F489276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1060 | 500 | 2120 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300042115|Ga0450911_000083|Ga0450911_000083_9245_10189 |
| Length | 314 |
| Sequence | MQSGGGVACFPDCIKATGDERVAGMGYNARRFSAFQAAVMQHPAEHSPLGKSSEYVSQYAPELLFPISRTTKWVELGLVAGKLPYQGVDYWNCYELSWLTPSGKPVVAIGEFAIPADSPNIIESKSFKLYLNSLNQSAYADRAEVEAVLKRDLSACAGAPVAVRVRGLDEVAAEGVAALPGRCVDDLEIAVSDYAHPRPELMRCGDEVVEEVLYSHLLKSNCPVTGQPDWGTLVIDYRGPRLDAASLLAYVVSFRQHQDFHEQCVERVFLDLQHLLQPEKLTVYARYVRRGGLDINPYRSTEAITPDNRRLVRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 33 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 34 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 35 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 56 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 91 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 96 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 97 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 104 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 107 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 108 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 109 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 110 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 111 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 112 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 113 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 114 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 119 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 120 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 121 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 122 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 123 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 124 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 125 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 126 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 127 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 128 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 129 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 130 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 131 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 132 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 133 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 134 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 135 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 136 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 137 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 138 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 139 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 140 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 141 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 142 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 143 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 144 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 219 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 220 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 221 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 222 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 223 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 224 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 225 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 236 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 237 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 239 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 240 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 241 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 242 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 243 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 244 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 245 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 246 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 247 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 248 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 249 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 250 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 251 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 252 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 253 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 254 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 255 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 256 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 257 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 258 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 259 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 260 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 261 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 262 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 263 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 264 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 265 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 266 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 267 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 268 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 269 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 270 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 271 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 272 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 273 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 274 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 275 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 276 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 277 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 278 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 279 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 280 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 281 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 282 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 283 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 284 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 285 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 286 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 287 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 288 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 289 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 290 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 291 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 292 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 293 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 294 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 295 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 296 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 297 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 298 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 299 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 300 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 301 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 302 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 303 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 304 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 305 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 306 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 307 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 308 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 309 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 310 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 311 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 312 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 313 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 314 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 315 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 316 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 317 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 318 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 319 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 320 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 321 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 322 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 323 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 324 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 325 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 326 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 327 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 328 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 329 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 330 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 331 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 332 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 333 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 334 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 335 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 336 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 337 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 338 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 339 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 340 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 341 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 342 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 343 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 344 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 345 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 346 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 347 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 348 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 349 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 350 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 351 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 352 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 353 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 354 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 355 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 356 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 357 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 358 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 359 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 360 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 361 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 362 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 363 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 364 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 365 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 366 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 367 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 368 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 369 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 370 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 371 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 372 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 373 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 374 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 375 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 376 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 377 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 378 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 379 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 380 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 381 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 382 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 383 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 384 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 385 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 386 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 387 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 388 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 389 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 390 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 391 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 392 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 393 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 394 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 395 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 396 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 397 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 398 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 399 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 400 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 401 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 402 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 403 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 404 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 405 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 406 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 407 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 408 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 409 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 410 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 411 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 412 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 413 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 414 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 415 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 416 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 417 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 418 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 419 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 420 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 421 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 422 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 423 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 424 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 425 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 426 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 427 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 428 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 429 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 430 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 431 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 432 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 433 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 434 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 435 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 436 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 437 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 438 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 439 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 440 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 441 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 442 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 443 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 444 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 445 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 446 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 447 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 448 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 449 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 450 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 451 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 452 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 453 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 454 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 455 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 456 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 457 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 458 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 459 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 460 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 461 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 462 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 463 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 464 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 465 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 466 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 467 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 468 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 469 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 470 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 471 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 472 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 473 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 474 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 475 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 476 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 477 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 478 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 479 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 480 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 481 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 482 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 483 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 484 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 485 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 486 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 487 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 488 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 489 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 490 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 491 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 492 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 493 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 494 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 495 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 496 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 497 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 498 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 499 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 500 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.47 |
| Metatranscriptomes | 0 |
| Isolates | 24.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 6.13 |
| Nodule | 2.26 |
| Rhizoplane | 7.64 |
| Rhizosphere | 68.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450911_000083 | 3300042115 | Bacteria | 37916 |
| 2 | MRS2a_Contig_7 | 2124908027 | Bacteria | 72867 |
| 3 | SwRhRL2b_contig_1594327 | 2162886007 | Bacteria | 4802 |
| 4 | SwRhRL2b_contig_241481 | 2162886007 | Bacteria | 2909 |
| 5 | JGI25162J39368_1000391 | 3300002737 | Bacteria | 36980 |
| 6 | JGI25154J39366_1005613 | 3300002738 | Bacteria | 1967 |
| 7 | JGI25163J39215_1001597 | 3300002771 | Bacteria | 3426 |
| 8 | JGI25163J39215_1001662 | 3300002771 | Bacteria | 3250 |
| 9 | JGI25164J39214_1000089 | 3300002772 | Bacteria | 91309 |
| 10 | JGI25164J39214_1000279 | 3300002772 | Bacteria | 36980 |
| 11 | JGI25165J46597_1000191 | 3300003214 | Bacteria | 91309 |
| 12 | JGI25165J46597_1000510 | 3300003214 | Bacteria | 36980 |
| 13 | Ga0055538_1000078 | 3300003751 | Bacteria | 86114 |
| 14 | Ga0055539_1000119 | 3300003752 | Bacteria | 86114 |
| 15 | Ga0055533_1000127 | 3300003756 | Bacteria | 86114 |
| 16 | Ga0055532_1000068 | 3300003758 | Bacteria | 138828 |
| 17 | Ga0055525_1000163 | 3300003759 | Bacteria | 86114 |
| 18 | Ga0055525_1003329 | 3300003759 | Bacteria | 1455 |
| 19 | Ga0055536_1000316 | 3300003781 | Bacteria | 35966 |
| 20 | Ga0055536_1003702 | 3300003781 | Bacteria | 8111 |
| 21 | Ga0055536_1003789 | 3300003781 | Bacteria | 7978 |
| 22 | Ga0055530_10000230 | 3300003791 | Bacteria | 49999 |
| 23 | Ga0055530_10000462 | 3300003791 | Bacteria | 35966 |
| 24 | Ga0055530_10002879 | 3300003791 | Bacteria | 10479 |
| 25 | Ga0055540_1000241 | 3300003792 | Bacteria | 49999 |
| 26 | Ga0055540_1001061 | 3300003792 | Bacteria | 17512 |
| 27 | Ga0055540_1002216 | 3300003792 | Bacteria | 10546 |
| 28 | Ga0055531_10000511 | 3300003794 | Bacteria | 35158 |
| 29 | Ga0055531_10007174 | 3300003794 | Bacteria | 6136 |
| 30 | Ga0055541_1000079 | 3300003841 | Bacteria | 86114 |
| 31 | Ga0065714_10000180 | 3300005288 | Bacteria | 8213 |
| 32 | Ga0065714_10003160 | 3300005288 | Bacteria | 8831 |
| 33 | Ga0065714_10007263 | 3300005288 | Bacteria | 3869 |
| 34 | Ga0065714_10009195 | 3300005288 | Bacteria | 3434 |
| 35 | Ga0065714_10065863 | 3300005288 | Bacteria | 8251 |
| 36 | Ga0065714_10066039 | 3300005288 | Bacteria | 7772 |
| 37 | Ga0065714_10109743 | 3300005288 | Bacteria | 1494 |
| 38 | Ga0065714_10131632 | 3300005288 | Bacteria | 1238 |
| 39 | Ga0065714_10142029 | 3300005288 | Bacteria | 1164 |
| 40 | Ga0065704_10074907 | 3300005289 | Bacteria | 5920 |
| 41 | Ga0065712_10002471 | 3300005290 | Bacteria | 11296 |
| 42 | Ga0065712_10009951 | 3300005290 | Bacteria | 2146 |
| 43 | Ga0065712_10070286 | 3300005290 | Bacteria | 6147 |
| 44 | Ga0065715_10096155 | 3300005293 | Bacteria | 3933 |
| 45 | Ga0070670_100017783 | 3300005331 | Bacteria | 6100 |
| 46 | Ga0070661_100008283 | 3300005344 | Bacteria | 7177 |
| 47 | Ga0070669_100000231 | 3300005353 | Bacteria | 46679 |
| 48 | Ga0070662_100001224 | 3300005457 | Bacteria | 15780 |
| 49 | Ga0070662_100507935 | 3300005457 | Bacteria | 1006 |
| 50 | Ga0068853_100054183 | 3300005539 | Bacteria | 3456 |
| 51 | Ga0070665_100583522 | 3300005548 | Bacteria | 1131 |
| 52 | Ga0070664_100007813 | 3300005564 | Bacteria | 8639 |
| 53 | Ga0068851_10000055 | 3300005834 | Bacteria | 67442 |
| 54 | Ga0075432_10001624 | 3300006058 | Bacteria | 7392 |
| 55 | Ga0075432_10009420 | 3300006058 | Bacteria | 3325 |
| 56 | Ga0075432_10022216 | 3300006058 | Bacteria | 2169 |
| 57 | Ga0075432_10076625 | 3300006058 | Bacteria | 1207 |
| 58 | Ga0075369_10024550 | 3300006186 | Bacteria | 2499 |
| 59 | Ga0075366_10000057 | 3300006195 | Bacteria | 40849 |
| 60 | Ga0079104_1000213 | 3300006946 | Bacteria | 81349 |
| 61 | Ga0079104_1000222 | 3300006946 | Bacteria | 78855 |
| 62 | Ga0105251_10000158 | 3300009011 | Bacteria | 69153 |
| 63 | Ga0105251_10000401 | 3300009011 | Bacteria | 42259 |
| 64 | Ga0105251_10003936 | 3300009011 | Bacteria | 10537 |
| 65 | Ga0105251_10005667 | 3300009011 | Bacteria | 8109 |
| 66 | Ga0105251_10006323 | 3300009011 | Bacteria | 7575 |
| 67 | Ga0105251_10009753 | 3300009011 | Bacteria | 5637 |
| 68 | Ga0105251_10012020 | 3300009011 | Bacteria | 4913 |
| 69 | Ga0105251_10020539 | 3300009011 | Bacteria | 3467 |
| 70 | Ga0105251_10021720 | 3300009011 | Bacteria | 3345 |
| 71 | Ga0105251_10038897 | 3300009011 | Bacteria | 2326 |
| 72 | Ga0105251_10132236 | 3300009011 | Bacteria | 1130 |
| 73 | Ga0105244_10001973 | 3300009036 | Bacteria | 15869 |
| 74 | Ga0105244_10002235 | 3300009036 | Bacteria | 14746 |
| 75 | Ga0105244_10004076 | 3300009036 | Bacteria | 10195 |
| 76 | Ga0105244_10004822 | 3300009036 | Bacteria | 9157 |
| 77 | Ga0105244_10006373 | 3300009036 | Bacteria | 7658 |
| 78 | Ga0105244_10006900 | 3300009036 | Bacteria | 7284 |
| 79 | Ga0105244_10013582 | 3300009036 | Bacteria | 4751 |
| 80 | Ga0105244_10021324 | 3300009036 | Bacteria | 3585 |
| 81 | Ga0105244_10057618 | 3300009036 | Bacteria | 1963 |
| 82 | Ga0105244_10070868 | 3300009036 | Bacteria | 1738 |
| 83 | Ga0105250_10000996 | 3300009092 | Bacteria | 16473 |
| 84 | Ga0105250_10003977 | 3300009092 | Bacteria | 6897 |
| 85 | Ga0105250_10013520 | 3300009092 | Bacteria | 3363 |
| 86 | Ga0105250_10020678 | 3300009092 | Bacteria | 2658 |
| 87 | Ga0105250_10030110 | 3300009092 | Bacteria | 2183 |
| 88 | Ga0105250_10162089 | 3300009092 | Bacteria | 934 |
| 89 | Ga0105243_10000627 | 3300009148 | Bacteria | 35211 |
| 90 | Ga0105243_10002038 | 3300009148 | Bacteria | 17137 |
| 91 | Ga0105243_10008887 | 3300009148 | Bacteria | 7686 |
| 92 | Ga0105243_10027936 | 3300009148 | Bacteria | 4328 |
| 93 | Ga0105243_10034942 | 3300009148 | Bacteria | 3896 |
| 94 | Ga0105243_10130603 | 3300009148 | Bacteria | 2130 |
| 95 | Ga0105242_10000734 | 3300009176 | Bacteria | 25556 |
| 96 | Ga0105248_10275397 | 3300009177 | Bacteria | 1895 |
| 97 | Ga0105237_10000730 | 3300009545 | Bacteria | 45375 |
| 98 | Ga0105246_10003889 | 3300011119 | Bacteria | 9049 |
| 99 | Ga0105246_10155032 | 3300011119 | Bacteria | 1739 |
| 100 | Ga0157373_10004670 | 3300013100 | Bacteria | 10303 |
| 101 | Ga0157373_10005788 | 3300013100 | Bacteria | 9261 |
| 102 | Ga0157373_10010115 | 3300013100 | Bacteria | 6949 |
| 103 | Ga0157373_10010961 | 3300013100 | Bacteria | 6674 |
| 104 | Ga0157373_10027490 | 3300013100 | Bacteria | 4104 |
| 105 | Ga0157373_10042314 | 3300013100 | Bacteria | 3256 |
| 106 | Ga0157373_10078983 | 3300013100 | Bacteria | 2320 |
| 107 | Ga0157373_10090802 | 3300013100 | Bacteria | 2151 |
| 108 | Ga0157371_10000186 | 3300013102 | Bacteria | 91270 |
| 109 | Ga0157371_10003775 | 3300013102 | Bacteria | 13559 |
| 110 | Ga0157371_10005382 | 3300013102 | Bacteria | 10813 |
| 111 | Ga0157371_10010666 | 3300013102 | Bacteria | 7136 |
| 112 | Ga0157371_10035327 | 3300013102 | Bacteria | 3582 |
| 113 | Ga0157371_10039893 | 3300013102 | Bacteria | 3356 |
| 114 | Ga0157371_10299424 | 3300013102 | Bacteria | 1164 |
| 115 | Ga0157370_10004247 | 3300013104 | Bacteria | 16554 |
| 116 | Ga0157370_10013623 | 3300013104 | Bacteria | 8369 |
| 117 | Ga0157370_10073748 | 3300013104 | Bacteria | 3220 |
| 118 | Ga0157370_10085837 | 3300013104 | Bacteria | 2957 |
| 119 | Ga0157370_10127606 | 3300013104 | Bacteria | 2374 |
| 120 | Ga0157370_10343596 | 3300013104 | Bacteria | 1376 |
| 121 | Ga0157370_10380740 | 3300013104 | Bacteria | 1300 |
| 122 | Ga0157369_10006197 | 3300013105 | Bacteria | 13875 |
| 123 | Ga0157369_10033267 | 3300013105 | Bacteria | 5666 |
| 124 | Ga0157369_10036486 | 3300013105 | Bacteria | 5385 |
| 125 | Ga0163162_10011325 | 3300013306 | Bacteria | 8697 |
| 126 | Ga0157372_10004510 | 3300013307 | Bacteria | 14853 |
| 127 | Ga0157372_10040263 | 3300013307 | Bacteria | 5160 |
| 128 | Ga0157375_10012012 | 3300013308 | Bacteria | 7669 |
| 129 | Ga0157375_10674839 | 3300013308 | Bacteria | 1188 |
| 130 | Ga0182008_10001777 | 3300014497 | Bacteria | 14125 |
| 131 | Ga0182008_10006367 | 3300014497 | Bacteria | 6611 |
| 132 | Ga0182008_10007869 | 3300014497 | Bacteria | 5854 |
| 133 | Ga0182008_10008096 | 3300014497 | Bacteria | 5756 |
| 134 | Ga0182008_10009790 | 3300014497 | Bacteria | 5158 |
| 135 | Ga0182008_10017212 | 3300014497 | Bacteria | 3751 |
| 136 | Ga0182008_10018226 | 3300014497 | Bacteria | 3636 |
| 137 | Ga0182006_1002441 | 3300015261 | Bacteria | 10157 |
| 138 | Ga0182006_1003793 | 3300015261 | Bacteria | 7597 |
| 139 | Ga0182006_1003932 | 3300015261 | Bacteria | 7439 |
| 140 | Ga0182006_1004298 | 3300015261 | Bacteria | 7048 |
| 141 | Ga0182006_1013700 | 3300015261 | Bacteria | 3509 |
| 142 | Ga0182006_1016252 | 3300015261 | Bacteria | 3176 |
| 143 | Ga0182007_10002905 | 3300015262 | Bacteria | 8324 |
| 144 | Ga0182007_10008233 | 3300015262 | Bacteria | 4295 |
| 145 | Ga0182007_10023244 | 3300015262 | Bacteria | 2181 |
| 146 | Ga0182005_1014060 | 3300015265 | Bacteria | 2245 |
| 147 | Ga0182005_1047910 | 3300015265 | Bacteria | 1162 |
| 148 | Ga0163161_10040090 | 3300017792 | Bacteria | 3363 |
| 149 | Ga0163161_10152410 | 3300017792 | Bacteria | 1758 |
| 150 | Ga0163161_10181188 | 3300017792 | Bacteria | 1615 |
| 151 | Ga0163161_10216202 | 3300017792 | Bacteria | 1482 |
| 152 | Ga0209435_102520 | 3300025206 | Bacteria | 2135 |
| 153 | Ga0209760_100087 | 3300025207 | Bacteria | 73419 |
| 154 | Ga0209760_100145 | 3300025207 | Bacteria | 44471 |
| 155 | Ga0209760_100173 | 3300025207 | Bacteria | 35497 |
| 156 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 157 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 158 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 159 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 160 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 161 | Ga0209563_100856 | 3300025230 | Bacteria | 9048 |
| 162 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 163 | Ga0207427_100048 | 3300025231 | Bacteria | 238464 |
| 164 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 165 | Ga0209437_100094 | 3300025233 | Bacteria | 238465 |
| 166 | Ga0209437_104886 | 3300025233 | Bacteria | 2326 |
| 167 | Ga0209646_1000324 | 3300025246 | Bacteria | 36648 |
| 168 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 169 | Ga0209759_1015352 | 3300025256 | Bacteria | 1980 |
| 170 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 171 | Ga0209233_1000106 | 3300025261 | Bacteria | 268795 |
| 172 | Ga0209675_1007693 | 3300025291 | Bacteria | 4081 |
| 173 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 174 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 175 | Ga0209676_1000166 | 3300025292 | Bacteria | 156596 |
| 176 | Ga0209676_1002655 | 3300025292 | Bacteria | 12151 |
| 177 | Ga0209676_1013379 | 3300025292 | Bacteria | 3159 |
| 178 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 179 | Ga0209050_1000275 | 3300025298 | Bacteria | 110235 |
| 180 | Ga0209050_1000395 | 3300025298 | Bacteria | 81719 |
| 181 | Ga0209050_1003875 | 3300025298 | Bacteria | 10627 |
| 182 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 183 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 184 | Ga0209051_1000585 | 3300025303 | Bacteria | 43163 |
| 185 | Ga0209257_1000181 | 3300025304 | Bacteria | 158039 |
| 186 | Ga0209257_1015751 | 3300025304 | Bacteria | 3116 |
| 187 | Ga0207656_10000659 | 3300025321 | Bacteria | 11289 |
| 188 | Ga0207696_1000019 | 3300025711 | Bacteria | 476309 |
| 189 | Ga0207696_1000063 | 3300025711 | Bacteria | 239123 |
| 190 | Ga0207696_1000117 | 3300025711 | Bacteria | 148004 |
| 191 | Ga0207696_1000274 | 3300025711 | Bacteria | 61734 |
| 192 | Ga0207696_1003502 | 3300025711 | Bacteria | 7103 |
| 193 | Ga0207696_1005934 | 3300025711 | Bacteria | 4995 |
| 194 | Ga0207696_1021415 | 3300025711 | Bacteria | 2071 |
| 195 | Ga0207655_1000019 | 3300025728 | Bacteria | 536324 |
| 196 | Ga0207655_1000084 | 3300025728 | Bacteria | 207679 |
| 197 | Ga0207655_1000096 | 3300025728 | Bacteria | 194292 |
| 198 | Ga0207655_1000216 | 3300025728 | Bacteria | 99551 |
| 199 | Ga0207655_1000835 | 3300025728 | Bacteria | 33137 |
| 200 | Ga0207655_1002510 | 3300025728 | Bacteria | 14790 |
| 201 | Ga0207655_1002846 | 3300025728 | Bacteria | 13379 |
| 202 | Ga0207655_1003156 | 3300025728 | Bacteria | 12452 |
| 203 | Ga0207655_1003902 | 3300025728 | Bacteria | 10832 |
| 204 | Ga0207655_1005894 | 3300025728 | Bacteria | 8215 |
| 205 | Ga0207655_1007227 | 3300025728 | Bacteria | 7238 |
| 206 | Ga0207655_1019172 | 3300025728 | Bacteria | 3591 |
| 207 | Ga0207655_1056970 | 3300025728 | Bacteria | 1538 |
| 208 | Ga0207713_1000058 | 3300025735 | Bacteria | 216911 |
| 209 | Ga0207713_1000160 | 3300025735 | Bacteria | 100682 |
| 210 | Ga0207713_1003721 | 3300025735 | Bacteria | 10250 |
| 211 | Ga0207713_1004302 | 3300025735 | Bacteria | 9280 |
| 212 | Ga0207713_1004421 | 3300025735 | Bacteria | 9116 |
| 213 | Ga0207713_1004598 | 3300025735 | Bacteria | 8916 |
| 214 | Ga0207713_1005603 | 3300025735 | Bacteria | 7818 |
| 215 | Ga0207713_1010940 | 3300025735 | Bacteria | 4981 |
| 216 | Ga0207713_1011997 | 3300025735 | Bacteria | 4666 |
| 217 | Ga0207713_1024386 | 3300025735 | Bacteria | 2822 |
| 218 | Ga0207713_1025426 | 3300025735 | Bacteria | 2734 |
| 219 | Ga0207713_1028021 | 3300025735 | Bacteria | 2547 |
| 220 | Ga0207713_1068331 | 3300025735 | Bacteria | 1321 |
| 221 | Ga0207671_10000079 | 3300025914 | Bacteria | 149692 |
| 222 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 223 | Ga0207681_10000143 | 3300025923 | Bacteria | 59590 |
| 224 | Ga0207681_10131632 | 3300025923 | Bacteria | 1850 |
| 225 | Ga0207650_10002170 | 3300025925 | Bacteria | 13707 |
| 226 | Ga0207650_10004358 | 3300025925 | Bacteria | 9667 |
| 227 | Ga0207706_10003826 | 3300025933 | Bacteria | 14341 |
| 228 | Ga0207709_10000045 | 3300025935 | Bacteria | 240671 |
| 229 | Ga0207709_10000763 | 3300025935 | Bacteria | 25375 |
| 230 | Ga0207709_10008423 | 3300025935 | Bacteria | 5703 |
| 231 | Ga0207709_10049379 | 3300025935 | Bacteria | 2568 |
| 232 | Ga0207709_10051325 | 3300025935 | Bacteria | 2528 |
| 233 | Ga0207709_10091677 | 3300025935 | Bacteria | 1988 |
| 234 | Ga0207711_10052700 | 3300025941 | Bacteria | 3488 |
| 235 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 236 | Ga0207639_10037922 | 3300026041 | Bacteria | 3583 |
| 237 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 238 | Ga0209281_1000090 | 3300027111 | Bacteria | 242950 |
| 239 | Ga0209281_1004373 | 3300027111 | Bacteria | 4248 |
| 240 | Ga0209389_1000053 | 3300027296 | Bacteria | 108874 |
| 241 | Ga0209371_1000245 | 3300027312 | Bacteria | 67465 |
| 242 | Ga0209371_1000513 | 3300027312 | Bacteria | 36998 |
| 243 | Ga0209996_1000654 | 3300027395 | Bacteria | 4161 |
| 244 | Ga0209282_1019657 | 3300027666 | Bacteria | 4285 |
| 245 | Ga0209971_1000371 | 3300027682 | Bacteria | 12275 |
| 246 | Ga0207428_10043582 | 3300027907 | Bacteria | 3623 |
| 247 | Ga0207428_10046802 | 3300027907 | Bacteria | 3477 |
| 248 | Ga0207428_10240691 | 3300027907 | Bacteria | 1352 |
| 249 | Ga0307517_10029448 | 3300028786 | Bacteria | 6482 |
| 250 | Ga0268256_1000201 | 3300030500 | Bacteria | 67997 |
| 251 | Ga0268256_1000441 | 3300030500 | Bacteria | 36967 |
| 252 | Ga0314311_1110334 | 3300030733 | Bacteria | 11812 |
| 253 | Ga0316178_1017010 | 3300030735 | Bacteria | 20955 |
| 254 | Ga0265331_10048697 | 3300031250 | Bacteria | 2036 |
| 255 | Ga0265327_10000053 | 3300031251 | Bacteria | 255002 |
| 256 | Ga0307513_10002568 | 3300031456 | Bacteria | 25085 |
| 257 | Ga0307513_10062742 | 3300031456 | Bacteria | 3926 |
| 258 | Ga0307513_10115399 | 3300031456 | Bacteria | 2668 |
| 259 | Ga0307509_10134402 | 3300031507 | Bacteria | 2422 |
| 260 | Ga0307408_100000018 | 3300031548 | Bacteria | 346872 |
| 261 | Ga0307408_100014661 | 3300031548 | Bacteria | 5207 |
| 262 | Ga0307405_10001157 | 3300031731 | Bacteria | 10852 |
| 263 | Ga0307405_10003239 | 3300031731 | Bacteria | 7424 |
| 264 | Ga0307405_10006597 | 3300031731 | Bacteria | 5722 |
| 265 | Ga0307405_10039823 | 3300031731 | Bacteria | 2843 |
| 266 | Ga0307406_10224128 | 3300031901 | Bacteria | 1399 |
| 267 | Ga0307407_10102036 | 3300031903 | Bacteria | 1783 |
| 268 | Ga0307412_10001593 | 3300031911 | Bacteria | 12493 |
| 269 | Ga0307412_10004029 | 3300031911 | Bacteria | 8186 |
| 270 | Ga0307412_10004082 | 3300031911 | Bacteria | 8133 |
| 271 | Ga0307412_10028821 | 3300031911 | Bacteria | 3479 |
| 272 | Ga0307414_10041413 | 3300032004 | Bacteria | 3120 |
| 273 | Ga0307414_10071338 | 3300032004 | Bacteria | 2505 |
| 274 | Ga0307414_10085548 | 3300032004 | Bacteria | 2323 |
| 275 | Ga0307414_10513362 | 3300032004 | Bacteria | 1062 |
| 276 | Ga0307411_10036808 | 3300032005 | Bacteria | 3070 |
| 277 | Ga0400483_092845 | 3300039062 | Bacteria | 4193 |
| 278 | Ga0400483_150883 | 3300039062 | Bacteria | 26021 |
| 279 | Ga0439436_0002628 | 3300041404 | Bacteria | 5413 |
| 280 | Ga0439438_000536 | 3300041405 | Bacteria | 17257 |
| 281 | Ga0439438_001084 | 3300041405 | Bacteria | 12163 |
| 282 | Ga0439438_003740 | 3300041405 | Bacteria | 6035 |
| 283 | Ga0439438_004003 | 3300041405 | Bacteria | 5789 |
| 284 | Ga0439438_007668 | 3300041405 | Bacteria | 3662 |
| 285 | Ga0439438_013102 | 3300041405 | Bacteria | 2514 |
| 286 | Ga0439447_006569 | 3300041407 | Bacteria | 3761 |
| 287 | Ga0439447_007774 | 3300041407 | Bacteria | 3370 |
| 288 | Ga0439447_013358 | 3300041407 | Bacteria | 2333 |
| 289 | Ga0439447_018294 | 3300041407 | Bacteria | 1891 |
| 290 | Ga0439466_0000821 | 3300041411 | Bacteria | 11829 |
| 291 | Ga0439466_0001319 | 3300041411 | Bacteria | 9670 |
| 292 | Ga0439466_0006960 | 3300041411 | Bacteria | 4286 |
| 293 | Ga0439466_0007055 | 3300041411 | Bacteria | 4254 |
| 294 | Ga0439466_0025311 | 3300041411 | Bacteria | 2072 |
| 295 | Ga0439465_0003369 | 3300041413 | Bacteria | 5214 |
| 296 | Ga0451789_0749432 | 3300041443 | Bacteria | 1819 |
| 297 | Ga0451791_0941148 | 3300041451 | Bacteria | 3103 |
| 298 | Ga0451797_0336573 | 3300041453 | Bacteria | 2105 |
| 299 | Ga0451807_1281855 | 3300041486 | Bacteria | 1157 |
| 300 | Ga0451837_1500961 | 3300041494 | Bacteria | 2056 |
| 301 | Ga0451837_1566606 | 3300041494 | Bacteria | 2176 |
| 302 | Ga0451843_0572613 | 3300041509 | Bacteria | 1436 |
| 303 | Ga0439431_0017049 | 3300041997 | Bacteria | 1705 |
| 304 | Ga0439437_000834 | 3300042000 | Bacteria | 3182 |
| 305 | Ga0439432_000869 | 3300042006 | Bacteria | 11311 |
| 306 | Ga0439432_001543 | 3300042006 | Bacteria | 8652 |
| 307 | Ga0439449_0005424 | 3300042007 | Bacteria | 4886 |
| 308 | Ga0439451_009009 | 3300042009 | Bacteria | 2022 |
| 309 | Ga0439451_009893 | 3300042009 | Bacteria | 1924 |
| 310 | Ga0439452_002052 | 3300042010 | Bacteria | 7654 |
| 311 | Ga0439452_002220 | 3300042010 | Bacteria | 7306 |
| 312 | Ga0439452_002653 | 3300042010 | Bacteria | 6510 |
| 313 | Ga0439452_003972 | 3300042010 | Bacteria | 5055 |
| 314 | Ga0439452_004192 | 3300042010 | Bacteria | 4889 |
| 315 | Ga0439452_017594 | 3300042010 | Bacteria | 1917 |
| 316 | Ga0439452_038520 | 3300042010 | Bacteria | 1134 |
| 317 | Ga0439455_0025721 | 3300042012 | Bacteria | 1432 |
| 318 | Ga0439455_0033881 | 3300042012 | Bacteria | 1283 |
| 319 | Ga0439456_000070 | 3300042013 | Bacteria | 36453 |
| 320 | Ga0439456_003090 | 3300042013 | Bacteria | 3364 |
| 321 | Ga0439456_003963 | 3300042013 | Bacteria | 3006 |
| 322 | Ga0439463_001163 | 3300042016 | Bacteria | 7038 |
| 323 | Ga0439463_002510 | 3300042016 | Bacteria | 4660 |
| 324 | Ga0439463_003607 | 3300042016 | Bacteria | 3902 |
| 325 | Ga0439463_011698 | 3300042016 | Bacteria | 2155 |
| 326 | Ga0450911_001065 | 3300042115 | Bacteria | 6926 |
| 327 | Ga0450919_008608 | 3300042121 | Bacteria | 1179 |
| 328 | Ga0450920_003629 | 3300042122 | Bacteria | 2683 |
| 329 | Ga0450922_001979 | 3300042124 | Bacteria | 1962 |
| 330 | Ga0450902_004472 | 3300042137 | Bacteria | 2083 |
| 331 | Ga0450903_003228 | 3300042138 | Bacteria | 2834 |
| 332 | Ga0450904_000082 | 3300042139 | Bacteria | 21628 |
| 333 | Ga0450904_003798 | 3300042139 | Bacteria | 1609 |
| 334 | Ga0450905_001446 | 3300042142 | Bacteria | 3035 |
| 335 | Ga0450905_002711 | 3300042142 | Bacteria | 2291 |
| 336 | Ga0450907_000625 | 3300042146 | Bacteria | 9362 |
| 337 | Ga0450907_000684 | 3300042146 | Bacteria | 8785 |
| 338 | Ga0450907_013911 | 3300042146 | Bacteria | 1342 |
| 339 | Ga0450910_004928 | 3300042147 | Bacteria | 1814 |
| 340 | Ga0439446_0002180 | 3300042156 | Bacteria | 4663 |
| 341 | Ga0439446_0018279 | 3300042156 | Bacteria | 1962 |
| 342 | Ga0450909_001873 | 3300042185 | Bacteria | 2963 |
| 343 | Ga0439459_0005877 | 3300042438 | Bacteria | 2029 |
| 344 | Ga0439459_0029921 | 3300042438 | Bacteria | 1102 |
| 345 | Ga0439464_0000409 | 3300042439 | Bacteria | 8456 |
| 346 | Ga0439464_0001480 | 3300042439 | Bacteria | 5553 |
| 347 | Ga0439464_0022690 | 3300042439 | Bacteria | 1730 |
| 348 | Ga0439460_0001529 | 3300042461 | Bacteria | 5437 |
| 349 | Ga0439460_0023703 | 3300042461 | Bacteria | 1694 |
| 350 | Ga0450893_0001894 | 3300042532 | Bacteria | 3243 |
| 351 | Ga0450901_000162 | 3300042533 | Bacteria | 7699 |
| 352 | Ga0451577_0052572 | 3300042876 | Bacteria | 3637 |
| 353 | Ga0495617_002382 | 3300046452 | Bacteria | 7496 |
| 354 | Ga0495617_003876 | 3300046452 | Bacteria | 5509 |
| 355 | Ga0495617_006286 | 3300046452 | Bacteria | 4174 |
| 356 | Ga0495617_014919 | 3300046452 | Bacteria | 2637 |
| 357 | Ga0495627_000051 | 3300046453 | Bacteria | 158822 |
| 358 | Ga0495627_000140 | 3300046453 | Bacteria | 86227 |
| 359 | Ga0495627_005064 | 3300046453 | Bacteria | 5385 |
| 360 | Ga0495627_013658 | 3300046453 | Bacteria | 2854 |
| 361 | Ga0495603_0017557 | 3300046455 | Bacteria | 4331 |
| 362 | Ga0495603_0017842 | 3300046455 | Bacteria | 4296 |
| 363 | Ga0495603_0058067 | 3300046455 | Bacteria | 2289 |
| 364 | Ga0495590_0002910 | 3300046457 | Bacteria | 7048 |
| 365 | Ga0495590_0003453 | 3300046457 | Bacteria | 6447 |
| 366 | Ga0495590_0012739 | 3300046457 | Bacteria | 3111 |
| 367 | Ga0495591_000018 | 3300046458 | Bacteria | 232216 |
| 368 | Ga0495591_000720 | 3300046458 | Bacteria | 24007 |
| 369 | Ga0495591_002135 | 3300046458 | Bacteria | 11352 |
| 370 | Ga0495591_002739 | 3300046458 | Bacteria | 9543 |
| 371 | Ga0495591_003389 | 3300046458 | Bacteria | 8259 |
| 372 | Ga0495591_003954 | 3300046458 | Bacteria | 7430 |
| 373 | Ga0495591_021328 | 3300046458 | Bacteria | 2116 |
| 374 | Ga0495591_027318 | 3300046458 | Bacteria | 1761 |
| 375 | Ga0495591_037719 | 3300046458 | Bacteria | 1396 |
| 376 | Ga0495591_055495 | 3300046458 | Bacteria | 1068 |
| 377 | Ga0495638_0008086 | 3300046460 | Bacteria | 7481 |
| 378 | Ga0495638_0009256 | 3300046460 | Bacteria | 6927 |
| 379 | Ga0495638_0013737 | 3300046460 | Bacteria | 5501 |
| 380 | Ga0495638_0014242 | 3300046460 | Bacteria | 5382 |
| 381 | Ga0495638_0049388 | 3300046460 | Bacteria | 2631 |
| 382 | Ga0495638_0091040 | 3300046460 | Bacteria | 1837 |
| 383 | Ga0495638_0215543 | 3300046460 | Bacteria | 1076 |
| 384 | Ga0495653_0019000 | 3300046463 | Bacteria | 5576 |
| 385 | Ga0495650_0001745 | 3300046471 | Bacteria | 19810 |
| 386 | Ga0495650_0005287 | 3300046471 | Bacteria | 8449 |
| 387 | Ga0495650_0005747 | 3300046471 | Bacteria | 7922 |
| 388 | Ga0495650_0007282 | 3300046471 | Bacteria | 6690 |
| 389 | Ga0495650_0007355 | 3300046471 | Bacteria | 6634 |
| 390 | Ga0495650_0008282 | 3300046471 | Bacteria | 6089 |
| 391 | Ga0495650_0009449 | 3300046471 | Bacteria | 5541 |
| 392 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 393 | Ga0495605_0000222 | 3300046474 | Bacteria | 70142 |
| 394 | Ga0495605_0001613 | 3300046474 | Bacteria | 14607 |
| 395 | Ga0495605_0002842 | 3300046474 | Bacteria | 10532 |
| 396 | Ga0495605_0003110 | 3300046474 | Bacteria | 10007 |
| 397 | Ga0495605_0004637 | 3300046474 | Bacteria | 8038 |
| 398 | Ga0495605_0008220 | 3300046474 | Bacteria | 5901 |
| 399 | Ga0495605_0020220 | 3300046474 | Bacteria | 3540 |
| 400 | Ga0495639_0002536 | 3300046475 | Bacteria | 7970 |
| 401 | Ga0495584_0004201 | 3300046491 | Bacteria | 7771 |
| 402 | Ga0495584_0004645 | 3300046491 | Bacteria | 7360 |
| 403 | Ga0495584_0005069 | 3300046491 | Bacteria | 6997 |
| 404 | Ga0495584_0013739 | 3300046491 | Bacteria | 4129 |
| 405 | Ga0495584_0015717 | 3300046491 | Bacteria | 3859 |
| 406 | Ga0495584_0019288 | 3300046491 | Bacteria | 3463 |
| 407 | Ga0495585_0003948 | 3300046492 | Bacteria | 9804 |
| 408 | Ga0495585_0005318 | 3300046492 | Bacteria | 8131 |
| 409 | Ga0495585_0005667 | 3300046492 | Bacteria | 7842 |
| 410 | Ga0495585_0026931 | 3300046492 | Bacteria | 3282 |
| 411 | Ga0495585_0032074 | 3300046492 | Bacteria | 2978 |
| 412 | Ga0495594_0024608 | 3300046499 | Bacteria | 3235 |
| 413 | Ga0495594_0113999 | 3300046499 | Bacteria | 1525 |
| 414 | Ga0495596_0000105 | 3300046500 | Bacteria | 59665 |
| 415 | Ga0495607_0000335 | 3300046501 | Bacteria | 48836 |
| 416 | Ga0495607_0000679 | 3300046501 | Bacteria | 32917 |
| 417 | Ga0495607_0000685 | 3300046501 | Bacteria | 32679 |
| 418 | Ga0495607_0003854 | 3300046501 | Bacteria | 11301 |
| 419 | Ga0495607_0004015 | 3300046501 | Bacteria | 11048 |
| 420 | Ga0495607_0005200 | 3300046501 | Bacteria | 9370 |
| 421 | Ga0495607_0008559 | 3300046501 | Bacteria | 6988 |
| 422 | Ga0495607_0009291 | 3300046501 | Bacteria | 6668 |
| 423 | Ga0495607_0010574 | 3300046501 | Bacteria | 6195 |
| 424 | Ga0495607_0017209 | 3300046501 | Bacteria | 4648 |
| 425 | Ga0495607_0019750 | 3300046501 | Bacteria | 4274 |
| 426 | Ga0495607_0022541 | 3300046501 | Bacteria | 3952 |
| 427 | Ga0495607_0025860 | 3300046501 | Bacteria | 3646 |
| 428 | Ga0495607_0069243 | 3300046501 | Bacteria | 1976 |
| 429 | Ga0495607_0092086 | 3300046501 | Bacteria | 1640 |
| 430 | Ga0495607_0112208 | 3300046501 | Bacteria | 1443 |
| 431 | Ga0495607_0200992 | 3300046501 | Bacteria | 986 |
| 432 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 433 | Ga0495583_0000561 | 3300046506 | Bacteria | 51417 |
| 434 | Ga0495583_0001188 | 3300046506 | Bacteria | 28058 |
| 435 | Ga0495583_0002128 | 3300046506 | Bacteria | 17722 |
| 436 | Ga0495583_0006609 | 3300046506 | Bacteria | 7541 |
| 437 | Ga0495583_0013452 | 3300046506 | Bacteria | 4562 |
| 438 | Ga0495606_0000094 | 3300046507 | Bacteria | 151840 |
| 439 | Ga0495606_0000502 | 3300046507 | Bacteria | 63679 |
| 440 | Ga0495606_0000958 | 3300046507 | Bacteria | 42386 |
| 441 | Ga0495606_0007380 | 3300046507 | Bacteria | 9864 |
| 442 | Ga0495606_0009190 | 3300046507 | Bacteria | 8402 |
| 443 | Ga0495606_0009383 | 3300046507 | Bacteria | 8285 |
| 444 | Ga0495606_0011707 | 3300046507 | Bacteria | 7120 |
| 445 | Ga0495606_0021273 | 3300046507 | Bacteria | 4754 |
| 446 | Ga0495606_0033029 | 3300046507 | Bacteria | 3575 |
| 447 | Ga0495606_0038357 | 3300046507 | Bacteria | 3242 |
| 448 | Ga0495606_0039380 | 3300046507 | Bacteria | 3186 |
| 449 | Ga0495606_0048675 | 3300046507 | Bacteria | 2785 |
| 450 | Ga0495610_0002667 | 3300046512 | Bacteria | 14715 |
| 451 | Ga0495610_0004363 | 3300046512 | Bacteria | 10489 |
| 452 | Ga0495610_0006420 | 3300046512 | Bacteria | 8098 |
| 453 | Ga0495610_0007567 | 3300046512 | Bacteria | 7193 |
| 454 | Ga0495610_0009101 | 3300046512 | Bacteria | 6325 |
| 455 | Ga0495610_0012501 | 3300046512 | Bacteria | 5104 |
| 456 | Ga0495610_0012916 | 3300046512 | Bacteria | 4992 |
| 457 | Ga0495610_0012994 | 3300046512 | Bacteria | 4974 |
| 458 | Ga0495610_0018171 | 3300046512 | Bacteria | 3979 |
| 459 | Ga0495610_0022406 | 3300046512 | Bacteria | 3456 |
| 460 | Ga0495616_0003437 | 3300046513 | Bacteria | 10145 |
| 461 | Ga0495616_0006678 | 3300046513 | Bacteria | 6962 |
| 462 | Ga0495616_0015018 | 3300046513 | Bacteria | 4313 |
| 463 | Ga0495616_0114052 | 3300046513 | Bacteria | 1253 |
| 464 | Ga0495620_0000035 | 3300046515 | Bacteria | 115562 |
| 465 | Ga0495620_0000073 | 3300046515 | Bacteria | 83446 |
| 466 | Ga0495620_0001062 | 3300046515 | Bacteria | 16873 |
| 467 | Ga0495620_0001625 | 3300046515 | Bacteria | 13297 |
| 468 | Ga0495620_0002881 | 3300046515 | Bacteria | 9886 |
| 469 | Ga0495620_0005281 | 3300046515 | Bacteria | 7228 |
| 470 | Ga0495620_0006669 | 3300046515 | Bacteria | 6326 |
| 471 | Ga0495620_0038029 | 3300046515 | Bacteria | 2138 |
| 472 | Ga0495630_0052580 | 3300046517 | Bacteria | 3050 |
| 473 | Ga0495630_0442925 | 3300046517 | Bacteria | 995 |
| 474 | Ga0495631_0000484 | 3300046518 | Bacteria | 26620 |
| 475 | Ga0495631_0002563 | 3300046518 | Bacteria | 10170 |
| 476 | Ga0495631_0006603 | 3300046518 | Bacteria | 5970 |
| 477 | Ga0495631_0008892 | 3300046518 | Bacteria | 5040 |
| 478 | Ga0495631_0010624 | 3300046518 | Bacteria | 4553 |
| 479 | Ga0495631_0013067 | 3300046518 | Bacteria | 4038 |
| 480 | Ga0495632_0000449 | 3300046519 | Bacteria | 39222 |
| 481 | Ga0495632_0000460 | 3300046519 | Bacteria | 38758 |
| 482 | Ga0495632_0006467 | 3300046519 | Bacteria | 7525 |
| 483 | Ga0495632_0006789 | 3300046519 | Bacteria | 7306 |
| 484 | Ga0495632_0007385 | 3300046519 | Bacteria | 6909 |
| 485 | Ga0495632_0008270 | 3300046519 | Bacteria | 6409 |
| 486 | Ga0495632_0016194 | 3300046519 | Bacteria | 4153 |
| 487 | Ga0495632_0019868 | 3300046519 | Bacteria | 3649 |
| 488 | Ga0495632_0166286 | 3300046519 | Bacteria | 1014 |
| 489 | Ga0495637_0000015 | 3300046520 | Bacteria | 228949 |
| 490 | Ga0495637_0002724 | 3300046520 | Bacteria | 9627 |
| 491 | Ga0495637_0005808 | 3300046520 | Bacteria | 6249 |
| 492 | Ga0495637_0006843 | 3300046520 | Bacteria | 5699 |
| 493 | Ga0495637_0009520 | 3300046520 | Bacteria | 4734 |
| 494 | Ga0495637_0010639 | 3300046520 | Bacteria | 4442 |
| 495 | Ga0495637_0011436 | 3300046520 | Bacteria | 4265 |
| 496 | Ga0495637_0014163 | 3300046520 | Bacteria | 3766 |
| 497 | Ga0495637_0017411 | 3300046520 | Bacteria | 3348 |
| 498 | Ga0495637_0024973 | 3300046520 | Bacteria | 2699 |
| 499 | Ga0495637_0029830 | 3300046520 | Bacteria | 2424 |
| 500 | Ga0495637_0036053 | 3300046520 | Bacteria | 2157 |
| 501 | Ga0495637_0065381 | 3300046520 | Bacteria | 1481 |
| 502 | Ga0495643_0000345 | 3300046522 | Bacteria | 63090 |
| 503 | Ga0495643_0000609 | 3300046522 | Bacteria | 43060 |
| 504 | Ga0495643_0002906 | 3300046522 | Bacteria | 12991 |
| 505 | Ga0495643_0007212 | 3300046522 | Bacteria | 7204 |
| 506 | Ga0495643_0007758 | 3300046522 | Bacteria | 6870 |
| 507 | Ga0495643_0013059 | 3300046522 | Bacteria | 4989 |
| 508 | Ga0495643_0021487 | 3300046522 | Bacteria | 3701 |
| 509 | Ga0495643_0037985 | 3300046522 | Bacteria | 2639 |
| 510 | Ga0495643_0080262 | 3300046522 | Bacteria | 1698 |
| 511 | Ga0495643_0142747 | 3300046522 | Bacteria | 1192 |
| 512 | Ga0495644_0002921 | 3300046523 | Bacteria | 6786 |
| 513 | Ga0495644_0003463 | 3300046523 | Bacteria | 6244 |
| 514 | Ga0495648_0000589 | 3300046524 | Bacteria | 38874 |
| 515 | Ga0495648_0005619 | 3300046524 | Bacteria | 10384 |
| 516 | Ga0495648_0007013 | 3300046524 | Bacteria | 9080 |
| 517 | Ga0495648_0010791 | 3300046524 | Bacteria | 6936 |
| 518 | Ga0495648_0013954 | 3300046524 | Bacteria | 5910 |
| 519 | Ga0495648_0022408 | 3300046524 | Bacteria | 4348 |
| 520 | Ga0495648_0045597 | 3300046524 | Bacteria | 2725 |
| 521 | Ga0495648_0125615 | 3300046524 | Bacteria | 1371 |
| 522 | Ga0495663_0001024 | 3300046525 | Bacteria | 9246 |
| 523 | Ga0495663_0005538 | 3300046525 | Bacteria | 3502 |
| 524 | Ga0495666_0005790 | 3300046526 | Bacteria | 6227 |
| 525 | Ga0495642_0001589 | 3300046528 | Bacteria | 9943 |
| 526 | Ga0495642_0002566 | 3300046528 | Bacteria | 7338 |
| 527 | Ga0495654_0000871 | 3300046530 | Bacteria | 22688 |
| 528 | Ga0495654_0001727 | 3300046530 | Bacteria | 14682 |
| 529 | Ga0495654_0005242 | 3300046530 | Bacteria | 7565 |
| 530 | Ga0495654_0005682 | 3300046530 | Bacteria | 7194 |
| 531 | Ga0495654_0006344 | 3300046530 | Bacteria | 6724 |
| 532 | Ga0495654_0007076 | 3300046530 | Bacteria | 6312 |
| 533 | Ga0495654_0016243 | 3300046530 | Bacteria | 3940 |
| 534 | Ga0495654_0022154 | 3300046530 | Bacteria | 3302 |
| 535 | Ga0495654_0047501 | 3300046530 | Bacteria | 2109 |
| 536 | Ga0495654_0058238 | 3300046530 | Bacteria | 1864 |
| 537 | Ga0495654_0107610 | 3300046530 | Bacteria | 1275 |
| 538 | Ga0495654_0154593 | 3300046530 | Bacteria | 1012 |
| 539 | Ga0495586_0253958 | 3300046535 | Bacteria | 1003 |
| 540 | Ga0495587_0006210 | 3300046536 | Bacteria | 7796 |
| 541 | Ga0495609_0000035 | 3300046538 | Bacteria | 196269 |
| 542 | Ga0495609_0000162 | 3300046538 | Bacteria | 69584 |
| 543 | Ga0495609_0000569 | 3300046538 | Bacteria | 28968 |
| 544 | Ga0495609_0029729 | 3300046538 | Bacteria | 2486 |
| 545 | Ga0495609_0067451 | 3300046538 | Bacteria | 1575 |
| 546 | Ga0495609_0165608 | 3300046538 | Bacteria | 935 |
| 547 | Ga0495597_0000044 | 3300046542 | Bacteria | 106714 |
| 548 | Ga0495597_0002661 | 3300046542 | Bacteria | 11051 |
| 549 | Ga0495597_0004928 | 3300046542 | Bacteria | 7174 |
| 550 | Ga0495597_0011362 | 3300046542 | Bacteria | 4318 |
| 551 | Ga0495597_0030461 | 3300046542 | Bacteria | 2459 |
| 552 | Ga0495597_0042816 | 3300046542 | Bacteria | 2017 |
| 553 | Ga0495597_0046211 | 3300046542 | Bacteria | 1929 |
| 554 | Ga0495597_0067290 | 3300046542 | Bacteria | 1550 |
| 555 | Ga0495622_0003194 | 3300046557 | Bacteria | 7760 |
| 556 | Ga0495622_0006082 | 3300046557 | Bacteria | 5611 |
| 557 | Ga0495622_0076114 | 3300046557 | Bacteria | 1546 |
| 558 | Ga0495622_0191022 | 3300046557 | Bacteria | 915 |
| 559 | Ga0495633_0000028 | 3300046558 | Bacteria | 203214 |
| 560 | Ga0495633_0008320 | 3300046558 | Bacteria | 5858 |
| 561 | Ga0495668_0004916 | 3300046616 | Bacteria | 9277 |
| 562 | Ga0495668_0010092 | 3300046616 | Bacteria | 5745 |
| 563 | Ga0495668_0012890 | 3300046616 | Bacteria | 4949 |
| 564 | Ga0495668_0023225 | 3300046616 | Bacteria | 3539 |
| 565 | Ga0495668_0036646 | 3300046616 | Bacteria | 2748 |
| 566 | Ga0495634_0007654 | 3300046642 | Bacteria | 8090 |
| 567 | Ga0495611_0001242 | 3300046648 | Bacteria | 13129 |
| 568 | Ga0495611_0001633 | 3300046648 | Bacteria | 10885 |
| 569 | Ga0495611_0002739 | 3300046648 | Bacteria | 7920 |
| 570 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 571 | Ga0495625_0011499 | 3300046660 | Bacteria | 7213 |
| 572 | Ga0495625_0030660 | 3300046660 | Bacteria | 4009 |
| 573 | Ga0495625_0076739 | 3300046660 | Bacteria | 2335 |
| 574 | Ga0495625_0105121 | 3300046660 | Bacteria | 1935 |
| 575 | Ga0495635_0034375 | 3300046663 | Bacteria | 3515 |
| 576 | Ga0495659_0001557 | 3300046664 | Bacteria | 7729 |
| 577 | Ga0495659_0005645 | 3300046664 | Bacteria | 3943 |
| 578 | Ga0495661_0000006 | 3300046665 | Bacteria | 427288 |
| 579 | Ga0495661_0000059 | 3300046665 | Bacteria | 131931 |
| 580 | Ga0495661_0000401 | 3300046665 | Bacteria | 46171 |
| 581 | Ga0495661_0000447 | 3300046665 | Bacteria | 43687 |
| 582 | Ga0495661_0005286 | 3300046665 | Bacteria | 9179 |
| 583 | Ga0495661_0027666 | 3300046665 | Bacteria | 3637 |
| 584 | Ga0495661_0105054 | 3300046665 | Bacteria | 1582 |
| 585 | Ga0495661_0166207 | 3300046665 | Bacteria | 1180 |
| 586 | Ga0495588_0011458 | 3300046674 | Bacteria | 4163 |
| 587 | Ga0495588_0087227 | 3300046674 | Bacteria | 1632 |
| 588 | Ga0495588_0180472 | 3300046674 | Bacteria | 1116 |
| 589 | Ga0495669_0004408 | 3300046684 | Bacteria | 5812 |
| 590 | Ga0495613_0036295 | 3300046689 | Bacteria | 3655 |
| 591 | Ga0495670_0002612 | 3300046691 | Bacteria | 8898 |
| 592 | Ga0495670_0012350 | 3300046691 | Bacteria | 4198 |
| 593 | Ga0495670_0014205 | 3300046691 | Bacteria | 3918 |
| 594 | Ga0495670_0014270 | 3300046691 | Bacteria | 3908 |
| 595 | Ga0495670_0014808 | 3300046691 | Bacteria | 3839 |
| 596 | Ga0495670_0024304 | 3300046691 | Bacteria | 2995 |
| 597 | Ga0495671_0002402 | 3300046692 | Bacteria | 11864 |
| 598 | Ga0495671_0002948 | 3300046692 | Bacteria | 10581 |
| 599 | Ga0495671_0003752 | 3300046692 | Bacteria | 9233 |
| 600 | Ga0495671_0004807 | 3300046692 | Bacteria | 7980 |
| 601 | Ga0495671_0005750 | 3300046692 | Bacteria | 7229 |
| 602 | Ga0495671_0008524 | 3300046692 | Bacteria | 5763 |
| 603 | Ga0495671_0010010 | 3300046692 | Bacteria | 5273 |
| 604 | Ga0495671_0016467 | 3300046692 | Bacteria | 3947 |
| 605 | Ga0495671_0026509 | 3300046692 | Bacteria | 3004 |
| 606 | Ga0495671_0051666 | 3300046692 | Bacteria | 2044 |
| 607 | Ga0495671_0085878 | 3300046692 | Bacteria | 1541 |
| 608 | Ga0495649_0001079 | 3300046694 | Bacteria | 21270 |
| 609 | Ga0495649_0003471 | 3300046694 | Bacteria | 10625 |
| 610 | Ga0495649_0004328 | 3300046694 | Bacteria | 9312 |
| 611 | Ga0495649_0007187 | 3300046694 | Bacteria | 6833 |
| 612 | Ga0495649_0007280 | 3300046694 | Bacteria | 6771 |
| 613 | Ga0495649_0015306 | 3300046694 | Bacteria | 4367 |
| 614 | Ga0495649_0021425 | 3300046694 | Bacteria | 3620 |
| 615 | Ga0495649_0032456 | 3300046694 | Bacteria | 2875 |
| 616 | Ga0495649_0034207 | 3300046694 | Bacteria | 2796 |
| 617 | Ga0495649_0120682 | 3300046694 | Bacteria | 1386 |
| 618 | Ga0495589_0003843 | 3300046794 | Bacteria | 8070 |
| 619 | Ga0495589_0004661 | 3300046794 | Bacteria | 7283 |
| 620 | Ga0495589_0060596 | 3300046794 | Bacteria | 1859 |
| 621 | Ga0495589_0071409 | 3300046794 | Bacteria | 1696 |
| 622 | Ga0495600_0009911 | 3300046809 | Bacteria | 5901 |
| 623 | Ga0495600_0233810 | 3300046809 | Bacteria | 1173 |
| 624 | Ga0495660_0000505 | 3300046810 | Bacteria | 32144 |
| 625 | Ga0495660_0001125 | 3300046810 | Bacteria | 19057 |
| 626 | Ga0495660_0002977 | 3300046810 | Bacteria | 10575 |
| 627 | Ga0495660_0004367 | 3300046810 | Bacteria | 8560 |
| 628 | Ga0495660_0005636 | 3300046810 | Bacteria | 7486 |
| 629 | Ga0495660_0022994 | 3300046810 | Bacteria | 3556 |
| 630 | Ga0495660_0023806 | 3300046810 | Bacteria | 3491 |
| 631 | Ga0495581_0050702 | 3300047315 | Bacteria | 2397 |
| 632 | Ga0495636_0032998 | 3300047318 | Bacteria | 2125 |
| 633 | Ga0495672_0005426 | 3300047320 | Bacteria | 10120 |
| 634 | Ga0495672_0006857 | 3300047320 | Bacteria | 8697 |
| 635 | Ga0495672_0009340 | 3300047320 | Bacteria | 7118 |
| 636 | Ga0495672_0009385 | 3300047320 | Bacteria | 7094 |
| 637 | Ga0495672_0009896 | 3300047320 | Bacteria | 6852 |
| 638 | Ga0495672_0009926 | 3300047320 | Bacteria | 6839 |
| 639 | Ga0495672_0010387 | 3300047320 | Bacteria | 6639 |
| 640 | Ga0495672_0010868 | 3300047320 | Bacteria | 6457 |
| 641 | Ga0495672_0015928 | 3300047320 | Bacteria | 5090 |
| 642 | Ga0495672_0019887 | 3300047320 | Bacteria | 4415 |
| 643 | Ga0495672_0023871 | 3300047320 | Bacteria | 3950 |
| 644 | Ga0495672_0035366 | 3300047320 | Bacteria | 3077 |
| 645 | Ga0495672_0080488 | 3300047320 | Bacteria | 1816 |
| 646 | Ga0495676_0000004 | 3300047321 | Bacteria | 313696 |
| 647 | Ga0495676_0021904 | 3300047321 | Bacteria | 5570 |
| 648 | Ga0495680_0028213 | 3300047322 | Bacteria | 4603 |
| 649 | Ga0495683_0000033 | 3300047323 | Bacteria | 149031 |
| 650 | Ga0495683_0000091 | 3300047323 | Bacteria | 91313 |
| 651 | Ga0495683_0003722 | 3300047323 | Bacteria | 8823 |
| 652 | Ga0495683_0005092 | 3300047323 | Bacteria | 7350 |
| 653 | Ga0495683_0018243 | 3300047323 | Bacteria | 3629 |
| 654 | Ga0495683_0047733 | 3300047323 | Bacteria | 2148 |
| 655 | Ga0495687_005976 | 3300047443 | Bacteria | 7587 |
| 656 | Ga0495687_006399 | 3300047443 | Bacteria | 7224 |
| 657 | Ga0495687_007940 | 3300047443 | Bacteria | 6165 |
| 658 | Ga0495675_0013139 | 3300047444 | Bacteria | 5223 |
| 659 | Ga0495675_0092161 | 3300047444 | Bacteria | 1901 |
| 660 | Ga0495679_000083 | 3300047446 | Bacteria | 87051 |
| 661 | Ga0495679_000461 | 3300047446 | Bacteria | 29942 |
| 662 | Ga0495679_002991 | 3300047446 | Bacteria | 8327 |
| 663 | Ga0495679_003054 | 3300047446 | Bacteria | 8223 |
| 664 | Ga0495679_027084 | 3300047446 | Bacteria | 1896 |
| 665 | Ga0495673_0003544 | 3300047469 | Bacteria | 10275 |
| 666 | Ga0495673_0003918 | 3300047469 | Bacteria | 9546 |
| 667 | Ga0495673_0004180 | 3300047469 | Bacteria | 9122 |
| 668 | Ga0495673_0004973 | 3300047469 | Bacteria | 8174 |
| 669 | Ga0495673_0006630 | 3300047469 | Bacteria | 6785 |
| 670 | Ga0495673_0008633 | 3300047469 | Bacteria | 5704 |
| 671 | Ga0495673_0011492 | 3300047469 | Bacteria | 4758 |
| 672 | Ga0495673_0014539 | 3300047469 | Bacteria | 4089 |
| 673 | Ga0495673_0016603 | 3300047469 | Bacteria | 3761 |
| 674 | Ga0495673_0020443 | 3300047469 | Bacteria | 3295 |
| 675 | Ga0495673_0032778 | 3300047469 | Bacteria | 2417 |
| 676 | Ga0495673_0117534 | 3300047469 | Bacteria | 1056 |
| 677 | Ga0495681_0003353 | 3300047470 | Bacteria | 11145 |
| 678 | Ga0495681_0005364 | 3300047470 | Bacteria | 8597 |
| 679 | Ga0495681_0006537 | 3300047470 | Bacteria | 7635 |
| 680 | Ga0495681_0006989 | 3300047470 | Bacteria | 7301 |
| 681 | Ga0495681_0007295 | 3300047470 | Bacteria | 7089 |
| 682 | Ga0495681_0015124 | 3300047470 | Bacteria | 4379 |
| 683 | Ga0495681_0021072 | 3300047470 | Bacteria | 3520 |
| 684 | Ga0495681_0022079 | 3300047470 | Bacteria | 3413 |
| 685 | Ga0495681_0033341 | 3300047470 | Bacteria | 2580 |
| 686 | Ga0495681_0063608 | 3300047470 | Bacteria | 1692 |
| 687 | Ga0495686_0009065 | 3300047472 | Bacteria | 7216 |
| 688 | Ga0495686_0063765 | 3300047472 | Bacteria | 2282 |
| 689 | Ga0495593_0006895 | 3300047673 | Bacteria | 6653 |
| 690 | Ga0495626_0000173 | 3300048091 | Bacteria | 79835 |
| 691 | Ga0495626_0003845 | 3300048091 | Bacteria | 9420 |
| 692 | Ga0495626_0003921 | 3300048091 | Bacteria | 9319 |
| 693 | Ga0495626_0004903 | 3300048091 | Bacteria | 8043 |
| 694 | Ga0495626_0005054 | 3300048091 | Bacteria | 7869 |
| 695 | Ga0495626_0005599 | 3300048091 | Bacteria | 7285 |
| 696 | Ga0495626_0008800 | 3300048091 | Bacteria | 5492 |
| 697 | Ga0496102_0007371 | 3300048905 | Bacteria | 9399 |
| 698 | Ga0496110_0183626 | 3300048913 | Bacteria | 1899 |
| 699 | Ga0496110_0238254 | 3300048913 | Bacteria | 1655 |
| 700 | Ga0496111_0080837 | 3300048914 | Bacteria | 2372 |
| 701 | Ga0496111_0462861 | 3300048914 | Bacteria | 935 |
| 702 | Ga0496112_0038333 | 3300048915 | Bacteria | 4679 |
| 703 | Ga0496112_0090559 | 3300048915 | Bacteria | 3028 |
| 704 | Ga0496114_0047512 | 3300048917 | Bacteria | 3570 |
| 705 | Ga0496116_0000574 | 3300048919 | Bacteria | 49172 |
| 706 | Ga0496116_0010026 | 3300048919 | Bacteria | 7992 |
| 707 | Ga0496117_0001296 | 3300048920 | Bacteria | 36823 |
| 708 | Ga0496117_0004436 | 3300048920 | Bacteria | 15484 |
| 709 | Ga0496117_0008721 | 3300048920 | Bacteria | 9582 |
| 710 | Ga0496117_0010406 | 3300048920 | Bacteria | 8484 |
| 711 | Ga0496117_0011529 | 3300048920 | Bacteria | 7910 |
| 712 | Ga0496117_0048847 | 3300048920 | Bacteria | 3016 |
| 713 | Ga0496117_0187291 | 3300048920 | Bacteria | 1183 |
| 714 | Ga0496118_0013881 | 3300048921 | Bacteria | 7581 |
| 715 | Ga0496118_0029328 | 3300048921 | Bacteria | 4616 |
| 716 | Ga0496118_0039239 | 3300048921 | Bacteria | 3781 |
| 717 | Ga0496118_0095737 | 3300048921 | Bacteria | 2025 |
| 718 | Ga0496118_0102172 | 3300048921 | Bacteria | 1933 |
| 719 | Ga0496118_0115462 | 3300048921 | Bacteria | 1767 |
| 720 | Ga0496118_0257754 | 3300048921 | Bacteria | 986 |
| 721 | Ga0496119_0000086 | 3300048922 | Bacteria | 137053 |
| 722 | Ga0496120_0001853 | 3300048923 | Bacteria | 23531 |
| 723 | Ga0496120_0019966 | 3300048923 | Bacteria | 4272 |
| 724 | Ga0496121_0000299 | 3300048924 | Bacteria | 103000 |
| 725 | Ga0496121_0003112 | 3300048924 | Bacteria | 23982 |
| 726 | Ga0496121_0004378 | 3300048924 | Bacteria | 19076 |
| 727 | Ga0496121_0015997 | 3300048924 | Bacteria | 7778 |
| 728 | Ga0496121_0190928 | 3300048924 | Bacteria | 1468 |
| 729 | Ga0496121_0307850 | 3300048924 | Bacteria | 1072 |
| 730 | Ga0496122_0000156 | 3300048925 | Bacteria | 160178 |
| 731 | Ga0496122_0005397 | 3300048925 | Bacteria | 15260 |
| 732 | Ga0496122_0009262 | 3300048925 | Bacteria | 10415 |
| 733 | Ga0496122_0010792 | 3300048925 | Bacteria | 9359 |
| 734 | Ga0496122_0014336 | 3300048925 | Bacteria | 7671 |
| 735 | Ga0496122_0017324 | 3300048925 | Bacteria | 6745 |
| 736 | Ga0496122_0023244 | 3300048925 | Bacteria | 5474 |
| 737 | Ga0496122_0028666 | 3300048925 | Bacteria | 4716 |
| 738 | Ga0496122_0042754 | 3300048925 | Bacteria | 3560 |
| 739 | Ga0496122_0073995 | 3300048925 | Bacteria | 2412 |
| 740 | Ga0496122_0075708 | 3300048925 | Bacteria | 2372 |
| 741 | Ga0496122_0191155 | 3300048925 | Bacteria | 1208 |
| 742 | Ga0496123_0000087 | 3300048926 | Bacteria | 182994 |
| 743 | Ga0496123_0000445 | 3300048926 | Bacteria | 74126 |
| 744 | Ga0496123_0003302 | 3300048926 | Bacteria | 18282 |
| 745 | Ga0496123_0013778 | 3300048926 | Bacteria | 6752 |
| 746 | Ga0496123_0015908 | 3300048926 | Bacteria | 6138 |
| 747 | Ga0496123_0021700 | 3300048926 | Bacteria | 4980 |
| 748 | Ga0496123_0075191 | 3300048926 | Bacteria | 2086 |
| 749 | Ga0496123_0102372 | 3300048926 | Bacteria | 1662 |
| 750 | Ga0496124_0000031 | 3300048927 | Bacteria | 344232 |
| 751 | Ga0496124_0006746 | 3300048927 | Bacteria | 12412 |
| 752 | Ga0496124_0009610 | 3300048927 | Bacteria | 9911 |
| 753 | Ga0496124_0010222 | 3300048927 | Bacteria | 9532 |
| 754 | Ga0496124_0012164 | 3300048927 | Bacteria | 8519 |
| 755 | Ga0496124_0017316 | 3300048927 | Bacteria | 6794 |
| 756 | Ga0496124_0020633 | 3300048927 | Bacteria | 6082 |
| 757 | Ga0496124_0086969 | 3300048927 | Bacteria | 2557 |
| 758 | Ga0496124_0168653 | 3300048927 | Bacteria | 1698 |
| 759 | Ga0496124_0275207 | 3300048927 | Bacteria | 1230 |
| 760 | Ga0496125_0000658 | 3300048928 | Bacteria | 57602 |
| 761 | Ga0496125_0009054 | 3300048928 | Bacteria | 10308 |
| 762 | Ga0496125_0013589 | 3300048928 | Bacteria | 7996 |
| 763 | Ga0496125_0020047 | 3300048928 | Bacteria | 6286 |
| 764 | Ga0496125_0039884 | 3300048928 | Bacteria | 4035 |
| 765 | Ga0496125_0047858 | 3300048928 | Bacteria | 3571 |
| 766 | Ga0496125_0084043 | 3300048928 | Bacteria | 2419 |
| 767 | Ga0496125_0115945 | 3300048928 | Bacteria | 1925 |
| 768 | Ga0496125_0131980 | 3300048928 | Bacteria | 1756 |
| 769 | Ga0496126_0014261 | 3300048929 | Bacteria | 8040 |
| 770 | Ga0496126_0146285 | 3300048929 | Bacteria | 2029 |
| 771 | Ga0496126_0176260 | 3300048929 | Bacteria | 1818 |
| 772 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 773 | Ga0495678_000137 | 3300049459 | Bacteria | 87580 |
| 774 | Ga0495678_004792 | 3300049459 | Bacteria | 7698 |
| 775 | Ga0495678_005207 | 3300049459 | Bacteria | 7270 |
| 776 | Ga0495678_009441 | 3300049459 | Bacteria | 4826 |
| 777 | Ga0495678_011475 | 3300049459 | Bacteria | 4239 |
| 778 | Ga0495678_014120 | 3300049459 | Bacteria | 3723 |
| 779 | Ga0495678_021163 | 3300049459 | Bacteria | 2868 |
| 780 | Ga0495678_034139 | 3300049459 | Bacteria | 2095 |
| 781 | Ga0495678_045352 | 3300049459 | Bacteria | 1734 |
| 782 | Ga0495678_055078 | 3300049459 | Bacteria | 1520 |
| 783 | Ga0495678_098589 | 3300049459 | Bacteria | 1016 |
| 784 | Ga0495682_0000492 | 3300049460 | Bacteria | 27338 |
| 785 | Ga0495682_0000550 | 3300049460 | Bacteria | 25848 |
| 786 | Ga0495682_0035567 | 3300049460 | Bacteria | 1834 |
| 787 | Ga0495682_0085664 | 3300049460 | Bacteria | 1132 |
| 788 | Ga0495682_0111945 | 3300049460 | Bacteria | 978 |
| 789 | Ga0501032_0078869 | 3300049569 | Bacteria | 2192 |
| 790 | Ga0501034_0000200 | 3300049571 | Bacteria | 113556 |
| 791 | Ga0501034_0319183 | 3300049571 | Bacteria | 1487 |
| 792 | Ga0501037_0024841 | 3300049573 | Bacteria | 4430 |
| 793 | Ga0501226_000009 | 3300049853 | Bacteria | 194138 |
| 794 | Ga0501226_000864 | 3300049853 | Bacteria | 4053 |
| 795 | nmdc:mga0k408_97_c1 | 3300050493 | Bacteria | 42090 |
| 796 | Ga0500595_012839 | 3300053119 | Bacteria | 3224 |
| 797 | Ga0500618_007221 | 3300053125 | Bacteria | 3188 |
| 798 | Ga0500573_0010506 | 3300053140 | Bacteria | 5168 |
| 799 | Ga0500634_0010173 | 3300053161 | Bacteria | 4796 |
| 800 | Ga0500609_010574 | 3300053731 | Bacteria | 1243 |
| 801 | 2510282126 | 2510065053 | Bacteria | 5005518 |
| 802 | 2510291715 | 2510065055 | Bacteria | 5037935 |
| 803 | 2510310274 | 2510065058 | Bacteria | 5005894 |
| 804 | 2511253778 | 2511231004 | Bacteria | 6669789 |
| 805 | 2511266162 | 2511231006 | Bacteria | 6794709 |
| 806 | 2511270314 | 2511231007 | Bacteria | 6306603 |
| 807 | 2511276082 | 2511231008 | Bacteria | 6624100 |
| 808 | 2511288336 | 2511231010 | Bacteria | 6373152 |
| 809 | 2511297880 | 2511231011 | Bacteria | 6149768 |
| 810 | 2511312632 | 2511231014 | Bacteria | 6462302 |
| 811 | 2511324726 | 2511231016 | Bacteria | 6704427 |
| 812 | 2511338100 | 2511231018 | Bacteria | 6436256 |
| 813 | 2511342884 | 2511231019 | Bacteria | 6520662 |
| 814 | 2511352635 | 2511231020 | Bacteria | 6115223 |
| 815 | 2511359008 | 2511231021 | Bacteria | 7302637 |
| 816 | 2511362631 | 2511231022 | Bacteria | 6719296 |
| 817 | 2511372126 | 2511231023 | Bacteria | 6808468 |
| 818 | 2511377337 | 2511231024 | Bacteria | 5835885 |
| 819 | 2511411826 | 2511231031 | Bacteria | 6558529 |
| 820 | 2511825948 | 2511231156 | Bacteria | 6845832 |
| 821 | 2512326883 | 2512047018 | Bacteria | 6663241 |
| 822 | 2554814577 | 2554235132 | Bacteria | 6772433 |
| 823 | 2555247946 | 2554235231 | Bacteria | 5215788 |
| 824 | 2555668965 | 2554235341 | Bacteria | 6867980 |
| 825 | 2583793490 | 2582580891 | Bacteria | 6800976 |
| 826 | 2597857154 | 2597489887 | Bacteria | 6666321 |
| 827 | 2597862871 | 2597489888 | Bacteria | 6179543 |
| 828 | 2597868669 | 2597489889 | Bacteria | 6297495 |
| 829 | 2599326505 | 2599185155 | Bacteria | 5827168 |
| 830 | 2599357323 | 2599185160 | Bacteria | 6844013 |
| 831 | 2599361865 | 2599185161 | Bacteria | 6960462 |
| 832 | 2599368186 | 2599185162 | Bacteria | 6957254 |
| 833 | 2599374975 | 2599185163 | Bacteria | 6995158 |
| 834 | 2599382428 | 2599185164 | Bacteria | 6841688 |
| 835 | 2599388875 | 2599185165 | Bacteria | 6843250 |
| 836 | 2599393833 | 2599185166 | Bacteria | 6959206 |
| 837 | 2599396570 | 2599185167 | Bacteria | 6353609 |
| 838 | 2599405598 | 2599185168 | Bacteria | 6997636 |
| 839 | 2599453370 | 2599185179 | Bacteria | 6611171 |
| 840 | 2599464176 | 2599185181 | Bacteria | 6844519 |
| 841 | 2599468472 | 2599185182 | Bacteria | 6883168 |
| 842 | 2599484176 | 2599185185 | Bacteria | 6652270 |
| 843 | 2599493195 | 2599185186 | Bacteria | 6831633 |
| 844 | 2599504653 | 2599185188 | Bacteria | 6164180 |
| 845 | 2599507552 | 2599185189 | Bacteria | 5862825 |
| 846 | 2599514702 | 2599185190 | Bacteria | 6285678 |
| 847 | 2599517367 | 2599185191 | Bacteria | 6297582 |
| 848 | 2599611417 | 2599185212 | Bacteria | 6765997 |
| 849 | 2599771495 | 2599185248 | Bacteria | 6696816 |
| 850 | 2599801827 | 2599185257 | Bacteria | 6492581 |
| 851 | 2599883017 | 2599185288 | Bacteria | 6666191 |
| 852 | 2599884031 | 2599185289 | Bacteria | 6778765 |
| 853 | 2599894033 | 2599185290 | Bacteria | 6289611 |
| 854 | 2599899036 | 2599185291 | Bacteria | 6775623 |
| 855 | 2599935014 | 2599185300 | Bacteria | 6062622 |
| 856 | 2599941619 | 2599185302 | Bacteria | 5954930 |
| 857 | 2599952423 | 2599185303 | Bacteria | 6512725 |
| 858 | 2599952861 | 2599185304 | Bacteria | 5951361 |
| 859 | 2599958825 | 2599185305 | Bacteria | 6748700 |
| 860 | 2599968680 | 2599185306 | Bacteria | 6637356 |
| 861 | 2599970591 | 2599185307 | Bacteria | 6194719 |
| 862 | 2599976937 | 2599185308 | Bacteria | 6621546 |
| 863 | 2599981788 | 2599185309 | Bacteria | 5969593 |
| 864 | 2599987697 | 2599185310 | Bacteria | 6014457 |
| 865 | 2599995189 | 2599185311 | Bacteria | 6354990 |
| 866 | 2599998411 | 2599185312 | Bacteria | 5912071 |
| 867 | 2600003310 | 2599185313 | Bacteria | 6658188 |
| 868 | 2600011106 | 2599185314 | Bacteria | 6621749 |
| 869 | 2600017885 | 2599185315 | Bacteria | 6771107 |
| 870 | 2600022404 | 2599185316 | Bacteria | 6320029 |
| 871 | 2600027425 | 2599185317 | Bacteria | 6435722 |
| 872 | 2600034196 | 2599185318 | Bacteria | 6961590 |
| 873 | 2600039704 | 2599185319 | Bacteria | 6637840 |
| 874 | 2600046027 | 2599185320 | Bacteria | 5963263 |
| 875 | 2600052404 | 2599185321 | Bacteria | 6764560 |
| 876 | 2600057365 | 2599185322 | Bacteria | 6763055 |
| 877 | 2600064542 | 2599185323 | Bacteria | 6688755 |
| 878 | 2600069659 | 2599185324 | Bacteria | 6590677 |
| 879 | 2600075679 | 2599185325 | Bacteria | 6324919 |
| 880 | 2600216451 | 2599185356 | Bacteria | 6843884 |
| 881 | 2600356866 | 2600254930 | Bacteria | 6431253 |
| 882 | 2600365490 | 2600254931 | Bacteria | 6734225 |
| 883 | 2600446664 | 2600254954 | Bacteria | 5100516 |
| 884 | 2601624983 | 2600255283 | Bacteria | 6061572 |
| 885 | 2601691403 | 2600255296 | Bacteria | 5784754 |
| 886 | 2601776956 | 2600255313 | Bacteria | 6842543 |
| 887 | 2601797479 | 2600255318 | Bacteria | 6383414 |
| 888 | 2602010797 | 2600255389 | Bacteria | 5275336 |
| 889 | 2606075788 | 2603880185 | Bacteria | 6379190 |
| 890 | 2606130924 | 2603880199 | Bacteria | 6377649 |
| 891 | 2608381961 | 2606217733 | Bacteria | 6360972 |
| 892 | 2621301046 | 2619619299 | Bacteria | 6649820 |
| 893 | 2624481743 | 2623620443 | Bacteria | 6427864 |
| 894 | 2624491342 | 2623620446 | Bacteria | 6500345 |
| 895 | 2643846329 | 2643221565 | Bacteria | 6216018 |
| 896 | 2643872951 | 2643221571 | Bacteria | 6228673 |
| 897 | 2643952851 | 2643221589 | Bacteria | 6250934 |
| 898 | 2644022613 | 2643221602 | Bacteria | 6249926 |
| 899 | 2644188826 | 2643221633 | Bacteria | 6733554 |
| 900 | 2644286761 | 2643221650 | Bacteria | 7029547 |
| 901 | 2644625151 | 2643221713 | Bacteria | 6554480 |
| 902 | 2652548620 | 2651869719 | Bacteria | 6047974 |
| 903 | 2671091535 | 2667528170 | Bacteria | 6786960 |
| 904 | 2671098504 | 2667528171 | Bacteria | 6900659 |
| 905 | 2671126208 | 2667528176 | Bacteria | 6724917 |
| 906 | 2671768776 | 2671180172 | Bacteria | 6495783 |
| 907 | 2677896719 | 2675903420 | Bacteria | 6247433 |
| 908 | 2678262791 | 2675903515 | Bacteria | 6580491 |
| 909 | 2715751642 | 2713897148 | Bacteria | 5883533 |
| 910 | 2715759811 | 2713897149 | Bacteria | 6506249 |
| 911 | 2718635015 | 2718217725 | Bacteria | 5758958 |
| 912 | 2723247698 | 2721755607 | Bacteria | 5841722 |
| 913 | 2729148001 | 2728369097 | Bacteria | 4333476 |
| 914 | 2738670330 | 2738541265 | Bacteria | 6594665 |
| 915 | 2738688430 | 2738541271 | Bacteria | 5657310 |
| 916 | 2738748723 | 2738541282 | Bacteria | 6593925 |
| 917 | 2738809608 | 2738541294 | Bacteria | 6925949 |
| 918 | 2738857765 | 2738541303 | Bacteria | 6591772 |
| 919 | 2738896968 | 2738541309 | Bacteria | 6926455 |
| 920 | 2739201523 | 2738543004 | Bacteria | 6381073 |
| 921 | 2739259516 | 2738543015 | Bacteria | 6750701 |
| 922 | 2739264162 | 2738543016 | Bacteria | 5657564 |
| 923 | 2739285188 | 2738543020 | Bacteria | 5718238 |
| 924 | 2739290502 | 2738543021 | Bacteria | 5718241 |
| 925 | 2739313927 | 2738543025 | Bacteria | 6600348 |
| 926 | 2743736573 | 2740892503 | Bacteria | 6855563 |
| 927 | 2745009127 | 2744054620 | Bacteria | 6551379 |
| 928 | 2765585091 | 2765235841 | Bacteria | 6137024 |
| 929 | 2774121061 | 2773857670 | Bacteria | 6407454 |
| 930 | 2774132470 | 2773857672 | Bacteria | 4993178 |
| 931 | 2774137258 | 2773857673 | Bacteria | 6513460 |
| 932 | 2784263519 | 2784132063 | Bacteria | 6262788 |
| 933 | 2784314134 | 2784132072 | Bacteria | 6596533 |
| 934 | 2794598190 | 2791355520 | Bacteria | 5948615 |
| 935 | 2807409226 | 2806310737 | Bacteria | 5751088 |
| 936 | 2807457528 | 2806310745 | Bacteria | 5742165 |
| 937 | 2808854418 | 2808606361 | Bacteria | 6136259 |
| 938 | 2808907714 | 2808606373 | Bacteria | 4423627 |
| 939 | 2808925771 | 2808606376 | Bacteria | 6248667 |
| 940 | 2808927662 | 2808606377 | Bacteria | 6646337 |
| 941 | 2808934498 | 2808606378 | Bacteria | 6177535 |
| 942 | 2808943391 | 2808606379 | Bacteria | 5022697 |
| 943 | 2808947872 | 2808606380 | Bacteria | 6248705 |
| 944 | 2808949798 | 2808606381 | Bacteria | 6646461 |
| 945 | 2808957940 | 2808606382 | Bacteria | 6841132 |
| 946 | 2808962923 | 2808606383 | Bacteria | 6138645 |
| 947 | 2808975750 | 2808606385 | Bacteria | 6711065 |
| 948 | 2808990611 | 2808606388 | Bacteria | 6706662 |
| 949 | 2808997660 | 2808606389 | Bacteria | 6138126 |
| 950 | 2809216658 | 2808606445 | Bacteria | 6057339 |
| 951 | 2812367566 | 2811994881 | Bacteria | 6298475 |
| 952 | 2817489603 | 2816332298 | Bacteria | 6852809 |
| 953 | 2819656321 | 2818991456 | Bacteria | 6123676 |
| 954 | 2819703583 | 2818991464 | Bacteria | 6907494 |
| 955 | 2823423369 | 2823421272 | Bacteria | 5372474 |
| 956 | 2825652850 | 2825651385 | Bacteria | 6715909 |
| 957 | 2826583205 | 2826581358 | Bacteria | 5963467 |
| 958 | 2834029523 | 2834028612 | Bacteria | 6354979 |
| 959 | 2842810021 | 2842805378 | Bacteria | 5385175 |
| 960 | 2842817454 | 2842815866 | Bacteria | 5947510 |
| 961 | 2842830988 | 2842826826 | Bacteria | 5974129 |
| 962 | 2842837572 | 2842832357 | Bacteria | 5959113 |
| 963 | 2842842185 | 2842837860 | Bacteria | 6066181 |
| 964 | 2842844482 | 2842843487 | Bacteria | 6004777 |
| 965 | 2842850535 | 2842849001 | Bacteria | 5924277 |
| 966 | 2842857501 | 2842854478 | Bacteria | 6143501 |
| 967 | 2844669454 | 2844665904 | Bacteria | 6817974 |
| 968 | 2852614958 | 2852612431 | Bacteria | 6885235 |
| 969 | 2852658396 | 2852657418 | Bacteria | 6472974 |
| 970 | 2852669926 | 2852667396 | Bacteria | 6885555 |
| 971 | 2860339712 | 2860339153 | Bacteria | 6846989 |
| 972 | 2860869516 | 2860867994 | Bacteria | 5645326 |
| 973 | 2878033725 | 2878029506 | Bacteria | 6418441 |
| 974 | 2880234367 | 2880230671 | Bacteria | 6140320 |
| 975 | 2904522903 | 2904518522 | Bacteria | 6068986 |
| 976 | 2904554373 | 2904550169 | Bacteria | 6221258 |
| 977 | 2908448441 | 2908446538 | Bacteria | 6829095 |
| 978 | 2912967342 | 2912963787 | Bacteria | 5646108 |
| 979 | 2913038765 | 2913036834 | Bacteria | 6704877 |
| 980 | 2917072754 | 2917070673 | Bacteria | 6868303 |
| 981 | 2917835881 | 2917832318 | Bacteria | 5346010 |
| 982 | 2919069091 | 2919063839 | Bacteria | 6302690 |
| 983 | 2919125739 | 2919125081 | Bacteria | 5385106 |
| 984 | 2919158428 | 2919155634 | Bacteria | 4860545 |
| 985 | 2919387849 | 2919385768 | Bacteria | 5897293 |
| 986 | 2919456806 | 2919456309 | Bacteria | 6586567 |
| 987 | 2919482038 | 2919481497 | Bacteria | 6907839 |
| 988 | 2919490575 | 2919487758 | Bacteria | 5929766 |
| 989 | 2919505280 | 2919501602 | Bacteria | 5286340 |
| 990 | 2919701148 | 2919697872 | Bacteria | 6553725 |
| 991 | 2923155587 | 2923153595 | Bacteria | 6870622 |
| 992 | 2923521616 | 2923519811 | Bacteria | 6298479 |
| 993 | 2923587093 | 2923586266 | Bacteria | 6565975 |
| 994 | 2926066957 | 2926063275 | Bacteria | 5285848 |
| 995 | 2929146217 | 2929144301 | Bacteria | 6622272 |
| 996 | 2929191494 | 2929189879 | Bacteria | 5930554 |
| 997 | 2931370416 | 2931369376 | Bacteria | 6847892 |
| 998 | 2931392533 | 2931390751 | Bacteria | 6273349 |
| 999 | 2931400388 | 2931396565 | Bacteria | 7251677 |
| 1000 | 2935354917 | 2935353572 | Unclassified | 6955622 |
| 1001 | 2939639456 | 2939636861 | Bacteria | 6297853 |
| 1002 | 2939652858 | 2939651529 | Bacteria | 5895393 |
| 1003 | 2945929073 | 2945928738 | Bacteria | 6053221 |
| 1004 | 2945962042 | 2945961074 | Bacteria | 7342064 |
| 1005 | 2946011297 | 2946006987 | Bacteria | 6705746 |
| 1006 | 2946029721 | 2946027586 | Bacteria | 6049274 |
| 1007 | 2947236347 | 2947233263 | Bacteria | 6439278 |
| 1008 | 2969308513 | 2969304461 | Bacteria | 6601805 |
| 1009 | 2974290098 | 2974289157 | Bacteria | 6080362 |
| 1010 | 2974300081 | 2974298342 | Bacteria | 4840922 |
| 1011 | 2984290435 | 2984286254 | Bacteria | 6702062 |
| 1012 | 2984502461 | 2984499530 | Bacteria | 5020881 |
| 1013 | 2984508927 | 2984504281 | Bacteria | 5262371 |
| 1014 | 2988733742 | 2988728565 | Bacteria | 6124362 |
| 1015 | 2990199133 | 2990196909 | Bacteria | 4054280 |
| 1016 | 2998143832 | 2998139840 | Bacteria | 6073514 |
| 1017 | 3007252623 | 3007252601 | Bacteria | 4559114 |
| 1018 | 3007318804 | 3007315729 | Bacteria | 5076637 |
| 1019 | 3007401126 | 3007395558 | Bacteria | 6755444 |
| 1020 | 3007421471 | 3007419365 | Bacteria | 7026924 |
| 1021 | 3007513317 | 3007511990 | Bacteria | 6481491 |
| 1022 | 3007619555 | 3007614139 | Bacteria | 6053559 |
| 1023 | 3007624960 | 3007619802 | Bacteria | 6411688 |
| 1024 | 3007808091 | 3007803356 | Bacteria | 5931491 |
| 1025 | 3007861001 | 3007855910 | Bacteria | 5637581 |
| 1026 | 3007861239 | 3007861166 | Bacteria | 6045338 |
| 1027 | 3007870090 | 3007866637 | Bacteria | 5899198 |
| 1028 | 3007875510 | 3007872151 | Bacteria | 5268868 |
| 1029 | 637319306 | 637000220 | Bacteria | 7074893 |
| 1030 | 640487607 | 640427133 | Bacteria | 4567418 |
| 1031 | 651175551 | 651053060 | Bacteria | 4689946 |
| 1032 | 8011351860 | 8011350971 | Bacteria | 6158957 |
| 1033 | 8015689847 | 8015687852 | Bacteria | 6613826 |
| 1034 | 8016728773 | 8016728285 | Bacteria | 5263933 |
| 1035 | 8019772895 | 8019769354 | Bacteria | 6924660 |
| 1036 | 8019778252 | 8019775933 | Bacteria | 6858656 |
| 1037 | 8029997045 | 8029995093 | Bacteria | 5990776 |
| 1038 | 8034963739 | 8034962539 | Bacteria | 4884839 |
| 1039 | 8052496343 | 8052494512 | Bacteria | 5765634 |
| 1040 | 8054289662 | 8054285046 | Bacteria | 6919322 |
| 1041 | 8054351956 | 8054347763 | Bacteria | 5901107 |
| 1042 | 8054505058 | 8054503363 | Bacteria | 6101651 |
| 1043 | 8054932474 | 8054929484 | Bacteria | 5599761 |
| 1044 | 8055772949 | 8055770955 | Bacteria | 6827675 |
| 1045 | 8055819564 | 8055817908 | Bacteria | 6609162 |
| 1046 | 8055880636 | 8055878733 | Bacteria | 5907058 |
| 1047 | 8056118048 | 8056115690 | Bacteria | 5527654 |
| 1048 | 8056124295 | 8056120720 | Bacteria | 5758328 |
| 1049 | 8056127843 | 8056125926 | Bacteria | 6228218 |
| 1050 | 8056133431 | 8056131705 | Bacteria | 6107031 |
| 1051 | 8056139212 | 8056137416 | Bacteria | 6147080 |
| 1052 | 8056145156 | 8056143049 | Bacteria | 6307666 |
| 1053 | 8056149703 | 8056148874 | Bacteria | 6479865 |
| 1054 | 8056156604 | 8056155041 | Bacteria | 6486948 |
| 1055 | 8056164845 | 8056161164 | Bacteria | 6106669 |
| 1056 | 8056167444 | 8056166840 | Bacteria | 5820959 |
| 1057 | 8056173449 | 8056172158 | Bacteria | 6133900 |
| 1058 | 8056183613 | 8056177738 | Bacteria | 6748268 |
| 1059 | 8056573096 | 8056569372 | Bacteria | 5997322 |
| 1060 | 8057799377 | 8057798959 | Bacteria | 6713499 |
| 1061 | Ga0450911_000083 | |||
| 1062 | MRS2a_Contig_7 | |||
| 1063 | SwRhRL2b_contig_1594327 | |||
| 1064 | SwRhRL2b_contig_241481 | |||
| 1065 | JGI25162J39368_1000391 | |||
| 1066 | JGI25154J39366_1005613 | |||
| 1067 | JGI25163J39215_1001597 | |||
| 1068 | JGI25163J39215_1001662 | |||
| 1069 | JGI25164J39214_1000089 | |||
| 1070 | JGI25164J39214_1000279 | |||
| 1071 | JGI25165J46597_1000191 | |||
| 1072 | JGI25165J46597_1000510 | |||
| 1073 | Ga0055538_1000078 | |||
| 1074 | Ga0055539_1000119 | |||
| 1075 | Ga0055533_1000127 | |||
| 1076 | Ga0055532_1000068 | |||
| 1077 | Ga0055525_1000163 | |||
| 1078 | Ga0055525_1003329 | |||
| 1079 | Ga0055536_1000316 | |||
| 1080 | Ga0055536_1003702 | |||
| 1081 | Ga0055536_1003789 | |||
| 1082 | Ga0055530_10000230 | |||
| 1083 | Ga0055530_10000462 | |||
| 1084 | Ga0055530_10002879 | |||
| 1085 | Ga0055540_1000241 | |||
| 1086 | Ga0055540_1001061 | |||
| 1087 | Ga0055540_1002216 | |||
| 1088 | Ga0055531_10000511 | |||
| 1089 | Ga0055531_10007174 | |||
| 1090 | Ga0055541_1000079 | |||
| 1091 | Ga0065714_10000180 | |||
| 1092 | Ga0065714_10003160 | |||
| 1093 | Ga0065714_10007263 | |||
| 1094 | Ga0065714_10009195 | |||
| 1095 | Ga0065714_10065863 | |||
| 1096 | Ga0065714_10066039 | |||
| 1097 | Ga0065714_10109743 | |||
| 1098 | Ga0065714_10131632 | |||
| 1099 | Ga0065714_10142029 | |||
| 1100 | Ga0065704_10074907 | |||
| 1101 | Ga0065712_10002471 | |||
| 1102 | Ga0065712_10009951 | |||
| 1103 | Ga0065712_10070286 | |||
| 1104 | Ga0065715_10096155 | |||
| 1105 | Ga0070670_100017783 | |||
| 1106 | Ga0070661_100008283 | |||
| 1107 | Ga0070669_100000231 | |||
| 1108 | Ga0070662_100001224 | |||
| 1109 | Ga0070662_100507935 | |||
| 1110 | Ga0068853_100054183 | |||
| 1111 | Ga0070665_100583522 | |||
| 1112 | Ga0070664_100007813 | |||
| 1113 | Ga0068851_10000055 | |||
| 1114 | Ga0075432_10001624 | |||
| 1115 | Ga0075432_10009420 | |||
| 1116 | Ga0075432_10022216 | |||
| 1117 | Ga0075432_10076625 | |||
| 1118 | Ga0075369_10024550 | |||
| 1119 | Ga0075366_10000057 | |||
| 1120 | Ga0079104_1000213 | |||
| 1121 | Ga0079104_1000222 | |||
| 1122 | Ga0105251_10000158 | |||
| 1123 | Ga0105251_10000401 | |||
| 1124 | Ga0105251_10003936 | |||
| 1125 | Ga0105251_10005667 | |||
| 1126 | Ga0105251_10006323 | |||
| 1127 | Ga0105251_10009753 | |||
| 1128 | Ga0105251_10012020 | |||
| 1129 | Ga0105251_10020539 | |||
| 1130 | Ga0105251_10021720 | |||
| 1131 | Ga0105251_10038897 | |||
| 1132 | Ga0105251_10132236 | |||
| 1133 | Ga0105244_10001973 | |||
| 1134 | Ga0105244_10002235 | |||
| 1135 | Ga0105244_10004076 | |||
| 1136 | Ga0105244_10004822 | |||
| 1137 | Ga0105244_10006373 | |||
| 1138 | Ga0105244_10006900 | |||
| 1139 | Ga0105244_10013582 | |||
| 1140 | Ga0105244_10021324 | |||
| 1141 | Ga0105244_10057618 | |||
| 1142 | Ga0105244_10070868 | |||
| 1143 | Ga0105250_10000996 | |||
| 1144 | Ga0105250_10003977 | |||
| 1145 | Ga0105250_10013520 | |||
| 1146 | Ga0105250_10020678 | |||
| 1147 | Ga0105250_10030110 | |||
| 1148 | Ga0105250_10162089 | |||
| 1149 | Ga0105243_10000627 | |||
| 1150 | Ga0105243_10002038 | |||
| 1151 | Ga0105243_10008887 | |||
| 1152 | Ga0105243_10027936 | |||
| 1153 | Ga0105243_10034942 | |||
| 1154 | Ga0105243_10130603 | |||
| 1155 | Ga0105242_10000734 | |||
| 1156 | Ga0105248_10275397 | |||
| 1157 | Ga0105237_10000730 | |||
| 1158 | Ga0105246_10003889 | |||
| 1159 | Ga0105246_10155032 | |||
| 1160 | Ga0157373_10004670 | |||
| 1161 | Ga0157373_10005788 | |||
| 1162 | Ga0157373_10010115 | |||
| 1163 | Ga0157373_10010961 | |||
| 1164 | Ga0157373_10027490 | |||
| 1165 | Ga0157373_10042314 | |||
| 1166 | Ga0157373_10078983 | |||
| 1167 | Ga0157373_10090802 | |||
| 1168 | Ga0157371_10000186 | |||
| 1169 | Ga0157371_10003775 | |||
| 1170 | Ga0157371_10005382 | |||
| 1171 | Ga0157371_10010666 | |||
| 1172 | Ga0157371_10035327 | |||
| 1173 | Ga0157371_10039893 | |||
| 1174 | Ga0157371_10299424 | |||
| 1175 | Ga0157370_10004247 | |||
| 1176 | Ga0157370_10013623 | |||
| 1177 | Ga0157370_10073748 | |||
| 1178 | Ga0157370_10085837 | |||
| 1179 | Ga0157370_10127606 | |||
| 1180 | Ga0157370_10343596 | |||
| 1181 | Ga0157370_10380740 | |||
| 1182 | Ga0157369_10006197 | |||
| 1183 | Ga0157369_10033267 | |||
| 1184 | Ga0157369_10036486 | |||
| 1185 | Ga0163162_10011325 | |||
| 1186 | Ga0157372_10004510 | |||
| 1187 | Ga0157372_10040263 | |||
| 1188 | Ga0157375_10012012 | |||
| 1189 | Ga0157375_10674839 | |||
| 1190 | Ga0182008_10001777 | |||
| 1191 | Ga0182008_10006367 | |||
| 1192 | Ga0182008_10007869 | |||
| 1193 | Ga0182008_10008096 | |||
| 1194 | Ga0182008_10009790 | |||
| 1195 | Ga0182008_10017212 | |||
| 1196 | Ga0182008_10018226 | |||
| 1197 | Ga0182006_1002441 | |||
| 1198 | Ga0182006_1003793 | |||
| 1199 | Ga0182006_1003932 | |||
| 1200 | Ga0182006_1004298 | |||
| 1201 | Ga0182006_1013700 | |||
| 1202 | Ga0182006_1016252 | |||
| 1203 | Ga0182007_10002905 | |||
| 1204 | Ga0182007_10008233 | |||
| 1205 | Ga0182007_10023244 | |||
| 1206 | Ga0182005_1014060 | |||
| 1207 | Ga0182005_1047910 | |||
| 1208 | Ga0163161_10040090 | |||
| 1209 | Ga0163161_10152410 | |||
| 1210 | Ga0163161_10181188 | |||
| 1211 | Ga0163161_10216202 | |||
| 1212 | Ga0209435_102520 | |||
| 1213 | Ga0209760_100087 | |||
| 1214 | Ga0209760_100145 | |||
| 1215 | Ga0209760_100173 | |||
| 1216 | Ga0209784_100015 | |||
| 1217 | Ga0209566_100012 | |||
| 1218 | Ga0209674_100027 | |||
| 1219 | Ga0209147_100019 | |||
| 1220 | Ga0209563_100031 | |||
| 1221 | Ga0209563_100856 | |||
| 1222 | Ga0207427_100001 | |||
| 1223 | Ga0207427_100048 | |||
| 1224 | Ga0209437_100003 | |||
| 1225 | Ga0209437_100094 | |||
| 1226 | Ga0209437_104886 | |||
| 1227 | Ga0209646_1000324 | |||
| 1228 | Ga0209677_100016 | |||
| 1229 | Ga0209759_1015352 | |||
| 1230 | Ga0209233_1000007 | |||
| 1231 | Ga0209233_1000106 | |||
| 1232 | Ga0209675_1007693 | |||
| 1233 | Ga0209676_1000002 | |||
| 1234 | Ga0209676_1000021 | |||
| 1235 | Ga0209676_1000166 | |||
| 1236 | Ga0209676_1002655 | |||
| 1237 | Ga0209676_1013379 | |||
| 1238 | Ga0209050_1000009 | |||
| 1239 | Ga0209050_1000275 | |||
| 1240 | Ga0209050_1000395 | |||
| 1241 | Ga0209050_1003875 | |||
| 1242 | Ga0209051_1000001 | |||
| 1243 | Ga0209051_1000008 | |||
| 1244 | Ga0209051_1000585 | |||
| 1245 | Ga0209257_1000181 | |||
| 1246 | Ga0209257_1015751 | |||
| 1247 | Ga0207656_10000659 | |||
| 1248 | Ga0207696_1000019 | |||
| 1249 | Ga0207696_1000063 | |||
| 1250 | Ga0207696_1000117 | |||
| 1251 | Ga0207696_1000274 | |||
| 1252 | Ga0207696_1003502 | |||
| 1253 | Ga0207696_1005934 | |||
| 1254 | Ga0207696_1021415 | |||
| 1255 | Ga0207655_1000019 | |||
| 1256 | Ga0207655_1000084 | |||
| 1257 | Ga0207655_1000096 | |||
| 1258 | Ga0207655_1000216 | |||
| 1259 | Ga0207655_1000835 | |||
| 1260 | Ga0207655_1002510 | |||
| 1261 | Ga0207655_1002846 | |||
| 1262 | Ga0207655_1003156 | |||
| 1263 | Ga0207655_1003902 | |||
| 1264 | Ga0207655_1005894 | |||
| 1265 | Ga0207655_1007227 | |||
| 1266 | Ga0207655_1019172 | |||
| 1267 | Ga0207655_1056970 | |||
| 1268 | Ga0207713_1000058 | |||
| 1269 | Ga0207713_1000160 | |||
| 1270 | Ga0207713_1003721 | |||
| 1271 | Ga0207713_1004302 | |||
| 1272 | Ga0207713_1004421 | |||
| 1273 | Ga0207713_1004598 | |||
| 1274 | Ga0207713_1005603 | |||
| 1275 | Ga0207713_1010940 | |||
| 1276 | Ga0207713_1011997 | |||
| 1277 | Ga0207713_1024386 | |||
| 1278 | Ga0207713_1025426 | |||
| 1279 | Ga0207713_1028021 | |||
| 1280 | Ga0207713_1068331 | |||
| 1281 | Ga0207671_10000079 | |||
| 1282 | Ga0207649_10000002 | |||
| 1283 | Ga0207681_10000143 | |||
| 1284 | Ga0207681_10131632 | |||
| 1285 | Ga0207650_10002170 | |||
| 1286 | Ga0207650_10004358 | |||
| 1287 | Ga0207706_10003826 | |||
| 1288 | Ga0207709_10000045 | |||
| 1289 | Ga0207709_10000763 | |||
| 1290 | Ga0207709_10008423 | |||
| 1291 | Ga0207709_10049379 | |||
| 1292 | Ga0207709_10051325 | |||
| 1293 | Ga0207709_10091677 | |||
| 1294 | Ga0207711_10052700 | |||
| 1295 | Ga0207679_10000006 | |||
| 1296 | Ga0207639_10037922 | |||
| 1297 | Ga0209281_1000011 | |||
| 1298 | Ga0209281_1000090 | |||
| 1299 | Ga0209281_1004373 | |||
| 1300 | Ga0209389_1000053 | |||
| 1301 | Ga0209371_1000245 | |||
| 1302 | Ga0209371_1000513 | |||
| 1303 | Ga0209996_1000654 | |||
| 1304 | Ga0209282_1019657 | |||
| 1305 | Ga0209971_1000371 | |||
| 1306 | Ga0207428_10043582 | |||
| 1307 | Ga0207428_10046802 | |||
| 1308 | Ga0207428_10240691 | |||
| 1309 | Ga0307517_10029448 | |||
| 1310 | Ga0268256_1000201 | |||
| 1311 | Ga0268256_1000441 | |||
| 1312 | Ga0314311_1110334 | |||
| 1313 | Ga0316178_1017010 | |||
| 1314 | Ga0265331_10048697 | |||
| 1315 | Ga0265327_10000053 | |||
| 1316 | Ga0307513_10002568 | |||
| 1317 | Ga0307513_10062742 | |||
| 1318 | Ga0307513_10115399 | |||
| 1319 | Ga0307509_10134402 | |||
| 1320 | Ga0307408_100000018 | |||
| 1321 | Ga0307408_100014661 | |||
| 1322 | Ga0307405_10001157 | |||
| 1323 | Ga0307405_10003239 | |||
| 1324 | Ga0307405_10006597 | |||
| 1325 | Ga0307405_10039823 | |||
| 1326 | Ga0307406_10224128 | |||
| 1327 | Ga0307407_10102036 | |||
| 1328 | Ga0307412_10001593 | |||
| 1329 | Ga0307412_10004029 | |||
| 1330 | Ga0307412_10004082 | |||
| 1331 | Ga0307412_10028821 | |||
| 1332 | Ga0307414_10041413 | |||
| 1333 | Ga0307414_10071338 | |||
| 1334 | Ga0307414_10085548 | |||
| 1335 | Ga0307414_10513362 | |||
| 1336 | Ga0307411_10036808 | |||
| 1337 | Ga0400483_092845 | |||
| 1338 | Ga0400483_150883 | |||
| 1339 | Ga0439436_0002628 | |||
| 1340 | Ga0439438_000536 | |||
| 1341 | Ga0439438_001084 | |||
| 1342 | Ga0439438_003740 | |||
| 1343 | Ga0439438_004003 | |||
| 1344 | Ga0439438_007668 | |||
| 1345 | Ga0439438_013102 | |||
| 1346 | Ga0439447_006569 | |||
| 1347 | Ga0439447_007774 | |||
| 1348 | Ga0439447_013358 | |||
| 1349 | Ga0439447_018294 | |||
| 1350 | Ga0439466_0000821 | |||
| 1351 | Ga0439466_0001319 | |||
| 1352 | Ga0439466_0006960 | |||
| 1353 | Ga0439466_0007055 | |||
| 1354 | Ga0439466_0025311 | |||
| 1355 | Ga0439465_0003369 | |||
| 1356 | Ga0451789_0749432 | |||
| 1357 | Ga0451791_0941148 | |||
| 1358 | Ga0451797_0336573 | |||
| 1359 | Ga0451807_1281855 | |||
| 1360 | Ga0451837_1500961 | |||
| 1361 | Ga0451837_1566606 | |||
| 1362 | Ga0451843_0572613 | |||
| 1363 | Ga0439431_0017049 | |||
| 1364 | Ga0439437_000834 | |||
| 1365 | Ga0439432_000869 | |||
| 1366 | Ga0439432_001543 | |||
| 1367 | Ga0439449_0005424 | |||
| 1368 | Ga0439451_009009 | |||
| 1369 | Ga0439451_009893 | |||
| 1370 | Ga0439452_002052 | |||
| 1371 | Ga0439452_002220 | |||
| 1372 | Ga0439452_002653 | |||
| 1373 | Ga0439452_003972 | |||
| 1374 | Ga0439452_004192 | |||
| 1375 | Ga0439452_017594 | |||
| 1376 | Ga0439452_038520 | |||
| 1377 | Ga0439455_0025721 | |||
| 1378 | Ga0439455_0033881 | |||
| 1379 | Ga0439456_000070 | |||
| 1380 | Ga0439456_003090 | |||
| 1381 | Ga0439456_003963 | |||
| 1382 | Ga0439463_001163 | |||
| 1383 | Ga0439463_002510 | |||
| 1384 | Ga0439463_003607 | |||
| 1385 | Ga0439463_011698 | |||
| 1386 | Ga0450911_001065 | |||
| 1387 | Ga0450919_008608 | |||
| 1388 | Ga0450920_003629 | |||
| 1389 | Ga0450922_001979 | |||
| 1390 | Ga0450902_004472 | |||
| 1391 | Ga0450903_003228 | |||
| 1392 | Ga0450904_000082 | |||
| 1393 | Ga0450904_003798 | |||
| 1394 | Ga0450905_001446 | |||
| 1395 | Ga0450905_002711 | |||
| 1396 | Ga0450907_000625 | |||
| 1397 | Ga0450907_000684 | |||
| 1398 | Ga0450907_013911 | |||
| 1399 | Ga0450910_004928 | |||
| 1400 | Ga0439446_0002180 | |||
| 1401 | Ga0439446_0018279 | |||
| 1402 | Ga0450909_001873 | |||
| 1403 | Ga0439459_0005877 | |||
| 1404 | Ga0439459_0029921 | |||
| 1405 | Ga0439464_0000409 | |||
| 1406 | Ga0439464_0001480 | |||
| 1407 | Ga0439464_0022690 | |||
| 1408 | Ga0439460_0001529 | |||
| 1409 | Ga0439460_0023703 | |||
| 1410 | Ga0450893_0001894 | |||
| 1411 | Ga0450901_000162 | |||
| 1412 | Ga0451577_0052572 | |||
| 1413 | Ga0495617_002382 | |||
| 1414 | Ga0495617_003876 | |||
| 1415 | Ga0495617_006286 | |||
| 1416 | Ga0495617_014919 | |||
| 1417 | Ga0495627_000051 | |||
| 1418 | Ga0495627_000140 | |||
| 1419 | Ga0495627_005064 | |||
| 1420 | Ga0495627_013658 | |||
| 1421 | Ga0495603_0017557 | |||
| 1422 | Ga0495603_0017842 | |||
| 1423 | Ga0495603_0058067 | |||
| 1424 | Ga0495590_0002910 | |||
| 1425 | Ga0495590_0003453 | |||
| 1426 | Ga0495590_0012739 | |||
| 1427 | Ga0495591_000018 | |||
| 1428 | Ga0495591_000720 | |||
| 1429 | Ga0495591_002135 | |||
| 1430 | Ga0495591_002739 | |||
| 1431 | Ga0495591_003389 | |||
| 1432 | Ga0495591_003954 | |||
| 1433 | Ga0495591_021328 | |||
| 1434 | Ga0495591_027318 | |||
| 1435 | Ga0495591_037719 | |||
| 1436 | Ga0495591_055495 | |||
| 1437 | Ga0495638_0008086 | |||
| 1438 | Ga0495638_0009256 | |||
| 1439 | Ga0495638_0013737 | |||
| 1440 | Ga0495638_0014242 | |||
| 1441 | Ga0495638_0049388 | |||
| 1442 | Ga0495638_0091040 | |||
| 1443 | Ga0495638_0215543 | |||
| 1444 | Ga0495653_0019000 | |||
| 1445 | Ga0495650_0001745 | |||
| 1446 | Ga0495650_0005287 | |||
| 1447 | Ga0495650_0005747 | |||
| 1448 | Ga0495650_0007282 | |||
| 1449 | Ga0495650_0007355 | |||
| 1450 | Ga0495650_0008282 | |||
| 1451 | Ga0495650_0009449 | |||
| 1452 | Ga0495605_0000036 | |||
| 1453 | Ga0495605_0000222 | |||
| 1454 | Ga0495605_0001613 | |||
| 1455 | Ga0495605_0002842 | |||
| 1456 | Ga0495605_0003110 | |||
| 1457 | Ga0495605_0004637 | |||
| 1458 | Ga0495605_0008220 | |||
| 1459 | Ga0495605_0020220 | |||
| 1460 | Ga0495639_0002536 | |||
| 1461 | Ga0495584_0004201 | |||
| 1462 | Ga0495584_0004645 | |||
| 1463 | Ga0495584_0005069 | |||
| 1464 | Ga0495584_0013739 | |||
| 1465 | Ga0495584_0015717 | |||
| 1466 | Ga0495584_0019288 | |||
| 1467 | Ga0495585_0003948 | |||
| 1468 | Ga0495585_0005318 | |||
| 1469 | Ga0495585_0005667 | |||
| 1470 | Ga0495585_0026931 | |||
| 1471 | Ga0495585_0032074 | |||
| 1472 | Ga0495594_0024608 | |||
| 1473 | Ga0495594_0113999 | |||
| 1474 | Ga0495596_0000105 | |||
| 1475 | Ga0495607_0000335 | |||
| 1476 | Ga0495607_0000679 | |||
| 1477 | Ga0495607_0000685 | |||
| 1478 | Ga0495607_0003854 | |||
| 1479 | Ga0495607_0004015 | |||
| 1480 | Ga0495607_0005200 | |||
| 1481 | Ga0495607_0008559 | |||
| 1482 | Ga0495607_0009291 | |||
| 1483 | Ga0495607_0010574 | |||
| 1484 | Ga0495607_0017209 | |||
| 1485 | Ga0495607_0019750 | |||
| 1486 | Ga0495607_0022541 | |||
| 1487 | Ga0495607_0025860 | |||
| 1488 | Ga0495607_0069243 | |||
| 1489 | Ga0495607_0092086 | |||
| 1490 | Ga0495607_0112208 | |||
| 1491 | Ga0495607_0200992 | |||
| 1492 | Ga0495583_0000028 | |||
| 1493 | Ga0495583_0000561 | |||
| 1494 | Ga0495583_0001188 | |||
| 1495 | Ga0495583_0002128 | |||
| 1496 | Ga0495583_0006609 | |||
| 1497 | Ga0495583_0013452 | |||
| 1498 | Ga0495606_0000094 | |||
| 1499 | Ga0495606_0000502 | |||
| 1500 | Ga0495606_0000958 | |||
| 1501 | Ga0495606_0007380 | |||
| 1502 | Ga0495606_0009190 | |||
| 1503 | Ga0495606_0009383 | |||
| 1504 | Ga0495606_0011707 | |||
| 1505 | Ga0495606_0021273 | |||
| 1506 | Ga0495606_0033029 | |||
| 1507 | Ga0495606_0038357 | |||
| 1508 | Ga0495606_0039380 | |||
| 1509 | Ga0495606_0048675 | |||
| 1510 | Ga0495610_0002667 | |||
| 1511 | Ga0495610_0004363 | |||
| 1512 | Ga0495610_0006420 | |||
| 1513 | Ga0495610_0007567 | |||
| 1514 | Ga0495610_0009101 | |||
| 1515 | Ga0495610_0012501 | |||
| 1516 | Ga0495610_0012916 | |||
| 1517 | Ga0495610_0012994 | |||
| 1518 | Ga0495610_0018171 | |||
| 1519 | Ga0495610_0022406 | |||
| 1520 | Ga0495616_0003437 | |||
| 1521 | Ga0495616_0006678 | |||
| 1522 | Ga0495616_0015018 | |||
| 1523 | Ga0495616_0114052 | |||
| 1524 | Ga0495620_0000035 | |||
| 1525 | Ga0495620_0000073 | |||
| 1526 | Ga0495620_0001062 | |||
| 1527 | Ga0495620_0001625 | |||
| 1528 | Ga0495620_0002881 | |||
| 1529 | Ga0495620_0005281 | |||
| 1530 | Ga0495620_0006669 | |||
| 1531 | Ga0495620_0038029 | |||
| 1532 | Ga0495630_0052580 | |||
| 1533 | Ga0495630_0442925 | |||
| 1534 | Ga0495631_0000484 | |||
| 1535 | Ga0495631_0002563 | |||
| 1536 | Ga0495631_0006603 | |||
| 1537 | Ga0495631_0008892 | |||
| 1538 | Ga0495631_0010624 | |||
| 1539 | Ga0495631_0013067 | |||
| 1540 | Ga0495632_0000449 | |||
| 1541 | Ga0495632_0000460 | |||
| 1542 | Ga0495632_0006467 | |||
| 1543 | Ga0495632_0006789 | |||
| 1544 | Ga0495632_0007385 | |||
| 1545 | Ga0495632_0008270 | |||
| 1546 | Ga0495632_0016194 | |||
| 1547 | Ga0495632_0019868 | |||
| 1548 | Ga0495632_0166286 | |||
| 1549 | Ga0495637_0000015 | |||
| 1550 | Ga0495637_0002724 | |||
| 1551 | Ga0495637_0005808 | |||
| 1552 | Ga0495637_0006843 | |||
| 1553 | Ga0495637_0009520 | |||
| 1554 | Ga0495637_0010639 | |||
| 1555 | Ga0495637_0011436 | |||
| 1556 | Ga0495637_0014163 | |||
| 1557 | Ga0495637_0017411 | |||
| 1558 | Ga0495637_0024973 | |||
| 1559 | Ga0495637_0029830 | |||
| 1560 | Ga0495637_0036053 | |||
| 1561 | Ga0495637_0065381 | |||
| 1562 | Ga0495643_0000345 | |||
| 1563 | Ga0495643_0000609 | |||
| 1564 | Ga0495643_0002906 | |||
| 1565 | Ga0495643_0007212 | |||
| 1566 | Ga0495643_0007758 | |||
| 1567 | Ga0495643_0013059 | |||
| 1568 | Ga0495643_0021487 | |||
| 1569 | Ga0495643_0037985 | |||
| 1570 | Ga0495643_0080262 | |||
| 1571 | Ga0495643_0142747 | |||
| 1572 | Ga0495644_0002921 | |||
| 1573 | Ga0495644_0003463 | |||
| 1574 | Ga0495648_0000589 | |||
| 1575 | Ga0495648_0005619 | |||
| 1576 | Ga0495648_0007013 | |||
| 1577 | Ga0495648_0010791 | |||
| 1578 | Ga0495648_0013954 | |||
| 1579 | Ga0495648_0022408 | |||
| 1580 | Ga0495648_0045597 | |||
| 1581 | Ga0495648_0125615 | |||
| 1582 | Ga0495663_0001024 | |||
| 1583 | Ga0495663_0005538 | |||
| 1584 | Ga0495666_0005790 | |||
| 1585 | Ga0495642_0001589 | |||
| 1586 | Ga0495642_0002566 | |||
| 1587 | Ga0495654_0000871 | |||
| 1588 | Ga0495654_0001727 | |||
| 1589 | Ga0495654_0005242 | |||
| 1590 | Ga0495654_0005682 | |||
| 1591 | Ga0495654_0006344 | |||
| 1592 | Ga0495654_0007076 | |||
| 1593 | Ga0495654_0016243 | |||
| 1594 | Ga0495654_0022154 | |||
| 1595 | Ga0495654_0047501 | |||
| 1596 | Ga0495654_0058238 | |||
| 1597 | Ga0495654_0107610 | |||
| 1598 | Ga0495654_0154593 | |||
| 1599 | Ga0495586_0253958 | |||
| 1600 | Ga0495587_0006210 | |||
| 1601 | Ga0495609_0000035 | |||
| 1602 | Ga0495609_0000162 | |||
| 1603 | Ga0495609_0000569 | |||
| 1604 | Ga0495609_0029729 | |||
| 1605 | Ga0495609_0067451 | |||
| 1606 | Ga0495609_0165608 | |||
| 1607 | Ga0495597_0000044 | |||
| 1608 | Ga0495597_0002661 | |||
| 1609 | Ga0495597_0004928 | |||
| 1610 | Ga0495597_0011362 | |||
| 1611 | Ga0495597_0030461 | |||
| 1612 | Ga0495597_0042816 | |||
| 1613 | Ga0495597_0046211 | |||
| 1614 | Ga0495597_0067290 | |||
| 1615 | Ga0495622_0003194 | |||
| 1616 | Ga0495622_0006082 | |||
| 1617 | Ga0495622_0076114 | |||
| 1618 | Ga0495622_0191022 | |||
| 1619 | Ga0495633_0000028 | |||
| 1620 | Ga0495633_0008320 | |||
| 1621 | Ga0495668_0004916 | |||
| 1622 | Ga0495668_0010092 | |||
| 1623 | Ga0495668_0012890 | |||
| 1624 | Ga0495668_0023225 | |||
| 1625 | Ga0495668_0036646 | |||
| 1626 | Ga0495634_0007654 | |||
| 1627 | Ga0495611_0001242 | |||
| 1628 | Ga0495611_0001633 | |||
| 1629 | Ga0495611_0002739 | |||
| 1630 | Ga0495625_0000004 | |||
| 1631 | Ga0495625_0011499 | |||
| 1632 | Ga0495625_0030660 | |||
| 1633 | Ga0495625_0076739 | |||
| 1634 | Ga0495625_0105121 | |||
| 1635 | Ga0495635_0034375 | |||
| 1636 | Ga0495659_0001557 | |||
| 1637 | Ga0495659_0005645 | |||
| 1638 | Ga0495661_0000006 | |||
| 1639 | Ga0495661_0000059 | |||
| 1640 | Ga0495661_0000401 | |||
| 1641 | Ga0495661_0000447 | |||
| 1642 | Ga0495661_0005286 | |||
| 1643 | Ga0495661_0027666 | |||
| 1644 | Ga0495661_0105054 | |||
| 1645 | Ga0495661_0166207 | |||
| 1646 | Ga0495588_0011458 | |||
| 1647 | Ga0495588_0087227 | |||
| 1648 | Ga0495588_0180472 | |||
| 1649 | Ga0495669_0004408 | |||
| 1650 | Ga0495613_0036295 | |||
| 1651 | Ga0495670_0002612 | |||
| 1652 | Ga0495670_0012350 | |||
| 1653 | Ga0495670_0014205 | |||
| 1654 | Ga0495670_0014270 | |||
| 1655 | Ga0495670_0014808 | |||
| 1656 | Ga0495670_0024304 | |||
| 1657 | Ga0495671_0002402 | |||
| 1658 | Ga0495671_0002948 | |||
| 1659 | Ga0495671_0003752 | |||
| 1660 | Ga0495671_0004807 | |||
| 1661 | Ga0495671_0005750 | |||
| 1662 | Ga0495671_0008524 | |||
| 1663 | Ga0495671_0010010 | |||
| 1664 | Ga0495671_0016467 | |||
| 1665 | Ga0495671_0026509 | |||
| 1666 | Ga0495671_0051666 | |||
| 1667 | Ga0495671_0085878 | |||
| 1668 | Ga0495649_0001079 | |||
| 1669 | Ga0495649_0003471 | |||
| 1670 | Ga0495649_0004328 | |||
| 1671 | Ga0495649_0007187 | |||
| 1672 | Ga0495649_0007280 | |||
| 1673 | Ga0495649_0015306 | |||
| 1674 | Ga0495649_0021425 | |||
| 1675 | Ga0495649_0032456 | |||
| 1676 | Ga0495649_0034207 | |||
| 1677 | Ga0495649_0120682 | |||
| 1678 | Ga0495589_0003843 | |||
| 1679 | Ga0495589_0004661 | |||
| 1680 | Ga0495589_0060596 | |||
| 1681 | Ga0495589_0071409 | |||
| 1682 | Ga0495600_0009911 | |||
| 1683 | Ga0495600_0233810 | |||
| 1684 | Ga0495660_0000505 | |||
| 1685 | Ga0495660_0001125 | |||
| 1686 | Ga0495660_0002977 | |||
| 1687 | Ga0495660_0004367 | |||
| 1688 | Ga0495660_0005636 | |||
| 1689 | Ga0495660_0022994 | |||
| 1690 | Ga0495660_0023806 | |||
| 1691 | Ga0495581_0050702 | |||
| 1692 | Ga0495636_0032998 | |||
| 1693 | Ga0495672_0005426 | |||
| 1694 | Ga0495672_0006857 | |||
| 1695 | Ga0495672_0009340 | |||
| 1696 | Ga0495672_0009385 | |||
| 1697 | Ga0495672_0009896 | |||
| 1698 | Ga0495672_0009926 | |||
| 1699 | Ga0495672_0010387 | |||
| 1700 | Ga0495672_0010868 | |||
| 1701 | Ga0495672_0015928 | |||
| 1702 | Ga0495672_0019887 | |||
| 1703 | Ga0495672_0023871 | |||
| 1704 | Ga0495672_0035366 | |||
| 1705 | Ga0495672_0080488 | |||
| 1706 | Ga0495676_0000004 | |||
| 1707 | Ga0495676_0021904 | |||
| 1708 | Ga0495680_0028213 | |||
| 1709 | Ga0495683_0000033 | |||
| 1710 | Ga0495683_0000091 | |||
| 1711 | Ga0495683_0003722 | |||
| 1712 | Ga0495683_0005092 | |||
| 1713 | Ga0495683_0018243 | |||
| 1714 | Ga0495683_0047733 | |||
| 1715 | Ga0495687_005976 | |||
| 1716 | Ga0495687_006399 | |||
| 1717 | Ga0495687_007940 | |||
| 1718 | Ga0495675_0013139 | |||
| 1719 | Ga0495675_0092161 | |||
| 1720 | Ga0495679_000083 | |||
| 1721 | Ga0495679_000461 | |||
| 1722 | Ga0495679_002991 | |||
| 1723 | Ga0495679_003054 | |||
| 1724 | Ga0495679_027084 | |||
| 1725 | Ga0495673_0003544 | |||
| 1726 | Ga0495673_0003918 | |||
| 1727 | Ga0495673_0004180 | |||
| 1728 | Ga0495673_0004973 | |||
| 1729 | Ga0495673_0006630 | |||
| 1730 | Ga0495673_0008633 | |||
| 1731 | Ga0495673_0011492 | |||
| 1732 | Ga0495673_0014539 | |||
| 1733 | Ga0495673_0016603 | |||
| 1734 | Ga0495673_0020443 | |||
| 1735 | Ga0495673_0032778 | |||
| 1736 | Ga0495673_0117534 | |||
| 1737 | Ga0495681_0003353 | |||
| 1738 | Ga0495681_0005364 | |||
| 1739 | Ga0495681_0006537 | |||
| 1740 | Ga0495681_0006989 | |||
| 1741 | Ga0495681_0007295 | |||
| 1742 | Ga0495681_0015124 | |||
| 1743 | Ga0495681_0021072 | |||
| 1744 | Ga0495681_0022079 | |||
| 1745 | Ga0495681_0033341 | |||
| 1746 | Ga0495681_0063608 | |||
| 1747 | Ga0495686_0009065 | |||
| 1748 | Ga0495686_0063765 | |||
| 1749 | Ga0495593_0006895 | |||
| 1750 | Ga0495626_0000173 | |||
| 1751 | Ga0495626_0003845 | |||
| 1752 | Ga0495626_0003921 | |||
| 1753 | Ga0495626_0004903 | |||
| 1754 | Ga0495626_0005054 | |||
| 1755 | Ga0495626_0005599 | |||
| 1756 | Ga0495626_0008800 | |||
| 1757 | Ga0496102_0007371 | |||
| 1758 | Ga0496110_0183626 | |||
| 1759 | Ga0496110_0238254 | |||
| 1760 | Ga0496111_0080837 | |||
| 1761 | Ga0496111_0462861 | |||
| 1762 | Ga0496112_0038333 | |||
| 1763 | Ga0496112_0090559 | |||
| 1764 | Ga0496114_0047512 | |||
| 1765 | Ga0496116_0000574 | |||
| 1766 | Ga0496116_0010026 | |||
| 1767 | Ga0496117_0001296 | |||
| 1768 | Ga0496117_0004436 | |||
| 1769 | Ga0496117_0008721 | |||
| 1770 | Ga0496117_0010406 | |||
| 1771 | Ga0496117_0011529 | |||
| 1772 | Ga0496117_0048847 | |||
| 1773 | Ga0496117_0187291 | |||
| 1774 | Ga0496118_0013881 | |||
| 1775 | Ga0496118_0029328 | |||
| 1776 | Ga0496118_0039239 | |||
| 1777 | Ga0496118_0095737 | |||
| 1778 | Ga0496118_0102172 | |||
| 1779 | Ga0496118_0115462 | |||
| 1780 | Ga0496118_0257754 | |||
| 1781 | Ga0496119_0000086 | |||
| 1782 | Ga0496120_0001853 | |||
| 1783 | Ga0496120_0019966 | |||
| 1784 | Ga0496121_0000299 | |||
| 1785 | Ga0496121_0003112 | |||
| 1786 | Ga0496121_0004378 | |||
| 1787 | Ga0496121_0015997 | |||
| 1788 | Ga0496121_0190928 | |||
| 1789 | Ga0496121_0307850 | |||
| 1790 | Ga0496122_0000156 | |||
| 1791 | Ga0496122_0005397 | |||
| 1792 | Ga0496122_0009262 | |||
| 1793 | Ga0496122_0010792 | |||
| 1794 | Ga0496122_0014336 | |||
| 1795 | Ga0496122_0017324 | |||
| 1796 | Ga0496122_0023244 | |||
| 1797 | Ga0496122_0028666 | |||
| 1798 | Ga0496122_0042754 | |||
| 1799 | Ga0496122_0073995 | |||
| 1800 | Ga0496122_0075708 | |||
| 1801 | Ga0496122_0191155 | |||
| 1802 | Ga0496123_0000087 | |||
| 1803 | Ga0496123_0000445 | |||
| 1804 | Ga0496123_0003302 | |||
| 1805 | Ga0496123_0013778 | |||
| 1806 | Ga0496123_0015908 | |||
| 1807 | Ga0496123_0021700 | |||
| 1808 | Ga0496123_0075191 | |||
| 1809 | Ga0496123_0102372 | |||
| 1810 | Ga0496124_0000031 | |||
| 1811 | Ga0496124_0006746 | |||
| 1812 | Ga0496124_0009610 | |||
| 1813 | Ga0496124_0010222 | |||
| 1814 | Ga0496124_0012164 | |||
| 1815 | Ga0496124_0017316 | |||
| 1816 | Ga0496124_0020633 | |||
| 1817 | Ga0496124_0086969 | |||
| 1818 | Ga0496124_0168653 | |||
| 1819 | Ga0496124_0275207 | |||
| 1820 | Ga0496125_0000658 | |||
| 1821 | Ga0496125_0009054 | |||
| 1822 | Ga0496125_0013589 | |||
| 1823 | Ga0496125_0020047 | |||
| 1824 | Ga0496125_0039884 | |||
| 1825 | Ga0496125_0047858 | |||
| 1826 | Ga0496125_0084043 | |||
| 1827 | Ga0496125_0115945 | |||
| 1828 | Ga0496125_0131980 | |||
| 1829 | Ga0496126_0014261 | |||
| 1830 | Ga0496126_0146285 | |||
| 1831 | Ga0496126_0176260 | |||
| 1832 | Ga0495678_000020 | |||
| 1833 | Ga0495678_000137 | |||
| 1834 | Ga0495678_004792 | |||
| 1835 | Ga0495678_005207 | |||
| 1836 | Ga0495678_009441 | |||
| 1837 | Ga0495678_011475 | |||
| 1838 | Ga0495678_014120 | |||
| 1839 | Ga0495678_021163 | |||
| 1840 | Ga0495678_034139 | |||
| 1841 | Ga0495678_045352 | |||
| 1842 | Ga0495678_055078 | |||
| 1843 | Ga0495678_098589 | |||
| 1844 | Ga0495682_0000492 | |||
| 1845 | Ga0495682_0000550 | |||
| 1846 | Ga0495682_0035567 | |||
| 1847 | Ga0495682_0085664 | |||
| 1848 | Ga0495682_0111945 | |||
| 1849 | Ga0501032_0078869 | |||
| 1850 | Ga0501034_0000200 | |||
| 1851 | Ga0501034_0319183 | |||
| 1852 | Ga0501037_0024841 | |||
| 1853 | Ga0501226_000009 | |||
| 1854 | Ga0501226_000864 | |||
| 1855 | nmdc:mga0k408_97_c1 | |||
| 1856 | Ga0500595_012839 | |||
| 1857 | Ga0500618_007221 | |||
| 1858 | Ga0500573_0010506 | |||
| 1859 | Ga0500634_0010173 | |||
| 1860 | Ga0500609_010574 | |||
| 1861 | 2510282126 | |||
| 1862 | 2510291715 | |||
| 1863 | 2510310274 | |||
| 1864 | 2511253778 | |||
| 1865 | 2511266162 | |||
| 1866 | 2511270314 | |||
| 1867 | 2511276082 | |||
| 1868 | 2511288336 | |||
| 1869 | 2511297880 | |||
| 1870 | 2511312632 | |||
| 1871 | 2511324726 | |||
| 1872 | 2511338100 | |||
| 1873 | 2511342884 | |||
| 1874 | 2511352635 | |||
| 1875 | 2511359008 | |||
| 1876 | 2511362631 | |||
| 1877 | 2511372126 | |||
| 1878 | 2511377337 | |||
| 1879 | 2511411826 | |||
| 1880 | 2511825948 | |||
| 1881 | 2512326883 | |||
| 1882 | 2554814577 | |||
| 1883 | 2555247946 | |||
| 1884 | 2555668965 | |||
| 1885 | 2583793490 | |||
| 1886 | 2597857154 | |||
| 1887 | 2597862871 | |||
| 1888 | 2597868669 | |||
| 1889 | 2599326505 | |||
| 1890 | 2599357323 | |||
| 1891 | 2599361865 | |||
| 1892 | 2599368186 | |||
| 1893 | 2599374975 | |||
| 1894 | 2599382428 | |||
| 1895 | 2599388875 | |||
| 1896 | 2599393833 | |||
| 1897 | 2599396570 | |||
| 1898 | 2599405598 | |||
| 1899 | 2599453370 | |||
| 1900 | 2599464176 | |||
| 1901 | 2599468472 | |||
| 1902 | 2599484176 | |||
| 1903 | 2599493195 | |||
| 1904 | 2599504653 | |||
| 1905 | 2599507552 | |||
| 1906 | 2599514702 | |||
| 1907 | 2599517367 | |||
| 1908 | 2599611417 | |||
| 1909 | 2599771495 | |||
| 1910 | 2599801827 | |||
| 1911 | 2599883017 | |||
| 1912 | 2599884031 | |||
| 1913 | 2599894033 | |||
| 1914 | 2599899036 | |||
| 1915 | 2599935014 | |||
| 1916 | 2599941619 | |||
| 1917 | 2599952423 | |||
| 1918 | 2599952861 | |||
| 1919 | 2599958825 | |||
| 1920 | 2599968680 | |||
| 1921 | 2599970591 | |||
| 1922 | 2599976937 | |||
| 1923 | 2599981788 | |||
| 1924 | 2599987697 | |||
| 1925 | 2599995189 | |||
| 1926 | 2599998411 | |||
| 1927 | 2600003310 | |||
| 1928 | 2600011106 | |||
| 1929 | 2600017885 | |||
| 1930 | 2600022404 | |||
| 1931 | 2600027425 | |||
| 1932 | 2600034196 | |||
| 1933 | 2600039704 | |||
| 1934 | 2600046027 | |||
| 1935 | 2600052404 | |||
| 1936 | 2600057365 | |||
| 1937 | 2600064542 | |||
| 1938 | 2600069659 | |||
| 1939 | 2600075679 | |||
| 1940 | 2600216451 | |||
| 1941 | 2600356866 | |||
| 1942 | 2600365490 | |||
| 1943 | 2600446664 | |||
| 1944 | 2601624983 | |||
| 1945 | 2601691403 | |||
| 1946 | 2601776956 | |||
| 1947 | 2601797479 | |||
| 1948 | 2602010797 | |||
| 1949 | 2606075788 | |||
| 1950 | 2606130924 | |||
| 1951 | 2608381961 | |||
| 1952 | 2621301046 | |||
| 1953 | 2624481743 | |||
| 1954 | 2624491342 | |||
| 1955 | 2643846329 | |||
| 1956 | 2643872951 | |||
| 1957 | 2643952851 | |||
| 1958 | 2644022613 | |||
| 1959 | 2644188826 | |||
| 1960 | 2644286761 | |||
| 1961 | 2644625151 | |||
| 1962 | 2652548620 | |||
| 1963 | 2671091535 | |||
| 1964 | 2671098504 | |||
| 1965 | 2671126208 | |||
| 1966 | 2671768776 | |||
| 1967 | 2677896719 | |||
| 1968 | 2678262791 | |||
| 1969 | 2715751642 | |||
| 1970 | 2715759811 | |||
| 1971 | 2718635015 | |||
| 1972 | 2723247698 | |||
| 1973 | 2729148001 | |||
| 1974 | 2738670330 | |||
| 1975 | 2738688430 | |||
| 1976 | 2738748723 | |||
| 1977 | 2738809608 | |||
| 1978 | 2738857765 | |||
| 1979 | 2738896968 | |||
| 1980 | 2739201523 | |||
| 1981 | 2739259516 | |||
| 1982 | 2739264162 | |||
| 1983 | 2739285188 | |||
| 1984 | 2739290502 | |||
| 1985 | 2739313927 | |||
| 1986 | 2743736573 | |||
| 1987 | 2745009127 | |||
| 1988 | 2765585091 | |||
| 1989 | 2774121061 | |||
| 1990 | 2774132470 | |||
| 1991 | 2774137258 | |||
| 1992 | 2784263519 | |||
| 1993 | 2784314134 | |||
| 1994 | 2794598190 | |||
| 1995 | 2807409226 | |||
| 1996 | 2807457528 | |||
| 1997 | 2808854418 | |||
| 1998 | 2808907714 | |||
| 1999 | 2808925771 | |||
| 2000 | 2808927662 | |||
| 2001 | 2808934498 | |||
| 2002 | 2808943391 | |||
| 2003 | 2808947872 | |||
| 2004 | 2808949798 | |||
| 2005 | 2808957940 | |||
| 2006 | 2808962923 | |||
| 2007 | 2808975750 | |||
| 2008 | 2808990611 | |||
| 2009 | 2808997660 | |||
| 2010 | 2809216658 | |||
| 2011 | 2812367566 | |||
| 2012 | 2817489603 | |||
| 2013 | 2819656321 | |||
| 2014 | 2819703583 | |||
| 2015 | 2823423369 | |||
| 2016 | 2825652850 | |||
| 2017 | 2826583205 | |||
| 2018 | 2834029523 | |||
| 2019 | 2842810021 | |||
| 2020 | 2842817454 | |||
| 2021 | 2842830988 | |||
| 2022 | 2842837572 | |||
| 2023 | 2842842185 | |||
| 2024 | 2842844482 | |||
| 2025 | 2842850535 | |||
| 2026 | 2842857501 | |||
| 2027 | 2844669454 | |||
| 2028 | 2852614958 | |||
| 2029 | 2852658396 | |||
| 2030 | 2852669926 | |||
| 2031 | 2860339712 | |||
| 2032 | 2860869516 | |||
| 2033 | 2878033725 | |||
| 2034 | 2880234367 | |||
| 2035 | 2904522903 | |||
| 2036 | 2904554373 | |||
| 2037 | 2908448441 | |||
| 2038 | 2912967342 | |||
| 2039 | 2913038765 | |||
| 2040 | 2917072754 | |||
| 2041 | 2917835881 | |||
| 2042 | 2919069091 | |||
| 2043 | 2919125739 | |||
| 2044 | 2919158428 | |||
| 2045 | 2919387849 | |||
| 2046 | 2919456806 | |||
| 2047 | 2919482038 | |||
| 2048 | 2919490575 | |||
| 2049 | 2919505280 | |||
| 2050 | 2919701148 | |||
| 2051 | 2923155587 | |||
| 2052 | 2923521616 | |||
| 2053 | 2923587093 | |||
| 2054 | 2926066957 | |||
| 2055 | 2929146217 | |||
| 2056 | 2929191494 | |||
| 2057 | 2931370416 | |||
| 2058 | 2931392533 | |||
| 2059 | 2931400388 | |||
| 2060 | 2935354917 | |||
| 2061 | 2939639456 | |||
| 2062 | 2939652858 | |||
| 2063 | 2945929073 | |||
| 2064 | 2945962042 | |||
| 2065 | 2946011297 | |||
| 2066 | 2946029721 | |||
| 2067 | 2947236347 | |||
| 2068 | 2969308513 | |||
| 2069 | 2974290098 | |||
| 2070 | 2974300081 | |||
| 2071 | 2984290435 | |||
| 2072 | 2984502461 | |||
| 2073 | 2984508927 | |||
| 2074 | 2988733742 | |||
| 2075 | 2990199133 | |||
| 2076 | 2998143832 | |||
| 2077 | 3007252623 | |||
| 2078 | 3007318804 | |||
| 2079 | 3007401126 | |||
| 2080 | 3007421471 | |||
| 2081 | 3007513317 | |||
| 2082 | 3007619555 | |||
| 2083 | 3007624960 | |||
| 2084 | 3007808091 | |||
| 2085 | 3007861001 | |||
| 2086 | 3007861239 | |||
| 2087 | 3007870090 | |||
| 2088 | 3007875510 | |||
| 2089 | 637319306 | |||
| 2090 | 640487607 | |||
| 2091 | 651175551 | |||
| 2092 | 8011351860 | |||
| 2093 | 8015689847 | |||
| 2094 | 8016728773 | |||
| 2095 | 8019772895 | |||
| 2096 | 8019778252 | |||
| 2097 | 8029997045 | |||
| 2098 | 8034963739 | |||
| 2099 | 8052496343 | |||
| 2100 | 8054289662 | |||
| 2101 | 8054351956 | |||
| 2102 | 8054505058 | |||
| 2103 | 8054932474 | |||
| 2104 | 8055772949 | |||
| 2105 | 8055819564 | |||
| 2106 | 8055880636 | |||
| 2107 | 8056118048 | |||
| 2108 | 8056124295 | |||
| 2109 | 8056127843 | |||
| 2110 | 8056133431 | |||
| 2111 | 8056139212 | |||
| 2112 | 8056145156 | |||
| 2113 | 8056149703 | |||
| 2114 | 8056156604 | |||
| 2115 | 8056164845 | |||
| 2116 | 8056167444 | |||
| 2117 | 8056173449 | |||
| 2118 | 8056183613 | |||
| 2119 | 8056573096 | |||
| 2120 | 8057799377 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rzp-assembly1.cif.gz_B | crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 | 0.96 | 19 | 276 |
| 3rzp-assembly2.cif.gz_C | crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 | 0.9595 | 19 | 276 |
| 3uxj-assembly2.cif.gz_C | crystal structure of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with nadp and preq0 | 0.9594 | 19 | 276 |
| 3rzp-assembly2.cif.gz_D | crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 | 0.9535 | 16 | 276 |
| 3rzp-assembly1.cif.gz_B | crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 | 0.9528 | 19 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bp1A01 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9584 | 16 | 131 | 3.30.1130.10 |
| 3bp1A01 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.927 | 16 | 131 | 3.30.1130.10 |
| 3rzpD02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8832 | 140 | 276 | 3.30.1130.10 |
| 3rzpD02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8768 | 140 | 276 | 3.30.1130.10 |
| af_Q2G081_22_166_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8611 | 154 | 270 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352G139-F1-model_v4 | deleted | 0.99 | 98 | 276 |
|
| AF-J2RYE4-F1-model_v4 | GTP cyclohydrolase I | 0.9898 | 117 | 276 |
GO:0008616
GO:0016787 GO:0033739 |
| AF-A0A0Q0CDB5-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase | 0.9891 | 138 | 276 |
GO:0008616
GO:0033739 |
| AF-A0A6H9RTP7-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF | 0.9844 | 82 | 235 |
GO:0008616
GO:0033739 |
| AF-J2RYE4-F1-model_v4 | GTP cyclohydrolase I | 0.9837 | 117 | 276 |
GO:0008616
GO:0016787 GO:0033739 |