F489301

General Info

Members Datasets Scaffolds Average Seq Length
1062 389 2124 196

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100165338|Ga0075434_1001653382
Length 230
Sequence MVQINFARREVNCKIVFYGPGLSGKTTNLEIIHKKVPDTARGNLTSIATEQDRTLFFDFMPLDLGQVAGMKTKLFLYTVPGQVYYDSTRKLVLQGADGVSFIADSDPNRMNDNIESFKNLERNLKDYGVDIRKIPLVIQYNKRDLPGALSIAELNAKVNPIGAPTFEAVAVKGEGVMQTLKGISKLVVDRLNEEYAPVKSAPAEKVGAAWYMGYLQNIKGLEFIPPPPKK

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
221 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
224 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
238 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
257 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
265 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
268 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
269 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
270 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
271 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
272 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
273 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
276 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
324 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
325 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
337 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
338 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
339 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
340 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
341 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
342 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
343 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
344 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
345 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
346 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
347 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
348 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
349 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
350 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
351 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
352 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
353 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
354 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
355 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
358 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
359 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
360 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
361 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
382 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 1.41
Rhizosphere 94.63
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100165338 3300006871 Bacteria 2232
2 SwRhRL2b_contig_2993171 2162886007 Bacteria 892
3 SwRhRL2b_contig_3228964 2162886007 Bacteria 1789
4 JGI24736J21556_1012294 3300001904 Bacteria 1387
5 JGI24752J21851_1005311 3300001976 Bacteria 1682
6 JGI24747J21853_1001607 3300001978 Bacteria 1724
7 JGI24737J22298_10037376 3300001990 Bacteria 1497
8 JGI24743J22301_10002545 3300001991 Bacteria 2765
9 JGI24749J21850_1006274 3300002076 Bacteria 1658
10 JGI24744J21845_10015891 3300002077 Bacteria 1501
11 JGI24034J26672_10001759 3300002239 Bacteria 2915
12 JGI25404J52841_10006515 3300003659 Bacteria 2448
13 JGI25404J52841_10016843 3300003659 Bacteria 1585
14 Ga0058859_11637650 3300004798 Bacteria 1254
15 Ga0058860_11963019 3300004801 Bacteria 1231
16 Ga0065704_10090655 3300005289 Bacteria 2755
17 Ga0065712_10117738 3300005290 Bacteria 1712
18 Ga0065712_10246565 3300005290 Bacteria 963
19 Ga0065715_10125440 3300005293 Bacteria 2131
20 Ga0065715_10295490 3300005293 Bacteria 1053
21 Ga0065707_10034469 3300005295 Bacteria 1148
22 Ga0065707_10083282 3300005295 Bacteria 9694
23 Ga0065707_10163868 3300005295 Bacteria 1539
24 Ga0070658_10004055 3300005327 Bacteria 12008
25 Ga0070658_10275107 3300005327 Bacteria 1433
26 Ga0070676_10000791 3300005328 Bacteria 15615
27 Ga0070676_10195943 3300005328 Bacteria 1322
28 Ga0070683_100003498 3300005329 Bacteria 12770
29 Ga0070683_100006454 3300005329 Bacteria 9841
30 Ga0070683_100007872 3300005329 Bacteria 9028
31 Ga0070683_100037675 3300005329 Bacteria 4427
32 Ga0070683_100201708 3300005329 Bacteria 1889
33 Ga0070683_100335339 3300005329 Bacteria 1440
34 Ga0070683_100576189 3300005329 Bacteria 1076
35 Ga0070690_100000173 3300005330 Bacteria 33077
36 Ga0070690_100002627 3300005330 Bacteria 9679
37 Ga0070670_100007248 3300005331 Bacteria 9398
38 Ga0070670_100048275 3300005331 Bacteria 3663
39 Ga0070670_100051828 3300005331 Bacteria 3524
40 Ga0070670_100127286 3300005331 Bacteria 2199
41 Ga0070670_100141642 3300005331 Bacteria 2080
42 Ga0070677_10000335 3300005333 Bacteria 16553
43 Ga0070677_10254713 3300005333 Unclassified 873
44 Ga0070677_10260061 3300005333 Bacteria 866
45 Ga0068869_100002272 3300005334 Bacteria 11569
46 Ga0068869_100032209 3300005334 Bacteria 3693
47 Ga0068869_100056978 3300005334 Bacteria 2852
48 Ga0068869_100151380 3300005334 Bacteria 1800
49 Ga0070666_10006566 3300005335 Bacteria 7147
50 Ga0070666_10010448 3300005335 Bacteria 5809
51 Ga0070666_10199963 3300005335 Bacteria 1406
52 Ga0070680_100010627 3300005336 Bacteria 7102
53 Ga0070680_100051322 3300005336 Bacteria 3365
54 Ga0070680_100226144 3300005336 Bacteria 1580
55 Ga0070680_100328122 3300005336 Bacteria 1300
56 Ga0070680_100622559 3300005336 Bacteria 927
57 Ga0068868_100014498 3300005338 Bacteria 5809
58 Ga0068868_100145610 3300005338 Bacteria 1948
59 Ga0070660_100000446 3300005339 Bacteria 27489
60 Ga0070660_100185209 3300005339 Bacteria 1685
61 Ga0070689_100000301 3300005340 Bacteria 28801
62 Ga0070689_100002383 3300005340 Bacteria 12256
63 Ga0070689_100008591 3300005340 Bacteria 7200
64 Ga0070689_100014544 3300005340 Bacteria 5719
65 Ga0070689_100088031 3300005340 Bacteria 2444
66 Ga0070689_100091432 3300005340 Bacteria 2399
67 Ga0070689_100671249 3300005340 Bacteria 903
68 Ga0070689_100818007 3300005340 Bacteria 820
69 Ga0070691_10093131 3300005341 Bacteria 1488
70 Ga0070687_100002906 3300005343 Bacteria 6564
71 Ga0070687_100093275 3300005343 Bacteria 1670
72 Ga0070687_100369879 3300005343 Bacteria 931
73 Ga0070661_100001682 3300005344 Bacteria 15311
74 Ga0070661_100017308 3300005344 Bacteria 5112
75 Ga0070661_100752456 3300005344 Bacteria 797
76 Ga0070692_10023861 3300005345 Bacteria 3001
77 Ga0070692_10078478 3300005345 Bacteria 1773
78 Ga0070692_10155760 3300005345 Bacteria 1305
79 Ga0070668_100000515 3300005347 Bacteria 25626
80 Ga0070668_100196447 3300005347 Bacteria 1655
81 Ga0070668_100308698 3300005347 Bacteria 1329
82 Ga0070668_101243331 3300005347 Bacteria 676
83 Ga0070669_100006572 3300005353 Bacteria 8368
84 Ga0070675_100005229 3300005354 Bacteria 9905
85 Ga0070675_100006848 3300005354 Bacteria 8748
86 Ga0070675_100508331 3300005354 Bacteria 1086
87 Ga0070675_100527896 3300005354 Bacteria 1066
88 Ga0070671_100008619 3300005355 Bacteria 8176
89 Ga0070671_100041960 3300005355 Bacteria 3803
90 Ga0070671_100065291 3300005355 Bacteria 3031
91 Ga0070671_100104373 3300005355 Bacteria 2378
92 Ga0070674_100001025 3300005356 Bacteria 14580
93 Ga0070674_100011419 3300005356 Bacteria 5410
94 Ga0070673_100002555 3300005364 Bacteria 11108
95 Ga0070673_100095828 3300005364 Bacteria 2434
96 Ga0070673_100833407 3300005364 Bacteria 853
97 Ga0070688_100000337 3300005365 Bacteria 23972
98 Ga0070688_100065217 3300005365 Bacteria 2314
99 Ga0070688_100138736 3300005365 Bacteria 1649
100 Ga0070688_100622201 3300005365 Bacteria 828
101 Ga0070659_100014210 3300005366 Bacteria 5944
102 Ga0070659_100016359 3300005366 Bacteria 5568
103 Ga0070659_100575971 3300005366 Bacteria 965
104 Ga0070667_100020902 3300005367 Bacteria 5437
105 Ga0070667_100092799 3300005367 Bacteria 2599
106 Ga0070667_100144918 3300005367 Bacteria 2082
107 Ga0070703_10177192 3300005406 Bacteria 821
108 Ga0070709_10182262 3300005434 Bacteria 1475
109 Ga0070709_10310270 3300005434 Bacteria 1154
110 Ga0070701_10001375 3300005438 Bacteria 8979
111 Ga0070701_10129943 3300005438 Bacteria 1430
112 Ga0070701_10161639 3300005438 Bacteria 1298
113 Ga0070705_100003382 3300005440 Bacteria 7822
114 Ga0070705_100086834 3300005440 Bacteria 1938
115 Ga0070705_100240582 3300005440 Bacteria 1265
116 Ga0070705_100559924 3300005440 Bacteria 878
117 Ga0070694_100595055 3300005444 Bacteria 890
118 Ga0070708_100001005 3300005445 Bacteria 21549
119 Ga0070708_100003824 3300005445 Bacteria 11816
120 Ga0070708_100021563 3300005445 Bacteria 5450
121 Ga0070708_100025768 3300005445 Bacteria 5029
122 Ga0070708_100535893 3300005445 Bacteria 1104
123 Ga0070663_100001223 3300005455 Bacteria 14097
124 Ga0070663_100012814 3300005455 Bacteria 5319
125 Ga0070663_100048666 3300005455 Bacteria 3007
126 Ga0070678_100000534 3300005456 Bacteria 18526
127 Ga0070678_100502731 3300005456 Bacteria 1070
128 Ga0070662_100004041 3300005457 Bacteria 9212
129 Ga0070662_100055389 3300005457 Bacteria 2876
130 Ga0070681_10000914 3300005458 Bacteria 24939
131 Ga0070681_10037633 3300005458 Bacteria 4854
132 Ga0070681_10169684 3300005458 Bacteria 2104
133 Ga0068867_100001235 3300005459 Bacteria 17607
134 Ga0068867_100004895 3300005459 Bacteria 9427
135 Ga0068867_100429025 3300005459 Bacteria 1121
136 Ga0070685_10001620 3300005466 Bacteria 11882
137 Ga0070685_10166454 3300005466 Bacteria 1409
138 Ga0070685_10504541 3300005466 Bacteria 857
139 Ga0070706_100000043 3300005467 Bacteria 146342
140 Ga0070706_100032130 3300005467 Bacteria 4841
141 Ga0070706_100035178 3300005467 Bacteria 4626
142 Ga0070706_100091217 3300005467 Bacteria 2826
143 Ga0070706_100259547 3300005467 Bacteria 1622
144 Ga0070707_100002825 3300005468 Bacteria 16524
145 Ga0070707_100014607 3300005468 Bacteria 7362
146 Ga0070707_100075390 3300005468 Bacteria 3254
147 Ga0070707_100294685 3300005468 Bacteria 1576
148 Ga0070707_101037032 3300005468 Bacteria 786
149 Ga0070707_101167769 3300005468 Bacteria 736
150 Ga0070698_100006131 3300005471 Bacteria 13098
151 Ga0070698_100009868 3300005471 Bacteria 10207
152 Ga0070698_100013571 3300005471 Bacteria 8626
153 Ga0070698_100018446 3300005471 Bacteria 7347
154 Ga0070698_100040058 3300005471 Bacteria 4817
155 Ga0070698_100624018 3300005471 Bacteria 1019
156 Ga0070698_100717095 3300005471 Bacteria 943
157 Ga0070699_100021214 3300005518 Bacteria 5601
158 Ga0070699_100026821 3300005518 Bacteria 4970
159 Ga0070699_100050911 3300005518 Bacteria 3586
160 Ga0070699_100059560 3300005518 Bacteria 3307
161 Ga0070699_100570201 3300005518 Bacteria 1031
162 Ga0070699_100758482 3300005518 Bacteria 887
163 Ga0070679_100019461 3300005530 Bacteria 6601
164 Ga0070679_100037243 3300005530 Bacteria 4830
165 Ga0070679_100066469 3300005530 Bacteria 3594
166 Ga0070679_100102242 3300005530 Bacteria 2852
167 Ga0070679_100264069 3300005530 Bacteria 1676
168 Ga0070679_100690168 3300005530 Bacteria 964
169 Ga0070684_100011443 3300005535 Bacteria 7068
170 Ga0070684_100470088 3300005535 Bacteria 1163
171 Ga0070697_100011124 3300005536 Bacteria 7032
172 Ga0070697_100030991 3300005536 Bacteria 4299
173 Ga0070697_100032757 3300005536 Bacteria 4184
174 Ga0070697_100065783 3300005536 Bacteria 2963
175 Ga0070697_100178824 3300005536 Bacteria 1798
176 Ga0068853_100001918 3300005539 Bacteria 15325
177 Ga0068853_100005814 3300005539 Bacteria 9715
178 Ga0068853_100029091 3300005539 Bacteria 4653
179 Ga0068853_100634735 3300005539 Bacteria 1016
180 Ga0068853_100880133 3300005539 Bacteria 860
181 Ga0070672_100002014 3300005543 Bacteria 12776
182 Ga0070672_100049259 3300005543 Unclassified 3277
183 Ga0070672_100185319 3300005543 Bacteria 1736
184 Ga0070672_100239392 3300005543 Unclassified 1526
185 Ga0070672_100299155 3300005543 Bacteria 1364
186 Ga0070686_100000627 3300005544 Bacteria 20664
187 Ga0070686_100008800 3300005544 Bacteria 5657
188 Ga0070686_100257910 3300005544 Bacteria 1276
189 Ga0070695_100020681 3300005545 Bacteria 4019
190 Ga0070695_100186424 3300005545 Bacteria 1473
191 Ga0070695_100187219 3300005545 Bacteria 1471
192 Ga0070695_100213356 3300005545 Bacteria 1387
193 Ga0070695_100403865 3300005545 Bacteria 1036
194 Ga0070695_100461028 3300005545 Bacteria 976
195 Ga0070695_100463118 3300005545 Bacteria 974
196 Ga0070695_100625343 3300005545 Bacteria 848
197 Ga0070696_100027834 3300005546 Bacteria 3855
198 Ga0070696_100346245 3300005546 Bacteria 1150
199 Ga0070696_100677182 3300005546 Bacteria 839
200 Ga0070693_100006471 3300005547 Bacteria 5680
201 Ga0070693_100466706 3300005547 Bacteria 889
202 Ga0070665_100017189 3300005548 Bacteria 7256
203 Ga0070665_100299743 3300005548 Bacteria 1610
204 Ga0070704_100019612 3300005549 Bacteria 4348
205 Ga0070704_100068741 3300005549 Bacteria 2564
206 Ga0070704_100089480 3300005549 Bacteria 2290
207 Ga0070704_100303029 3300005549 Bacteria 1332
208 Ga0070704_100447390 3300005549 Bacteria 1112
209 Ga0070704_100644604 3300005549 Bacteria 935
210 Ga0070704_100713098 3300005549 Bacteria 890
211 Ga0068855_100001561 3300005563 Bacteria 28787
212 Ga0068855_100506249 3300005563 Bacteria 1312
213 Ga0070664_100003152 3300005564 Bacteria 13328
214 Ga0070664_100005560 3300005564 Bacteria 10125
215 Ga0070664_100114162 3300005564 Bacteria 2360
216 Ga0070664_100785848 3300005564 Bacteria 890
217 Ga0068857_100004750 3300005577 Bacteria 11510
218 Ga0068857_100012635 3300005577 Bacteria 7357
219 Ga0068854_100001664 3300005578 Bacteria 13534
220 Ga0068854_100153251 3300005578 Unclassified 1779
221 Ga0068854_100348902 3300005578 Bacteria 1211
222 Ga0068856_100013372 3300005614 Bacteria 7945
223 Ga0068856_100295516 3300005614 Bacteria 1637
224 Ga0070702_100042252 3300005615 Bacteria 2562
225 Ga0070702_100260909 3300005615 Bacteria 1180
226 Ga0070702_100570301 3300005615 Bacteria 843
227 Ga0068852_100000820 3300005616 Bacteria 20531
228 Ga0068852_100432678 3300005616 Bacteria 1300
229 Ga0068859_100008142 3300005617 Bacteria 10630
230 Ga0068859_100014777 3300005617 Bacteria 7843
231 Ga0068859_100021993 3300005617 Bacteria 6395
232 Ga0068859_100022725 3300005617 Bacteria 6288
233 Ga0068864_100000877 3300005618 Bacteria 25308
234 Ga0068864_100033632 3300005618 Bacteria 4359
235 Ga0068864_100036288 3300005618 Bacteria 4201
236 Ga0068864_100087989 3300005618 Bacteria 2735
237 Ga0068864_100093330 3300005618 Bacteria 2658
238 Ga0068866_10002290 3300005718 Bacteria 7927
239 Ga0068866_10146078 3300005718 Bacteria 1364
240 Ga0068861_100002462 3300005719 Bacteria 12068
241 Ga0068861_100078739 3300005719 Bacteria 2575
242 Ga0068861_100146225 3300005719 Bacteria 1935
243 Ga0068851_10000329 3300005834 Bacteria 21551
244 Ga0068851_10053978 3300005834 Bacteria 2047
245 Ga0068851_10078463 3300005834 Bacteria 1721
246 Ga0068870_10000995 3300005840 Bacteria 11184
247 Ga0068870_10032952 3300005840 Bacteria 2639
248 Ga0068870_10081731 3300005840 Bacteria 1788
249 Ga0068870_10113366 3300005840 Bacteria 1551
250 Ga0068863_100002073 3300005841 Bacteria 19886
251 Ga0068863_100007415 3300005841 Bacteria 10736
252 Ga0068863_100034529 3300005841 Bacteria 4817
253 Ga0068863_100053099 3300005841 Bacteria 3840
254 Ga0068863_100067006 3300005841 Bacteria 3396
255 Ga0068863_100339481 3300005841 Bacteria 1461
256 Ga0068858_100006820 3300005842 Bacteria 11108
257 Ga0068858_100046071 3300005842 Bacteria 4043
258 Ga0068858_101255888 3300005842 Bacteria 728
259 Ga0068860_100022816 3300005843 Bacteria 6052
260 Ga0068860_100024643 3300005843 Bacteria 5809
261 Ga0068860_100028437 3300005843 Bacteria 5381
262 Ga0068860_100404096 3300005843 Bacteria 1352
263 Ga0068860_100625033 3300005843 Bacteria 1084
264 Ga0068860_101491300 3300005843 Bacteria 698
265 Ga0068862_100007441 3300005844 Bacteria 9079
266 Ga0068862_100146207 3300005844 Bacteria 2101
267 Ga0068862_101140204 3300005844 Bacteria 776
268 Ga0081540_1000069 3300005983 Bacteria 111562
269 Ga0081540_1000351 3300005983 Bacteria 46620
270 Ga0081540_1000908 3300005983 Bacteria 26739
271 Ga0081539_10242516 3300005985 Bacteria 806
272 Ga0075365_10027167 3300006038 Bacteria 3638
273 Ga0075368_10020705 3300006042 Bacteria 2492
274 Ga0075363_100017936 3300006048 Bacteria 3519
275 Ga0075364_10018518 3300006051 Bacteria 4360
276 Ga0075364_10165367 3300006051 Unclassified 1494
277 Ga0075364_10324811 3300006051 Bacteria 1048
278 Ga0070715_10106652 3300006163 Bacteria 1315
279 Ga0070716_100051764 3300006173 Bacteria 2336
280 Ga0075362_10015000 3300006177 Bacteria 3142
281 Ga0075367_10101138 3300006178 Bacteria 1762
282 Ga0075367_10360888 3300006178 Bacteria 917
283 Ga0075366_10008588 3300006195 Bacteria 5686
284 Ga0097621_100006872 3300006237 Bacteria 8094
285 Ga0097621_100146294 3300006237 Bacteria 2023
286 Ga0097621_100248640 3300006237 Bacteria 1556
287 Ga0097621_100866738 3300006237 Bacteria 840
288 Ga0075370_10066161 3300006353 Bacteria 2061
289 Ga0068871_100005294 3300006358 Bacteria 9035
290 Ga0068871_100175878 3300006358 Bacteria 1837
291 Ga0068871_100463594 3300006358 Bacteria 1137
292 Ga0068871_101252873 3300006358 Bacteria 697
293 Ga0075428_100160445 3300006844 Bacteria 2441
294 Ga0075428_100596037 3300006844 Bacteria 1180
295 Ga0075428_100751671 3300006844 Bacteria 1037
296 Ga0075430_100667875 3300006846 Bacteria 857
297 Ga0075430_100887003 3300006846 Bacteria 735
298 Ga0075431_100015466 3300006847 Bacteria 7732
299 Ga0075431_100100008 3300006847 Bacteria 2992
300 Ga0075431_100319805 3300006847 Bacteria 1565
301 Ga0075431_100369468 3300006847 Bacteria 1440
302 Ga0075431_100852738 3300006847 Unclassified 882
303 Ga0075431_100856215 3300006847 Bacteria 880
304 Ga0075433_10013757 3300006852 Bacteria 6593
305 Ga0075433_10058316 3300006852 Bacteria 3377
306 Ga0075433_10075065 3300006852 Bacteria 2975
307 Ga0075433_10097710 3300006852 Bacteria 2599
308 Ga0075433_10435781 3300006852 Bacteria 1155
309 Ga0075434_100001372 3300006871 Bacteria 20435
310 Ga0075434_100050388 3300006871 Bacteria 4136
311 Ga0075434_100067401 3300006871 Bacteria 3565
312 Ga0075434_100305383 3300006871 Bacteria 1611
313 Ga0075434_101218286 3300006871 Bacteria 765
314 Ga0075429_100002216 3300006880 Bacteria 16267
315 Ga0075429_100013252 3300006880 Bacteria 7149
316 Ga0075429_100045120 3300006880 Bacteria 3834
317 Ga0075429_100138855 3300006880 Bacteria 2127
318 Ga0075429_100270021 3300006880 Bacteria 1490
319 Ga0075429_100311193 3300006880 Bacteria 1379
320 Ga0068865_100000473 3300006881 Bacteria 22470
321 Ga0075436_100010502 3300006914 Bacteria 6350
322 Ga0075436_100113096 3300006914 Bacteria 1896
323 Ga0097620_100008142 3300006931 Bacteria 10630
324 Ga0097620_100014777 3300006931 Bacteria 7843
325 Ga0097620_100021992 3300006931 Bacteria 6395
326 Ga0097620_100022726 3300006931 Bacteria 6288
327 Ga0075435_100002976 3300007076 Bacteria 11388
328 Ga0075435_100026418 3300007076 Bacteria 4529
329 Ga0075435_100065515 3300007076 Bacteria 2953
330 Ga0099794_10004638 3300007265 Bacteria 5430
331 Ga0099794_10034889 3300007265 Bacteria 2373
332 Ga0099794_10066522 3300007265 Bacteria 1759
333 Ga0105251_10060549 3300009011 Bacteria 1782
334 Ga0105251_10211960 3300009011 Bacteria 872
335 Ga0105250_10022522 3300009092 Bacteria 2539
336 Ga0105240_10006880 3300009093 Bacteria 16617
337 Ga0105240_10019430 3300009093 Bacteria 9077
338 Ga0105240_11001788 3300009093 Bacteria 893
339 Ga0111539_10001125 3300009094 Bacteria 35365
340 Ga0111539_10002191 3300009094 Bacteria 26074
341 Ga0111539_10004600 3300009094 Bacteria 18032
342 Ga0111539_10005878 3300009094 Bacteria 15845
343 Ga0111539_10009303 3300009094 Bacteria 12406
344 Ga0111539_10034441 3300009094 Bacteria 6140
345 Ga0111539_10141815 3300009094 Bacteria 2813
346 Ga0111539_10208233 3300009094 Bacteria 2279
347 Ga0111539_10241595 3300009094 Bacteria 2102
348 Ga0111539_10325107 3300009094 Bacteria 1790
349 Ga0111539_10369264 3300009094 Bacteria 1670
350 Ga0111539_10573122 3300009094 Bacteria 1315
351 Ga0111539_11033788 3300009094 Bacteria 955
352 Ga0111539_11594635 3300009094 Bacteria 757
353 Ga0105245_10000280 3300009098 Bacteria 48458
354 Ga0105247_10001217 3300009101 Bacteria 19097
355 Ga0105247_10021299 3300009101 Bacteria 3901
356 Ga0105247_10449534 3300009101 Bacteria 929
357 Ga0114129_10003496 3300009147 Bacteria 22089
358 Ga0114129_10059043 3300009147 Bacteria 5364
359 Ga0114129_10110997 3300009147 Bacteria 3785
360 Ga0114129_10142484 3300009147 Bacteria 3284
361 Ga0114129_10297523 3300009147 Bacteria 2152
362 Ga0114129_10299938 3300009147 Bacteria 2142
363 Ga0114129_10547448 3300009147 Bacteria 1505
364 Ga0114129_10719718 3300009147 Bacteria 1281
365 Ga0105243_10013838 3300009148 Bacteria 6107
366 Ga0105243_10133539 3300009148 Bacteria 2109
367 Ga0105243_10974880 3300009148 Bacteria 848
368 Ga0105241_10053970 3300009174 Bacteria 3075
369 Ga0105241_10748940 3300009174 Bacteria 896
370 Ga0105241_10943676 3300009174 Bacteria 804
371 Ga0105242_10001087 3300009176 Bacteria 21366
372 Ga0105242_10005006 3300009176 Bacteria 10247
373 Ga0105242_10012725 3300009176 Bacteria 6480
374 Ga0105248_10001972 3300009177 Bacteria 22812
375 Ga0105248_10037724 3300009177 Bacteria 5407
376 Ga0105248_10045413 3300009177 Bacteria 4927
377 Ga0105248_10051859 3300009177 Bacteria 4603
378 Ga0105248_10096999 3300009177 Bacteria 3321
379 Ga0105248_10205584 3300009177 Bacteria 2219
380 Ga0105248_11419510 3300009177 Bacteria 785
381 Ga0105237_10000240 3300009545 Bacteria 77901
382 Ga0105238_10000523 3300009551 Bacteria 40256
383 Ga0105238_10936748 3300009551 Bacteria 885
384 Ga0105249_10000800 3300009553 Bacteria 28288
385 Ga0105249_10272084 3300009553 Bacteria 1688
386 Ga0105249_10648223 3300009553 Bacteria 1113
387 Ga0105249_10663371 3300009553 Bacteria 1101
388 Ga0105249_11056581 3300009553 Bacteria 882
389 Ga0105249_11942645 3300009553 Bacteria 661
390 Ga0105239_10011955 3300010375 Bacteria 9679
391 Ga0105239_10019911 3300010375 Bacteria 7406
392 Ga0105239_10955366 3300010375 Bacteria 984
393 Ga0105246_10011693 3300011119 Bacteria 5454
394 Ga0157373_10006799 3300013100 Bacteria 8521
395 Ga0157373_10128296 3300013100 Bacteria 1783
396 Ga0157371_10000524 3300013102 Bacteria 45827
397 Ga0157371_10315084 3300013102 Bacteria 1134
398 Ga0157371_10626892 3300013102 Bacteria 801
399 Ga0157370_10014435 3300013104 Bacteria 8074
400 Ga0157369_10002563 3300013105 Bacteria 21752
401 Ga0157369_10079420 3300013105 Bacteria 3514
402 Ga0157374_10023849 3300013296 Bacteria 5479
403 Ga0157374_10328832 3300013296 Bacteria 1516
404 Ga0157374_10337316 3300013296 Bacteria 1496
405 Ga0157374_11015084 3300013296 Bacteria 849
406 Ga0157378_10000561 3300013297 Bacteria 35280
407 Ga0157378_10097339 3300013297 Bacteria 2682
408 Ga0157378_10098188 3300013297 Bacteria 2670
409 Ga0157378_10243319 3300013297 Bacteria 1719
410 Ga0157378_10320346 3300013297 Bacteria 1506
411 Ga0163162_10006460 3300013306 Bacteria 11357
412 Ga0163162_10108306 3300013306 Bacteria 2875
413 Ga0163162_10164827 3300013306 Bacteria 2340
414 Ga0163162_10180421 3300013306 Bacteria 2237
415 Ga0157372_10005105 3300013307 Bacteria 13956
416 Ga0157372_10054768 3300013307 Unclassified 4452
417 Ga0157372_11561022 3300013307 Bacteria 760
418 Ga0157372_11900332 3300013307 Bacteria 684
419 Ga0157375_10001595 3300013308 Bacteria 19476
420 Ga0157375_10034842 3300013308 Bacteria 4799
421 Ga0157375_10106091 3300013308 Unclassified 2901
422 Ga0157375_10107589 3300013308 Bacteria 2882
423 Ga0157375_10432966 3300013308 Unclassified 1481
424 Ga0163163_10006280 3300014325 Bacteria 10373
425 Ga0163163_10008551 3300014325 Bacteria 9099
426 Ga0163163_10042874 3300014325 Bacteria 4434
427 Ga0163163_10047994 3300014325 Bacteria 4197
428 Ga0163163_10177816 3300014325 Bacteria 2175
429 Ga0157380_10022874 3300014326 Bacteria 4713
430 Ga0157380_10024880 3300014326 Bacteria 4535
431 Ga0157380_10133837 3300014326 Bacteria 2119
432 Ga0157380_10147089 3300014326 Bacteria 2032
433 Ga0157377_10000250 3300014745 Bacteria 26631
434 Ga0157377_10112383 3300014745 Bacteria 1639
435 Ga0157379_10000550 3300014968 Bacteria 30219
436 Ga0157379_10007710 3300014968 Bacteria 9322
437 Ga0157376_10015355 3300014969 Bacteria 5784
438 Ga0157376_10046094 3300014969 Bacteria 3593
439 Ga0182007_10056614 3300015262 Bacteria 1287
440 Ga0163161_10004000 3300017792 Bacteria 10316
441 Ga0163161_10006234 3300017792 Bacteria 8261
442 Ga0163161_10012463 3300017792 Bacteria 5903
443 Ga0163161_10385820 3300017792 Bacteria 1120
444 Ga0213874_10013998 3300021377 Bacteria 2090
445 Ga0213876_10293210 3300021384 Bacteria 864
446 Ga0213876_10299062 3300021384 Bacteria 855
447 Ga0207697_10001471 3300025315 Bacteria 12871
448 Ga0207697_10174947 3300025315 Bacteria 939
449 Ga0207656_10001890 3300025321 Bacteria 6968
450 Ga0207653_10103105 3300025885 Bacteria 1011
451 Ga0207653_10136974 3300025885 Bacteria 893
452 Ga0207682_10000080 3300025893 Bacteria 42569
453 Ga0207682_10118511 3300025893 Bacteria 1172
454 Ga0207642_10004090 3300025899 Bacteria 4674
455 Ga0207642_10006999 3300025899 Bacteria 3783
456 Ga0207710_10002142 3300025900 Bacteria 9311
457 Ga0207710_10057687 3300025900 Bacteria 1754
458 Ga0207688_10000193 3300025901 Bacteria 27050
459 Ga0207688_10186102 3300025901 Bacteria 1240
460 Ga0207680_10000488 3300025903 Bacteria 18832
461 Ga0207680_10089487 3300025903 Bacteria 1954
462 Ga0207680_10288431 3300025903 Bacteria 1142
463 Ga0207647_10000872 3300025904 Bacteria 23363
464 Ga0207647_10111267 3300025904 Bacteria 1619
465 Ga0207699_10016691 3300025906 Bacteria 3847
466 Ga0207645_10000201 3300025907 Bacteria 48793
467 Ga0207645_10105690 3300025907 Bacteria 1819
468 Ga0207645_10240654 3300025907 Bacteria 1196
469 Ga0207643_10000288 3300025908 Bacteria 35045
470 Ga0207643_10023036 3300025908 Bacteria 3433
471 Ga0207643_10117201 3300025908 Bacteria 1574
472 Ga0207643_10155989 3300025908 Bacteria 1371
473 Ga0207705_10002143 3300025909 Bacteria 15311
474 Ga0207705_10028167 3300025909 Bacteria 4005
475 Ga0207705_10215213 3300025909 Unclassified 1458
476 Ga0207684_10000082 3300025910 Bacteria 178155
477 Ga0207684_10012147 3300025910 Bacteria 7495
478 Ga0207684_10034110 3300025910 Bacteria 4326
479 Ga0207684_10052399 3300025910 Bacteria 3463
480 Ga0207684_10063490 3300025910 Bacteria 3135
481 Ga0207684_10298518 3300025910 Bacteria 1389
482 Ga0207684_10341072 3300025910 Bacteria 1290
483 Ga0207654_10002723 3300025911 Bacteria 8973
484 Ga0207707_10015940 3300025912 Bacteria 6555
485 Ga0207707_10042933 3300025912 Bacteria 3945
486 Ga0207695_10014152 3300025913 Bacteria 9467
487 Ga0207695_10046350 3300025913 Bacteria 4608
488 Ga0207695_10457085 3300025913 Bacteria 1160
489 Ga0207671_10008081 3300025914 Bacteria 8988
490 Ga0207671_10104405 3300025914 Bacteria 2150
491 Ga0207693_10427080 3300025915 Bacteria 1036
492 Ga0207660_10164979 3300025917 Bacteria 1711
493 Ga0207660_10252898 3300025917 Bacteria 1391
494 Ga0207660_10266047 3300025917 Bacteria 1357
495 Ga0207660_10471352 3300025917 Bacteria 1017
496 Ga0207660_11116986 3300025917 Bacteria 642
497 Ga0207662_10000010 3300025918 Bacteria 91647
498 Ga0207662_10000724 3300025918 Bacteria 15073
499 Ga0207662_10123034 3300025918 Bacteria 1628
500 Ga0207662_10147006 3300025918 Bacteria 1497
501 Ga0207662_10147957 3300025918 Bacteria 1492
502 Ga0207662_10155517 3300025918 Bacteria 1457
503 Ga0207662_10372545 3300025918 Bacteria 963
504 Ga0207657_10000355 3300025919 Bacteria 48874
505 Ga0207657_10112814 3300025919 Bacteria 2243
506 Ga0207649_10001787 3300025920 Bacteria 12309
507 Ga0207649_10094983 3300025920 Bacteria 1960
508 Ga0207652_10019589 3300025921 Bacteria 5568
509 Ga0207652_10072618 3300025921 Bacteria 2992
510 Ga0207652_10074326 3300025921 Bacteria 2959
511 Ga0207652_10119403 3300025921 Bacteria 2345
512 Ga0207652_10258713 3300025921 Bacteria 1570
513 Ga0207652_10871682 3300025921 Bacteria 796
514 Ga0207646_10001687 3300025922 Bacteria 26847
515 Ga0207646_10011223 3300025922 Bacteria 8699
516 Ga0207646_10041927 3300025922 Bacteria 4112
517 Ga0207646_10080050 3300025922 Bacteria 2921
518 Ga0207646_10250525 3300025922 Bacteria 1600
519 Ga0207681_10000442 3300025923 Bacteria 28975
520 Ga0207681_10138377 3300025923 Bacteria 1810
521 Ga0207694_10003684 3300025924 Bacteria 12130
522 Ga0207650_10000488 3300025925 Bacteria 33011
523 Ga0207650_10045901 3300025925 Bacteria 3215
524 Ga0207650_10110697 3300025925 Bacteria 2125
525 Ga0207650_10128996 3300025925 Bacteria 1977
526 Ga0207650_10342635 3300025925 Bacteria 1228
527 Ga0207650_10365625 3300025925 Bacteria 1189
528 Ga0207659_10000546 3300025926 Bacteria 22479
529 Ga0207659_10083651 3300025926 Bacteria 2366
530 Ga0207659_10091903 3300025926 Bacteria 2268
531 Ga0207659_10173975 3300025926 Bacteria 1700
532 Ga0207659_10222107 3300025926 Bacteria 1520
533 Ga0207687_10002902 3300025927 Bacteria 11627
534 Ga0207700_10816954 3300025928 Bacteria 834
535 Ga0207644_10001444 3300025931 Bacteria 15316
536 Ga0207644_10021929 3300025931 Bacteria 4356
537 Ga0207644_10058729 3300025931 Bacteria 2781
538 Ga0207690_10010202 3300025932 Bacteria 5579
539 Ga0207690_10170598 3300025932 Bacteria 1630
540 Ga0207706_10000077 3300025933 Bacteria 102336
541 Ga0207706_10030173 3300025933 Bacteria 4838
542 Ga0207706_10212854 3300025933 Bacteria 1693
543 Ga0207686_10002327 3300025934 Bacteria 10391
544 Ga0207686_10006579 3300025934 Bacteria 6260
545 Ga0207686_10123771 3300025934 Bacteria 1764
546 Ga0207709_10018682 3300025935 Bacteria 3887
547 Ga0207709_10557905 3300025935 Bacteria 902
548 Ga0207670_10001062 3300025936 Bacteria 14484
549 Ga0207670_10001220 3300025936 Bacteria 13578
550 Ga0207670_10012407 3300025936 Bacteria 4987
551 Ga0207670_10038234 3300025936 Bacteria 3133
552 Ga0207670_10304827 3300025936 Bacteria 1248
553 Ga0207669_10001892 3300025937 Bacteria 8870
554 Ga0207669_10021456 3300025937 Bacteria 3411
555 Ga0207669_10602226 3300025937 Bacteria 893
556 Ga0207704_10000416 3300025938 Bacteria 19257
557 Ga0207704_10396915 3300025938 Bacteria 1087
558 Ga0207665_10080543 3300025939 Bacteria 2240
559 Ga0207665_10357229 3300025939 Bacteria 1104
560 Ga0207691_10000033 3300025940 Bacteria 115126
561 Ga0207691_10013617 3300025940 Bacteria 7773
562 Ga0207691_10080687 3300025940 Bacteria 2925
563 Ga0207691_10332825 3300025940 Unclassified 1301
564 Ga0207711_10000361 3300025941 Bacteria 48220
565 Ga0207711_10003737 3300025941 Bacteria 13123
566 Ga0207711_10034192 3300025941 Bacteria 4305
567 Ga0207711_10114908 3300025941 Bacteria 2398
568 Ga0207711_10946217 3300025941 Bacteria 800
569 Ga0207689_10000232 3300025942 Bacteria 49618
570 Ga0207689_10006797 3300025942 Bacteria 10066
571 Ga0207689_10029231 3300025942 Bacteria 4605
572 Ga0207689_10059700 3300025942 Bacteria 3137
573 Ga0207689_10074731 3300025942 Bacteria 2784
574 Ga0207689_10157142 3300025942 Bacteria 1874
575 Ga0207689_10488196 3300025942 Bacteria 1031
576 Ga0207661_10012101 3300025944 Bacteria 6267
577 Ga0207661_10029983 3300025944 Bacteria 4184
578 Ga0207661_10076877 3300025944 Bacteria 2743
579 Ga0207661_10294855 3300025944 Bacteria 1452
580 Ga0207679_10000113 3300025945 Bacteria 65633
581 Ga0207679_10000778 3300025945 Bacteria 20877
582 Ga0207679_10017505 3300025945 Bacteria 4783
583 Ga0207679_10074383 3300025945 Bacteria 2574
584 Ga0207679_10302735 3300025945 Bacteria 1379
585 Ga0207667_10010401 3300025949 Bacteria 10877
586 Ga0207667_10134637 3300025949 Bacteria 2545
587 Ga0207667_10548852 3300025949 Bacteria 1169
588 Ga0207651_10000643 3300025960 Bacteria 14801
589 Ga0207651_10069447 3300025960 Bacteria 2488
590 Ga0207651_10085130 3300025960 Bacteria 2293
591 Ga0207651_10102719 3300025960 Bacteria 2126
592 Ga0207651_10131554 3300025960 Bacteria 1916
593 Ga0207651_10375029 3300025960 Bacteria 1204
594 Ga0207651_10488030 3300025960 Bacteria 1063
595 Ga0207712_10002843 3300025961 Bacteria 11089
596 Ga0207712_10116119 3300025961 Bacteria 2016
597 Ga0207712_10670657 3300025961 Bacteria 903
598 Ga0207668_10004196 3300025972 Bacteria 8451
599 Ga0207668_11208638 3300025972 Bacteria 679
600 Ga0207640_10001598 3300025981 Bacteria 12183
601 Ga0207640_10469695 3300025981 Bacteria 1041
602 Ga0207640_10501309 3300025981 Bacteria 1011
603 Ga0207658_10001436 3300025986 Bacteria 18570
604 Ga0207658_10018563 3300025986 Bacteria 4805
605 Ga0207677_10000346 3300026023 Bacteria 32732
606 Ga0207677_10087515 3300026023 Bacteria 2255
607 Ga0207703_10000293 3300026035 Bacteria 54982
608 Ga0207703_10009820 3300026035 Bacteria 7507
609 Ga0207703_10032481 3300026035 Bacteria 4132
610 Ga0207703_10267979 3300026035 Bacteria 1546
611 Ga0207703_11413187 3300026035 Bacteria 669
612 Ga0207639_10000799 3300026041 Bacteria 21367
613 Ga0207639_10039698 3300026041 Bacteria 3508
614 Ga0207639_10066239 3300026041 Bacteria 2806
615 Ga0207639_10740619 3300026041 Bacteria 913
616 Ga0207639_10756289 3300026041 Bacteria 904
617 Ga0207678_10000135 3300026067 Bacteria 61373
618 Ga0207678_10003414 3300026067 Bacteria 14300
619 Ga0207678_10066085 3300026067 Bacteria 3105
620 Ga0207708_10008073 3300026075 Bacteria 7802
621 Ga0207708_10014439 3300026075 Bacteria 5911
622 Ga0207708_10386831 3300026075 Bacteria 1154
623 Ga0207708_10568671 3300026075 Bacteria 957
624 Ga0207708_10928102 3300026075 Bacteria 754
625 Ga0207702_10005231 3300026078 Bacteria 11391
626 Ga0207641_10001355 3300026088 Bacteria 24285
627 Ga0207641_10004112 3300026088 Bacteria 12683
628 Ga0207641_10033207 3300026088 Bacteria 4288
629 Ga0207641_10166263 3300026088 Bacteria 2009
630 Ga0207641_10179707 3300026088 Bacteria 1937
631 Ga0207641_10432346 3300026088 Bacteria 1269
632 Ga0207641_10849978 3300026088 Bacteria 904
633 Ga0207648_10000387 3300026089 Bacteria 48794
634 Ga0207648_10156900 3300026089 Bacteria 2009
635 Ga0207648_10192397 3300026089 Bacteria 1808
636 Ga0207648_10352440 3300026089 Bacteria 1327
637 Ga0207648_10358754 3300026089 Bacteria 1315
638 Ga0207648_10848963 3300026089 Bacteria 852
639 Ga0207676_10001108 3300026095 Bacteria 20366
640 Ga0207676_10012991 3300026095 Bacteria 5978
641 Ga0207676_10096587 3300026095 Bacteria 2439
642 Ga0207676_10116280 3300026095 Bacteria 2247
643 Ga0207676_10206202 3300026095 Bacteria 1740
644 Ga0207676_10237418 3300026095 Bacteria 1633
645 Ga0207676_10294312 3300026095 Bacteria 1480
646 Ga0207674_10000216 3300026116 Bacteria 71622
647 Ga0207674_10000789 3300026116 Bacteria 41291
648 Ga0207674_10004602 3300026116 Bacteria 16564
649 Ga0207674_10225854 3300026116 Bacteria 1820
650 Ga0207675_100000043 3300026118 Bacteria 89667
651 Ga0207675_100018706 3300026118 Bacteria 6467
652 Ga0207675_100021226 3300026118 Bacteria 6049
653 Ga0207675_100339755 3300026118 Bacteria 1470
654 Ga0207675_100765925 3300026118 Bacteria 977
655 Ga0207683_10000232 3300026121 Bacteria 49365
656 Ga0207683_10096260 3300026121 Bacteria 2639
657 Ga0207683_10275132 3300026121 Bacteria 1538
658 Ga0207698_10001633 3300026142 Bacteria 13065
659 Ga0207698_10167767 3300026142 Bacteria 1929
660 Ga0207698_10416706 3300026142 Bacteria 1288
661 Ga0207698_10651728 3300026142 Bacteria 1043
662 Ga0209588_1020651 3300027671 Bacteria 2063
663 Ga0209588_1119948 3300027671 Bacteria 842
664 Ga0209966_1008042 3300027695 Bacteria 1862
665 Ga0209813_10020500 3300027866 Bacteria 1850
666 Ga0207428_10000066 3300027907 Bacteria 150622
667 Ga0207428_10003573 3300027907 Bacteria 15016
668 Ga0207428_10030567 3300027907 Bacteria 4452
669 Ga0207428_10038271 3300027907 Bacteria 3900
670 Ga0207428_10045635 3300027907 Bacteria 3528
671 Ga0207428_10329300 3300027907 Bacteria 1126
672 Ga0268266_10001211 3300028379 Bacteria 31826
673 Ga0268265_10000746 3300028380 Bacteria 31751
674 Ga0268265_10333833 3300028380 Bacteria 1378
675 Ga0268264_10001826 3300028381 Bacteria 19449
676 Ga0268264_10005623 3300028381 Bacteria 10616
677 Ga0268264_10052727 3300028381 Bacteria 3392
678 Ga0268264_10109688 3300028381 Bacteria 2415
679 Ga0268264_10203600 3300028381 Bacteria 1812
680 Ga0268264_10250645 3300028381 Bacteria 1645
681 Ga0268264_10274595 3300028381 Bacteria 1576
682 Ga0268264_10295637 3300028381 Bacteria 1522
683 Ga0268264_11304740 3300028381 Bacteria 736
684 Ga0265328_10076356 3300031239 Bacteria 1233
685 Ga0265331_10130676 3300031250 Unclassified 1146
686 Ga0307509_10350498 3300031507 Bacteria 1200
687 Ga0307509_10635953 3300031507 Bacteria 737
688 Ga0307408_100078846 3300031548 Bacteria 2456
689 Ga0307408_100150292 3300031548 Bacteria 1838
690 Ga0307408_100564699 3300031548 Bacteria 1006
691 Ga0316575_10185778 3300031665 Bacteria 864
692 Ga0316579_10012316 3300031691 Bacteria 3657
693 Ga0265314_10062348 3300031711 Bacteria 2534
694 Ga0316576_10000571 3300031727 Bacteria 17469
695 Ga0316576_10091238 3300031727 Bacteria 2270
696 Ga0316576_10118036 3300031727 Bacteria 1991
697 Ga0316576_10134978 3300031727 Bacteria 1857
698 Ga0316576_10189662 3300031727 Bacteria 1550
699 Ga0316576_10547813 3300031727 Unclassified 848
700 Ga0316578_10052076 3300031728 Unclassified 2398
701 Ga0316578_10403012 3300031728 Bacteria 811
702 Ga0307405_10010270 3300031731 Bacteria 4839
703 Ga0307405_10079552 3300031731 Bacteria 2137
704 Ga0307405_11100274 3300031731 Bacteria 683
705 Ga0316577_10011260 3300031733 Bacteria 4844
706 Ga0307413_10004290 3300031824 Bacteria 6180
707 Ga0307413_10005701 3300031824 Bacteria 5591
708 Ga0307410_10004410 3300031852 Bacteria 7273
709 Ga0307410_10032514 3300031852 Bacteria 3358
710 Ga0307410_10132170 3300031852 Bacteria 1835
711 Ga0307406_10015109 3300031901 Bacteria 4460
712 Ga0307406_10055059 3300031901 Bacteria 2541
713 Ga0307406_10563480 3300031901 Bacteria 934
714 Ga0307407_10000390 3300031903 Bacteria 13291
715 Ga0307407_10121321 3300031903 Bacteria 1658
716 Ga0307407_10207764 3300031903 Bacteria 1316
717 Ga0307412_10005092 3300031911 Bacteria 7353
718 Ga0307412_10012047 3300031911 Bacteria 5027
719 Ga0307412_10111539 3300031911 Bacteria 1954
720 Ga0307409_100015151 3300031995 Bacteria 5046
721 Ga0307409_100196500 3300031995 Bacteria 1801
722 Ga0307409_100366838 3300031995 Bacteria 1364
723 Ga0307416_100003245 3300032002 Bacteria 9530
724 Ga0307416_100127594 3300032002 Bacteria 2282
725 Ga0307416_100153175 3300032002 Bacteria 2118
726 Ga0307416_101482350 3300032002 Bacteria 784
727 Ga0307414_10013413 3300032004 Bacteria 4878
728 Ga0307414_10405556 3300032004 Bacteria 1185
729 Ga0307411_10005104 3300032005 Bacteria 6404
730 Ga0307411_10123486 3300032005 Bacteria 1878
731 Ga0307415_100047372 3300032126 Bacteria 2893
732 Ga0307415_100275778 3300032126 Bacteria 1380
733 Ga0307415_100298038 3300032126 Bacteria 1334
734 Ga0316585_10060421 3300032137 Bacteria 1224
735 Ga0316593_10065051 3300032168 Bacteria 1253
736 Ga0316586_1018184 3300033527 Bacteria 1139
737 Ga0316588_1005437 3300033528 Bacteria 2482
738 Ga0316588_1026798 3300033528 Bacteria 1336
739 Ga0316588_1133722 3300033528 Bacteria 632
740 Ga0373950_0025172 3300034818 Bacteria 1074
741 Ga0373958_0019684 3300034819 Bacteria 1236
742 Ga0373938_0074207 3300034957 Bacteria 818
743 Ga0373928_0000364 3300035084 Bacteria 9051
744 Ga0373951_0001768 3300035091 Bacteria 5621
745 Ga0373923_0102405 3300035111 Bacteria 1264
746 Ga0373957_0152559 3300035120 Bacteria 949
747 Ga0373943_0130451 3300035170 Bacteria 1345
748 Ga0373942_0000748 3300035207 Bacteria 8962
749 Ga0316574_0069409 3300035398 Bacteria 2224
750 Ga0316574_0096912 3300035398 Bacteria 1885
751 Ga0316574_0242632 3300035398 Bacteria 1152
752 Ga0316574_0430536 3300035398 Bacteria 828
753 Ga0373931_0283074 3300035691 Bacteria 1019
754 Ga0373935_0214603 3300035692 Bacteria 1335
755 Ga0373935_0589056 3300035692 Bacteria 813
756 Ga0373935_0662119 3300035692 Bacteria 766
757 Ga0373927_0547608 3300035695 Bacteria 765
758 Ga0373947_0097489 3300035725 Bacteria 1843
759 Ga0373947_0759710 3300035725 Bacteria 662
760 Ga0373937_0042140 3300036401 Bacteria 4165
761 Ga0373937_0089841 3300036401 Bacteria 2845
762 Ga0373937_0294561 3300036401 Bacteria 1533
763 Ga0373937_1233007 3300036401 Bacteria 696
764 Ga0316582_0006842 3300036647 Bacteria 6027
765 Ga0316584_0003185 3300036712 Bacteria 10619
766 Ga0316584_0004679 3300036712 Bacteria 9073
767 Ga0316584_0087127 3300036712 Bacteria 2337
768 Ga0316584_0199422 3300036712 Bacteria 1477
769 Ga0316584_0216498 3300036712 Bacteria 1409
770 Ga0373925_0016770 3300037068 Bacteria 5305
771 Ga0373925_0178606 3300037068 Bacteria 1679
772 Ga0373925_0302684 3300037068 Bacteria 1291
773 Ga0395900_0318262 3300037418 Bacteria 1537
774 Ga0395905_0092776 3300037471 Bacteria 2832
775 Ga0395905_0653400 3300037471 Bacteria 953
776 Ga0316581_0001924 3300037588 Bacteria 4851
777 Ga0436364_0008364 3300037853 Bacteria 829
778 Ga0436364_0785716 3300037853 Bacteria 836
779 Ga0395901_0285210 3300038443 Bacteria 1715
780 Ga0400490_13757 3300038726 Bacteria 14776
781 Ga0400491_08082 3300038727 Bacteria 2949
782 Ga0436365_1032345 3300039437 Bacteria 804
783 Ga0436365_1202894 3300039437 Bacteria 2765
784 Ga0436365_1649219 3300039437 Bacteria 848
785 Ga0436360_0285177 3300039438 Bacteria 867
786 Ga0436363_0234091 3300039450 Bacteria 2028
787 Ga0436363_0734767 3300039450 Bacteria 3188
788 Ga0436363_0869589 3300039450 Bacteria 639
789 Ga0436362_1216711 3300039453 Bacteria 1289
790 Ga0439461_0036136 3300041410 Bacteria 1051
791 Ga0451802_2142220 3300041460 Bacteria 849
792 Ga0451851_0565194 3300041507 Bacteria 1227
793 Ga0439448_0029359 3300042005 Bacteria 1740
794 Ga0451577_0000055 3300042876 Bacteria 276883
795 Ga0451577_0000367 3300042876 Bacteria 84000
796 Ga0451577_0000719 3300042876 Bacteria 51351
797 Ga0451577_0001213 3300042876 Bacteria 36010
798 Ga0451577_0008605 3300042876 Bacteria 9922
799 Ga0451577_0013694 3300042876 Bacteria 7580
800 Ga0451577_0016029 3300042876 Bacteria 6952
801 Ga0451577_0019977 3300042876 Bacteria 6153
802 Ga0451577_0047528 3300042876 Bacteria 3837
803 Ga0451577_0414733 3300042876 Bacteria 1222
804 Ga0451577_0606827 3300042876 Bacteria 993
805 Ga0451577_0694823 3300042876 Bacteria 921
806 Ga0451577_1068605 3300042876 Bacteria 723
807 Ga0466969_0006121 3300044656 Bacteria 6406
808 Ga0453683_0000009 3300044673 Bacteria 491115
809 Ga0453683_0000447 3300044673 Bacteria 47447
810 Ga0453683_0001018 3300044673 Bacteria 26323
811 Ga0453683_0001209 3300044673 Bacteria 23211
812 Ga0453683_0005262 3300044673 Bacteria 9056
813 Ga0453683_0006058 3300044673 Bacteria 8332
814 Ga0453683_0009627 3300044673 Bacteria 6444
815 Ga0453683_0030930 3300044673 Bacteria 3383
816 Ga0453683_0044600 3300044673 Bacteria 2782
817 Ga0453683_0049222 3300044673 Bacteria 2642
818 Ga0453683_0154651 3300044673 Bacteria 1450
819 Ga0453683_0185205 3300044673 Bacteria 1321
820 Ga0453683_0185710 3300044673 Bacteria 1319
821 Ga0453683_0216198 3300044673 Bacteria 1218
822 Ga0453683_0319035 3300044673 Bacteria 995
823 Ga0453683_0383148 3300044673 Bacteria 905
824 Ga0453683_0445324 3300044673 Bacteria 837
825 Ga0466966_0056924 3300044684 Bacteria 2472
826 Ga0453684_0000183 3300044712 Bacteria 277052
827 Ga0453684_0000231 3300044712 Bacteria 241070
828 Ga0453684_0000708 3300044712 Bacteria 118229
829 Ga0453684_0001148 3300044712 Bacteria 82674
830 Ga0453684_0001201 3300044712 Bacteria 79902
831 Ga0453684_0005000 3300044712 Bacteria 26945
832 Ga0453684_0006456 3300044712 Bacteria 22262
833 Ga0453684_0006467 3300044712 Bacteria 22238
834 Ga0453684_0021145 3300044712 Bacteria 9748
835 Ga0453684_0026432 3300044712 Bacteria 8382
836 Ga0453684_0053056 3300044712 Bacteria 5295
837 Ga0453684_0059202 3300044712 Bacteria 4940
838 Ga0453684_0061655 3300044712 Bacteria 4812
839 Ga0453684_0073803 3300044712 Bacteria 4299
840 Ga0453684_0087309 3300044712 Bacteria 3866
841 Ga0453684_0123107 3300044712 Bacteria 3127
842 Ga0453684_0140816 3300044712 Bacteria 2880
843 Ga0453684_0203766 3300044712 Bacteria 2304
844 Ga0453684_0207576 3300044712 Bacteria 2279
845 Ga0453684_0233225 3300044712 Bacteria 2123
846 Ga0453684_0286579 3300044712 Bacteria 1876
847 Ga0453684_0389891 3300044712 Bacteria 1562
848 Ga0453684_0549611 3300044712 Bacteria 1272
849 Ga0453684_1135971 3300044712 Bacteria 823
850 Ga0466970_0171959 3300044765 Bacteria 1201
851 Ga0466957_0434857 3300044842 Bacteria 902
852 Ga0466957_0602300 3300044842 Bacteria 769
853 Ga0466960_0103755 3300044901 Bacteria 1468
854 Ga0466960_0248757 3300044901 Bacteria 987
855 Ga0466959_0107785 3300045049 Bacteria 1991
856 Ga0451576_0000960 3300045051 Bacteria 53994
857 Ga0451576_0006783 3300045051 Bacteria 13929
858 Ga0451576_0031983 3300045051 Bacteria 5607
859 Ga0451576_0035311 3300045051 Bacteria 5305
860 Ga0451576_0068403 3300045051 Bacteria 3695
861 Ga0451576_0231565 3300045051 Bacteria 1930
862 Ga0451576_0247658 3300045051 Bacteria 1862
863 Ga0451576_0280225 3300045051 Bacteria 1743
864 Ga0451576_0428983 3300045051 Bacteria 1387
865 Ga0451576_0429386 3300045051 Bacteria 1386
866 Ga0451576_0468345 3300045051 Bacteria 1323
867 Ga0451576_0564563 3300045051 Bacteria 1196
868 Ga0451576_1032390 3300045051 Bacteria 861
869 Ga0451576_1054070 3300045051 Bacteria 851
870 Ga0451576_1114371 3300045051 Bacteria 826
871 Ga0451576_1644521 3300045051 Bacteria 666
872 Ga0466967_1126286 3300045976 Bacteria 782
873 Ga0495603_0048476 3300046455 Bacteria 2529
874 Ga0495629_0531544 3300046459 Unclassified 791
875 Ga0495580_0000526 3300046472 Bacteria 32324
876 Ga0495580_0026753 3300046472 Bacteria 4202
877 Ga0495580_0116384 3300046472 Bacteria 1856
878 Ga0495662_0179976 3300046476 Bacteria 1042
879 Ga0495594_0058562 3300046499 Bacteria 2129
880 Ga0495628_0267199 3300046516 Bacteria 1273
881 Ga0495630_0022980 3300046517 Bacteria 4607
882 Ga0495632_0029727 3300046519 Bacteria 2842
883 Ga0495586_0032660 3300046535 Bacteria 2791
884 Ga0495586_0199984 3300046535 Bacteria 1133
885 Ga0495635_0000345 3300046663 Bacteria 29623
886 Ga0495588_0033173 3300046674 Bacteria 2606
887 Ga0495657_0059717 3300046675 Bacteria 2529
888 Ga0495647_0005029 3300046681 Bacteria 4330
889 Ga0495658_0276131 3300046683 Bacteria 1060
890 Ga0495613_0179705 3300046689 Bacteria 1499
891 Ga0495624_0608065 3300046690 Bacteria 651
892 Ga0495670_0374264 3300046691 Unclassified 768
893 Ga0495581_0124594 3300047315 Bacteria 1500
894 Ga0495636_0030061 3300047318 Bacteria 2219
895 Ga0495636_0138289 3300047318 Bacteria 1087
896 Ga0495672_0002923 3300047320 Bacteria 15089
897 Ga0495680_0001236 3300047322 Bacteria 28036
898 Ga0495684_0002900 3300047471 Bacteria 13507
899 Ga0495593_0206679 3300047673 Bacteria 986
900 Ga0495602_0042983 3300048088 Bacteria 4113
901 Ga0495615_0006706 3300048090 Bacteria 2150
902 Ga0496100_0428587 3300048903 Bacteria 1011
903 Ga0496101_0389823 3300048904 Bacteria 1096
904 Ga0496103_0076339 3300048906 Bacteria 2102
905 Ga0496105_0166973 3300048908 Bacteria 1806
906 Ga0496106_0002331 3300048909 Bacteria 14158
907 Ga0496107_0011103 3300048910 Bacteria 6267
908 Ga0496108_0054456 3300048911 Bacteria 3357
909 Ga0496109_0021723 3300048912 Bacteria 5679
910 Ga0496109_0970825 3300048912 Bacteria 787
911 Ga0496111_0226089 3300048914 Bacteria 1390
912 Ga0496112_0009800 3300048915 Bacteria 8653
913 Ga0496112_0520331 3300048915 Bacteria 1124
914 Ga0496113_0007328 3300048916 Bacteria 7084
915 Ga0496114_0027564 3300048917 Bacteria 4655
916 Ga0496124_0195838 3300048927 Bacteria 1542
917 Ga0501291_024093 3300049514 Bacteria 987
918 Ga0501296_008287 3300049519 Bacteria 1202
919 Ga0501298_012478 3300049521 Bacteria 1490
920 Ga0501031_0633145 3300049568 Bacteria 688
921 Ga0501034_0000138 3300049571 Bacteria 136415
922 Ga0501034_0359979 3300049571 Bacteria 1382
923 Ga0501034_0653265 3300049571 Bacteria 953
924 Ga0501041_0062629 3300049577 Bacteria 2278
925 Ga0501042_0065368 3300049578 Bacteria 2599
926 Ga0501042_0090296 3300049578 Bacteria 2199
927 Ga0501042_0496587 3300049578 Bacteria 886
928 Ga0501042_0731528 3300049578 Bacteria 720
929 Ga0501043_0334578 3300049579 Bacteria 1153
930 Ga0501043_0571376 3300049579 Bacteria 838
931 Ga0501048_0048410 3300049582 Bacteria 3032
932 Ga0501048_0121450 3300049582 Bacteria 1846
933 Ga0501072_0069148 3300049588 Bacteria 2788
934 Ga0501072_0786644 3300049588 Bacteria 746
935 Ga0501073_0037298 3300049589 Bacteria 3452
936 Ga0501075_0166492 3300049591 Bacteria 1682
937 Ga0501076_0060042 3300049592 Bacteria 3025
938 Ga0501076_0230862 3300049592 Bacteria 1513
939 Ga0501076_0300610 3300049592 Bacteria 1316
940 Ga0501076_0565290 3300049592 Bacteria 938
941 Ga0501077_0417037 3300049593 Bacteria 859
942 Ga0501077_0555473 3300049593 Bacteria 737
943 Ga0501202_027360 3300049652 Bacteria 1172
944 Ga0501207_030797 3300049654 Bacteria 901
945 Ga0501209_030028 3300049656 Bacteria 1371
946 Ga0501209_070873 3300049656 Bacteria 991
947 Ga0501217_045142 3300049661 Bacteria 1134
948 Ga0501223_043025 3300049663 Bacteria 876
949 Ga0501224_041028 3300049664 Bacteria 700
950 Ga0501227_000384 3300049665 Bacteria 9346
951 Ga0501227_031827 3300049665 Bacteria 1270
952 Ga0501230_000839 3300049667 Bacteria 3410
953 Ga0501233_007105 3300049668 Bacteria 2125
954 Ga0501233_022515 3300049668 Bacteria 1362
955 Ga0501233_039927 3300049668 Bacteria 1099
956 Ga0501233_139937 3300049668 Bacteria 668
957 Ga0501238_013476 3300049671 Bacteria 1114
958 Ga0501239_001848 3300049672 Bacteria 1868
959 Ga0501242_012369 3300049674 Bacteria 1039
960 Ga0501243_055606 3300049675 Bacteria 723
961 Ga0501247_004759 3300049677 Bacteria 1496
962 Ga0501250_057221 3300049680 Bacteria 614
963 Ga0501256_013699 3300049685 Bacteria 800
964 Ga0501257_009666 3300049686 Bacteria 2181
965 Ga0501257_036859 3300049686 Bacteria 1192
966 Ga0501260_008761 3300049689 Bacteria 999
967 Ga0501225_0001801 3300049705 Bacteria 6707
968 Ga0501225_0011619 3300049705 Bacteria 2477
969 Ga0501225_0028030 3300049705 Bacteria 1548
970 Ga0501081_0051507 3300049743 Bacteria 2839
971 Ga0501081_0544375 3300049743 Bacteria 867
972 Ga0501263_009473 3300049760 Bacteria 1179
973 Ga0501267_001656 3300049764 Bacteria 1938
974 Ga0501268_010071 3300049765 Bacteria 1464
975 Ga0501270_000196 3300049767 Bacteria 5067
976 Ga0501273_005822 3300049770 Bacteria 1406
977 Ga0501035_0000091 3300049822 Bacteria 111687
978 Ga0501044_0185691 3300049823 Bacteria 2044
979 nmdc:mga03683_17877_c1 3300050489 Bacteria 2689
980 nmdc:mga03683_366317_c1 3300050489 Bacteria 684
981 nmdc:mga00v17_12078_c1 3300050491 Bacteria 4757
982 nmdc:mga00v17_125796_c1 3300050491 Unclassified 1635
983 nmdc:mga0yw44_93133_c1 3300050492 Bacteria 1908
984 nmdc:mga0k408_877_c1 3300050493 Bacteria 16543
985 nmdc:mga04h51_28980_c1 3300050495 Bacteria 1731
986 nmdc:mga07m45_85832_c1 3300050496 Bacteria 1800
987 nmdc:mga05p37_1040930_c1 3300050507 Bacteria 865
988 nmdc:mga05p37_198676_c1 3300050507 Bacteria 2430
989 nmdc:mga05p37_201648_c1 3300050507 Bacteria 2409
990 nmdc:mga05p37_205021_c1 3300050507 Bacteria 2386
991 nmdc:mga05p37_2115_c1 3300050507 Bacteria 23196
992 nmdc:mga05p37_243438_c1 3300050507 Bacteria 2161
993 nmdc:mga05p37_409416_c1 3300050507 Bacteria 1581
994 nmdc:mga05p37_510592_c1 3300050507 Bacteria 1377
995 nmdc:mga05p37_77002_c1 3300050507 Bacteria 4106
996 nmdc:mga05p37_89813_c1 3300050507 Bacteria 3786
997 nmdc:mga09592_165499_c1 3300050508 Bacteria 1911
998 nmdc:mga09592_18910_c1 3300050508 Bacteria 5652
999 nmdc:mga09592_25768_c1 3300050508 Bacteria 4869
1000 nmdc:mga09592_31560_c1 3300050508 Bacteria 4415
1001 nmdc:mga09592_343217_c1 3300050508 Bacteria 1293
1002 nmdc:mga09592_378270_c1 3300050508 Unclassified 1224
1003 nmdc:mga09592_674461_c1 3300050508 Bacteria 881
1004 nmdc:mga09592_68522_c1 3300050508 Bacteria 3009
1005 nmdc:mga09592_74244_c1 3300050508 Bacteria 2890
1006 nmdc:mga09592_908625_c1 3300050508 Bacteria 740
1007 nmdc:mga0qj67_212258_c1 3300050509 Bacteria 1572
1008 nmdc:mga0qj67_340464_c1 3300050509 Bacteria 1213
1009 nmdc:mga0qj67_384057_c1 3300050509 Bacteria 1134
1010 nmdc:mga0qj67_701284_c1 3300050509 Bacteria 805
1011 nmdc:mga06r32_1271512_c1 3300050510 Bacteria 680
1012 nmdc:mga06r32_139754_c1 3300050510 Bacteria 2397
1013 nmdc:mga06r32_17594_c1 3300050510 Bacteria 6528
1014 nmdc:mga06r32_232991_c1 3300050510 Bacteria 1829
1015 nmdc:mga06r32_39808_c1 3300050510 Bacteria 4461
1016 nmdc:mga06r32_527866_c1 3300050510 Bacteria 1156
1017 nmdc:mga06r32_58870_c1 3300050510 Bacteria 3693
1018 nmdc:mga06r32_649271_c1 3300050510 Bacteria 1023
1019 nmdc:mga06r32_723910_c1 3300050510 Bacteria 959
1020 nmdc:mga06r32_992491_c1 3300050510 Bacteria 793
1021 nmdc:mga08y16_14759_c1 3300050511 Bacteria 8214
1022 nmdc:mga08y16_166471_c1 3300050511 Bacteria 2290
1023 nmdc:mga08y16_1926_c1 3300050511 Bacteria 21179
1024 nmdc:mga08y16_197718_c1 3300050511 Bacteria 2084
1025 nmdc:mga08y16_32231_c1 3300050511 Bacteria 5510
1026 nmdc:mga08y16_34477_c1 3300050511 Bacteria 5317
1027 nmdc:mga08y16_46328_c1 3300050511 Bacteria 4552
1028 nmdc:mga08y16_5852_c1 3300050511 Bacteria 12882
1029 nmdc:mga08y16_61606_c1 3300050511 Bacteria 3918
1030 nmdc:mga08y16_794389_c1 3300050511 Bacteria 940
1031 nmdc:mga08y16_96473_c1 3300050511 Bacteria 3079
1032 nmdc:mga0n895_156417_c1 3300050512 Bacteria 2310
1033 nmdc:mga0n895_2222_c1 3300050512 Bacteria 15003
1034 nmdc:mga0n895_50493_c1 3300050512 Bacteria 4078
1035 nmdc:mga0n895_56880_c1 3300050512 Bacteria 3855
1036 nmdc:mga0rr50_1642_c1 3300050513 Bacteria 12315
1037 nmdc:mga0rr50_179685_c1 3300050513 Bacteria 1729
1038 nmdc:mga0rr50_18696_c1 3300050513 Bacteria 4661
1039 nmdc:mga0rr50_433843_c1 3300050513 Bacteria 1112
1040 nmdc:mga08x19_6947_c1 3300050514 Bacteria 6723
1041 nmdc:mga0a205_16510_c2 3300050515 Bacteria 6587
1042 nmdc:mga0a205_308506_c1 3300050515 Bacteria 1455
1043 nmdc:mga0a205_65914_c1 3300050515 Bacteria 3500
1044 nmdc:mga0a205_729526_c1 3300050515 Bacteria 840
1045 nmdc:mga0a205_73070_c1 3300050515 Bacteria 3314
1046 nmdc:mga0a205_83402_c1 3300050515 Bacteria 3087
1047 nmdc:mga0a205_95_c1 3300050515 Bacteria 49929
1048 nmdc:mga0a205_96777_c1 3300050515 Bacteria 2851
1049 nmdc:mga0a205_99848_c1 3300050515 Bacteria 2801
1050 nmdc:mga0sz30_86701_c1 3300050516 Bacteria 1359
1051 Ga0495619_0169293 3300053085 Bacteria 1510
1052 Ga0500646_0127456 3300053090 Bacteria 824
1053 Ga0500645_016909 3300053730 Bacteria 2292
1054 Ga0501084_0200171 3300054114 Bacteria 1685
1055 Ga0501084_0870255 3300054114 Bacteria 758
1056 Ga0587083_0066021 3300059505 Bacteria 828
1057 Ga0587092_009046 3300059512 Bacteria 1330
1058 Ga0587109_024001 3300059624 Bacteria 1110
1059 Ga0587068_008833 3300059641 Bacteria 1470
1060 Ga0587068_075967 3300059641 Bacteria 671
1061 Ga0501082_0657543 3300060353 Bacteria 917
1062 Ga0530510_0018759 3300061734 Bacteria 4907
1063 Ga0075434_100165338
1064 SwRhRL2b_contig_2993171
1065 SwRhRL2b_contig_3228964
1066 JGI24736J21556_1012294
1067 JGI24752J21851_1005311
1068 JGI24747J21853_1001607
1069 JGI24737J22298_10037376
1070 JGI24743J22301_10002545
1071 JGI24749J21850_1006274
1072 JGI24744J21845_10015891
1073 JGI24034J26672_10001759
1074 JGI25404J52841_10006515
1075 JGI25404J52841_10016843
1076 Ga0058859_11637650
1077 Ga0058860_11963019
1078 Ga0065704_10090655
1079 Ga0065712_10117738
1080 Ga0065712_10246565
1081 Ga0065715_10125440
1082 Ga0065715_10295490
1083 Ga0065707_10034469
1084 Ga0065707_10083282
1085 Ga0065707_10163868
1086 Ga0070658_10004055
1087 Ga0070658_10275107
1088 Ga0070676_10000791
1089 Ga0070676_10195943
1090 Ga0070683_100003498
1091 Ga0070683_100006454
1092 Ga0070683_100007872
1093 Ga0070683_100037675
1094 Ga0070683_100201708
1095 Ga0070683_100335339
1096 Ga0070683_100576189
1097 Ga0070690_100000173
1098 Ga0070690_100002627
1099 Ga0070670_100007248
1100 Ga0070670_100048275
1101 Ga0070670_100051828
1102 Ga0070670_100127286
1103 Ga0070670_100141642
1104 Ga0070677_10000335
1105 Ga0070677_10254713
1106 Ga0070677_10260061
1107 Ga0068869_100002272
1108 Ga0068869_100032209
1109 Ga0068869_100056978
1110 Ga0068869_100151380
1111 Ga0070666_10006566
1112 Ga0070666_10010448
1113 Ga0070666_10199963
1114 Ga0070680_100010627
1115 Ga0070680_100051322
1116 Ga0070680_100226144
1117 Ga0070680_100328122
1118 Ga0070680_100622559
1119 Ga0068868_100014498
1120 Ga0068868_100145610
1121 Ga0070660_100000446
1122 Ga0070660_100185209
1123 Ga0070689_100000301
1124 Ga0070689_100002383
1125 Ga0070689_100008591
1126 Ga0070689_100014544
1127 Ga0070689_100088031
1128 Ga0070689_100091432
1129 Ga0070689_100671249
1130 Ga0070689_100818007
1131 Ga0070691_10093131
1132 Ga0070687_100002906
1133 Ga0070687_100093275
1134 Ga0070687_100369879
1135 Ga0070661_100001682
1136 Ga0070661_100017308
1137 Ga0070661_100752456
1138 Ga0070692_10023861
1139 Ga0070692_10078478
1140 Ga0070692_10155760
1141 Ga0070668_100000515
1142 Ga0070668_100196447
1143 Ga0070668_100308698
1144 Ga0070668_101243331
1145 Ga0070669_100006572
1146 Ga0070675_100005229
1147 Ga0070675_100006848
1148 Ga0070675_100508331
1149 Ga0070675_100527896
1150 Ga0070671_100008619
1151 Ga0070671_100041960
1152 Ga0070671_100065291
1153 Ga0070671_100104373
1154 Ga0070674_100001025
1155 Ga0070674_100011419
1156 Ga0070673_100002555
1157 Ga0070673_100095828
1158 Ga0070673_100833407
1159 Ga0070688_100000337
1160 Ga0070688_100065217
1161 Ga0070688_100138736
1162 Ga0070688_100622201
1163 Ga0070659_100014210
1164 Ga0070659_100016359
1165 Ga0070659_100575971
1166 Ga0070667_100020902
1167 Ga0070667_100092799
1168 Ga0070667_100144918
1169 Ga0070703_10177192
1170 Ga0070709_10182262
1171 Ga0070709_10310270
1172 Ga0070701_10001375
1173 Ga0070701_10129943
1174 Ga0070701_10161639
1175 Ga0070705_100003382
1176 Ga0070705_100086834
1177 Ga0070705_100240582
1178 Ga0070705_100559924
1179 Ga0070694_100595055
1180 Ga0070708_100001005
1181 Ga0070708_100003824
1182 Ga0070708_100021563
1183 Ga0070708_100025768
1184 Ga0070708_100535893
1185 Ga0070663_100001223
1186 Ga0070663_100012814
1187 Ga0070663_100048666
1188 Ga0070678_100000534
1189 Ga0070678_100502731
1190 Ga0070662_100004041
1191 Ga0070662_100055389
1192 Ga0070681_10000914
1193 Ga0070681_10037633
1194 Ga0070681_10169684
1195 Ga0068867_100001235
1196 Ga0068867_100004895
1197 Ga0068867_100429025
1198 Ga0070685_10001620
1199 Ga0070685_10166454
1200 Ga0070685_10504541
1201 Ga0070706_100000043
1202 Ga0070706_100032130
1203 Ga0070706_100035178
1204 Ga0070706_100091217
1205 Ga0070706_100259547
1206 Ga0070707_100002825
1207 Ga0070707_100014607
1208 Ga0070707_100075390
1209 Ga0070707_100294685
1210 Ga0070707_101037032
1211 Ga0070707_101167769
1212 Ga0070698_100006131
1213 Ga0070698_100009868
1214 Ga0070698_100013571
1215 Ga0070698_100018446
1216 Ga0070698_100040058
1217 Ga0070698_100624018
1218 Ga0070698_100717095
1219 Ga0070699_100021214
1220 Ga0070699_100026821
1221 Ga0070699_100050911
1222 Ga0070699_100059560
1223 Ga0070699_100570201
1224 Ga0070699_100758482
1225 Ga0070679_100019461
1226 Ga0070679_100037243
1227 Ga0070679_100066469
1228 Ga0070679_100102242
1229 Ga0070679_100264069
1230 Ga0070679_100690168
1231 Ga0070684_100011443
1232 Ga0070684_100470088
1233 Ga0070697_100011124
1234 Ga0070697_100030991
1235 Ga0070697_100032757
1236 Ga0070697_100065783
1237 Ga0070697_100178824
1238 Ga0068853_100001918
1239 Ga0068853_100005814
1240 Ga0068853_100029091
1241 Ga0068853_100634735
1242 Ga0068853_100880133
1243 Ga0070672_100002014
1244 Ga0070672_100049259
1245 Ga0070672_100185319
1246 Ga0070672_100239392
1247 Ga0070672_100299155
1248 Ga0070686_100000627
1249 Ga0070686_100008800
1250 Ga0070686_100257910
1251 Ga0070695_100020681
1252 Ga0070695_100186424
1253 Ga0070695_100187219
1254 Ga0070695_100213356
1255 Ga0070695_100403865
1256 Ga0070695_100461028
1257 Ga0070695_100463118
1258 Ga0070695_100625343
1259 Ga0070696_100027834
1260 Ga0070696_100346245
1261 Ga0070696_100677182
1262 Ga0070693_100006471
1263 Ga0070693_100466706
1264 Ga0070665_100017189
1265 Ga0070665_100299743
1266 Ga0070704_100019612
1267 Ga0070704_100068741
1268 Ga0070704_100089480
1269 Ga0070704_100303029
1270 Ga0070704_100447390
1271 Ga0070704_100644604
1272 Ga0070704_100713098
1273 Ga0068855_100001561
1274 Ga0068855_100506249
1275 Ga0070664_100003152
1276 Ga0070664_100005560
1277 Ga0070664_100114162
1278 Ga0070664_100785848
1279 Ga0068857_100004750
1280 Ga0068857_100012635
1281 Ga0068854_100001664
1282 Ga0068854_100153251
1283 Ga0068854_100348902
1284 Ga0068856_100013372
1285 Ga0068856_100295516
1286 Ga0070702_100042252
1287 Ga0070702_100260909
1288 Ga0070702_100570301
1289 Ga0068852_100000820
1290 Ga0068852_100432678
1291 Ga0068859_100008142
1292 Ga0068859_100014777
1293 Ga0068859_100021993
1294 Ga0068859_100022725
1295 Ga0068864_100000877
1296 Ga0068864_100033632
1297 Ga0068864_100036288
1298 Ga0068864_100087989
1299 Ga0068864_100093330
1300 Ga0068866_10002290
1301 Ga0068866_10146078
1302 Ga0068861_100002462
1303 Ga0068861_100078739
1304 Ga0068861_100146225
1305 Ga0068851_10000329
1306 Ga0068851_10053978
1307 Ga0068851_10078463
1308 Ga0068870_10000995
1309 Ga0068870_10032952
1310 Ga0068870_10081731
1311 Ga0068870_10113366
1312 Ga0068863_100002073
1313 Ga0068863_100007415
1314 Ga0068863_100034529
1315 Ga0068863_100053099
1316 Ga0068863_100067006
1317 Ga0068863_100339481
1318 Ga0068858_100006820
1319 Ga0068858_100046071
1320 Ga0068858_101255888
1321 Ga0068860_100022816
1322 Ga0068860_100024643
1323 Ga0068860_100028437
1324 Ga0068860_100404096
1325 Ga0068860_100625033
1326 Ga0068860_101491300
1327 Ga0068862_100007441
1328 Ga0068862_100146207
1329 Ga0068862_101140204
1330 Ga0081540_1000069
1331 Ga0081540_1000351
1332 Ga0081540_1000908
1333 Ga0081539_10242516
1334 Ga0075365_10027167
1335 Ga0075368_10020705
1336 Ga0075363_100017936
1337 Ga0075364_10018518
1338 Ga0075364_10165367
1339 Ga0075364_10324811
1340 Ga0070715_10106652
1341 Ga0070716_100051764
1342 Ga0075362_10015000
1343 Ga0075367_10101138
1344 Ga0075367_10360888
1345 Ga0075366_10008588
1346 Ga0097621_100006872
1347 Ga0097621_100146294
1348 Ga0097621_100248640
1349 Ga0097621_100866738
1350 Ga0075370_10066161
1351 Ga0068871_100005294
1352 Ga0068871_100175878
1353 Ga0068871_100463594
1354 Ga0068871_101252873
1355 Ga0075428_100160445
1356 Ga0075428_100596037
1357 Ga0075428_100751671
1358 Ga0075430_100667875
1359 Ga0075430_100887003
1360 Ga0075431_100015466
1361 Ga0075431_100100008
1362 Ga0075431_100319805
1363 Ga0075431_100369468
1364 Ga0075431_100852738
1365 Ga0075431_100856215
1366 Ga0075433_10013757
1367 Ga0075433_10058316
1368 Ga0075433_10075065
1369 Ga0075433_10097710
1370 Ga0075433_10435781
1371 Ga0075434_100001372
1372 Ga0075434_100050388
1373 Ga0075434_100067401
1374 Ga0075434_100305383
1375 Ga0075434_101218286
1376 Ga0075429_100002216
1377 Ga0075429_100013252
1378 Ga0075429_100045120
1379 Ga0075429_100138855
1380 Ga0075429_100270021
1381 Ga0075429_100311193
1382 Ga0068865_100000473
1383 Ga0075436_100010502
1384 Ga0075436_100113096
1385 Ga0097620_100008142
1386 Ga0097620_100014777
1387 Ga0097620_100021992
1388 Ga0097620_100022726
1389 Ga0075435_100002976
1390 Ga0075435_100026418
1391 Ga0075435_100065515
1392 Ga0099794_10004638
1393 Ga0099794_10034889
1394 Ga0099794_10066522
1395 Ga0105251_10060549
1396 Ga0105251_10211960
1397 Ga0105250_10022522
1398 Ga0105240_10006880
1399 Ga0105240_10019430
1400 Ga0105240_11001788
1401 Ga0111539_10001125
1402 Ga0111539_10002191
1403 Ga0111539_10004600
1404 Ga0111539_10005878
1405 Ga0111539_10009303
1406 Ga0111539_10034441
1407 Ga0111539_10141815
1408 Ga0111539_10208233
1409 Ga0111539_10241595
1410 Ga0111539_10325107
1411 Ga0111539_10369264
1412 Ga0111539_10573122
1413 Ga0111539_11033788
1414 Ga0111539_11594635
1415 Ga0105245_10000280
1416 Ga0105247_10001217
1417 Ga0105247_10021299
1418 Ga0105247_10449534
1419 Ga0114129_10003496
1420 Ga0114129_10059043
1421 Ga0114129_10110997
1422 Ga0114129_10142484
1423 Ga0114129_10297523
1424 Ga0114129_10299938
1425 Ga0114129_10547448
1426 Ga0114129_10719718
1427 Ga0105243_10013838
1428 Ga0105243_10133539
1429 Ga0105243_10974880
1430 Ga0105241_10053970
1431 Ga0105241_10748940
1432 Ga0105241_10943676
1433 Ga0105242_10001087
1434 Ga0105242_10005006
1435 Ga0105242_10012725
1436 Ga0105248_10001972
1437 Ga0105248_10037724
1438 Ga0105248_10045413
1439 Ga0105248_10051859
1440 Ga0105248_10096999
1441 Ga0105248_10205584
1442 Ga0105248_11419510
1443 Ga0105237_10000240
1444 Ga0105238_10000523
1445 Ga0105238_10936748
1446 Ga0105249_10000800
1447 Ga0105249_10272084
1448 Ga0105249_10648223
1449 Ga0105249_10663371
1450 Ga0105249_11056581
1451 Ga0105249_11942645
1452 Ga0105239_10011955
1453 Ga0105239_10019911
1454 Ga0105239_10955366
1455 Ga0105246_10011693
1456 Ga0157373_10006799
1457 Ga0157373_10128296
1458 Ga0157371_10000524
1459 Ga0157371_10315084
1460 Ga0157371_10626892
1461 Ga0157370_10014435
1462 Ga0157369_10002563
1463 Ga0157369_10079420
1464 Ga0157374_10023849
1465 Ga0157374_10328832
1466 Ga0157374_10337316
1467 Ga0157374_11015084
1468 Ga0157378_10000561
1469 Ga0157378_10097339
1470 Ga0157378_10098188
1471 Ga0157378_10243319
1472 Ga0157378_10320346
1473 Ga0163162_10006460
1474 Ga0163162_10108306
1475 Ga0163162_10164827
1476 Ga0163162_10180421
1477 Ga0157372_10005105
1478 Ga0157372_10054768
1479 Ga0157372_11561022
1480 Ga0157372_11900332
1481 Ga0157375_10001595
1482 Ga0157375_10034842
1483 Ga0157375_10106091
1484 Ga0157375_10107589
1485 Ga0157375_10432966
1486 Ga0163163_10006280
1487 Ga0163163_10008551
1488 Ga0163163_10042874
1489 Ga0163163_10047994
1490 Ga0163163_10177816
1491 Ga0157380_10022874
1492 Ga0157380_10024880
1493 Ga0157380_10133837
1494 Ga0157380_10147089
1495 Ga0157377_10000250
1496 Ga0157377_10112383
1497 Ga0157379_10000550
1498 Ga0157379_10007710
1499 Ga0157376_10015355
1500 Ga0157376_10046094
1501 Ga0182007_10056614
1502 Ga0163161_10004000
1503 Ga0163161_10006234
1504 Ga0163161_10012463
1505 Ga0163161_10385820
1506 Ga0213874_10013998
1507 Ga0213876_10293210
1508 Ga0213876_10299062
1509 Ga0207697_10001471
1510 Ga0207697_10174947
1511 Ga0207656_10001890
1512 Ga0207653_10103105
1513 Ga0207653_10136974
1514 Ga0207682_10000080
1515 Ga0207682_10118511
1516 Ga0207642_10004090
1517 Ga0207642_10006999
1518 Ga0207710_10002142
1519 Ga0207710_10057687
1520 Ga0207688_10000193
1521 Ga0207688_10186102
1522 Ga0207680_10000488
1523 Ga0207680_10089487
1524 Ga0207680_10288431
1525 Ga0207647_10000872
1526 Ga0207647_10111267
1527 Ga0207699_10016691
1528 Ga0207645_10000201
1529 Ga0207645_10105690
1530 Ga0207645_10240654
1531 Ga0207643_10000288
1532 Ga0207643_10023036
1533 Ga0207643_10117201
1534 Ga0207643_10155989
1535 Ga0207705_10002143
1536 Ga0207705_10028167
1537 Ga0207705_10215213
1538 Ga0207684_10000082
1539 Ga0207684_10012147
1540 Ga0207684_10034110
1541 Ga0207684_10052399
1542 Ga0207684_10063490
1543 Ga0207684_10298518
1544 Ga0207684_10341072
1545 Ga0207654_10002723
1546 Ga0207707_10015940
1547 Ga0207707_10042933
1548 Ga0207695_10014152
1549 Ga0207695_10046350
1550 Ga0207695_10457085
1551 Ga0207671_10008081
1552 Ga0207671_10104405
1553 Ga0207693_10427080
1554 Ga0207660_10164979
1555 Ga0207660_10252898
1556 Ga0207660_10266047
1557 Ga0207660_10471352
1558 Ga0207660_11116986
1559 Ga0207662_10000010
1560 Ga0207662_10000724
1561 Ga0207662_10123034
1562 Ga0207662_10147006
1563 Ga0207662_10147957
1564 Ga0207662_10155517
1565 Ga0207662_10372545
1566 Ga0207657_10000355
1567 Ga0207657_10112814
1568 Ga0207649_10001787
1569 Ga0207649_10094983
1570 Ga0207652_10019589
1571 Ga0207652_10072618
1572 Ga0207652_10074326
1573 Ga0207652_10119403
1574 Ga0207652_10258713
1575 Ga0207652_10871682
1576 Ga0207646_10001687
1577 Ga0207646_10011223
1578 Ga0207646_10041927
1579 Ga0207646_10080050
1580 Ga0207646_10250525
1581 Ga0207681_10000442
1582 Ga0207681_10138377
1583 Ga0207694_10003684
1584 Ga0207650_10000488
1585 Ga0207650_10045901
1586 Ga0207650_10110697
1587 Ga0207650_10128996
1588 Ga0207650_10342635
1589 Ga0207650_10365625
1590 Ga0207659_10000546
1591 Ga0207659_10083651
1592 Ga0207659_10091903
1593 Ga0207659_10173975
1594 Ga0207659_10222107
1595 Ga0207687_10002902
1596 Ga0207700_10816954
1597 Ga0207644_10001444
1598 Ga0207644_10021929
1599 Ga0207644_10058729
1600 Ga0207690_10010202
1601 Ga0207690_10170598
1602 Ga0207706_10000077
1603 Ga0207706_10030173
1604 Ga0207706_10212854
1605 Ga0207686_10002327
1606 Ga0207686_10006579
1607 Ga0207686_10123771
1608 Ga0207709_10018682
1609 Ga0207709_10557905
1610 Ga0207670_10001062
1611 Ga0207670_10001220
1612 Ga0207670_10012407
1613 Ga0207670_10038234
1614 Ga0207670_10304827
1615 Ga0207669_10001892
1616 Ga0207669_10021456
1617 Ga0207669_10602226
1618 Ga0207704_10000416
1619 Ga0207704_10396915
1620 Ga0207665_10080543
1621 Ga0207665_10357229
1622 Ga0207691_10000033
1623 Ga0207691_10013617
1624 Ga0207691_10080687
1625 Ga0207691_10332825
1626 Ga0207711_10000361
1627 Ga0207711_10003737
1628 Ga0207711_10034192
1629 Ga0207711_10114908
1630 Ga0207711_10946217
1631 Ga0207689_10000232
1632 Ga0207689_10006797
1633 Ga0207689_10029231
1634 Ga0207689_10059700
1635 Ga0207689_10074731
1636 Ga0207689_10157142
1637 Ga0207689_10488196
1638 Ga0207661_10012101
1639 Ga0207661_10029983
1640 Ga0207661_10076877
1641 Ga0207661_10294855
1642 Ga0207679_10000113
1643 Ga0207679_10000778
1644 Ga0207679_10017505
1645 Ga0207679_10074383
1646 Ga0207679_10302735
1647 Ga0207667_10010401
1648 Ga0207667_10134637
1649 Ga0207667_10548852
1650 Ga0207651_10000643
1651 Ga0207651_10069447
1652 Ga0207651_10085130
1653 Ga0207651_10102719
1654 Ga0207651_10131554
1655 Ga0207651_10375029
1656 Ga0207651_10488030
1657 Ga0207712_10002843
1658 Ga0207712_10116119
1659 Ga0207712_10670657
1660 Ga0207668_10004196
1661 Ga0207668_11208638
1662 Ga0207640_10001598
1663 Ga0207640_10469695
1664 Ga0207640_10501309
1665 Ga0207658_10001436
1666 Ga0207658_10018563
1667 Ga0207677_10000346
1668 Ga0207677_10087515
1669 Ga0207703_10000293
1670 Ga0207703_10009820
1671 Ga0207703_10032481
1672 Ga0207703_10267979
1673 Ga0207703_11413187
1674 Ga0207639_10000799
1675 Ga0207639_10039698
1676 Ga0207639_10066239
1677 Ga0207639_10740619
1678 Ga0207639_10756289
1679 Ga0207678_10000135
1680 Ga0207678_10003414
1681 Ga0207678_10066085
1682 Ga0207708_10008073
1683 Ga0207708_10014439
1684 Ga0207708_10386831
1685 Ga0207708_10568671
1686 Ga0207708_10928102
1687 Ga0207702_10005231
1688 Ga0207641_10001355
1689 Ga0207641_10004112
1690 Ga0207641_10033207
1691 Ga0207641_10166263
1692 Ga0207641_10179707
1693 Ga0207641_10432346
1694 Ga0207641_10849978
1695 Ga0207648_10000387
1696 Ga0207648_10156900
1697 Ga0207648_10192397
1698 Ga0207648_10352440
1699 Ga0207648_10358754
1700 Ga0207648_10848963
1701 Ga0207676_10001108
1702 Ga0207676_10012991
1703 Ga0207676_10096587
1704 Ga0207676_10116280
1705 Ga0207676_10206202
1706 Ga0207676_10237418
1707 Ga0207676_10294312
1708 Ga0207674_10000216
1709 Ga0207674_10000789
1710 Ga0207674_10004602
1711 Ga0207674_10225854
1712 Ga0207675_100000043
1713 Ga0207675_100018706
1714 Ga0207675_100021226
1715 Ga0207675_100339755
1716 Ga0207675_100765925
1717 Ga0207683_10000232
1718 Ga0207683_10096260
1719 Ga0207683_10275132
1720 Ga0207698_10001633
1721 Ga0207698_10167767
1722 Ga0207698_10416706
1723 Ga0207698_10651728
1724 Ga0209588_1020651
1725 Ga0209588_1119948
1726 Ga0209966_1008042
1727 Ga0209813_10020500
1728 Ga0207428_10000066
1729 Ga0207428_10003573
1730 Ga0207428_10030567
1731 Ga0207428_10038271
1732 Ga0207428_10045635
1733 Ga0207428_10329300
1734 Ga0268266_10001211
1735 Ga0268265_10000746
1736 Ga0268265_10333833
1737 Ga0268264_10001826
1738 Ga0268264_10005623
1739 Ga0268264_10052727
1740 Ga0268264_10109688
1741 Ga0268264_10203600
1742 Ga0268264_10250645
1743 Ga0268264_10274595
1744 Ga0268264_10295637
1745 Ga0268264_11304740
1746 Ga0265328_10076356
1747 Ga0265331_10130676
1748 Ga0307509_10350498
1749 Ga0307509_10635953
1750 Ga0307408_100078846
1751 Ga0307408_100150292
1752 Ga0307408_100564699
1753 Ga0316575_10185778
1754 Ga0316579_10012316
1755 Ga0265314_10062348
1756 Ga0316576_10000571
1757 Ga0316576_10091238
1758 Ga0316576_10118036
1759 Ga0316576_10134978
1760 Ga0316576_10189662
1761 Ga0316576_10547813
1762 Ga0316578_10052076
1763 Ga0316578_10403012
1764 Ga0307405_10010270
1765 Ga0307405_10079552
1766 Ga0307405_11100274
1767 Ga0316577_10011260
1768 Ga0307413_10004290
1769 Ga0307413_10005701
1770 Ga0307410_10004410
1771 Ga0307410_10032514
1772 Ga0307410_10132170
1773 Ga0307406_10015109
1774 Ga0307406_10055059
1775 Ga0307406_10563480
1776 Ga0307407_10000390
1777 Ga0307407_10121321
1778 Ga0307407_10207764
1779 Ga0307412_10005092
1780 Ga0307412_10012047
1781 Ga0307412_10111539
1782 Ga0307409_100015151
1783 Ga0307409_100196500
1784 Ga0307409_100366838
1785 Ga0307416_100003245
1786 Ga0307416_100127594
1787 Ga0307416_100153175
1788 Ga0307416_101482350
1789 Ga0307414_10013413
1790 Ga0307414_10405556
1791 Ga0307411_10005104
1792 Ga0307411_10123486
1793 Ga0307415_100047372
1794 Ga0307415_100275778
1795 Ga0307415_100298038
1796 Ga0316585_10060421
1797 Ga0316593_10065051
1798 Ga0316586_1018184
1799 Ga0316588_1005437
1800 Ga0316588_1026798
1801 Ga0316588_1133722
1802 Ga0373950_0025172
1803 Ga0373958_0019684
1804 Ga0373938_0074207
1805 Ga0373928_0000364
1806 Ga0373951_0001768
1807 Ga0373923_0102405
1808 Ga0373957_0152559
1809 Ga0373943_0130451
1810 Ga0373942_0000748
1811 Ga0316574_0069409
1812 Ga0316574_0096912
1813 Ga0316574_0242632
1814 Ga0316574_0430536
1815 Ga0373931_0283074
1816 Ga0373935_0214603
1817 Ga0373935_0589056
1818 Ga0373935_0662119
1819 Ga0373927_0547608
1820 Ga0373947_0097489
1821 Ga0373947_0759710
1822 Ga0373937_0042140
1823 Ga0373937_0089841
1824 Ga0373937_0294561
1825 Ga0373937_1233007
1826 Ga0316582_0006842
1827 Ga0316584_0003185
1828 Ga0316584_0004679
1829 Ga0316584_0087127
1830 Ga0316584_0199422
1831 Ga0316584_0216498
1832 Ga0373925_0016770
1833 Ga0373925_0178606
1834 Ga0373925_0302684
1835 Ga0395900_0318262
1836 Ga0395905_0092776
1837 Ga0395905_0653400
1838 Ga0316581_0001924
1839 Ga0436364_0008364
1840 Ga0436364_0785716
1841 Ga0395901_0285210
1842 Ga0400490_13757
1843 Ga0400491_08082
1844 Ga0436365_1032345
1845 Ga0436365_1202894
1846 Ga0436365_1649219
1847 Ga0436360_0285177
1848 Ga0436363_0234091
1849 Ga0436363_0734767
1850 Ga0436363_0869589
1851 Ga0436362_1216711
1852 Ga0439461_0036136
1853 Ga0451802_2142220
1854 Ga0451851_0565194
1855 Ga0439448_0029359
1856 Ga0451577_0000055
1857 Ga0451577_0000367
1858 Ga0451577_0000719
1859 Ga0451577_0001213
1860 Ga0451577_0008605
1861 Ga0451577_0013694
1862 Ga0451577_0016029
1863 Ga0451577_0019977
1864 Ga0451577_0047528
1865 Ga0451577_0414733
1866 Ga0451577_0606827
1867 Ga0451577_0694823
1868 Ga0451577_1068605
1869 Ga0466969_0006121
1870 Ga0453683_0000009
1871 Ga0453683_0000447
1872 Ga0453683_0001018
1873 Ga0453683_0001209
1874 Ga0453683_0005262
1875 Ga0453683_0006058
1876 Ga0453683_0009627
1877 Ga0453683_0030930
1878 Ga0453683_0044600
1879 Ga0453683_0049222
1880 Ga0453683_0154651
1881 Ga0453683_0185205
1882 Ga0453683_0185710
1883 Ga0453683_0216198
1884 Ga0453683_0319035
1885 Ga0453683_0383148
1886 Ga0453683_0445324
1887 Ga0466966_0056924
1888 Ga0453684_0000183
1889 Ga0453684_0000231
1890 Ga0453684_0000708
1891 Ga0453684_0001148
1892 Ga0453684_0001201
1893 Ga0453684_0005000
1894 Ga0453684_0006456
1895 Ga0453684_0006467
1896 Ga0453684_0021145
1897 Ga0453684_0026432
1898 Ga0453684_0053056
1899 Ga0453684_0059202
1900 Ga0453684_0061655
1901 Ga0453684_0073803
1902 Ga0453684_0087309
1903 Ga0453684_0123107
1904 Ga0453684_0140816
1905 Ga0453684_0203766
1906 Ga0453684_0207576
1907 Ga0453684_0233225
1908 Ga0453684_0286579
1909 Ga0453684_0389891
1910 Ga0453684_0549611
1911 Ga0453684_1135971
1912 Ga0466970_0171959
1913 Ga0466957_0434857
1914 Ga0466957_0602300
1915 Ga0466960_0103755
1916 Ga0466960_0248757
1917 Ga0466959_0107785
1918 Ga0451576_0000960
1919 Ga0451576_0006783
1920 Ga0451576_0031983
1921 Ga0451576_0035311
1922 Ga0451576_0068403
1923 Ga0451576_0231565
1924 Ga0451576_0247658
1925 Ga0451576_0280225
1926 Ga0451576_0428983
1927 Ga0451576_0429386
1928 Ga0451576_0468345
1929 Ga0451576_0564563
1930 Ga0451576_1032390
1931 Ga0451576_1054070
1932 Ga0451576_1114371
1933 Ga0451576_1644521
1934 Ga0466967_1126286
1935 Ga0495603_0048476
1936 Ga0495629_0531544
1937 Ga0495580_0000526
1938 Ga0495580_0026753
1939 Ga0495580_0116384
1940 Ga0495662_0179976
1941 Ga0495594_0058562
1942 Ga0495628_0267199
1943 Ga0495630_0022980
1944 Ga0495632_0029727
1945 Ga0495586_0032660
1946 Ga0495586_0199984
1947 Ga0495635_0000345
1948 Ga0495588_0033173
1949 Ga0495657_0059717
1950 Ga0495647_0005029
1951 Ga0495658_0276131
1952 Ga0495613_0179705
1953 Ga0495624_0608065
1954 Ga0495670_0374264
1955 Ga0495581_0124594
1956 Ga0495636_0030061
1957 Ga0495636_0138289
1958 Ga0495672_0002923
1959 Ga0495680_0001236
1960 Ga0495684_0002900
1961 Ga0495593_0206679
1962 Ga0495602_0042983
1963 Ga0495615_0006706
1964 Ga0496100_0428587
1965 Ga0496101_0389823
1966 Ga0496103_0076339
1967 Ga0496105_0166973
1968 Ga0496106_0002331
1969 Ga0496107_0011103
1970 Ga0496108_0054456
1971 Ga0496109_0021723
1972 Ga0496109_0970825
1973 Ga0496111_0226089
1974 Ga0496112_0009800
1975 Ga0496112_0520331
1976 Ga0496113_0007328
1977 Ga0496114_0027564
1978 Ga0496124_0195838
1979 Ga0501291_024093
1980 Ga0501296_008287
1981 Ga0501298_012478
1982 Ga0501031_0633145
1983 Ga0501034_0000138
1984 Ga0501034_0359979
1985 Ga0501034_0653265
1986 Ga0501041_0062629
1987 Ga0501042_0065368
1988 Ga0501042_0090296
1989 Ga0501042_0496587
1990 Ga0501042_0731528
1991 Ga0501043_0334578
1992 Ga0501043_0571376
1993 Ga0501048_0048410
1994 Ga0501048_0121450
1995 Ga0501072_0069148
1996 Ga0501072_0786644
1997 Ga0501073_0037298
1998 Ga0501075_0166492
1999 Ga0501076_0060042
2000 Ga0501076_0230862
2001 Ga0501076_0300610
2002 Ga0501076_0565290
2003 Ga0501077_0417037
2004 Ga0501077_0555473
2005 Ga0501202_027360
2006 Ga0501207_030797
2007 Ga0501209_030028
2008 Ga0501209_070873
2009 Ga0501217_045142
2010 Ga0501223_043025
2011 Ga0501224_041028
2012 Ga0501227_000384
2013 Ga0501227_031827
2014 Ga0501230_000839
2015 Ga0501233_007105
2016 Ga0501233_022515
2017 Ga0501233_039927
2018 Ga0501233_139937
2019 Ga0501238_013476
2020 Ga0501239_001848
2021 Ga0501242_012369
2022 Ga0501243_055606
2023 Ga0501247_004759
2024 Ga0501250_057221
2025 Ga0501256_013699
2026 Ga0501257_009666
2027 Ga0501257_036859
2028 Ga0501260_008761
2029 Ga0501225_0001801
2030 Ga0501225_0011619
2031 Ga0501225_0028030
2032 Ga0501081_0051507
2033 Ga0501081_0544375
2034 Ga0501263_009473
2035 Ga0501267_001656
2036 Ga0501268_010071
2037 Ga0501270_000196
2038 Ga0501273_005822
2039 Ga0501035_0000091
2040 Ga0501044_0185691
2041 nmdc:mga03683_17877_c1
2042 nmdc:mga03683_366317_c1
2043 nmdc:mga00v17_12078_c1
2044 nmdc:mga00v17_125796_c1
2045 nmdc:mga0yw44_93133_c1
2046 nmdc:mga0k408_877_c1
2047 nmdc:mga04h51_28980_c1
2048 nmdc:mga07m45_85832_c1
2049 nmdc:mga05p37_1040930_c1
2050 nmdc:mga05p37_198676_c1
2051 nmdc:mga05p37_201648_c1
2052 nmdc:mga05p37_205021_c1
2053 nmdc:mga05p37_2115_c1
2054 nmdc:mga05p37_243438_c1
2055 nmdc:mga05p37_409416_c1
2056 nmdc:mga05p37_510592_c1
2057 nmdc:mga05p37_77002_c1
2058 nmdc:mga05p37_89813_c1
2059 nmdc:mga09592_165499_c1
2060 nmdc:mga09592_18910_c1
2061 nmdc:mga09592_25768_c1
2062 nmdc:mga09592_31560_c1
2063 nmdc:mga09592_343217_c1
2064 nmdc:mga09592_378270_c1
2065 nmdc:mga09592_674461_c1
2066 nmdc:mga09592_68522_c1
2067 nmdc:mga09592_74244_c1
2068 nmdc:mga09592_908625_c1
2069 nmdc:mga0qj67_212258_c1
2070 nmdc:mga0qj67_340464_c1
2071 nmdc:mga0qj67_384057_c1
2072 nmdc:mga0qj67_701284_c1
2073 nmdc:mga06r32_1271512_c1
2074 nmdc:mga06r32_139754_c1
2075 nmdc:mga06r32_17594_c1
2076 nmdc:mga06r32_232991_c1
2077 nmdc:mga06r32_39808_c1
2078 nmdc:mga06r32_527866_c1
2079 nmdc:mga06r32_58870_c1
2080 nmdc:mga06r32_649271_c1
2081 nmdc:mga06r32_723910_c1
2082 nmdc:mga06r32_992491_c1
2083 nmdc:mga08y16_14759_c1
2084 nmdc:mga08y16_166471_c1
2085 nmdc:mga08y16_1926_c1
2086 nmdc:mga08y16_197718_c1
2087 nmdc:mga08y16_32231_c1
2088 nmdc:mga08y16_34477_c1
2089 nmdc:mga08y16_46328_c1
2090 nmdc:mga08y16_5852_c1
2091 nmdc:mga08y16_61606_c1
2092 nmdc:mga08y16_794389_c1
2093 nmdc:mga08y16_96473_c1
2094 nmdc:mga0n895_156417_c1
2095 nmdc:mga0n895_2222_c1
2096 nmdc:mga0n895_50493_c1
2097 nmdc:mga0n895_56880_c1
2098 nmdc:mga0rr50_1642_c1
2099 nmdc:mga0rr50_179685_c1
2100 nmdc:mga0rr50_18696_c1
2101 nmdc:mga0rr50_433843_c1
2102 nmdc:mga08x19_6947_c1
2103 nmdc:mga0a205_16510_c2
2104 nmdc:mga0a205_308506_c1
2105 nmdc:mga0a205_65914_c1
2106 nmdc:mga0a205_729526_c1
2107 nmdc:mga0a205_73070_c1
2108 nmdc:mga0a205_83402_c1
2109 nmdc:mga0a205_95_c1
2110 nmdc:mga0a205_96777_c1
2111 nmdc:mga0a205_99848_c1
2112 nmdc:mga0sz30_86701_c1
2113 Ga0495619_0169293
2114 Ga0500646_0127456
2115 Ga0500645_016909
2116 Ga0501084_0200171
2117 Ga0501084_0870255
2118 Ga0587083_0066021
2119 Ga0587092_009046
2120 Ga0587109_024001
2121 Ga0587068_008833
2122 Ga0587068_075967
2123 Ga0501082_0657543
2124 Ga0530510_0018759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00025

Arf

ADP-ribosylation factor family

2

187

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h5b-assembly1.cif.gz_A myxococcus xanthus mgla in complex with its gap mglb and gtpgammas 0.9463 2 190
5ymx-assembly2.cif.gz_B myxococcus xanthus mgla in gdp bound conformation 0.9445 2 194
3t1q-assembly1.cif.gz_A mgla bound to gppnhp in complex with mglb 0.9371 10 190
5ymx-assembly1.cif.gz_A myxococcus xanthus mgla in gdp bound conformation 0.9368 2 194
6h5b-assembly1.cif.gz_A myxococcus xanthus mgla in complex with its gap mglb and gtpgammas 0.9367 2 190
ID Description Score Start End Superfamily
3t1oB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9159 3 190 3.40.50.300
3t1oB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9066 3 190 3.40.50.300
af_P35292_16_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.832 12 193 3.40.50.300
af_O17788_2_199_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.814 12 194 3.40.50.300
af_Q58735_1_154_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8128 12 185 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9Q7P6-F1-model_v4 GTPase domain-containing protein 1.002 98 194
AF-A0A7V9Q7P6-F1-model_v4 GTPase domain-containing protein 0.9913 98 194
AF-A0A2V7IZR8-F1-model_v4 Gliding-motility protein MglA 0.9847 87 194
AF-A0A6J4LAY2-F1-model_v4 Mutual gliding-motility protein MglA 0.9841 99 191
AF-A0A2M8D2J2-F1-model_v4 Gliding-motility protein MglA 0.9819 1 193 GO:0003924
GO:0005525

Map