035 Ga0207703_10034863 Ga0207703_100348633 285
667 3300026035 Ga0207703_10082270 Ga0207703_100822703 285
668 3300026041 Ga0207639_10005386 Ga0207639_100053868 285
669 3300026041 Ga0207639_10018925 Ga0207639_100189252 285
670 3300026067 Ga0207678_10007984 Ga0207678_100079842 285
671 3300026075 Ga0207708_10020348 Ga0207708_100203482 285
672 3300026088 Ga0207641_10010691 Ga0207641_100106915 285
673 3300026089 Ga0207648_10019145 Ga0207648_100191454 285
674 3300026095 Ga0207676_10261604 Ga0207676_102616042 285
675 3300026095 Ga0207676_10375334 Ga0207676_103753342 285
676 3300026121 Ga0207683_10022246 Ga0207683_100222464 285
677 3300026121 Ga0207683_10118424 Ga0207683_101184243 285
678 3300026121 Ga0207683_10214896 Ga0207683_102148962 285
679 3300026142 Ga0207698_10073838 Ga0207698_100738383 285
680 3300026142 Ga0207698_10308578 Ga0207698_103085782 285
681 3300028379 Ga0268266_10013583 Ga0268266_100135832 285
682 3300028379 Ga0268266_10034979 Ga0268266_100349792 285
683 3300028379 Ga0268266_10078584 Ga0268266_100785842 285
684 3300028380 Ga0268265_10000007 Ga0268265_1000000767 285
685 3300028380 Ga0268265_10013185 Ga0268265_100131852 285
686 3300028381 Ga0268264_10000007 Ga0268264_10000007203 285
687 3300028381 Ga0268264_10024292 Ga0268264_100242923 285
688 3300028381 Ga0268264_10258421 Ga0268264_102584212 285
689 3300028381 Ga0268264_10384548 Ga0268264_103845482 285
690 3300031824 Ga0307413_10094073 Ga0307413_100940732 285
691 3300041410 Ga0439461_0000622 Ga0439461_0000622_3822_4727 285
692 3300041411 Ga0439466_0010203 Ga0439466_0010203_576_1481 285
693 3300041413 Ga0439465_0004933 Ga0439465_0004933_561_1463 285
694 3300041456 Ga0451795_0177854 Ga0451795_0177854_1993_2898 285
695 3300041997 Ga0439431_0004964 Ga0439431_0004964_251_1156 285
696 3300042435 Ga0439434_0003247 Ga0439434_0003247_2267_3172 285
697 3300042435 Ga0439434_0045611 Ga0439434_0045611_86_988 285
698 3300044658 Ga0466972_0001755 Ga0466972_0001755_9236_10141 285
699 3300044658 Ga0466972_0020443 Ga0466972_0020443_1041_1943 285
700 3300044683 Ga0466965_0000502 Ga0466965_0000502_1985_2890 285
701 3300044765 Ga0466970_0005387 Ga0466970_0005387_1966_2958 285
702 3300044765 Ga0466970_0025003 Ga0466970_0025003_350_1252 285
703 3300044765 Ga0466970_0037802 Ga0466970_0037802_573_1475 285
704 3300044765 Ga0466970_0160682 Ga0466970_0160682_290_1195 285
705 3300044842 Ga0466957_0025969 Ga0466957_0025969_1746_2648 285
706 3300044901 Ga0466960_0090547 Ga0466960_0090547_316_1275 285
707 3300045976 Ga0466967_0061221 Ga0466967_0061221_496_1401 285
708 3300046452 Ga0495617_025457 Ga0495617_025457_375_1304 285
709 3300046455 Ga0495603_0033670 Ga0495603_0033670_1663_2613 285
710 3300046459 Ga0495629_0015172 Ga0495629_0015172_1390_2340 285
711 3300046459 Ga0495629_0136970 Ga0495629_0136970_750_1679 285
712 3300046460 Ga0495638_0008024 Ga0495638_0008024_5491_6396 285
713 3300046460 Ga0495638_0026620 Ga0495638_0026620_2155_3084 285
714 3300046474 Ga0495605_0003611 Ga0495605_0003611_6084_7013 285
715 3300046477 Ga0495664_0067571 Ga0495664_0067571_1132_2061 285
716 3300046492 Ga0495585_0088955 Ga0495585_0088955_638_1588 285
717 3300046499 Ga0495594_0024219 Ga0495594_0024219_876_1826 285
718 3300046499 Ga0495594_0148271 Ga0495594_0148271_39_968 285
719 3300046501 Ga0495607_0020887 Ga0495607_0020887_1709_2638 285
720 3300046506 Ga0495583_0020416 Ga0495583_0020416_22_951 285
721 3300046506 Ga0495583_0031590 Ga0495583_0031590_431_1360 285
722 3300046506 Ga0495583_0050471 Ga0495583_0050471_101_1006 285
723 3300046507 Ga0495606_0007016 Ga0495606_0007016_2999_3928 285
724 3300046507 Ga0495606_0029891 Ga0495606_0029891_2210_3115 285
725 3300046512 Ga0495610_0046548 Ga0495610_0046548_390_1319 285
726 3300046513 Ga0495616_0001426 Ga0495616_0001426_14116_15045 285
727 3300046514 Ga0495618_0059889 Ga0495618_0059889_842_1771 285
728 3300046515 Ga0495620_0001023 Ga0495620_0001023_16121_17050 285
729 3300046515 Ga0495620_0012144 Ga0495620_0012144_899_1828 285
730 3300046522 Ga0495643_0004195 Ga0495643_0004195_365_1294 285
731 3300046524 Ga0495648_0087811 Ga0495648_0087811_150_1079 285
732 3300046524 Ga0495648_0149596 Ga0495648_0149596_144_1073 285
733 3300046530 Ga0495654_0039660 Ga0495654_0039660_1236_2165 285
734 3300046538 Ga0495609_0012613 Ga0495609_0012613_2306_3235 285
735 3300046542 Ga0495597_0009742 Ga0495597_0009742_1727_2656 285
736 3300046616 Ga0495668_0029453 Ga0495668_0029453_872_1801 285
737 3300046642 Ga0495634_0084145 Ga0495634_0084145_790_1719 285
738 3300046648 Ga0495611_0076347 Ga0495611_0076347_471_1388 285
739 3300046665 Ga0495661_0049946 Ga0495661_0049946_719_1648 285
740 3300046674 Ga0495588_0003822 Ga0495588_0003822_4929_5879 285
741 3300046680 Ga0495646_0035636 Ga0495646_0035636_1531_2460 285
742 3300046694 Ga0495649_0058036 Ga0495649_0058036_153_1082 285
743 3300046694 Ga0495649_0130421 Ga0495649_0130421_152_1081 285
744 3300046694 Ga0495649_0167204 Ga0495649_0167204_75_977 285
745 3300046794 Ga0495589_0011982 Ga0495589_0011982_1407_2336 285
746 3300047318 Ga0495636_0067816 Ga0495636_0067816_376_1305 285
747 3300047321 Ga0495676_0015081 Ga0495676_0015081_3486_4436 285
748 3300047321 Ga0495676_0045065 Ga0495676_0045065_2513_3442 285
749 3300047322 Ga0495680_0012497 Ga0495680_0012497_1154_2083 285
750 3300047443 Ga0495687_065986 Ga0495687_065986_391_1320 285
751 3300047444 Ga0495675_0047407 Ga0495675_0047407_535_1464 285
752 3300047447 Ga0495685_007409 Ga0495685_007409_1504_2433 285
753 3300047470 Ga0495681_0048299 Ga0495681_0048299_812_1741 285
754 3300047673 Ga0495593_0204005 Ga0495593_0204005_47_976 285
755 3300048903 Ga0496100_0001703 Ga0496100_0001703_4625_5530 285
756 3300048903 Ga0496100_0006454 Ga0496100_0006454_2763_3683 285
757 3300048903 Ga0496100_0006878 Ga0496100_0006878_1885_2811 285
758 3300048903 Ga0496100_0028605 Ga0496100_0028605_642_1544 285
759 3300048903 Ga0496100_0046275 Ga0496100_0046275_1306_2208 285
760 3300048903 Ga0496100_0105229 Ga0496100_0105229_448_1368 285
761 3300048903 Ga0496100_0118346 Ga0496100_0118346_129_1046 285
762 3300048904 Ga0496101_0000030 Ga0496101_0000030_47884_48804 285
763 3300048904 Ga0496101_0001379 Ga0496101_0001379_9208_10113 285
764 3300048904 Ga0496101_0011975 Ga0496101_0011975_1859_2761 285
765 3300048905 Ga0496102_0000001 Ga0496102_0000001_627712_628632 285
766 3300048905 Ga0496102_0000112 Ga0496102_0000112_20129_21055 285
767 3300048905 Ga0496102_0017128 Ga0496102_0017128_3972_4874 285
768 3300048905 Ga0496102_0078104 Ga0496102_0078104_1542_2459 285
769 3300048905 Ga0496102_0079513 Ga0496102_0079513_231_1133 285
770 3300048906 Ga0496103_0000003 Ga0496103_0000003_358774_359694 285
771 3300048906 Ga0496103_0002476 Ga0496103_0002476_7820_8722 285
772 3300048906 Ga0496103_0129948 Ga0496103_0129948_223_1140 285
773 3300048907 Ga0496104_0217930 Ga0496104_0217930_617_1534 285
774 3300048908 Ga0496105_0038689 Ga0496105_0038689_894_1799 285
775 3300048908 Ga0496105_0065002 Ga0496105_0065002_1982_2899 285
776 3300048909 Ga0496106_0009358 Ga0496106_0009358_349_1254 285
777 3300048909 Ga0496106_0014688 Ga0496106_0014688_2281_3201 285
778 3300048909 Ga0496106_0021410 Ga0496106_0021410_1311_2213 285
779 3300048910 Ga0496107_0012120 Ga0496107_0012120_151_1056 285
780 3300048910 Ga0496107_0027547 Ga0496107_0027547_2780_3700 285
781 3300048911 Ga0496108_0000589 Ga0496108_0000589_24639_25556 285
782 3300048911 Ga0496108_0012853 Ga0496108_0012853_5602_6507 285
783 3300048911 Ga0496108_0175780 Ga0496108_0175780_499_1404 285
784 3300048912 Ga0496109_0004292 Ga0496109_0004292_1295_2212 285
785 3300048912 Ga0496109_0068561 Ga0496109_0068561_526_1428 285
786 3300048912 Ga0496109_0115824 Ga0496109_0115824_313_1218 285
787 3300048912 Ga0496109_0355675 Ga0496109_0355675_403_1305 285
788 3300048915 Ga0496112_0028927 Ga0496112_0028927_3233_4135 285
789 3300048915 Ga0496112_0057653 Ga0496112_0057653_1530_2447 285
790 3300048915 Ga0496112_0105055 Ga0496112_0105055_1482_2402 285
791 3300048915 Ga0496112_0112943 Ga0496112_0112943_567_1472 285
792 3300048916 Ga0496113_0021756 Ga0496113_0021756_2314_3219 285
793 3300048916 Ga0496113_0070881 Ga0496113_0070881_563_1483 285
794 3300048917 Ga0496114_0003564 Ga0496114_0003564_865_1770 285
795 3300048917 Ga0496114_0016475 Ga0496114_0016475_2251_3153 285
796 3300048918 Ga0496115_0004692 Ga0496115_0004692_5548_6453 285
797 3300048918 Ga0496115_0014973 Ga0496115_0014973_2785_3687 285
798 3300048919 Ga0496116_0000013 Ga0496116_0000013_244300_245220 285
799 3300048919 Ga0496116_0021964 Ga0496116_0021964_1632_2537 285
800 3300048920 Ga0496117_0000013 Ga0496117_0000013_358774_359694 285
801 3300048920 Ga0496117_0000719 Ga0496117_0000719_17927_18853 285
802 3300048921 Ga0496118_0000011 Ga0496118_0000011_244302_245222 285
803 3300048921 Ga0496118_0003063 Ga0496118_0003063_7915_8841 285
804 3300048922 Ga0496119_0000076 Ga0496119_0000076_4591_5511 285
805 3300048922 Ga0496119_0014589 Ga0496119_0014589_4405_5331 285
806 3300048923 Ga0496120_0001268 Ga0496120_0001268_4445_5365 285
807 3300048923 Ga0496120_0052426 Ga0496120_0052426_494_1420 285
808 3300048924 Ga0496121_0014867 Ga0496121_0014867_3325_4251 285
809 3300048926 Ga0496123_0029954 Ga0496123_0029954_2321_3241 285
810 3300048927 Ga0496124_0056202 Ga0496124_0056202_1435_2361 285
811 3300048929 Ga0496126_0002163 Ga0496126_0002163_7016_7936 285
812 3300050490 nmdc:mga03n38_10969_c1 nmdc:mga03n38_10969_c1_2099_3004 285
813 3300050490 nmdc:mga03n38_19000_c1 nmdc:mga03n38_19000_c1_1063_1965 285
814 3300050491 nmdc:mga00v17_14060_c1 nmdc:mga00v17_14060_c1_1133_2035 285
815 3300050491 nmdc:mga00v17_151372_c1 nmdc:mga00v17_151372_c1_483_1388 285
816 3300050491 nmdc:mga00v17_7507_c1 nmdc:mga00v17_7507_c1_3695_4597 285
817 3300050492 nmdc:mga0yw44_22077_c1 nmdc:mga0yw44_22077_c1_1548_2450 285
818 3300050496 nmdc:mga07m45_38352_c1 nmdc:mga07m45_38352_c1_817_1719 285
819 3300050496 nmdc:mga07m45_92094_c1 nmdc:mga07m45_92094_c1_169_1071 285
820 3300050507 nmdc:mga05p37_3169_c1 nmdc:mga05p37_3169_c1_16389_17291 285
821 3300050509 nmdc:mga0qj67_15554_c1 nmdc:mga0qj67_15554_c1_537_1439 285
822 3300050516 nmdc:mga0sz30_16128_c3 nmdc:mga0sz30_16128_c3_36_938 285
823 3300050516 nmdc:mga0sz30_3342_c1 nmdc:mga0sz30_3342_c1_2698_3600 285
824 3300050516 nmdc:mga0sz30_3484_c2 nmdc:mga0sz30_3484_c2_2065_2967 285
825 3300050516 nmdc:mga0sz30_483_c1 nmdc:mga0sz30_483_c1_1198_2100 285
826 3300053079 Ga0500610_0046814 Ga0500610_0046814_983_1888 285
827 3300053153 Ga0500616_0073659 Ga0500616_0073659_21_926 285
828 iso_pu_bacteria 2616644814 2616697702 285
829 iso_pu_bacteria 2616644941 2616905574 285
830 3300003203 JGI25406J46586_10002006 JGI25406J46586_100020067 286
831 3300003373 JGI25407J50210_10014559 JGI25407J50210_100145591 286
832 3300005334 Ga0068869_100058741 Ga0068869_1000587412 286
833 3300005337 Ga0070682_100089163 Ga0070682_1000891633 286
834 3300005337 Ga0070682_100172079 Ga0070682_1001720791 286
835 3300005345 Ga0070692_10086442 Ga0070692_100864422 286
836 3300005347 Ga0070668_100252826 Ga0070668_1002528262 286
837 3300005353 Ga0070669_100104510 Ga0070669_1001045102 286
838 3300005441 Ga0070700_100040024 Ga0070700_1000400242 286
839 3300005459 Ga0068867_100145593 Ga0068867_1001455931 286
840 3300005539 Ga0068853_100094468 Ga0068853_1000944682 286
841 3300005578 Ga0068854_100013941 Ga0068854_1000139417 286
842 3300005718 Ga0068866_10005802 Ga0068866_100058022 286
843 3300005719 Ga0068861_100139583 Ga0068861_1001395832 286
844 3300005937 Ga0081455_10032407 Ga0081455_100324074 286
845 3300005937 Ga0081455_10034638 Ga0081455_100346384 286
846 3300005981 Ga0081538_10000186 Ga0081538_1000018653 286
847 3300005981 Ga0081538_10096580 Ga0081538_100965802 286
848 3300005985 Ga0081539_10000208 Ga0081539_1000020845 286
849 3300006058 Ga0075432_10000861 Ga0075432_100008615 286
850 3300006844 Ga0075428_100011650 Ga0075428_10001165011 286
851 3300006871 Ga0075434_100000386 Ga0075434_10000038616 286
852 3300006871 Ga0075434_100001823 Ga0075434_1000018233 286
853 3300006880 Ga0075429_100044631 Ga0075429_1000446313 286
854 3300006914 Ga0075436_100000338 Ga0075436_10000033813 286
855 3300007076 Ga0075435_100002397 Ga0075435_10000239710 286
856 3300007076 Ga0075435_100002693 Ga0075435_1000026937 286
857 3300009094 Ga0111539_10072056 Ga0111539_100720562 286
858 3300009098 Ga0105245_10066600 Ga0105245_100666004 286
859 3300009147 Ga0114129_10037098 Ga0114129_100370983 286
860 3300009148 Ga0105243_10007430 Ga0105243_100074306 286
861 3300009176 Ga0105242_10057869 Ga0105242_100578694 286
862 3300009551 Ga0105238_10029299 Ga0105238_100292993 286
863 3300009553 Ga0105249_10036561 Ga0105249_100365612 286
864 3300009553 Ga0105249_10140623 Ga0105249_101406232 286
865 3300010375 Ga0105239_10050997 Ga0105239_100509972 286
866 3300013105 Ga0157369_10733294 Ga0157369_107332941 286
867 3300013306 Ga0163162_10092950 Ga0163162_100929502 286
868 3300013307 Ga0157372_10037234 Ga0157372_100372347 286
869 3300013307 Ga0157372_10316851 Ga0157372_103168511 286
870 3300013307 Ga0157372_10566810 Ga0157372_105668102 286
871 3300017792 Ga0163161_10034890 Ga0163161_100348902 286
872 3300017792 Ga0163161_10038680 Ga0163161_100386802 286
873 3300025899 Ga0207642_10003227 Ga0207642_100032272 286
874 3300025901 Ga0207688_10004821 Ga0207688_100048214 286
875 3300025923 Ga0207681_10113069 Ga0207681_101130692 286
876 3300025927 Ga0207687_10066500 Ga0207687_100665002 286
877 3300025927 Ga0207687_10132478 Ga0207687_101324782 286
878 3300025933 Ga0207706_10025627 Ga0207706_100256276 286
879 3300025934 Ga0207686_10157011 Ga0207686_101570111 286
880 3300025935 Ga0207709_10081196 Ga0207709_100811962 286
881 3300025938 Ga0207704_10017139 Ga0207704_100171392 286
882 3300025961 Ga0207712_10007451 Ga0207712_100074517 286
883 3300025961 Ga0207712_10015268 Ga0207712_100152681 286
884 3300026118 Ga0207675_100004805 Ga0207675_1000048056 286
885 3300027907 Ga0207428_10001237 Ga0207428_1000123710 286
886 3300027907 Ga0207428_10009580 Ga0207428_100095808 286
887 3300028381 Ga0268264_10252950 Ga0268264_102529502 286
888 3300031548 Ga0307408_100025439 Ga0307408_1000254393 286
889 3300031731 Ga0307405_10010297 Ga0307405_100102975 286
890 3300031731 Ga0307405_10011336 Ga0307405_100113364 286
891 3300031731 Ga0307405_10050903 Ga0307405_100509032 286
892 3300031824 Ga0307413_10006809 Ga0307413_100068093 286
893 3300031824 Ga0307413_10027077 Ga0307413_100270773 286
894 3300031824 Ga0307413_10133366 Ga0307413_101333662 286
895 3300031852 Ga0307410_10000186 Ga0307410_100001865 286
896 3300031852 Ga0307410_10006417 Ga0307410_100064174 286
897 3300031852 Ga0307410_10006476 Ga0307410_100064764 286
898 3300031852 Ga0307410_10014259 Ga0307410_100142593 286
899 3300031901 Ga0307406_10000071 Ga0307406_1000007137 286
900 3300031901 Ga0307406_10008812 Ga0307406_100088125 286
901 3300031903 Ga0307407_10004883 Ga0307407_100048835 286
902 3300031903 Ga0307407_10023459 Ga0307407_100234592 286
903 3300031903 Ga0307407_10240326 Ga0307407_102403262 286
904 3300031911 Ga0307412_10292644 Ga0307412_102926442 286
905 3300031995 Ga0307409_100000106 Ga0307409_1000001067 286
906 3300031995 Ga0307409_100002886 Ga0307409_1000028864 286
907 3300031995 Ga0307409_100003055 Ga0307409_1000030555 286
908 3300031995 Ga0307409_100029134 Ga0307409_1000291343 286
909 3300032002 Ga0307416_100000850 Ga0307416_1000008502 286
910 3300032002 Ga0307416_100017280 Ga0307416_1000172802 286
911 3300032002 Ga0307416_100049737 Ga0307416_1000497372 286
912 3300032002 Ga0307416_100176833 Ga0307416_1001768332 286
913 3300032004 Ga0307414_10010360 Ga0307414_100103602 286
914 3300032004 Ga0307414_10026408 Ga0307414_100264082 286
915 3300032004 Ga0307414_10081940 Ga0307414_100819403 286
916 3300032004 Ga0307414_10218668 Ga0307414_102186682 286
917 3300032005 Ga0307411_10011519 Ga0307411_100115192 286
918 3300032005 Ga0307411_10042548 Ga0307411_100425482 286
919 3300032005 Ga0307411_10098100 Ga0307411_100981002 286
920 3300032126 Ga0307415_100002560 Ga0307415_1000025607 286
921 3300032126 Ga0307415_100013305 Ga0307415_1000133052 286
922 3300032126 Ga0307415_100021903 Ga0307415_1000219033 286
923 3300032126 Ga0307415_100160352 Ga0307415_1001603522 286
924 3300032126 Ga0307415_100306451 Ga0307415_1003064512 286
925 3300042012 Ga0439455_0028684 Ga0439455_0028684_302_1219 286
926 3300045976 Ga0466967_0125089 Ga0466967_0125089_982_1899 286
927 3300046615 Ga0495656_0196795 Ga0495656_0196795_57_974 286
928 3300048905 Ga0496102_0626825 Ga0496102_0626825_33_947 286
929 3300048911 Ga0496108_0187444 Ga0496108_0187444_544_1458 286
930 3300048912 Ga0496109_0014192 Ga0496109_0014192_5641_6564 286
931 3300048913 Ga0496110_0189785 Ga0496110_0189785_186_1109 286
932 3300048914 Ga0496111_0056368 Ga0496111_0056368_199_1113 286
933 3300048917 Ga0496114_0160515 Ga0496114_0160515_174_1088 286
934 3300048917 Ga0496114_0208575 Ga0496114_0208575_425_1348 286
935 3300049675 Ga0501243_019330 Ga0501243_019330_186_1100 286
936 3300050507 nmdc:mga05p37_88589_c1 nmdc:mga05p37_88589_c1_2876_3790 286
937 3300050508 nmdc:mga09592_106048_c1 nmdc:mga09592_106048_c1_95_1009 286
938 3300050512 nmdc:mga0n895_46863_c1 nmdc:mga0n895_46863_c1_2643_3557 286
939 3300050515 nmdc:mga0a205_213796_c1 nmdc:mga0a205_213796_c1_838_1752 286
940 3300053083 Ga0495655_0012580 Ga0495655_0012580_69_986 286
941 iso_pu_bacteria 2582581312 2585299880 286
942 3300003320 rootH2_10002244 rootH2_100022443 287
943 3300006048 Ga0075363_100032995 Ga0075363_1000329952 287
944 3300006051 Ga0075364_10051528 Ga0075364_100515282 287
945 3300006051 Ga0075364_10105783 Ga0075364_101057832 287
946 3300009094 Ga0111539_10134313 Ga0111539_101343132 287
947 3300027907 Ga0207428_10102957 Ga0207428_101029572 287
948 3300031852 Ga0307410_10004749 Ga0307410_100047493 287
949 3300031903 Ga0307407_10089121 Ga0307407_100891212 287
950 3300031995 Ga0307409_100024232 Ga0307409_1000242324 287
951 3300031995 Ga0307409_100210805 Ga0307409_1002108052 287
952 3300032004 Ga0307414_10184653 Ga0307414_101846532 287
953 3300032005 Ga0307411_10009357 Ga0307411_100093572 287
954 3300032126 Ga0307415_100005844 Ga0307415_1000058445 287
955 3300044658 Ga0466972_0039617 Ga0466972_0039617_1052_1978 287
956 3300044901 Ga0466960_0000313 Ga0466960_0000313_6901_7830 287
957 3300045976 Ga0466967_0496111 Ga0466967_0496111_181_1095 287
958 3300046455 Ga0495603_0007354 Ga0495603_0007354_1249_2211 287
959 3300046459 Ga0495629_0001933 Ga0495629_0001933_6352_7314 287
960 3300046689 Ga0495613_0001211 Ga0495613_0001211_960_1922 287
961 3300047321 Ga0495676_0012589 Ga0495676_0012589_5487_6449 287
962 3300048909 Ga0496106_0021710 Ga0496106_0021710_1172_2134 287
963 3300048909 Ga0496106_0141029 Ga0496106_0141029_24_944 287
964 3300049568 Ga0501031_0021971 Ga0501031_0021971_2770_3687 287
965 3300049569 Ga0501032_0001487 Ga0501032_0001487_13669_14589 287
966 3300049571 Ga0501034_0016674 Ga0501034_0016674_3244_4164 287
967 3300049572 Ga0501036_0009792 Ga0501036_0009792_4778_5695 287
968 3300049573 Ga0501037_0000846 Ga0501037_0000846_6974_7894 287
969 3300049574 Ga0501038_0018635 Ga0501038_0018635_2923_3843 287
970 3300049575 Ga0501039_0004087 Ga0501039_0004087_6689_7609 287
971 3300049575 Ga0501039_0033422 Ga0501039_0033422_3025_3942 287
972 3300049576 Ga0501040_0025389 Ga0501040_0025389_96_1013 287
973 3300049577 Ga0501041_0011160 Ga0501041_0011160_948_1865 287
974 3300049578 Ga0501042_0022676 Ga0501042_0022676_3084_4001 287
975 3300049579 Ga0501043_0000710 Ga0501043_0000710_23462_24382 287
976 3300049580 Ga0501046_0013365 Ga0501046_0013365_1701_2618 287
977 3300049584 Ga0501068_0008717 Ga0501068_0008717_2547_3464 287
978 3300049584 Ga0501068_0135296 Ga0501068_0135296_506_1426 287
979 3300049587 Ga0501071_0008152 Ga0501071_0008152_4893_5810 287
980 3300049588 Ga0501072_0010719 Ga0501072_0010719_3452_4369 287
981 3300049590 Ga0501074_0031457 Ga0501074_0031457_2647_3564 287
982 3300049592 Ga0501076_0007496 Ga0501076_0007496_3124_4041 287
983 3300049824 Ga0501045_0020185 Ga0501045_0020185_2971_3888 287
984 3300050491 nmdc:mga00v17_16277_c1 nmdc:mga00v17_16277_c1_2856_3776 287
985 3300050511 nmdc:mga08y16_199381_c1 nmdc:mga08y16_199381_c1_729_1649 287
986 3300054114 Ga0501084_0010469 Ga0501084_0010469_4126_5043 287
987 3300061734 Ga0530510_0167183 Ga0530510_0167183_537_1454 287
988 3300005337 Ga0070682_100062857 Ga0070682_1000628574 288
989 3300006178 Ga0075367_10001716 Ga0075367_1000171611 288
990 3300014745 Ga0157377_10096844 Ga0157377_100968441 288
991 3300030521 Ga0307511_10002260 Ga0307511_1000226014 288
992 3300031852 Ga0307410_10373282 Ga0307410_103732821 288
993 3300031901 Ga0307406_10090558 Ga0307406_100905582 288
994 3300031903 Ga0307407_10051314 Ga0307407_100513143 288
995 3300031903 Ga0307407_10194601 Ga0307407_101946011 288
996 3300032004 Ga0307414_10020775 Ga0307414_100207753 288
997 3300044693 Ga0466961_0054195 Ga0466961_0054195_1087_2067 288
998 3300044694 Ga0466963_0057579 Ga0466963_0057579_1384_2364 288
999 3300044719 Ga0466971_0007148 Ga0466971_0007148_2338_3318 288
1000 3300044842 Ga0466957_0040330 Ga0466957_0040330_1164_2144 288
1001 3300046539 Ga0495621_0036286 Ga0495621_0036286_276_1256 288
1002 iso_pu_bacteria 8054472261 8054477001 288
1003 3300005615 Ga0070702_100121378 Ga0070702_1001213782 289
1004 3300009101 Ga0105247_10321876 Ga0105247_103218761 289
1005 3300031901 Ga0307406_10015056 Ga0307406_100150564 289
1006 3300031901 Ga0307406_10083025 Ga0307406_100830252 289
1007 3300031903 Ga0307407_10064946 Ga0307407_100649462 289
1008 3300031995 Ga0307409_100076346 Ga0307409_1000763462 289
1009 3300031995 Ga0307409_100280006 Ga0307409_1002800062 289
1010 3300032002 Ga0307416_100229361 Ga0307416_1002293612 289
1011 3300032002 Ga0307416_100443581 Ga0307416_1004435811 289
1012 3300032004 Ga0307414_10083907 Ga0307414_100839072 289
1013 3300032126 Ga0307415_100060321 Ga0307415_1000603212 289
1014 3300044658 Ga0466972_0057811 Ga0466972_0057811_885_1838 289
1015 3300046543 Ga0495645_0129952 Ga0495645_0129952_641_1582 289
1016 iso_pu_bacteria 2622736605 2623497875 289
1017 3300001991 JGI24743J22301_10005135 JGI24743J22301_100051352 290
1018 3300002077 JGI24744J21845_10001322 JGI24744J21845_100013223 290
1019 3300005328 Ga0070676_10199641 Ga0070676_101996412 290
1020 3300005343 Ga0070687_100091510 Ga0070687_1000915102 290
1021 3300005365 Ga0070688_100128638 Ga0070688_1001286382 290
1022 3300005366 Ga0070659_100063986 Ga0070659_1000639863 290
1023 3300005437 Ga0070710_10003297 Ga0070710_1000329711 290
1024 3300005439 Ga0070711_100013123 Ga0070711_1000131234 290
1025 3300005444 Ga0070694_100331705 Ga0070694_1003317052 290
1026 3300005455 Ga0070663_100141789 Ga0070663_1001417893 290
1027 3300005546 Ga0070696_100087772 Ga0070696_1000877722 290
1028 3300005578 Ga0068854_100291283 Ga0068854_1002912832 290
1029 3300005718 Ga0068866_10022932 Ga0068866_100229322 290
1030 3300005841 Ga0068863_100161053 Ga0068863_1001610532 290
1031 3300005842 Ga0068858_100100702 Ga0068858_1001007023 290
1032 3300006163 Ga0070715_10018460 Ga0070715_100184602 290
1033 3300006175 Ga0070712_100021410 Ga0070712_1000214106 290
1034 3300006881 Ga0068865_100056712 Ga0068865_1000567124 290
1035 3300009177 Ga0105248_10223629 Ga0105248_102236293 290
1036 3300009545 Ga0105237_10211240 Ga0105237_102112402 290
1037 3300013297 Ga0157378_10268423 Ga0157378_102684232 290
1038 3300013308 Ga0157375_10157551 Ga0157375_101575513 290
1039 3300025901 Ga0207688_10011102 Ga0207688_100111023 290
1040 3300025914 Ga0207671_10182227 Ga0207671_101822272 290
1041 3300025915 Ga0207693_10000907 Ga0207693_1000090714 290
1042 3300025933 Ga0207706_10009858 Ga0207706_100098587 290
1043 3300025939 Ga0207665_10015075 Ga0207665_100150753 290
1044 3300025942 Ga0207689_10119135 Ga0207689_101191351 290
1045 3300025960 Ga0207651_10037994 Ga0207651_100379942 290
1046 3300025981 Ga0207640_10209288 Ga0207640_102092882 290
1047 3300026067 Ga0207678_10008236 Ga0207678_100082364 290
1048 3300026089 Ga0207648_10050267 Ga0207648_100502674 290
1049 3300026118 Ga0207675_100017465 Ga0207675_1000174654 290
1050 3300026121 Ga0207683_10002324 Ga0207683_1000232413 290
1051 3300026142 Ga0207698_10326190 Ga0207698_103261903 290
1052 3300035088 Ga0373940_0037846 Ga0373940_0037846_97_1011 290
1053 3300035691 Ga0373931_0039646 Ga0373931_0039646_1478_2392 290
1054 3300048904 Ga0496101_0072796 Ga0496101_0072796_1387_2301 290
1055 3300048907 Ga0496104_0141043 Ga0496104_0141043_992_1906 290
1056 3300048910 Ga0496107_0100178 Ga0496107_0100178_944_1858 290
1057 3300048912 Ga0496109_0007158 Ga0496109_0007158_2661_3575 290
1058 3300048913 Ga0496110_0256744 Ga0496110_0256744_23_937 290
1059 3300048915 Ga0496112_0213834 Ga0496112_0213834_853_1767 290
1060 3300048916 Ga0496113_0043182 Ga0496113_0043182_928_1842 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

47

310

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.8295 3 277
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.7905 3 277
3wqo-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase-like protein 0.7164 8 282
3cqh-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae from the anaerobic l-ascorbate utilization pathway of escherichia coli 0.7152 8 283
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.7135 7 283
ID Description Score Start End Superfamily
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.834 3 277 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7947 3 277 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.729 1 286 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7169 8 281 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7098 8 281 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2S8MRC4-F1-model_v4 deleted 0.9787 8 75
AF-A0A7Y5NMG5-F1-model_v4 TIM barrel protein 0.9769 165 286
AF-A0A6P0QQ53-F1-model_v4 deleted 0.9768 166 284
AF-A0A7Y5T6H7-F1-model_v4 TIM barrel protein 0.9758 1 289
AF-A0A7K3H676-F1-model_v4 TIM barrel protein 0.9746 4 285

Feature Viewer

pLDDT pTM Quality
94.71 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map