F489299

General Info

Members Datasets Scaffolds Average Seq Length
1062 568 2124 243

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10000005|Ga0075370_1000000566
Length 294
Sequence MTFAAAVITLYPEMFPGPLGVSLAGRAREEGKWSLDAIQLRDFAADKHRTVDDTPAGGGAGMVLRADVLAAAVDFAVAQSSPVRGGGPAKLVEGYKPHNVPSRGQDNLPVPLHHPADGPPPRTGEVLDVPIIALTPRGKPLTQARVRELAAGPGVILICGRFEGFDERIFAARPIEEVSIGDIVLSGGEPAALMLLDACIRLLPGVMGAPSSGTEESFENGLLEYPHYTRPAEWEGRTIPEVLRSGDHAKIAEWRKRQSEIDTRSRRPDLWERHEGVRVQSASGARREKKDMDQ

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
142 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
143 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
163 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
263 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
264 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
265 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
266 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
267 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
272 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
273 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
282 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
285 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
286 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
292 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
297 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
298 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
299 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
303 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
304 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
305 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
306 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
307 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
308 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
309 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
310 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
311 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
312 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
315 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
323 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
324 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
327 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
328 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
337 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
348 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
349 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
350 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
351 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
352 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
353 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
359 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
367 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
368 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
371 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
372 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
373 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
374 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
375 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
379 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
380 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
381 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
382 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
383 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
384 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
385 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
386 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
387 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
388 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
389 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
393 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
394 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
395 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
396 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
397 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
398 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
399 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
400 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
401 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
416 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
422 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
423 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
424 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
425 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
426 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
427 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
428 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
434 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
435 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
449 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
450 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
451 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
455 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
456 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
457 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
458 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
459 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
460 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
461 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
462 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
463 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
464 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
465 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
466 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
467 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
468 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
469 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
472 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
473 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
474 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
475 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
476 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
477 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
478 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
479 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
480 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
481 2791355199
482 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
483 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
484 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
485 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
486 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
487 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
488 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
489 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
490 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
491 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
492 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
493 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
494 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
495 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
496 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
497 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
498 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
499 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
500 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
501 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
502 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
503 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
504 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
505 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
506 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
507 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
508 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
509 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
510 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
511 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
512 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
513 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
514 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
515 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
516 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
517 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
518 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
519 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
520 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
521 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
522 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
523 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
524 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
525 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
526 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
527 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
528 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
529 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
530 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
531 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
532 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
533 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
534 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
535 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
536 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
537 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
538 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
539 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
540 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
541 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
542 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
543 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
544 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
545 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
546 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
547 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
548 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
549 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
550 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
551 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
552 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
553 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
554 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
555 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
556 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
557 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
558 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
559 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
560 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
561 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
562 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
563 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
564 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
565 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
566 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
567 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
568 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.95
Metatranscriptomes 0.09
Isolates 8.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.63
Nodule 6.87
Rhizoplane 4.33
Rhizosphere 76.55
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10000005 3300006353 Bacteria 112202
2 SwRhRL2b_contig_1994602 2162886007 Bacteria 2728
3 SwRhRL2b_contig_3660127 2162886007 Bacteria 11567
4 2214756328 2209111006 Bacteria 3130
5 ARcpr5oldR_c000007 3300000041 Bacteria 41749
6 ARSoilYngRDRAFT_c00111 3300000042 Bacteria 13938
7 ARSoilYngRDRAFT_c00874 3300000042 Bacteria 2358
8 ARcpr5yngRDRAFT_c000269 3300000043 Bacteria 7452
9 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
10 ARCol0oldRDRAFT_c00252 3300000045 Bacteria 5061
11 ARCol0yngRDRAFT_1000074 3300000652 Bacteria 18636
12 JGI24736J21556_1000017 3300001904 Bacteria 28475
13 JGI24752J21851_1000051 3300001976 Bacteria 14477
14 JGI24752J21851_1001794 3300001976 Bacteria 2874
15 JGI24752J21851_1012592 3300001976 Bacteria 1106
16 JGI24746J21847_1002919 3300001977 Bacteria 2687
17 JGI24747J21853_1000683 3300001978 Bacteria 2249
18 JGI24740J21852_10024052 3300001979 Bacteria 2071
19 JGI24740J21852_10025155 3300001979 Bacteria 2010
20 JGI24739J22299_10000119 3300001989 Bacteria 24437
21 JGI24737J22298_10000258 3300001990 Bacteria 17613
22 JGI24737J22298_10001992 3300001990 Bacteria 7298
23 JGI24737J22298_10012325 3300001990 Bacteria 2787
24 JGI24735J21928_10017458 3300002067 Bacteria 2219
25 JGI24750J21931_1000266 3300002070 Bacteria 8930
26 JGI24750J21931_1000890 3300002070 Bacteria 4093
27 JGI24750J21931_1017396 3300002070 Bacteria 983
28 JGI24745J21846_1000139 3300002073 Bacteria 5616
29 JGI24748J21848_1000015 3300002074 Bacteria 143883
30 JGI24748J21848_1000484 3300002074 Bacteria 4368
31 JGI24738J21930_10006607 3300002075 Bacteria 2706
32 JGI24738J21930_10015721 3300002075 Bacteria 1605
33 JGI24749J21850_1003669 3300002076 Bacteria 2145
34 JGI24744J21845_10008736 3300002077 Bacteria 2082
35 JGI24744J21845_10011748 3300002077 Bacteria 1787
36 JGI24033J26618_1000347 3300002155 Bacteria 4774
37 JGI24034J26672_10000006 3300002239 Bacteria 294495
38 JGI24034J26672_10001007 3300002239 Bacteria 3680
39 JGI24742J22300_10000480 3300002244 Bacteria 5934
40 JGI24751J29686_10005558 3300002459 Bacteria 2566
41 JGI25406J46586_10000915 3300003203 Bacteria 13864
42 JGI25160J50197_1007763 3300003354 Bacteria 4160
43 JGI25404J52841_10026566 3300003659 Bacteria 1245
44 JGI25404J52841_10036488 3300003659 Bacteria 1046
45 JGI25404J52841_10039946 3300003659 Bacteria 993
46 Ga0055529_1000016 3300003763 Bacteria 364775
47 Ga0055529_1007318 3300003763 Bacteria 1505
48 Ga0055524_1046309 3300003775 Bacteria 1036
49 Ga0055531_10000601 3300003794 Bacteria 31249
50 Ga0065704_10000222 3300005289 Bacteria 73073
51 Ga0065704_10001918 3300005289 Bacteria 15286
52 Ga0065704_10129918 3300005289 Bacteria 1642
53 Ga0065712_10019168 3300005290 Bacteria 1731
54 Ga0065715_10119375 3300005293 Bacteria 2288
55 Ga0065707_10081865 3300005295 Bacteria 32547
56 Ga0070658_10000124 3300005327 Bacteria 68224
57 Ga0070658_10062550 3300005327 Bacteria 3034
58 Ga0070658_10091330 3300005327 Bacteria 2509
59 Ga0070658_10301462 3300005327 Bacteria 1366
60 Ga0070676_10092899 3300005328 Bacteria 1851
61 Ga0070690_100000074 3300005330 Bacteria 48493
62 Ga0070690_100136324 3300005330 Bacteria 1663
63 Ga0070690_100176293 3300005330 Bacteria 1475
64 Ga0070670_100002160 3300005331 Bacteria 16146
65 Ga0070670_100036719 3300005331 Bacteria 4216
66 Ga0070670_100451406 3300005331 Bacteria 1139
67 Ga0070677_10000023 3300005333 Bacteria 44929
68 Ga0068869_100000153 3300005334 Bacteria 34191
69 Ga0070666_10000014 3300005335 Bacteria 224479
70 Ga0070666_10000352 3300005335 Bacteria 28924
71 Ga0070666_10015196 3300005335 Bacteria 4909
72 Ga0070680_100000814 3300005336 Bacteria 21982
73 Ga0070680_100082098 3300005336 Bacteria 2660
74 Ga0070680_100641544 3300005336 Bacteria 912
75 Ga0070682_100000445 3300005337 Bacteria 26505
76 Ga0070682_100160407 3300005337 Bacteria 1552
77 Ga0068868_100008401 3300005338 Bacteria 7390
78 Ga0068868_100169974 3300005338 Bacteria 1804
79 Ga0068868_100483920 3300005338 Bacteria 1082
80 Ga0070660_100045038 3300005339 Bacteria 3376
81 Ga0070660_100108994 3300005339 Bacteria 2201
82 Ga0070660_100445627 3300005339 Bacteria 1074
83 Ga0070689_100176740 3300005340 Bacteria 1732
84 Ga0070689_100390930 3300005340 Bacteria 1174
85 Ga0070691_10000320 3300005341 Bacteria 17013
86 Ga0070691_10071651 3300005341 Bacteria 1683
87 Ga0070687_100000187 3300005343 Bacteria 21513
88 Ga0070661_100001011 3300005344 Bacteria 19919
89 Ga0070661_100005469 3300005344 Bacteria 8763
90 Ga0070661_100050367 3300005344 Bacteria 3047
91 Ga0070661_100119189 3300005344 Bacteria 1975
92 Ga0070692_10004168 3300005345 Bacteria 5990
93 Ga0070692_10006165 3300005345 Bacteria 5184
94 Ga0070668_100000012 3300005347 Bacteria 117937
95 Ga0070668_100040858 3300005347 Bacteria 3551
96 Ga0070668_100049907 3300005347 Bacteria 3220
97 Ga0070668_100065214 3300005347 Bacteria 2825
98 Ga0070668_100096685 3300005347 Bacteria 2334
99 Ga0070668_100210491 3300005347 Bacteria 1599
100 Ga0070669_100000018 3300005353 Bacteria 195789
101 Ga0070669_100000433 3300005353 Bacteria 31979
102 Ga0070669_100001247 3300005353 Bacteria 18439
103 Ga0070669_100054572 3300005353 Bacteria 2927
104 Ga0070675_100001136 3300005354 Bacteria 19211
105 Ga0070671_100000011 3300005355 Bacteria 202057
106 Ga0070671_100002139 3300005355 Bacteria 15248
107 Ga0070671_100006311 3300005355 Bacteria 9455
108 Ga0070671_100061520 3300005355 Bacteria 3127
109 Ga0070674_100016869 3300005356 Bacteria 4582
110 Ga0070674_100405952 3300005356 Bacteria 1114
111 Ga0070673_100000278 3300005364 Bacteria 26473
112 Ga0070688_100002853 3300005365 Bacteria 8810
113 Ga0070688_100007418 3300005365 Bacteria 5911
114 Ga0070659_100349820 3300005366 Bacteria 1239
115 Ga0070659_100427744 3300005366 Bacteria 1120
116 Ga0070667_100000038 3300005367 Bacteria 171914
117 Ga0070667_100003737 3300005367 Bacteria 12923
118 Ga0070667_100048891 3300005367 Bacteria 3561
119 Ga0070667_100148343 3300005367 Bacteria 2058
120 Ga0070703_10056199 3300005406 Bacteria 1274
121 Ga0070714_100306938 3300005435 Bacteria 1481
122 Ga0070714_100777022 3300005435 Bacteria 927
123 Ga0070713_100014423 3300005436 Bacteria 5870
124 Ga0070711_100380826 3300005439 Bacteria 1141
125 Ga0070705_100133334 3300005440 Bacteria 1624
126 Ga0070705_100357931 3300005440 Bacteria 1066
127 Ga0070708_100018176 3300005445 Bacteria 5881
128 Ga0070663_100006501 3300005455 Bacteria 7036
129 Ga0070663_100016582 3300005455 Bacteria 4789
130 Ga0070663_100021962 3300005455 Bacteria 4256
131 Ga0070663_100084217 3300005455 Bacteria 2343
132 Ga0070663_100128393 3300005455 Bacteria 1922
133 Ga0070663_100179229 3300005455 Bacteria 1642
134 Ga0070663_100383324 3300005455 Bacteria 1145
135 Ga0070678_100000438 3300005456 Bacteria 19678
136 Ga0070678_100128549 3300005456 Bacteria 2009
137 Ga0070662_100228880 3300005457 Bacteria 1486
138 Ga0070681_10028258 3300005458 Bacteria 5638
139 Ga0070681_10038126 3300005458 Bacteria 4819
140 Ga0070681_10456598 3300005458 Bacteria 1190
141 Ga0068867_100013504 3300005459 Bacteria 5785
142 Ga0070685_10000341 3300005466 Bacteria 28600
143 Ga0070685_10005396 3300005466 Bacteria 6474
144 Ga0070706_100166737 3300005467 Bacteria 2057
145 Ga0070698_100124081 3300005471 Bacteria 2540
146 Ga0070698_100297537 3300005471 Bacteria 1545
147 Ga0070699_100193414 3300005518 Bacteria 1808
148 Ga0070679_100002503 3300005530 Bacteria 16646
149 Ga0070679_100326532 3300005530 Bacteria 1483
150 Ga0070679_100330593 3300005530 Bacteria 1472
151 Ga0070684_100000101 3300005535 Bacteria 55960
152 Ga0070684_100010867 3300005535 Bacteria 7234
153 Ga0070684_100023917 3300005535 Bacteria 5117
154 Ga0070684_100506831 3300005535 Bacteria 1118
155 Ga0070697_100000401 3300005536 Bacteria 33563
156 Ga0070697_100340132 3300005536 Bacteria 1295
157 Ga0068853_100002669 3300005539 Bacteria 13447
158 Ga0068853_100016584 3300005539 Bacteria 6066
159 Ga0068853_100019771 3300005539 Bacteria 5592
160 Ga0068853_100364045 3300005539 Bacteria 1348
161 Ga0068853_100382508 3300005539 Bacteria 1314
162 Ga0070672_100080066 3300005543 Bacteria 2616
163 Ga0070686_100000002 3300005544 Bacteria 336303
164 Ga0070686_100004826 3300005544 Bacteria 7444
165 Ga0070686_100078864 3300005544 Bacteria 2176
166 Ga0070686_100135597 3300005544 Bacteria 1707
167 Ga0070695_100789552 3300005545 Bacteria 760
168 Ga0070665_100000025 3300005548 Bacteria 367488
169 Ga0070665_100019468 3300005548 Bacteria 6812
170 Ga0070665_100029346 3300005548 Bacteria 5537
171 Ga0070704_100010927 3300005549 Bacteria 5537
172 Ga0070704_100365641 3300005549 Bacteria 1222
173 Ga0068855_100018656 3300005563 Bacteria 8342
174 Ga0068855_100045413 3300005563 Bacteria 5196
175 Ga0068855_100056760 3300005563 Bacteria 4592
176 Ga0070664_100019815 3300005564 Bacteria 5537
177 Ga0070664_100072795 3300005564 Bacteria 2947
178 Ga0068854_100000794 3300005578 Bacteria 18790
179 Ga0068854_100002938 3300005578 Bacteria 10571
180 Ga0068856_100032338 3300005614 Bacteria 5121
181 Ga0068856_100049538 3300005614 Bacteria 4140
182 Ga0068856_100290338 3300005614 Bacteria 1652
183 Ga0068856_100331881 3300005614 Bacteria 1538
184 Ga0068856_100517414 3300005614 Unclassified 1214
185 Ga0068856_100823727 3300005614 Bacteria 947
186 Ga0070702_100004251 3300005615 Bacteria 6527
187 Ga0068852_100007512 3300005616 Bacteria 7958
188 Ga0068852_100032633 3300005616 Bacteria 4313
189 Ga0068852_100723129 3300005616 Bacteria 1007
190 Ga0068852_100737951 3300005616 Bacteria 996
191 Ga0068859_100002363 3300005617 Bacteria 19203
192 Ga0068859_100010182 3300005617 Bacteria 9468
193 Ga0068859_100032092 3300005617 Bacteria 5275
194 Ga0068864_100000715 3300005618 Bacteria 27854
195 Ga0068864_100026310 3300005618 Bacteria 4907
196 Ga0068864_100046445 3300005618 Bacteria 3726
197 Ga0068864_100051917 3300005618 Bacteria 3533
198 Ga0068864_100111673 3300005618 Bacteria 2435
199 Ga0068866_10158245 3300005718 Bacteria 1319
200 Ga0068861_100000175 3300005719 Bacteria 34015
201 Ga0068861_100126335 3300005719 Bacteria 2069
202 Ga0068861_100263130 3300005719 Bacteria 1477
203 Ga0068851_10005837 3300005834 Bacteria 5608
204 Ga0068851_10057583 3300005834 Bacteria 1984
205 Ga0068851_10064527 3300005834 Bacteria 1882
206 Ga0068870_10003459 3300005840 Bacteria 6690
207 Ga0068863_100000201 3300005841 Bacteria 63515
208 Ga0068863_100000541 3300005841 Bacteria 38515
209 Ga0068863_100034724 3300005841 Bacteria 4802
210 Ga0068863_100115791 3300005841 Bacteria 2554
211 Ga0068863_100120089 3300005841 Bacteria 2505
212 Ga0068858_100008092 3300005842 Bacteria 10123
213 Ga0068858_100016054 3300005842 Bacteria 7035
214 Ga0068858_100023961 3300005842 Bacteria 5686
215 Ga0068858_100141393 3300005842 Bacteria 2259
216 Ga0068860_100000001 3300005843 Bacteria 703043
217 Ga0068860_100000477 3300005843 Bacteria 49839
218 Ga0068860_100021808 3300005843 Bacteria 6196
219 Ga0068860_100177528 3300005843 Bacteria 2058
220 Ga0068860_100319042 3300005843 Bacteria 1525
221 Ga0068862_100000048 3300005844 Bacteria 150043
222 Ga0068862_100005633 3300005844 Bacteria 10458
223 Ga0068862_100007404 3300005844 Bacteria 9102
224 Ga0068862_100031542 3300005844 Bacteria 4474
225 Ga0068862_100106691 3300005844 Bacteria 2456
226 Ga0068862_100234647 3300005844 Bacteria 1665
227 Ga0081455_10000002 3300005937 Bacteria 460472
228 Ga0081455_10109709 3300005937 Bacteria 2196
229 Ga0081455_10257431 3300005937 Bacteria 1273
230 Ga0081455_10341680 3300005937 Bacteria 1059
231 Ga0081540_1032403 3300005983 Bacteria 2855
232 Ga0081540_1034949 3300005983 Bacteria 2701
233 Ga0081540_1051490 3300005983 Bacteria 2035
234 Ga0081540_1095964 3300005983 Bacteria 1291
235 Ga0081539_10000371 3300005985 Bacteria 98455
236 Ga0070717_10010474 3300006028 Bacteria 7004
237 Ga0070717_10031009 3300006028 Bacteria 4298
238 Ga0075365_10030971 3300006038 Bacteria 3430
239 Ga0075365_10325455 3300006038 Bacteria 1082
240 Ga0075365_10502262 3300006038 Bacteria 857
241 Ga0075368_10034407 3300006042 Bacteria 1974
242 Ga0075368_10057572 3300006042 Bacteria 1552
243 Ga0075363_100010816 3300006048 Bacteria 4350
244 Ga0075363_100037033 3300006048 Bacteria 2561
245 Ga0075364_10080138 3300006051 Bacteria 2158
246 Ga0075364_10272336 3300006051 Bacteria 1152
247 Ga0075364_10389626 3300006051 Bacteria 950
248 Ga0075432_10002238 3300006058 Bacteria 6435
249 Ga0075432_10070611 3300006058 Bacteria 1254
250 Ga0075362_10000006 3300006177 Bacteria 123313
251 Ga0075367_10001412 3300006178 Bacteria 10280
252 Ga0075367_10028134 3300006178 Bacteria 3204
253 Ga0075367_10082573 3300006178 Bacteria 1945
254 Ga0075367_10083539 3300006178 Bacteria 1935
255 Ga0075367_10137191 3300006178 Bacteria 1514
256 Ga0075367_10190837 3300006178 Bacteria 1278
257 Ga0075369_10015094 3300006186 Bacteria 3095
258 Ga0075366_10000394 3300006195 Bacteria 20296
259 Ga0097621_100002611 3300006237 Bacteria 12347
260 Ga0075370_10022271 3300006353 Bacteria 3478
261 Ga0075370_10042810 3300006353 Bacteria 2558
262 Ga0075370_10099883 3300006353 Bacteria 1679
263 Ga0075370_10174685 3300006353 Bacteria 1263
264 Ga0075370_10227402 3300006353 Bacteria 1103
265 Ga0068871_100000012 3300006358 Bacteria 105267
266 Ga0068871_100167892 3300006358 Bacteria 1879
267 Ga0075430_100001004 3300006846 Bacteria 22319
268 Ga0075431_100007962 3300006847 Bacteria 10567
269 Ga0075433_10102994 3300006852 Bacteria 2528
270 Ga0075434_100050796 3300006871 Bacteria 4119
271 Ga0075434_100455490 3300006871 Bacteria 1300
272 Ga0075434_100464037 3300006871 Bacteria 1287
273 Ga0075429_100310296 3300006880 Bacteria 1381
274 Ga0068865_100000328 3300006881 Bacteria 26279
275 Ga0075436_100000298 3300006914 Bacteria 31645
276 Ga0097620_100002363 3300006931 Bacteria 19203
277 Ga0097620_100010182 3300006931 Bacteria 9468
278 Ga0097620_100032090 3300006931 Bacteria 5275
279 Ga0105251_10006570 3300009011 Bacteria 7376
280 Ga0105251_10025689 3300009011 Bacteria 3009
281 Ga0105251_10049297 3300009011 Bacteria 2016
282 Ga0105251_10088189 3300009011 Bacteria 1427
283 Ga0105250_10043634 3300009092 Bacteria 1797
284 Ga0105250_10095270 3300009092 Bacteria 1213
285 Ga0105240_10008624 3300009093 Bacteria 14565
286 Ga0105240_10220276 3300009093 Bacteria 2211
287 Ga0105240_10487760 3300009093 Bacteria 1372
288 Ga0105240_10645185 3300009093 Bacteria 1161
289 Ga0111539_10345068 3300009094 Bacteria 1733
290 Ga0111539_10451107 3300009094 Bacteria 1498
291 Ga0111539_11342813 3300009094 Bacteria 830
292 Ga0105245_10000460 3300009098 Bacteria 37264
293 Ga0105245_10791767 3300009098 Bacteria 986
294 Ga0105247_10000881 3300009101 Bacteria 22689
295 Ga0105247_10028195 3300009101 Bacteria 3397
296 Ga0105247_10033046 3300009101 Bacteria 3145
297 Ga0105247_10038149 3300009101 Bacteria 2932
298 Ga0105247_10316585 3300009101 Bacteria 1087
299 Ga0105247_10573158 3300009101 Bacteria 833
300 Ga0114129_10575284 3300009147 Bacteria 1462
301 Ga0105243_10001028 3300009148 Bacteria 25704
302 Ga0105243_10189574 3300009148 Bacteria 1795
303 Ga0105241_10002719 3300009174 Bacteria 13247
304 Ga0105241_10059091 3300009174 Bacteria 2947
305 Ga0105241_10093049 3300009174 Bacteria 2381
306 Ga0105242_10000607 3300009176 Bacteria 28041
307 Ga0105242_10275996 3300009176 Bacteria 1525
308 Ga0105248_10000309 3300009177 Bacteria 58008
309 Ga0105248_10223856 3300009177 Bacteria 2118
310 Ga0105237_10010578 3300009545 Bacteria 9800
311 Ga0105237_10099411 3300009545 Bacteria 2901
312 Ga0105237_10372587 3300009545 Bacteria 1432
313 Ga0105237_10438871 3300009545 Bacteria 1311
314 Ga0105237_10497644 3300009545 Bacteria 1225
315 Ga0105238_10118328 3300009551 Bacteria 2629
316 Ga0105238_10310408 3300009551 Bacteria 1562
317 Ga0105238_10516258 3300009551 Bacteria 1197
318 Ga0105238_10570329 3300009551 Bacteria 1137
319 Ga0105249_10000005 3300009553 Bacteria 362467
320 Ga0105249_10033877 3300009553 Bacteria 4626
321 Ga0105249_10207095 3300009553 Bacteria 1922
322 Ga0105239_10035107 3300010375 Bacteria 5507
323 Ga0105239_10155775 3300010375 Bacteria 2551
324 Ga0105239_10329835 3300010375 Bacteria 1721
325 Ga0105239_10475523 3300010375 Bacteria 1419
326 Ga0157315_1001489 3300012508 Bacteria 1313
327 Ga0157326_1004058 3300012513 Bacteria 1539
328 Ga0157338_1000532 3300012515 Bacteria 2303
329 Ga0157371_10000146 3300013102 Bacteria 103290
330 Ga0157371_10010704 3300013102 Bacteria 7122
331 Ga0157370_10070523 3300013104 Bacteria 3298
332 Ga0157369_10559408 3300013105 Bacteria 1182
333 Ga0157374_10005485 3300013296 Bacteria 10651
334 Ga0157374_10186699 3300013296 Bacteria 2027
335 Ga0157378_10170665 3300013297 Bacteria 2040
336 Ga0157378_10424037 3300013297 Bacteria 1315
337 Ga0163162_10000992 3300013306 Bacteria 26439
338 Ga0163162_10041084 3300013306 Bacteria 4626
339 Ga0163162_10119689 3300013306 Bacteria 2736
340 Ga0157372_10047192 3300013307 Bacteria 4784
341 Ga0157372_10095101 3300013307 Bacteria 3394
342 Ga0157372_11082650 3300013307 Bacteria 927
343 Ga0157375_10053523 3300013308 Bacteria 3972
344 Ga0157375_10255398 3300013308 Bacteria 1914
345 Ga0157375_10336048 3300013308 Bacteria 1676
346 Ga0163163_10000824 3300014325 Bacteria 26424
347 Ga0163163_10049492 3300014325 Bacteria 4137
348 Ga0163163_10165674 3300014325 Bacteria 2256
349 Ga0163163_11176677 3300014325 Bacteria 829
350 Ga0157380_10000223 3300014326 Bacteria 33890
351 Ga0157380_10021931 3300014326 Bacteria 4796
352 Ga0157380_10027515 3300014326 Bacteria 4325
353 Ga0157380_10251999 3300014326 Bacteria 1598
354 Ga0182008_10035428 3300014497 Bacteria 2500
355 Ga0157377_10010864 3300014745 Bacteria 4522
356 Ga0157379_10035759 3300014968 Bacteria 4429
357 Ga0157379_10118222 3300014968 Bacteria 2384
358 Ga0157379_10223236 3300014968 Bacteria 1707
359 Ga0157376_10011320 3300014969 Bacteria 6571
360 Ga0157376_10461748 3300014969 Bacteria 1241
361 Ga0183363_1004 3300015690 Bacteria 416766
362 Ga0163161_10000534 3300017792 Bacteria 31044
363 Ga0163161_10000559 3300017792 Bacteria 29995
364 Ga0163161_10033791 3300017792 Bacteria 3655
365 Ga0206353_11267825 3300020082 Bacteria 8157
366 Ga0213876_10085403 3300021384 Bacteria 1670
367 Ga0213876_10148624 3300021384 Bacteria 1246
368 Ga0213875_10002032 3300021388 Bacteria 12448
369 Ga0207672_1001332 3300025223 Bacteria 2001
370 Ga0209148_1000017 3300025254 Bacteria 787064
371 Ga0209148_1000094 3300025254 Bacteria 241711
372 Ga0209455_1000005 3300025272 Bacteria 1416756
373 Ga0209455_1000223 3300025272 Bacteria 77481
374 Ga0207673_1000025 3300025290 Bacteria 11860
375 Ga0209256_1004477 3300025299 Bacteria 8739
376 Ga0207697_10000211 3300025315 Bacteria 31108
377 Ga0207656_10015627 3300025321 Bacteria 2941
378 Ga0207656_10093095 3300025321 Bacteria 1371
379 Ga0207713_1068962 3300025735 Bacteria 1312
380 Ga0207713_1088682 3300025735 Bacteria 1092
381 Ga0207653_10056460 3300025885 Bacteria 1317
382 Ga0207682_10000011 3300025893 Bacteria 85533
383 Ga0207642_10000524 3300025899 Bacteria 11752
384 Ga0207710_10005139 3300025900 Bacteria 5661
385 Ga0207710_10018673 3300025900 Bacteria 2951
386 Ga0207688_10000020 3300025901 Bacteria 51200
387 Ga0207680_10000004 3300025903 Bacteria 827324
388 Ga0207680_10004313 3300025903 Bacteria 6741
389 Ga0207680_10021990 3300025903 Bacteria 3462
390 Ga0207680_10084116 3300025903 Bacteria 2007
391 Ga0207680_10334489 3300025903 Bacteria 1061
392 Ga0207647_10004347 3300025904 Bacteria 10506
393 Ga0207647_10019896 3300025904 Bacteria 4507
394 Ga0207699_10061610 3300025906 Bacteria 2258
395 Ga0207645_10000788 3300025907 Bacteria 26477
396 Ga0207645_10270788 3300025907 Bacteria 1126
397 Ga0207643_10000284 3300025908 Bacteria 35172
398 Ga0207705_10000009 3300025909 Bacteria 576128
399 Ga0207705_10004964 3300025909 Bacteria 9986
400 Ga0207705_10006387 3300025909 Bacteria 8739
401 Ga0207705_10060513 3300025909 Bacteria 2735
402 Ga0207684_10191864 3300025910 Bacteria 1762
403 Ga0207654_10001265 3300025911 Bacteria 13469
404 Ga0207654_10005735 3300025911 Bacteria 6270
405 Ga0207654_10226444 3300025911 Bacteria 1243
406 Ga0207707_10000689 3300025912 Bacteria 33589
407 Ga0207695_10008440 3300025913 Bacteria 12898
408 Ga0207695_10026473 3300025913 Bacteria 6474
409 Ga0207695_10026901 3300025913 Bacteria 6413
410 Ga0207695_10241138 3300025913 Bacteria 1709
411 Ga0207671_10004774 3300025914 Bacteria 12777
412 Ga0207671_10019640 3300025914 Bacteria 5163
413 Ga0207671_10034109 3300025914 Bacteria 3784
414 Ga0207671_10040085 3300025914 Bacteria 3467
415 Ga0207663_10104021 3300025916 Bacteria 1913
416 Ga0207660_10000442 3300025917 Bacteria 27342
417 Ga0207660_10073313 3300025917 Bacteria 2496
418 Ga0207660_10245894 3300025917 Bacteria 1411
419 Ga0207662_10000249 3300025918 Bacteria 24950
420 Ga0207657_10005758 3300025919 Bacteria 12925
421 Ga0207657_10017155 3300025919 Bacteria 6955
422 Ga0207657_10019263 3300025919 Bacteria 6485
423 Ga0207657_10096809 3300025919 Bacteria 2454
424 Ga0207657_10282159 3300025919 Bacteria 1318
425 Ga0207649_10000057 3300025920 Bacteria 102314
426 Ga0207649_10000686 3300025920 Bacteria 22393
427 Ga0207652_10017507 3300025921 Bacteria 5864
428 Ga0207652_10050418 3300025921 Bacteria 3566
429 Ga0207652_10104030 3300025921 Bacteria 2511
430 Ga0207646_10401320 3300025922 Bacteria 1238
431 Ga0207681_10000008 3300025923 Bacteria 414329
432 Ga0207681_10000152 3300025923 Bacteria 57600
433 Ga0207681_10000153 3300025923 Bacteria 57579
434 Ga0207681_10000181 3300025923 Bacteria 51755
435 Ga0207681_10176176 3300025923 Bacteria 1625
436 Ga0207681_10424232 3300025923 Bacteria 1078
437 Ga0207694_10092511 3300025924 Bacteria 2387
438 Ga0207694_10138744 3300025924 Bacteria 1954
439 Ga0207694_10162760 3300025924 Bacteria 1803
440 Ga0207694_10421977 3300025924 Bacteria 1111
441 Ga0207650_10001609 3300025925 Bacteria 16125
442 Ga0207650_10009752 3300025925 Bacteria 6567
443 Ga0207650_10794520 3300025925 Bacteria 802
444 Ga0207659_10000028 3300025926 Bacteria 130804
445 Ga0207687_10000061 3300025927 Bacteria 84113
446 Ga0207700_10007626 3300025928 Bacteria 6638
447 Ga0207664_10040973 3300025929 Bacteria 3605
448 Ga0207644_10000006 3300025931 Bacteria 408793
449 Ga0207644_10000060 3300025931 Bacteria 79209
450 Ga0207644_10000315 3300025931 Bacteria 31527
451 Ga0207644_10005556 3300025931 Bacteria 8205
452 Ga0207644_10426267 3300025931 Bacteria 1087
453 Ga0207690_10000445 3300025932 Bacteria 26765
454 Ga0207690_10003095 3300025932 Bacteria 10022
455 Ga0207690_10123607 3300025932 Bacteria 1884
456 Ga0207690_10149816 3300025932 Bacteria 1728
457 Ga0207706_10163336 3300025933 Bacteria 1957
458 Ga0207686_10067778 3300025934 Bacteria 2284
459 Ga0207686_10073445 3300025934 Bacteria 2207
460 Ga0207709_10000539 3300025935 Bacteria 32486
461 Ga0207709_10007306 3300025935 Bacteria 6159
462 Ga0207709_10091058 3300025935 Bacteria 1993
463 Ga0207670_10000217 3300025936 Bacteria 37598
464 Ga0207670_10224818 3300025936 Bacteria 1439
465 Ga0207669_10000147 3300025937 Bacteria 34031
466 Ga0207669_10015280 3300025937 Bacteria 3868
467 Ga0207704_10000299 3300025938 Bacteria 23415
468 Ga0207691_10139944 3300025940 Bacteria 2133
469 Ga0207711_10001580 3300025941 Bacteria 21028
470 Ga0207711_10039899 3300025941 Bacteria 3994
471 Ga0207711_10156437 3300025941 Bacteria 2060
472 Ga0207711_10296583 3300025941 Bacteria 1491
473 Ga0207689_10001029 3300025942 Bacteria 26794
474 Ga0207661_10000215 3300025944 Bacteria 37435
475 Ga0207661_10025714 3300025944 Bacteria 4478
476 Ga0207661_10063138 3300025944 Bacteria 2999
477 Ga0207679_10000026 3300025945 Bacteria 200073
478 Ga0207679_10327827 3300025945 Bacteria 1328
479 Ga0207667_10000552 3300025949 Bacteria 49276
480 Ga0207667_10003106 3300025949 Bacteria 20551
481 Ga0207667_10010207 3300025949 Bacteria 10997
482 Ga0207667_10027203 3300025949 Bacteria 6231
483 Ga0207667_10030695 3300025949 Bacteria 5810
484 Ga0207667_10196889 3300025949 Bacteria 2067
485 Ga0207667_10919358 3300025949 Bacteria 866
486 Ga0207651_10000173 3300025960 Bacteria 27970
487 Ga0207712_10000001 3300025961 Bacteria 750309
488 Ga0207712_10000686 3300025961 Bacteria 26195
489 Ga0207668_10000071 3300025972 Bacteria 77508
490 Ga0207668_10000125 3300025972 Bacteria 54353
491 Ga0207668_10000242 3300025972 Bacteria 36700
492 Ga0207668_10152121 3300025972 Bacteria 1792
493 Ga0207668_10295731 3300025972 Bacteria 1334
494 Ga0207640_10000528 3300025981 Bacteria 23035
495 Ga0207640_10003534 3300025981 Bacteria 8427
496 Ga0207640_10005323 3300025981 Bacteria 7011
497 Ga0207640_10112873 3300025981 Bacteria 1930
498 Ga0207640_10288203 3300025981 Bacteria 1293
499 Ga0207658_10000029 3300025986 Bacteria 171928
500 Ga0207658_10000483 3300025986 Bacteria 36812
501 Ga0207658_10007401 3300025986 Bacteria 7487
502 Ga0207658_10042988 3300025986 Bacteria 3282
503 Ga0207677_10018655 3300026023 Bacteria 4168
504 Ga0207703_10034718 3300026035 Bacteria 4003
505 Ga0207703_10053578 3300026035 Bacteria 3279
506 Ga0207703_10091895 3300026035 Bacteria 2553
507 Ga0207703_10193528 3300026035 Bacteria 1803
508 Ga0207703_10443578 3300026035 Bacteria 1211
509 Ga0207703_10626492 3300026035 Bacteria 1019
510 Ga0207639_10004462 3300026041 Bacteria 9444
511 Ga0207639_10016305 3300026041 Bacteria 5253
512 Ga0207639_10033141 3300026041 Bacteria 3808
513 Ga0207639_10131855 3300026041 Bacteria 2070
514 Ga0207678_10001079 3300026067 Bacteria 24988
515 Ga0207678_10011901 3300026067 Bacteria 7639
516 Ga0207678_10053597 3300026067 Bacteria 3476
517 Ga0207678_10119951 3300026067 Bacteria 2244
518 Ga0207678_10181409 3300026067 Bacteria 1798
519 Ga0207678_10231959 3300026067 Bacteria 1580
520 Ga0207702_10000462 3300026078 Bacteria 45995
521 Ga0207702_10004092 3300026078 Bacteria 13085
522 Ga0207702_10012057 3300026078 Bacteria 7188
523 Ga0207702_10639138 3300026078 Unclassified 1046
524 Ga0207702_10790935 3300026078 Bacteria 937
525 Ga0207641_10000033 3300026088 Bacteria 219261
526 Ga0207641_10000091 3300026088 Bacteria 127567
527 Ga0207641_10029637 3300026088 Bacteria 4526
528 Ga0207641_10042015 3300026088 Bacteria 3834
529 Ga0207641_10054884 3300026088 Bacteria 3383
530 Ga0207648_10193733 3300026089 Bacteria 1802
531 Ga0207648_10822316 3300026089 Bacteria 865
532 Ga0207676_10000361 3300026095 Bacteria 38795
533 Ga0207676_10001517 3300026095 Bacteria 17145
534 Ga0207676_10005644 3300026095 Bacteria 8856
535 Ga0207676_10554402 3300026095 Bacteria 1098
536 Ga0207674_10068165 3300026116 Bacteria 3580
537 Ga0207675_100000049 3300026118 Bacteria 84016
538 Ga0207675_100000171 3300026118 Bacteria 58198
539 Ga0207675_100002282 3300026118 Bacteria 19053
540 Ga0207675_100219984 3300026118 Bacteria 1829
541 Ga0207675_100910020 3300026118 Bacteria 896
542 Ga0207683_10000034 3300026121 Bacteria 101817
543 Ga0207683_10217210 3300026121 Bacteria 1741
544 Ga0207683_10353539 3300026121 Bacteria 1349
545 Ga0207698_10000111 3300026142 Bacteria 50675
546 Ga0207698_10040663 3300026142 Bacteria 3458
547 Ga0207698_10171424 3300026142 Bacteria 1911
548 Ga0207698_10204801 3300026142 Bacteria 1770
549 Ga0207698_10325073 3300026142 Bacteria 1442
550 Ga0210002_1007589 3300027617 Bacteria 1646
551 Ga0209983_1005123 3300027665 Bacteria 2727
552 Ga0209971_1025954 3300027682 Bacteria 1400
553 Ga0209971_1032075 3300027682 Bacteria 1261
554 Ga0209998_10013722 3300027717 Bacteria 1688
555 Ga0209813_10000093 3300027866 Bacteria 33306
556 Ga0209813_10026051 3300027866 Bacteria 1687
557 Ga0209813_10055552 3300027866 Bacteria 1251
558 Ga0207428_10000352 3300027907 Bacteria 59444
559 Ga0207428_10043348 3300027907 Bacteria 3634
560 Ga0268266_10000002 3300028379 Bacteria 3059047
561 Ga0268266_10000028 3300028379 Bacteria 425294
562 Ga0268266_10001236 3300028379 Bacteria 31292
563 Ga0268266_10092352 3300028379 Bacteria 2655
564 Ga0268266_10672226 3300028379 Bacteria 997
565 Ga0268265_10000071 3300028380 Bacteria 132890
566 Ga0268265_10005043 3300028380 Bacteria 9063
567 Ga0268265_10020624 3300028380 Bacteria 4602
568 Ga0268265_10087562 3300028380 Bacteria 2478
569 Ga0268265_10338297 3300028380 Bacteria 1369
570 Ga0268264_10000006 3300028381 Bacteria 827324
571 Ga0268264_10000010 3300028381 Bacteria 596543
572 Ga0268264_10007704 3300028381 Bacteria 8970
573 Ga0268264_10312620 3300028381 Bacteria 1483
574 Ga0265338_10058189 3300028800 Bacteria 3414
575 Ga0265332_10022881 3300031238 Bacteria 2757
576 Ga0265332_10183610 3300031238 Bacteria 871
577 Ga0265320_10041942 3300031240 Bacteria 2273
578 Ga0265325_10042221 3300031241 Bacteria 2386
579 Ga0265325_10052524 3300031241 Bacteria 2092
580 Ga0265340_10090458 3300031247 Bacteria 1431
581 Ga0265339_10000738 3300031249 Bacteria 25301
582 Ga0265327_10000070 3300031251 Bacteria 217350
583 Ga0307408_100016762 3300031548 Bacteria 4897
584 Ga0307408_100130639 3300031548 Bacteria 1959
585 Ga0307408_100166906 3300031548 Bacteria 1754
586 Ga0307408_100247061 3300031548 Bacteria 1469
587 Ga0265313_10000289 3300031595 Bacteria 55172
588 Ga0265313_10088903 3300031595 Bacteria 1390
589 Ga0265314_10010574 3300031711 Bacteria 7681
590 Ga0265314_10019267 3300031711 Bacteria 5289
591 Ga0265314_10065252 3300031711 Bacteria 2460
592 Ga0265342_10005212 3300031712 Bacteria 9983
593 Ga0265342_10035100 3300031712 Bacteria 3072
594 Ga0307405_10054239 3300031731 Bacteria 2502
595 Ga0307413_10020137 3300031824 Bacteria 3541
596 Ga0307413_10428091 3300031824 Bacteria 1044
597 Ga0307413_10611952 3300031824 Bacteria 893
598 Ga0307410_10069017 3300031852 Bacteria 2443
599 Ga0307406_10018849 3300031901 Bacteria 4040
600 Ga0307406_10379831 3300031901 Bacteria 1113
601 Ga0307407_10110630 3300031903 Bacteria 1723
602 Ga0307412_10084762 3300031911 Bacteria 2200
603 Ga0307412_10296412 3300031911 Bacteria 1276
604 Ga0307409_100341488 3300031995 Bacteria 1409
605 Ga0307414_10026491 3300032004 Bacteria 3732
606 Ga0307414_10076255 3300032004 Bacteria 2436
607 Ga0307414_10087398 3300032004 Bacteria 2303
608 Ga0307414_10114122 3300032004 Bacteria 2063
609 Ga0307414_10115211 3300032004 Bacteria 2055
610 Ga0307414_10184269 3300032004 Bacteria 1682
611 Ga0307414_10245628 3300032004 Bacteria 1484
612 Ga0307411_10011783 3300032005 Bacteria 4737
613 Ga0307411_10023317 3300032005 Bacteria 3663
614 Ga0307411_10087477 3300032005 Bacteria 2164
615 Ga0307411_10089216 3300032005 Bacteria 2147
616 Ga0307415_100090085 3300032126 Bacteria 2217
617 Ga0373948_0000052 3300034817 Bacteria 12263
618 Ga0373948_0051130 3300034817 Bacteria 888
619 Ga0373958_0010064 3300034819 Bacteria 1569
620 Ga0373958_0046507 3300034819 Bacteria 904
621 Ga0373959_0001596 3300034820 Bacteria 3608
622 Ga0373938_0000045 3300034957 Bacteria 16308
623 Ga0373928_0001393 3300035084 Bacteria 4715
624 Ga0373929_0010842 3300035085 Bacteria 1709
625 Ga0373934_0008195 3300035086 Bacteria 3891
626 Ga0373934_0026071 3300035086 Bacteria 2266
627 Ga0373940_0000833 3300035088 Bacteria 5141
628 Ga0373940_0005919 3300035088 Bacteria 2681
629 Ga0373944_0028916 3300035089 Bacteria 1653
630 Ga0373949_0001411 3300035090 Bacteria 6869
631 Ga0373951_0007829 3300035091 Bacteria 2423
632 Ga0373952_0007258 3300035092 Bacteria 2071
633 Ga0373923_0002261 3300035111 Bacteria 5867
634 Ga0373923_0002293 3300035111 Bacteria 5844
635 Ga0373923_0072969 3300035111 Bacteria 1477
636 Ga0373932_0001518 3300035112 Bacteria 6450
637 Ga0373936_0114336 3300035113 Bacteria 1148
638 Ga0373939_0007603 3300035114 Bacteria 2634
639 Ga0373939_0009750 3300035114 Bacteria 2387
640 Ga0373941_0002611 3300035115 Bacteria 3992
641 Ga0373945_0033685 3300035116 Bacteria 1822
642 Ga0373953_0011303 3300035117 Bacteria 3130
643 Ga0373953_0012460 3300035117 Bacteria 3012
644 Ga0373956_0008321 3300035119 Bacteria 4199
645 Ga0373960_0010573 3300035121 Bacteria 2257
646 Ga0373955_0002044 3300035172 Bacteria 8678
647 Ga0373942_0000535 3300035207 Bacteria 10652
648 Ga0373961_0001186 3300035241 Bacteria 8073
649 Ga0373962_0011088 3300035242 Bacteria 2254
650 Ga0373931_0016268 3300035691 Bacteria 3659
651 Ga0373935_0027001 3300035692 Bacteria 3548
652 Ga0373927_0022190 3300035695 Bacteria 4158
653 Ga0373927_0063848 3300035695 Bacteria 2382
654 Ga0373933_0001999 3300035724 Bacteria 11767
655 Ga0373933_0104908 3300035724 Bacteria 1757
656 Ga0373937_0054341 3300036401 Bacteria 3674
657 Ga0316584_0146371 3300036712 Bacteria 1760
658 Ga0373925_0014166 3300037068 Bacteria 5771
659 Ga0373925_0016337 3300037068 Bacteria 5374
660 Ga0373925_0209985 3300037068 Bacteria 1551
661 Ga0395899_0061303 3300037312 Bacteria 2770
662 Ga0395900_0018921 3300037418 Bacteria 7024
663 Ga0395905_0239027 3300037471 Bacteria 1698
664 Ga0436364_0022476 3300037853 Bacteria 20187
665 Ga0395901_0056281 3300038443 Bacteria 4090
666 Ga0395901_0185877 3300038443 Bacteria 2179
667 Ga0436365_1035422 3300039437 Bacteria 3210
668 Ga0436361_0255533 3300039447 Bacteria 1066
669 Ga0439465_0024236 3300041413 Bacteria 1912
670 Ga0439441_050454 3300042001 Bacteria 856
671 Ga0439450_002651 3300042008 Bacteria 2845
672 Ga0439455_0012977 3300042012 Bacteria 1879
673 Ga0439455_0017001 3300042012 Bacteria 1689
674 Ga0439463_036780 3300042016 Bacteria 1241
675 Ga0450912_002252 3300042116 Bacteria 1280
676 Ga0439460_0004647 3300042461 Bacteria 3351
677 Ga0451577_0206917 3300042876 Bacteria 1772
678 Ga0451577_0567654 3300042876 Bacteria 1030
679 Ga0453683_0123584 3300044673 Bacteria 1629
680 Ga0466966_0310166 3300044684 Bacteria 948
681 Ga0466963_0006521 3300044694 Bacteria 6912
682 Ga0453684_0060916 3300044712 Bacteria 4848
683 Ga0453684_0078082 3300044712 Bacteria 4145
684 Ga0453684_0100255 3300044712 Bacteria 3545
685 Ga0453684_1126690 3300044712 Bacteria 828
686 Ga0466971_0002216 3300044719 Bacteria 8219
687 Ga0451576_0000236 3300045051 Bacteria 135064
688 Ga0451576_0004698 3300045051 Bacteria 17570
689 Ga0451576_0482934 3300045051 Bacteria 1301
690 Ga0466958_0010866 3300045836 Bacteria 5112
691 Ga0466958_0014106 3300045836 Bacteria 4559
692 Ga0466967_0073411 3300045976 Bacteria 3069
693 Ga0466967_0680529 3300045976 Bacteria 1018
694 Ga0495592_0005711 3300046454 Bacteria 9205
695 Ga0495603_0075958 3300046455 Bacteria 1972
696 Ga0495603_0182027 3300046455 Bacteria 1216
697 Ga0495629_0014627 3300046459 Bacteria 5646
698 Ga0495629_0098558 3300046459 Bacteria 2039
699 Ga0495629_0113466 3300046459 Bacteria 1889
700 Ga0495638_0003712 3300046460 Bacteria 11885
701 Ga0495651_0009193 3300046462 Bacteria 7588
702 Ga0495653_0019489 3300046463 Bacteria 5501
703 Ga0495650_0011072 3300046471 Bacteria 4976
704 Ga0495580_0001981 3300046472 Bacteria 18011
705 Ga0495639_0005755 3300046475 Bacteria 5333
706 Ga0495639_0260388 3300046475 Bacteria 859
707 Ga0495662_0058209 3300046476 Bacteria 1867
708 Ga0495664_0164850 3300046477 Bacteria 1344
709 Ga0495584_0052635 3300046491 Bacteria 2049
710 Ga0495606_0005777 3300046507 Bacteria 11699
711 Ga0495608_0005680 3300046511 Bacteria 8906
712 Ga0495616_0000022 3300046513 Bacteria 149720
713 Ga0495618_0018445 3300046514 Bacteria 4284
714 Ga0495618_0041270 3300046514 Bacteria 2906
715 Ga0495620_0140909 3300046515 Bacteria 943
716 Ga0495628_0003465 3300046516 Bacteria 14119
717 Ga0495628_0050658 3300046516 Bacteria 3284
718 Ga0495630_0033645 3300046517 Bacteria 3823
719 Ga0495632_0000007 3300046519 Bacteria 343246
720 Ga0495637_0001086 3300046520 Bacteria 16822
721 Ga0495643_0000304 3300046522 Bacteria 68483
722 Ga0495643_0001459 3300046522 Bacteria 21686
723 Ga0495648_0002812 3300046524 Bacteria 15664
724 Ga0495663_0000005 3300046525 Bacteria 342265
725 Ga0495666_0099155 3300046526 Bacteria 1373
726 Ga0495642_0015827 3300046528 Bacteria 2936
727 Ga0495652_0026176 3300046529 Bacteria 5155
728 Ga0495652_0193035 3300046529 Bacteria 1552
729 Ga0495665_0083094 3300046531 Bacteria 1684
730 Ga0495640_0007536 3300046533 Bacteria 8553
731 Ga0495640_0056516 3300046533 Bacteria 2681
732 Ga0495587_0020315 3300046536 Bacteria 4100
733 Ga0495598_0009383 3300046537 Bacteria 2311
734 Ga0495645_0019080 3300046543 Bacteria 4936
735 Ga0495622_0012188 3300046557 Bacteria 3977
736 Ga0495622_0019673 3300046557 Bacteria 3143
737 Ga0495622_0071170 3300046557 Bacteria 1605
738 Ga0495633_0000447 3300046558 Bacteria 42625
739 Ga0495656_0056008 3300046615 Bacteria 1702
740 Ga0495668_0010481 3300046616 Bacteria 5607
741 Ga0495668_0215652 3300046616 Bacteria 1051
742 Ga0495634_0123737 3300046642 Bacteria 1654
743 Ga0495635_0001868 3300046663 Bacteria 14260
744 Ga0495635_0057776 3300046663 Bacteria 2669
745 Ga0495657_0007182 3300046675 Bacteria 8638
746 Ga0495599_0037684 3300046678 Bacteria 3037
747 Ga0495646_0028295 3300046680 Bacteria 3511
748 Ga0495646_0064240 3300046680 Bacteria 2176
749 Ga0495658_0047772 3300046683 Bacteria 2411
750 Ga0495669_0003985 3300046684 Bacteria 6076
751 Ga0495624_0048211 3300046690 Bacteria 2704
752 Ga0495670_0000007 3300046691 Bacteria 247088
753 Ga0495671_0000126 3300046692 Bacteria 68483
754 Ga0495671_0204980 3300046692 Bacteria 956
755 Ga0495600_0015222 3300046809 Bacteria 4859
756 Ga0495600_0220599 3300046809 Bacteria 1213
757 Ga0495581_0027850 3300047315 Bacteria 3277
758 Ga0495604_0006243 3300047317 Bacteria 9452
759 Ga0495674_0104129 3300047319 Bacteria 2412
760 Ga0495672_0197793 3300047320 Bacteria 1007
761 Ga0495676_0116086 3300047321 Bacteria 1956
762 Ga0495680_0011034 3300047322 Bacteria 8028
763 Ga0495687_000211 3300047443 Bacteria 83788
764 Ga0495675_0005364 3300047444 Bacteria 7811
765 Ga0495677_0000664 3300047445 Bacteria 13906
766 Ga0495681_0007530 3300047470 Bacteria 6938
767 Ga0495684_0004347 3300047471 Bacteria 11073
768 Ga0495686_0001143 3300047472 Bacteria 31211
769 Ga0495686_0022098 3300047472 Bacteria 4212
770 Ga0495686_0025654 3300047472 Bacteria 3863
771 Ga0495593_0011080 3300047673 Bacteria 5188
772 Ga0495602_0120977 3300048088 Bacteria 2106
773 Ga0496100_0036658 3300048903 Bacteria 3095
774 Ga0496100_0204664 3300048903 Bacteria 1440
775 Ga0496100_0362410 3300048903 Bacteria 1097
776 Ga0496101_0000756 3300048904 Bacteria 19156
777 Ga0496101_0042688 3300048904 Bacteria 3238
778 Ga0496101_0124348 3300048904 Bacteria 1953
779 Ga0496102_0018645 3300048905 Bacteria 6102
780 Ga0496102_0044075 3300048905 Bacteria 4047
781 Ga0496103_0000372 3300048906 Bacteria 40272
782 Ga0496103_0013313 3300048906 Bacteria 4874
783 Ga0496104_0084318 3300048907 Bacteria 3032
784 Ga0496104_0111744 3300048907 Bacteria 2620
785 Ga0496104_0117617 3300048907 Bacteria 2551
786 Ga0496104_0132698 3300048907 Bacteria 2392
787 Ga0496105_0357719 3300048908 Bacteria 1165
788 Ga0496105_0456285 3300048908 Bacteria 1008
789 Ga0496106_0000338 3300048909 Bacteria 32910
790 Ga0496106_0004105 3300048909 Bacteria 10848
791 Ga0496106_0012705 3300048909 Bacteria 6221
792 Ga0496106_0145873 3300048909 Bacteria 1864
793 Ga0496106_0186884 3300048909 Bacteria 1646
794 Ga0496107_0002397 3300048910 Bacteria 12134
795 Ga0496107_0065004 3300048910 Bacteria 2644
796 Ga0496107_0193435 3300048910 Bacteria 1512
797 Ga0496108_0002029 3300048911 Bacteria 16208
798 Ga0496108_0012372 3300048911 Bacteria 6944
799 Ga0496108_0017759 3300048911 Bacteria 5818
800 Ga0496108_0158344 3300048911 Bacteria 1956
801 Ga0496109_0000736 3300048912 Bacteria 27218
802 Ga0496110_0155586 3300048913 Bacteria 2071
803 Ga0496110_0243937 3300048913 Bacteria 1635
804 Ga0496111_0005543 3300048914 Bacteria 8109
805 Ga0496111_0008071 3300048914 Bacteria 6952
806 Ga0496111_0714579 3300048914 Bacteria 728
807 Ga0496112_0005715 3300048915 Bacteria 10806
808 Ga0496112_0061469 3300048915 Bacteria 3703
809 Ga0496112_0070393 3300048915 Bacteria 3457
810 Ga0496112_0326911 3300048915 Bacteria 1477
811 Ga0496112_0550452 3300048915 Bacteria 1088
812 Ga0496113_0000137 3300048916 Bacteria 31613
813 Ga0496113_0023006 3300048916 Bacteria 4415
814 Ga0496113_0336613 3300048916 Bacteria 1210
815 Ga0496114_0030111 3300048917 Bacteria 4464
816 Ga0496115_0001071 3300048918 Bacteria 19818
817 Ga0496115_0193755 3300048918 Bacteria 1679
818 Ga0496116_0001243 3300048919 Bacteria 29596
819 Ga0496116_0042404 3300048919 Bacteria 3111
820 Ga0496117_0002288 3300048920 Bacteria 24709
821 Ga0496117_0003419 3300048920 Bacteria 18462
822 Ga0496117_0007148 3300048920 Bacteria 11029
823 Ga0496118_0000097 3300048921 Bacteria 160837
824 Ga0496118_0019050 3300048921 Bacteria 6152
825 Ga0496118_0029290 3300048921 Bacteria 4621
826 Ga0496118_0038849 3300048921 Bacteria 3808
827 Ga0496119_0083693 3300048922 Bacteria 1831
828 Ga0496119_0099488 3300048922 Bacteria 1635
829 Ga0496121_0000529 3300048924 Bacteria 72533
830 Ga0496121_0000654 3300048924 Bacteria 64945
831 Ga0496121_0000731 3300048924 Bacteria 60609
832 Ga0496121_0001257 3300048924 Bacteria 43906
833 Ga0496121_0104514 3300048924 Bacteria 2176
834 Ga0496122_0001187 3300048925 Bacteria 44594
835 Ga0496122_0228637 3300048925 Bacteria 1060
836 Ga0496123_0002266 3300048926 Bacteria 24245
837 Ga0496124_0001077 3300048927 Bacteria 43137
838 Ga0496124_0003799 3300048927 Bacteria 18136
839 Ga0496124_0194639 3300048927 Bacteria 1548
840 Ga0496125_0011588 3300048928 Bacteria 8808
841 Ga0496125_0140350 3300048928 Bacteria 1681
842 Ga0496125_0211726 3300048928 Bacteria 1258
843 Ga0496125_0243441 3300048928 Bacteria 1140
844 Ga0496126_0003267 3300048929 Bacteria 20694
845 Ga0496126_0005782 3300048929 Bacteria 13983
846 Ga0496126_0014598 3300048929 Bacteria 7933
847 Ga0496126_0021647 3300048929 Bacteria 6276
848 Ga0496126_0044085 3300048929 Bacteria 4111
849 Ga0496126_0136412 3300048929 Bacteria 2116
850 Ga0496126_0227841 3300048929 Bacteria 1562
851 Ga0501032_0091848 3300049569 Bacteria 2013
852 Ga0501032_0313568 3300049569 Bacteria 1013
853 Ga0501033_0013961 3300049570 Bacteria 6109
854 Ga0501033_0020668 3300049570 Bacteria 4974
855 Ga0501033_0103135 3300049570 Bacteria 2080
856 Ga0501033_0413781 3300049570 Bacteria 939
857 Ga0501034_0017600 3300049571 Bacteria 7327
858 Ga0501034_0025723 3300049571 Bacteria 5994
859 Ga0501034_0052853 3300049571 Bacteria 4092
860 Ga0501034_0056536 3300049571 Bacteria 3948
861 Ga0501034_0364325 3300049571 Bacteria 1372
862 Ga0501036_0032297 3300049572 Bacteria 4423
863 Ga0501036_0078188 3300049572 Bacteria 2798
864 Ga0501037_0018892 3300049573 Bacteria 5080
865 Ga0501037_0199755 3300049573 Bacteria 1413
866 Ga0501037_0226240 3300049573 Bacteria 1314
867 Ga0501038_0113484 3300049574 Bacteria 2242
868 Ga0501038_0667850 3300049574 Bacteria 781
869 Ga0501039_0249734 3300049575 Bacteria 1395
870 Ga0501043_0006400 3300049579 Bacteria 9461
871 Ga0501043_0018572 3300049579 Bacteria 5455
872 Ga0501043_0041490 3300049579 Bacteria 3615
873 Ga0501043_0286331 3300049579 Bacteria 1262
874 Ga0501046_0038152 3300049580 Bacteria 3858
875 Ga0501047_0011978 3300049581 Bacteria 8207
876 Ga0501047_0062952 3300049581 Bacteria 3578
877 Ga0501047_0110422 3300049581 Bacteria 2632
878 Ga0501048_0086363 3300049582 Bacteria 2213
879 Ga0501048_0191134 3300049582 Bacteria 1451
880 Ga0501067_0122896 3300049583 Bacteria 1445
881 Ga0501070_0134484 3300049586 Bacteria 2042
882 Ga0501073_0226949 3300049589 Bacteria 1290
883 Ga0501074_0040096 3300049590 Bacteria 3392
884 Ga0501075_0288530 3300049591 Bacteria 1250
885 Ga0501076_0212167 3300049592 Bacteria 1582
886 Ga0501077_0012101 3300049593 Bacteria 5402
887 Ga0501223_000495 3300049663 Bacteria 9553
888 Ga0501224_000006 3300049664 Bacteria 149611
889 Ga0501233_000165 3300049668 Bacteria 9518
890 Ga0501235_002887 3300049669 Bacteria 3702
891 Ga0501243_054949 3300049675 Bacteria 726
892 Ga0501225_0000845 3300049705 Bacteria 9521
893 Ga0501234_002685 3300049707 Bacteria 2799
894 Ga0501079_0069571 3300049741 Bacteria 2717
895 Ga0501080_0105755 3300049742 Bacteria 2609
896 Ga0501035_0153442 3300049822 Bacteria 1997
897 Ga0501044_0015307 3300049823 Bacteria 8261
898 Ga0501044_0066736 3300049823 Bacteria 3667
899 Ga0501044_0165712 3300049823 Bacteria 2184
900 Ga0501044_0291934 3300049823 Bacteria 1562
901 Ga0501044_0529132 3300049823 Bacteria 1078
902 Ga0501226_000208 3300049853 Bacteria 9283
903 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
904 nmdc:mga03n38_4148_c1 3300050490 Bacteria 4759
905 nmdc:mga00v17_82616_c1 3300050491 Bacteria 2008
906 nmdc:mga0yw44_272609_c1 3300050492 Bacteria 1130
907 nmdc:mga0yw44_317992_c1 3300050492 Bacteria 1045
908 nmdc:mga0yw44_48932_c1 3300050492 Bacteria 2550
909 nmdc:mga0yw44_63369_c1 3300050492 Bacteria 2273
910 nmdc:mga0k408_20_c1 3300050493 Bacteria 109563
911 nmdc:mga06z11_124663_c1 3300050494 Bacteria 1440
912 nmdc:mga06z11_134335_c1 3300050494 Bacteria 1392
913 nmdc:mga06z11_14854_c1 3300050494 Bacteria 3460
914 nmdc:mga06z11_168_c1 3300050494 Bacteria 25790
915 nmdc:mga06z11_35705_c1 3300050494 Bacteria 2449
916 nmdc:mga06z11_79591_c1 3300050494 Bacteria 1755
917 nmdc:mga04h51_196_c1 3300050495 Bacteria 16597
918 nmdc:mga04h51_32232_c1 3300050495 Bacteria 1661
919 nmdc:mga04h51_72287_c1 3300050495 Bacteria 1207
920 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
921 nmdc:mga07m45_22684_c1 3300050496 Bacteria 3429
922 nmdc:mga07m45_89838_c1 3300050496 Bacteria 1759
923 nmdc:mga05p37_396674_c1 3300050507 Bacteria 1612
924 nmdc:mga09592_176207_c1 3300050508 Bacteria 1849
925 nmdc:mga09592_203413_c1 3300050508 Bacteria 1715
926 nmdc:mga0qj67_1526_c1 3300050509 Bacteria 16241
927 nmdc:mga0qj67_50274_c1 3300050509 Bacteria 3296
928 nmdc:mga06r32_157408_c1 3300050510 Bacteria 2253
929 nmdc:mga06r32_24040_c1 3300050510 Bacteria 5649
930 nmdc:mga08y16_100280_c1 3300050511 Bacteria 3015
931 nmdc:mga0n895_129838_c1 3300050512 Bacteria 2545
932 nmdc:mga0n895_349680_c1 3300050512 Bacteria 1497
933 nmdc:mga0n895_660169_c1 3300050512 Bacteria 1044
934 nmdc:mga0rr50_458226_c1 3300050513 Bacteria 1081
935 nmdc:mga0rr50_71161_c1 3300050513 Bacteria 2653
936 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
937 nmdc:mga0a205_14874_c2 3300050515 Bacteria 2546
938 nmdc:mga0a205_251821_c1 3300050515 Bacteria 1645
939 nmdc:mga0sz30_14764_c1 3300050516 Bacteria 3080
940 Ga0495595_0001147 3300053084 Bacteria 10254
941 Ga0495619_0011284 3300053085 Bacteria 5621
942 Ga0495619_0244115 3300053085 Bacteria 1244
943 Ga0500643_000291 3300053087 Bacteria 43108
944 Ga0500643_002128 3300053087 Bacteria 10497
945 Ga0500643_009923 3300053087 Bacteria 3592
946 Ga0500647_0166671 3300053091 Bacteria 1019
947 Ga0500562_004655 3300053108 Bacteria 3462
948 Ga0500562_041023 3300053108 Bacteria 1230
949 Ga0500592_000729 3300053116 Bacteria 5391
950 Ga0500595_002941 3300053119 Bacteria 8136
951 Ga0500618_000868 3300053125 Bacteria 16150
952 Ga0500559_0085179 3300053136 Bacteria 1441
953 Ga0500573_0000022 3300053140 Bacteria 154562
954 Ga0500604_0002419 3300053151 Bacteria 5091
955 Ga0500616_0007800 3300053153 Bacteria 6750
956 Ga0500624_000012 3300053157 Bacteria 165895
957 Ga0500624_000088 3300053157 Bacteria 47211
958 Ga0500627_0002242 3300053158 Bacteria 5669
959 Ga0500638_045361 3300053162 Bacteria 2133
960 Ga0500639_111532 3300053163 Bacteria 1330
961 Ga0500611_043820 3300053727 Bacteria 995
962 Ga0500645_002393 3300053730 Bacteria 8422
963 Ga0500645_037526 3300053730 Bacteria 1438
964 Ga0501084_0460012 3300054114 Bacteria 1076
965 Ga0500661_001460 3300055283 Bacteria 4434
966 Ga0466962_0009919 3300061719 Bacteria 4569
967 2511391809 2511231027 Bacteria 5013807
968 2513888610 2513237141 Bacteria 8496279
969 2514419528 2513237305 Bacteria 7293571
970 2528853350 2528768022 Bacteria 10457665
971 2723573441 2721755686 Bacteria 7343952
972 2765465702 2765235802 Bacteria 5618596
973 2776269595 2775506902 Bacteria 6208009
974 2776282526 2775506904 Bacteria 5954060
975 2793078341
976 2793281020 2791355253 Bacteria 5171699
977 2809064962 2808606401 Bacteria 4586670
978 2809080872 2808606404 Bacteria 4652788
979 2809085294 2808606405 Bacteria 4586632
980 2830076567 2830075706 Bacteria 3855215
981 2839993345 2839993093 Bacteria 5512535
982 2840766346 2840764183 Bacteria 6358399
983 2842779080 2842775625 Bacteria 5587290
984 2842873962 2842871566 Bacteria 4827117
985 2856327191 2856320880 Bacteria 7263508
986 2856356932 2856356410 Bacteria 6297484
987 2869279578 2869278585 Bacteria 7077053
988 2871494937 2871488783 Bacteria 6929816
989 2871500127 2871495908 Bacteria 6935695
990 2874607919 2874604998 Bacteria 7834745
991 2878742105 2878738818 Bacteria 7136951
992 2878760063 2878753008 Bacteria 6922523
993 2878764249 2878760144 Bacteria 6823465
994 2878771319 2878767105 Bacteria 6898628
995 2880522028 2880518877 Bacteria 5012590
996 2881851333 2881845957 Bacteria 6611900
997 2881864770 2881861095 Bacteria 7128710
998 2882916767 2882912400 Bacteria 6801539
999 2885323333 2885318864 Bacteria 6729568
1000 2885418604 2885409591 Bacteria 9235467
1001 2889035336 2889033259 Bacteria 9099371
1002 2894653784 2894652903 Bacteria 4587256
1003 2903494296 2903492973 Bacteria 13473544
1004 2903544942 2903540706 Bacteria 7062119
1005 2924726138 2924718760 Bacteria 6331356
1006 2924779789 2924776078 Bacteria 7492003
1007 2924790869 2924784321 Bacteria 7416538
1008 2928522803 2928521798 Bacteria 4960112
1009 2932790931 2932784394 Bacteria 9704911
1010 2932833647 2932828146 Bacteria 9745859
1011 2935623173 2935616580 Bacteria 9032984
1012 2935644248 2935638405 Bacteria 10015038
1013 2935672170 2935665750 Bacteria 9571747
1014 2935710281 2935703347 Bacteria 10242284
1015 2935808272 2935801545 Bacteria 9301974
1016 2935833508 2935827899 Bacteria 10038562
1017 2935844461 2935837841 Bacteria 9454360
1018 2935861421 2935855204 Bacteria 9035059
1019 2935869540 2935864058 Bacteria 9784707
1020 2935879869 2935873716 Bacteria 9632195
1021 2935966753 2935959822 Bacteria 7869783
1022 2935997908 2935992306 Bacteria 9802711
1023 2936008827 2936002035 Bacteria 9362176
1024 2937881717 2937877337 Bacteria 7246526
1025 2937974253 2937972304 Bacteria 7532020
1026 2937998787 2937994558 Bacteria 7036190
1027 2941543366 2941538514 Bacteria 9402094
1028 2946787947 2946787523 Bacteria 4366789
1029 2954013831 2954011201 Bacteria 4762601
1030 2958035156 2958034702 Bacteria 6989922
1031 2958044188 2958041894 Bacteria 13082850
1032 2958088805 2958084443 Bacteria 7312792
1033 2958092651 2958092219 Bacteria 6861151
1034 2958169262 2958165035 Bacteria 6906348
1035 2961133824 2961127735 Bacteria 7196641
1036 2961167724 2961163497 Bacteria 6901077
1037 2961177333 2961170736 Bacteria 7072258
1038 2965022543 2965018300 Bacteria 6883036
1039 2968002436 2967996073 Bacteria 6787468
1040 2968009667 2968003550 Bacteria 6929263
1041 2968023576 2968016561 Bacteria 7022047
1042 2968176125 2968171901 Bacteria 6894245
1043 2970476158 2970469710 Bacteria 6969209
1044 2970510007 2970503327 Bacteria 7099517
1045 2970559093 2970554993 Bacteria 6814252
1046 2970594178 2970593180 Bacteria 7073582
1047 2977828585 2977821940 Bacteria 6906439
1048 2979814883 2979808191 Bacteria 7179355
1049 2987663731 2987659509 Bacteria 6966464
1050 2996354741 2996348954 Bacteria 7239054
1051 3004192788 3004188549 Bacteria 6952365
1052 3004281389 3004275668 Bacteria 7114440
1053 3004336886 3004334049 Bacteria 8449246
1054 8004381562 8004374579 Bacteria 6898112
1055 8006967604 8006964411 Bacteria 8966052
1056 8007000403 8006994254 Bacteria 8309700
1057 8016518030 8016511872 Bacteria 9921665
1058 8017058615 8017057580 Bacteria 10023680
1059 8019577044 8019576017 Bacteria 10049540
1060 8019595110 8019586578 Bacteria 10212056
1061 8019606629 8019597564 Bacteria 10041141
1062 8045867200 8045864390 Bacteria 5043873
1063 Ga0075370_10000005
1064 SwRhRL2b_contig_1994602
1065 SwRhRL2b_contig_3660127
1066 2214756328
1067 ARcpr5oldR_c000007
1068 ARSoilYngRDRAFT_c00111
1069 ARSoilYngRDRAFT_c00874
1070 ARcpr5yngRDRAFT_c000269
1071 ARSoilOldRDRAFT_c000004
1072 ARCol0oldRDRAFT_c00252
1073 ARCol0yngRDRAFT_1000074
1074 JGI24736J21556_1000017
1075 JGI24752J21851_1000051
1076 JGI24752J21851_1001794
1077 JGI24752J21851_1012592
1078 JGI24746J21847_1002919
1079 JGI24747J21853_1000683
1080 JGI24740J21852_10024052
1081 JGI24740J21852_10025155
1082 JGI24739J22299_10000119
1083 JGI24737J22298_10000258
1084 JGI24737J22298_10001992
1085 JGI24737J22298_10012325
1086 JGI24735J21928_10017458
1087 JGI24750J21931_1000266
1088 JGI24750J21931_1000890
1089 JGI24750J21931_1017396
1090 JGI24745J21846_1000139
1091 JGI24748J21848_1000015
1092 JGI24748J21848_1000484
1093 JGI24738J21930_10006607
1094 JGI24738J21930_10015721
1095 JGI24749J21850_1003669
1096 JGI24744J21845_10008736
1097 JGI24744J21845_10011748
1098 JGI24033J26618_1000347
1099 JGI24034J26672_10000006
1100 JGI24034J26672_10001007
1101 JGI24742J22300_10000480
1102 JGI24751J29686_10005558
1103 JGI25406J46586_10000915
1104 JGI25160J50197_1007763
1105 JGI25404J52841_10026566
1106 JGI25404J52841_10036488
1107 JGI25404J52841_10039946
1108 Ga0055529_1000016
1109 Ga0055529_1007318
1110 Ga0055524_1046309
1111 Ga0055531_10000601
1112 Ga0065704_10000222
1113 Ga0065704_10001918
1114 Ga0065704_10129918
1115 Ga0065712_10019168
1116 Ga0065715_10119375
1117 Ga0065707_10081865
1118 Ga0070658_10000124
1119 Ga0070658_10062550
1120 Ga0070658_10091330
1121 Ga0070658_10301462
1122 Ga0070676_10092899
1123 Ga0070690_100000074
1124 Ga0070690_100136324
1125 Ga0070690_100176293
1126 Ga0070670_100002160
1127 Ga0070670_100036719
1128 Ga0070670_100451406
1129 Ga0070677_10000023
1130 Ga0068869_100000153
1131 Ga0070666_10000014
1132 Ga0070666_10000352
1133 Ga0070666_10015196
1134 Ga0070680_100000814
1135 Ga0070680_100082098
1136 Ga0070680_100641544
1137 Ga0070682_100000445
1138 Ga0070682_100160407
1139 Ga0068868_100008401
1140 Ga0068868_100169974
1141 Ga0068868_100483920
1142 Ga0070660_100045038
1143 Ga0070660_100108994
1144 Ga0070660_100445627
1145 Ga0070689_100176740
1146 Ga0070689_100390930
1147 Ga0070691_10000320
1148 Ga0070691_10071651
1149 Ga0070687_100000187
1150 Ga0070661_100001011
1151 Ga0070661_100005469
1152 Ga0070661_100050367
1153 Ga0070661_100119189
1154 Ga0070692_10004168
1155 Ga0070692_10006165
1156 Ga0070668_100000012
1157 Ga0070668_100040858
1158 Ga0070668_100049907
1159 Ga0070668_100065214
1160 Ga0070668_100096685
1161 Ga0070668_100210491
1162 Ga0070669_100000018
1163 Ga0070669_100000433
1164 Ga0070669_100001247
1165 Ga0070669_100054572
1166 Ga0070675_100001136
1167 Ga0070671_100000011
1168 Ga0070671_100002139
1169 Ga0070671_100006311
1170 Ga0070671_100061520
1171 Ga0070674_100016869
1172 Ga0070674_100405952
1173 Ga0070673_100000278
1174 Ga0070688_100002853
1175 Ga0070688_100007418
1176 Ga0070659_100349820
1177 Ga0070659_100427744
1178 Ga0070667_100000038
1179 Ga0070667_100003737
1180 Ga0070667_100048891
1181 Ga0070667_100148343
1182 Ga0070703_10056199
1183 Ga0070714_100306938
1184 Ga0070714_100777022
1185 Ga0070713_100014423
1186 Ga0070711_100380826
1187 Ga0070705_100133334
1188 Ga0070705_100357931
1189 Ga0070708_100018176
1190 Ga0070663_100006501
1191 Ga0070663_100016582
1192 Ga0070663_100021962
1193 Ga0070663_100084217
1194 Ga0070663_100128393
1195 Ga0070663_100179229
1196 Ga0070663_100383324
1197 Ga0070678_100000438
1198 Ga0070678_100128549
1199 Ga0070662_100228880
1200 Ga0070681_10028258
1201 Ga0070681_10038126
1202 Ga0070681_10456598
1203 Ga0068867_100013504
1204 Ga0070685_10000341
1205 Ga0070685_10005396
1206 Ga0070706_100166737
1207 Ga0070698_100124081
1208 Ga0070698_100297537
1209 Ga0070699_100193414
1210 Ga0070679_100002503
1211 Ga0070679_100326532
1212 Ga0070679_100330593
1213 Ga0070684_100000101
1214 Ga0070684_100010867
1215 Ga0070684_100023917
1216 Ga0070684_100506831
1217 Ga0070697_100000401
1218 Ga0070697_100340132
1219 Ga0068853_100002669
1220 Ga0068853_100016584
1221 Ga0068853_100019771
1222 Ga0068853_100364045
1223 Ga0068853_100382508
1224 Ga0070672_100080066
1225 Ga0070686_100000002
1226 Ga0070686_100004826
1227 Ga0070686_100078864
1228 Ga0070686_100135597
1229 Ga0070695_100789552
1230 Ga0070665_100000025
1231 Ga0070665_100019468
1232 Ga0070665_100029346
1233 Ga0070704_100010927
1234 Ga0070704_100365641
1235 Ga0068855_100018656
1236 Ga0068855_100045413
1237 Ga0068855_100056760
1238 Ga0070664_100019815
1239 Ga0070664_100072795
1240 Ga0068854_100000794
1241 Ga0068854_100002938
1242 Ga0068856_100032338
1243 Ga0068856_100049538
1244 Ga0068856_100290338
1245 Ga0068856_100331881
1246 Ga0068856_100517414
1247 Ga0068856_100823727
1248 Ga0070702_100004251
1249 Ga0068852_100007512
1250 Ga0068852_100032633
1251 Ga0068852_100723129
1252 Ga0068852_100737951
1253 Ga0068859_100002363
1254 Ga0068859_100010182
1255 Ga0068859_100032092
1256 Ga0068864_100000715
1257 Ga0068864_100026310
1258 Ga0068864_100046445
1259 Ga0068864_100051917
1260 Ga0068864_100111673
1261 Ga0068866_10158245
1262 Ga0068861_100000175
1263 Ga0068861_100126335
1264 Ga0068861_100263130
1265 Ga0068851_10005837
1266 Ga0068851_10057583
1267 Ga0068851_10064527
1268 Ga0068870_10003459
1269 Ga0068863_100000201
1270 Ga0068863_100000541
1271 Ga0068863_100034724
1272 Ga0068863_100115791
1273 Ga0068863_100120089
1274 Ga0068858_100008092
1275 Ga0068858_100016054
1276 Ga0068858_100023961
1277 Ga0068858_100141393
1278 Ga0068860_100000001
1279 Ga0068860_100000477
1280 Ga0068860_100021808
1281 Ga0068860_100177528
1282 Ga0068860_100319042
1283 Ga0068862_100000048
1284 Ga0068862_100005633
1285 Ga0068862_100007404
1286 Ga0068862_100031542
1287 Ga0068862_100106691
1288 Ga0068862_100234647
1289 Ga0081455_10000002
1290 Ga0081455_10109709
1291 Ga0081455_10257431
1292 Ga0081455_10341680
1293 Ga0081540_1032403
1294 Ga0081540_1034949
1295 Ga0081540_1051490
1296 Ga0081540_1095964
1297 Ga0081539_10000371
1298 Ga0070717_10010474
1299 Ga0070717_10031009
1300 Ga0075365_10030971
1301 Ga0075365_10325455
1302 Ga0075365_10502262
1303 Ga0075368_10034407
1304 Ga0075368_10057572
1305 Ga0075363_100010816
1306 Ga0075363_100037033
1307 Ga0075364_10080138
1308 Ga0075364_10272336
1309 Ga0075364_10389626
1310 Ga0075432_10002238
1311 Ga0075432_10070611
1312 Ga0075362_10000006
1313 Ga0075367_10001412
1314 Ga0075367_10028134
1315 Ga0075367_10082573
1316 Ga0075367_10083539
1317 Ga0075367_10137191
1318 Ga0075367_10190837
1319 Ga0075369_10015094
1320 Ga0075366_10000394
1321 Ga0097621_100002611
1322 Ga0075370_10022271
1323 Ga0075370_10042810
1324 Ga0075370_10099883
1325 Ga0075370_10174685
1326 Ga0075370_10227402
1327 Ga0068871_100000012
1328 Ga0068871_100167892
1329 Ga0075430_100001004
1330 Ga0075431_100007962
1331 Ga0075433_10102994
1332 Ga0075434_100050796
1333 Ga0075434_100455490
1334 Ga0075434_100464037
1335 Ga0075429_100310296
1336 Ga0068865_100000328
1337 Ga0075436_100000298
1338 Ga0097620_100002363
1339 Ga0097620_100010182
1340 Ga0097620_100032090
1341 Ga0105251_10006570
1342 Ga0105251_10025689
1343 Ga0105251_10049297
1344 Ga0105251_10088189
1345 Ga0105250_10043634
1346 Ga0105250_10095270
1347 Ga0105240_10008624
1348 Ga0105240_10220276
1349 Ga0105240_10487760
1350 Ga0105240_10645185
1351 Ga0111539_10345068
1352 Ga0111539_10451107
1353 Ga0111539_11342813
1354 Ga0105245_10000460
1355 Ga0105245_10791767
1356 Ga0105247_10000881
1357 Ga0105247_10028195
1358 Ga0105247_10033046
1359 Ga0105247_10038149
1360 Ga0105247_10316585
1361 Ga0105247_10573158
1362 Ga0114129_10575284
1363 Ga0105243_10001028
1364 Ga0105243_10189574
1365 Ga0105241_10002719
1366 Ga0105241_10059091
1367 Ga0105241_10093049
1368 Ga0105242_10000607
1369 Ga0105242_10275996
1370 Ga0105248_10000309
1371 Ga0105248_10223856
1372 Ga0105237_10010578
1373 Ga0105237_10099411
1374 Ga0105237_10372587
1375 Ga0105237_10438871
1376 Ga0105237_10497644
1377 Ga0105238_10118328
1378 Ga0105238_10310408
1379 Ga0105238_10516258
1380 Ga0105238_10570329
1381 Ga0105249_10000005
1382 Ga0105249_10033877
1383 Ga0105249_10207095
1384 Ga0105239_10035107
1385 Ga0105239_10155775
1386 Ga0105239_10329835
1387 Ga0105239_10475523
1388 Ga0157315_1001489
1389 Ga0157326_1004058
1390 Ga0157338_1000532
1391 Ga0157371_10000146
1392 Ga0157371_10010704
1393 Ga0157370_10070523
1394 Ga0157369_10559408
1395 Ga0157374_10005485
1396 Ga0157374_10186699
1397 Ga0157378_10170665
1398 Ga0157378_10424037
1399 Ga0163162_10000992
1400 Ga0163162_10041084
1401 Ga0163162_10119689
1402 Ga0157372_10047192
1403 Ga0157372_10095101
1404 Ga0157372_11082650
1405 Ga0157375_10053523
1406 Ga0157375_10255398
1407 Ga0157375_10336048
1408 Ga0163163_10000824
1409 Ga0163163_10049492
1410 Ga0163163_10165674
1411 Ga0163163_11176677
1412 Ga0157380_10000223
1413 Ga0157380_10021931
1414 Ga0157380_10027515
1415 Ga0157380_10251999
1416 Ga0182008_10035428
1417 Ga0157377_10010864
1418 Ga0157379_10035759
1419 Ga0157379_10118222
1420 Ga0157379_10223236
1421 Ga0157376_10011320
1422 Ga0157376_10461748
1423 Ga0183363_1004
1424 Ga0163161_10000534
1425 Ga0163161_10000559
1426 Ga0163161_10033791
1427 Ga0206353_11267825
1428 Ga0213876_10085403
1429 Ga0213876_10148624
1430 Ga0213875_10002032
1431 Ga0207672_1001332
1432 Ga0209148_1000017
1433 Ga0209148_1000094
1434 Ga0209455_1000005
1435 Ga0209455_1000223
1436 Ga0207673_1000025
1437 Ga0209256_1004477
1438 Ga0207697_10000211
1439 Ga0207656_10015627
1440 Ga0207656_10093095
1441 Ga0207713_1068962
1442 Ga0207713_1088682
1443 Ga0207653_10056460
1444 Ga0207682_10000011
1445 Ga0207642_10000524
1446 Ga0207710_10005139
1447 Ga0207710_10018673
1448 Ga0207688_10000020
1449 Ga0207680_10000004
1450 Ga0207680_10004313
1451 Ga0207680_10021990
1452 Ga0207680_10084116
1453 Ga0207680_10334489
1454 Ga0207647_10004347
1455 Ga0207647_10019896
1456 Ga0207699_10061610
1457 Ga0207645_10000788
1458 Ga0207645_10270788
1459 Ga0207643_10000284
1460 Ga0207705_10000009
1461 Ga0207705_10004964
1462 Ga0207705_10006387
1463 Ga0207705_10060513
1464 Ga0207684_10191864
1465 Ga0207654_10001265
1466 Ga0207654_10005735
1467 Ga0207654_10226444
1468 Ga0207707_10000689
1469 Ga0207695_10008440
1470 Ga0207695_10026473
1471 Ga0207695_10026901
1472 Ga0207695_10241138
1473 Ga0207671_10004774
1474 Ga0207671_10019640
1475 Ga0207671_10034109
1476 Ga0207671_10040085
1477 Ga0207663_10104021
1478 Ga0207660_10000442
1479 Ga0207660_10073313
1480 Ga0207660_10245894
1481 Ga0207662_10000249
1482 Ga0207657_10005758
1483 Ga0207657_10017155
1484 Ga0207657_10019263
1485 Ga0207657_10096809
1486 Ga0207657_10282159
1487 Ga0207649_10000057
1488 Ga0207649_10000686
1489 Ga0207652_10017507
1490 Ga0207652_10050418
1491 Ga0207652_10104030
1492 Ga0207646_10401320
1493 Ga0207681_10000008
1494 Ga0207681_10000152
1495 Ga0207681_10000153
1496 Ga0207681_10000181
1497 Ga0207681_10176176
1498 Ga0207681_10424232
1499 Ga0207694_10092511
1500 Ga0207694_10138744
1501 Ga0207694_10162760
1502 Ga0207694_10421977
1503 Ga0207650_10001609
1504 Ga0207650_10009752
1505 Ga0207650_10794520
1506 Ga0207659_10000028
1507 Ga0207687_10000061
1508 Ga0207700_10007626
1509 Ga0207664_10040973
1510 Ga0207644_10000006
1511 Ga0207644_10000060
1512 Ga0207644_10000315
1513 Ga0207644_10005556
1514 Ga0207644_10426267
1515 Ga0207690_10000445
1516 Ga0207690_10003095
1517 Ga0207690_10123607
1518 Ga0207690_10149816
1519 Ga0207706_10163336
1520 Ga0207686_10067778
1521 Ga0207686_10073445
1522 Ga0207709_10000539
1523 Ga0207709_10007306
1524 Ga0207709_10091058
1525 Ga0207670_10000217
1526 Ga0207670_10224818
1527 Ga0207669_10000147
1528 Ga0207669_10015280
1529 Ga0207704_10000299
1530 Ga0207691_10139944
1531 Ga0207711_10001580
1532 Ga0207711_10039899
1533 Ga0207711_10156437
1534 Ga0207711_10296583
1535 Ga0207689_10001029
1536 Ga0207661_10000215
1537 Ga0207661_10025714
1538 Ga0207661_10063138
1539 Ga0207679_10000026
1540 Ga0207679_10327827
1541 Ga0207667_10000552
1542 Ga0207667_10003106
1543 Ga0207667_10010207
1544 Ga0207667_10027203
1545 Ga0207667_10030695
1546 Ga0207667_10196889
1547 Ga0207667_10919358
1548 Ga0207651_10000173
1549 Ga0207712_10000001
1550 Ga0207712_10000686
1551 Ga0207668_10000071
1552 Ga0207668_10000125
1553 Ga0207668_10000242
1554 Ga0207668_10152121
1555 Ga0207668_10295731
1556 Ga0207640_10000528
1557 Ga0207640_10003534
1558 Ga0207640_10005323
1559 Ga0207640_10112873
1560 Ga0207640_10288203
1561 Ga0207658_10000029
1562 Ga0207658_10000483
1563 Ga0207658_10007401
1564 Ga0207658_10042988
1565 Ga0207677_10018655
1566 Ga0207703_10034718
1567 Ga0207703_10053578
1568 Ga0207703_10091895
1569 Ga0207703_10193528
1570 Ga0207703_10443578
1571 Ga0207703_10626492
1572 Ga0207639_10004462
1573 Ga0207639_10016305
1574 Ga0207639_10033141
1575 Ga0207639_10131855
1576 Ga0207678_10001079
1577 Ga0207678_10011901
1578 Ga0207678_10053597
1579 Ga0207678_10119951
1580 Ga0207678_10181409
1581 Ga0207678_10231959
1582 Ga0207702_10000462
1583 Ga0207702_10004092
1584 Ga0207702_10012057
1585 Ga0207702_10639138
1586 Ga0207702_10790935
1587 Ga0207641_10000033
1588 Ga0207641_10000091
1589 Ga0207641_10029637
1590 Ga0207641_10042015
1591 Ga0207641_10054884
1592 Ga0207648_10193733
1593 Ga0207648_10822316
1594 Ga0207676_10000361
1595 Ga0207676_10001517
1596 Ga0207676_10005644
1597 Ga0207676_10554402
1598 Ga0207674_10068165
1599 Ga0207675_100000049
1600 Ga0207675_100000171
1601 Ga0207675_100002282
1602 Ga0207675_100219984
1603 Ga0207675_100910020
1604 Ga0207683_10000034
1605 Ga0207683_10217210
1606 Ga0207683_10353539
1607 Ga0207698_10000111
1608 Ga0207698_10040663
1609 Ga0207698_10171424
1610 Ga0207698_10204801
1611 Ga0207698_10325073
1612 Ga0210002_1007589
1613 Ga0209983_1005123
1614 Ga0209971_1025954
1615 Ga0209971_1032075
1616 Ga0209998_10013722
1617 Ga0209813_10000093
1618 Ga0209813_10026051
1619 Ga0209813_10055552
1620 Ga0207428_10000352
1621 Ga0207428_10043348
1622 Ga0268266_10000002
1623 Ga0268266_10000028
1624 Ga0268266_10001236
1625 Ga0268266_10092352
1626 Ga0268266_10672226
1627 Ga0268265_10000071
1628 Ga0268265_10005043
1629 Ga0268265_10020624
1630 Ga0268265_10087562
1631 Ga0268265_10338297
1632 Ga0268264_10000006
1633 Ga0268264_10000010
1634 Ga0268264_10007704
1635 Ga0268264_10312620
1636 Ga0265338_10058189
1637 Ga0265332_10022881
1638 Ga0265332_10183610
1639 Ga0265320_10041942
1640 Ga0265325_10042221
1641 Ga0265325_10052524
1642 Ga0265340_10090458
1643 Ga0265339_10000738
1644 Ga0265327_10000070
1645 Ga0307408_100016762
1646 Ga0307408_100130639
1647 Ga0307408_100166906
1648 Ga0307408_100247061
1649 Ga0265313_10000289
1650 Ga0265313_10088903
1651 Ga0265314_10010574
1652 Ga0265314_10019267
1653 Ga0265314_10065252
1654 Ga0265342_10005212
1655 Ga0265342_10035100
1656 Ga0307405_10054239
1657 Ga0307413_10020137
1658 Ga0307413_10428091
1659 Ga0307413_10611952
1660 Ga0307410_10069017
1661 Ga0307406_10018849
1662 Ga0307406_10379831
1663 Ga0307407_10110630
1664 Ga0307412_10084762
1665 Ga0307412_10296412
1666 Ga0307409_100341488
1667 Ga0307414_10026491
1668 Ga0307414_10076255
1669 Ga0307414_10087398
1670 Ga0307414_10114122
1671 Ga0307414_10115211
1672 Ga0307414_10184269
1673 Ga0307414_10245628
1674 Ga0307411_10011783
1675 Ga0307411_10023317
1676 Ga0307411_10087477
1677 Ga0307411_10089216
1678 Ga0307415_100090085
1679 Ga0373948_0000052
1680 Ga0373948_0051130
1681 Ga0373958_0010064
1682 Ga0373958_0046507
1683 Ga0373959_0001596
1684 Ga0373938_0000045
1685 Ga0373928_0001393
1686 Ga0373929_0010842
1687 Ga0373934_0008195
1688 Ga0373934_0026071
1689 Ga0373940_0000833
1690 Ga0373940_0005919
1691 Ga0373944_0028916
1692 Ga0373949_0001411
1693 Ga0373951_0007829
1694 Ga0373952_0007258
1695 Ga0373923_0002261
1696 Ga0373923_0002293
1697 Ga0373923_0072969
1698 Ga0373932_0001518
1699 Ga0373936_0114336
1700 Ga0373939_0007603
1701 Ga0373939_0009750
1702 Ga0373941_0002611
1703 Ga0373945_0033685
1704 Ga0373953_0011303
1705 Ga0373953_0012460
1706 Ga0373956_0008321
1707 Ga0373960_0010573
1708 Ga0373955_0002044
1709 Ga0373942_0000535
1710 Ga0373961_0001186
1711 Ga0373962_0011088
1712 Ga0373931_0016268
1713 Ga0373935_0027001
1714 Ga0373927_0022190
1715 Ga0373927_0063848
1716 Ga0373933_0001999
1717 Ga0373933_0104908
1718 Ga0373937_0054341
1719 Ga0316584_0146371
1720 Ga0373925_0014166
1721 Ga0373925_0016337
1722 Ga0373925_0209985
1723 Ga0395899_0061303
1724 Ga0395900_0018921
1725 Ga0395905_0239027
1726 Ga0436364_0022476
1727 Ga0395901_0056281
1728 Ga0395901_0185877
1729 Ga0436365_1035422
1730 Ga0436361_0255533
1731 Ga0439465_0024236
1732 Ga0439441_050454
1733 Ga0439450_002651
1734 Ga0439455_0012977
1735 Ga0439455_0017001
1736 Ga0439463_036780
1737 Ga0450912_002252
1738 Ga0439460_0004647
1739 Ga0451577_0206917
1740 Ga0451577_0567654
1741 Ga0453683_0123584
1742 Ga0466966_0310166
1743 Ga0466963_0006521
1744 Ga0453684_0060916
1745 Ga0453684_0078082
1746 Ga0453684_0100255
1747 Ga0453684_1126690
1748 Ga0466971_0002216
1749 Ga0451576_0000236
1750 Ga0451576_0004698
1751 Ga0451576_0482934
1752 Ga0466958_0010866
1753 Ga0466958_0014106
1754 Ga0466967_0073411
1755 Ga0466967_0680529
1756 Ga0495592_0005711
1757 Ga0495603_0075958
1758 Ga0495603_0182027
1759 Ga0495629_0014627
1760 Ga0495629_0098558
1761 Ga0495629_0113466
1762 Ga0495638_0003712
1763 Ga0495651_0009193
1764 Ga0495653_0019489
1765 Ga0495650_0011072
1766 Ga0495580_0001981
1767 Ga0495639_0005755
1768 Ga0495639_0260388
1769 Ga0495662_0058209
1770 Ga0495664_0164850
1771 Ga0495584_0052635
1772 Ga0495606_0005777
1773 Ga0495608_0005680
1774 Ga0495616_0000022
1775 Ga0495618_0018445
1776 Ga0495618_0041270
1777 Ga0495620_0140909
1778 Ga0495628_0003465
1779 Ga0495628_0050658
1780 Ga0495630_0033645
1781 Ga0495632_0000007
1782 Ga0495637_0001086
1783 Ga0495643_0000304
1784 Ga0495643_0001459
1785 Ga0495648_0002812
1786 Ga0495663_0000005
1787 Ga0495666_0099155
1788 Ga0495642_0015827
1789 Ga0495652_0026176
1790 Ga0495652_0193035
1791 Ga0495665_0083094
1792 Ga0495640_0007536
1793 Ga0495640_0056516
1794 Ga0495587_0020315
1795 Ga0495598_0009383
1796 Ga0495645_0019080
1797 Ga0495622_0012188
1798 Ga0495622_0019673
1799 Ga0495622_0071170
1800 Ga0495633_0000447
1801 Ga0495656_0056008
1802 Ga0495668_0010481
1803 Ga0495668_0215652
1804 Ga0495634_0123737
1805 Ga0495635_0001868
1806 Ga0495635_0057776
1807 Ga0495657_0007182
1808 Ga0495599_0037684
1809 Ga0495646_0028295
1810 Ga0495646_0064240
1811 Ga0495658_0047772
1812 Ga0495669_0003985
1813 Ga0495624_0048211
1814 Ga0495670_0000007
1815 Ga0495671_0000126
1816 Ga0495671_0204980
1817 Ga0495600_0015222
1818 Ga0495600_0220599
1819 Ga0495581_0027850
1820 Ga0495604_0006243
1821 Ga0495674_0104129
1822 Ga0495672_0197793
1823 Ga0495676_0116086
1824 Ga0495680_0011034
1825 Ga0495687_000211
1826 Ga0495675_0005364
1827 Ga0495677_0000664
1828 Ga0495681_0007530
1829 Ga0495684_0004347
1830 Ga0495686_0001143
1831 Ga0495686_0022098
1832 Ga0495686_0025654
1833 Ga0495593_0011080
1834 Ga0495602_0120977
1835 Ga0496100_0036658
1836 Ga0496100_0204664
1837 Ga0496100_0362410
1838 Ga0496101_0000756
1839 Ga0496101_0042688
1840 Ga0496101_0124348
1841 Ga0496102_0018645
1842 Ga0496102_0044075
1843 Ga0496103_0000372
1844 Ga0496103_0013313
1845 Ga0496104_0084318
1846 Ga0496104_0111744
1847 Ga0496104_0117617
1848 Ga0496104_0132698
1849 Ga0496105_0357719
1850 Ga0496105_0456285
1851 Ga0496106_0000338
1852 Ga0496106_0004105
1853 Ga0496106_0012705
1854 Ga0496106_0145873
1855 Ga0496106_0186884
1856 Ga0496107_0002397
1857 Ga0496107_0065004
1858 Ga0496107_0193435
1859 Ga0496108_0002029
1860 Ga0496108_0012372
1861 Ga0496108_0017759
1862 Ga0496108_0158344
1863 Ga0496109_0000736
1864 Ga0496110_0155586
1865 Ga0496110_0243937
1866 Ga0496111_0005543
1867 Ga0496111_0008071
1868 Ga0496111_0714579
1869 Ga0496112_0005715
1870 Ga0496112_0061469
1871 Ga0496112_0070393
1872 Ga0496112_0326911
1873 Ga0496112_0550452
1874 Ga0496113_0000137
1875 Ga0496113_0023006
1876 Ga0496113_0336613
1877 Ga0496114_0030111
1878 Ga0496115_0001071
1879 Ga0496115_0193755
1880 Ga0496116_0001243
1881 Ga0496116_0042404
1882 Ga0496117_0002288
1883 Ga0496117_0003419
1884 Ga0496117_0007148
1885 Ga0496118_0000097
1886 Ga0496118_0019050
1887 Ga0496118_0029290
1888 Ga0496118_0038849
1889 Ga0496119_0083693
1890 Ga0496119_0099488
1891 Ga0496121_0000529
1892 Ga0496121_0000654
1893 Ga0496121_0000731
1894 Ga0496121_0001257
1895 Ga0496121_0104514
1896 Ga0496122_0001187
1897 Ga0496122_0228637
1898 Ga0496123_0002266
1899 Ga0496124_0001077
1900 Ga0496124_0003799
1901 Ga0496124_0194639
1902 Ga0496125_0011588
1903 Ga0496125_0140350
1904 Ga0496125_0211726
1905 Ga0496125_0243441
1906 Ga0496126_0003267
1907 Ga0496126_0005782
1908 Ga0496126_0014598
1909 Ga0496126_0021647
1910 Ga0496126_0044085
1911 Ga0496126_0136412
1912 Ga0496126_0227841
1913 Ga0501032_0091848
1914 Ga0501032_0313568
1915 Ga0501033_0013961
1916 Ga0501033_0020668
1917 Ga0501033_0103135
1918 Ga0501033_0413781
1919 Ga0501034_0017600
1920 Ga0501034_0025723
1921 Ga0501034_0052853
1922 Ga0501034_0056536
1923 Ga0501034_0364325
1924 Ga0501036_0032297
1925 Ga0501036_0078188
1926 Ga0501037_0018892
1927 Ga0501037_0199755
1928 Ga0501037_0226240
1929 Ga0501038_0113484
1930 Ga0501038_0667850
1931 Ga0501039_0249734
1932 Ga0501043_0006400
1933 Ga0501043_0018572
1934 Ga0501043_0041490
1935 Ga0501043_0286331
1936 Ga0501046_0038152
1937 Ga0501047_0011978
1938 Ga0501047_0062952
1939 Ga0501047_0110422
1940 Ga0501048_0086363
1941 Ga0501048_0191134
1942 Ga0501067_0122896
1943 Ga0501070_0134484
1944 Ga0501073_0226949
1945 Ga0501074_0040096
1946 Ga0501075_0288530
1947 Ga0501076_0212167
1948 Ga0501077_0012101
1949 Ga0501223_000495
1950 Ga0501224_000006
1951 Ga0501233_000165
1952 Ga0501235_002887
1953 Ga0501243_054949
1954 Ga0501225_0000845
1955 Ga0501234_002685
1956 Ga0501079_0069571
1957 Ga0501080_0105755
1958 Ga0501035_0153442
1959 Ga0501044_0015307
1960 Ga0501044_0066736
1961 Ga0501044_0165712
1962 Ga0501044_0291934
1963 Ga0501044_0529132
1964 Ga0501226_000208
1965 nmdc:mga03683_3_c1
1966 nmdc:mga03n38_4148_c1
1967 nmdc:mga00v17_82616_c1
1968 nmdc:mga0yw44_272609_c1
1969 nmdc:mga0yw44_317992_c1
1970 nmdc:mga0yw44_48932_c1
1971 nmdc:mga0yw44_63369_c1
1972 nmdc:mga0k408_20_c1
1973 nmdc:mga06z11_124663_c1
1974 nmdc:mga06z11_134335_c1
1975 nmdc:mga06z11_14854_c1
1976 nmdc:mga06z11_168_c1
1977 nmdc:mga06z11_35705_c1
1978 nmdc:mga06z11_79591_c1
1979 nmdc:mga04h51_196_c1
1980 nmdc:mga04h51_32232_c1
1981 nmdc:mga04h51_72287_c1
1982 nmdc:mga07m45_1_c1
1983 nmdc:mga07m45_22684_c1
1984 nmdc:mga07m45_89838_c1
1985 nmdc:mga05p37_396674_c1
1986 nmdc:mga09592_176207_c1
1987 nmdc:mga09592_203413_c1
1988 nmdc:mga0qj67_1526_c1
1989 nmdc:mga0qj67_50274_c1
1990 nmdc:mga06r32_157408_c1
1991 nmdc:mga06r32_24040_c1
1992 nmdc:mga08y16_100280_c1
1993 nmdc:mga0n895_129838_c1
1994 nmdc:mga0n895_349680_c1
1995 nmdc:mga0n895_660169_c1
1996 nmdc:mga0rr50_458226_c1
1997 nmdc:mga0rr50_71161_c1
1998 nmdc:mga08x19_18_c1
1999 nmdc:mga0a205_14874_c2
2000 nmdc:mga0a205_251821_c1
2001 nmdc:mga0sz30_14764_c1
2002 Ga0495595_0001147
2003 Ga0495619_0011284
2004 Ga0495619_0244115
2005 Ga0500643_000291
2006 Ga0500643_002128
2007 Ga0500643_009923
2008 Ga0500647_0166671
2009 Ga0500562_004655
2010 Ga0500562_041023
2011 Ga0500592_000729
2012 Ga0500595_002941
2013 Ga0500618_000868
2014 Ga0500559_0085179
2015 Ga0500573_0000022
2016 Ga0500604_0002419
2017 Ga0500616_0007800
2018 Ga0500624_000012
2019 Ga0500624_000088
2020 Ga0500627_0002242
2021 Ga0500638_045361
2022 Ga0500639_111532
2023 Ga0500611_043820
2024 Ga0500645_002393
2025 Ga0500645_037526
2026 Ga0501084_0460012
2027 Ga0500661_001460
2028 Ga0466962_0009919
2029 2511391809
2030 2513888610
2031 2514419528
2032 2528853350
2033 2723573441
2034 2765465702
2035 2776269595
2036 2776282526
2037 2793078341
2038 2793281020
2039 2809064962
2040 2809080872
2041 2809085294
2042 2830076567
2043 2839993345
2044 2840766346
2045 2842779080
2046 2842873962
2047 2856327191
2048 2856356932
2049 2869279578
2050 2871494937
2051 2871500127
2052 2874607919
2053 2878742105
2054 2878760063
2055 2878764249
2056 2878771319
2057 2880522028
2058 2881851333
2059 2881864770
2060 2882916767
2061 2885323333
2062 2885418604
2063 2889035336
2064 2894653784
2065 2903494296
2066 2903544942
2067 2924726138
2068 2924779789
2069 2924790869
2070 2928522803
2071 2932790931
2072 2932833647
2073 2935623173
2074 2935644248
2075 2935672170
2076 2935710281
2077 2935808272
2078 2935833508
2079 2935844461
2080 2935861421
2081 2935869540
2082 2935879869
2083 2935966753
2084 2935997908
2085 2936008827
2086 2937881717
2087 2937974253
2088 2937998787
2089 2941543366
2090 2946787947
2091 2954013831
2092 2958035156
2093 2958044188
2094 2958088805
2095 2958092651
2096 2958169262
2097 2961133824
2098 2961167724
2099 2961177333
2100 2965022543
2101 2968002436
2102 2968009667
2103 2968023576
2104 2968176125
2105 2970476158
2106 2970510007
2107 2970559093
2108 2970594178
2109 2977828585
2110 2979814883
2111 2987663731
2112 2996354741
2113 3004192788
2114 3004281389
2115 3004336886
2116 8004381562
2117 8006967604
2118 8007000403
2119 8016518030
2120 8017058615
2121 8019577044
2122 8019595110
2123 8019606629
2124 8045867200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

126

268

0.96

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

24

83

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yq1-assembly1.cif.gz_A crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds 0.8898 2 226
4yq2-assembly1.cif.gz_A crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds 0.8881 2 226
4ig6-assembly1.cif.gz_A crystal structure of a trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum bound to s-adenosylhomocysteine 0.8871 3 224
8byh-assembly1.cif.gz_A crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.8855 1 227
5wyr-assembly1.cif.gz_B crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa 0.8807 1 227
ID Description Score Start End Superfamily
4ig6A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9808 176 224 1.10.1270.20
4yq2A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9793 175 226 1.10.1270.20
5zhkA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9778 176 224 1.10.1270.20
3quvB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9733 175 224 1.10.1270.20
5zhlA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9716 176 224 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A3D4QIM4-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9504 2 133 GO:0002939
GO:0005829
GO:0052906
AF-A0A528D6F4-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9502 1 166 GO:0002939
GO:0005829
GO:0052906
AF-A0A439KNT5-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9448 1 148 GO:0002939
GO:0005829
GO:0052906
AF-A0A661I5S3-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9393 3 164 GO:0002939
GO:0005829
GO:0052906
AF-A0A528D6F4-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9393 1 166 GO:0002939
GO:0005829
GO:0052906

Map