F489304

General Info

Members Datasets Scaffolds Average Seq Length
1062 759 2124 145

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10432640|Ga0157374_104326402
Length 171
Sequence VKALSQAVSTPRKTSGRPTARSKKEQEMLKGIPAIIGPDLLYVLQAMGHGDQITIVDGNYPGESAGPELVRMDGHSATEVLEAILTLMPLDDFVDDPAICMQVVGNAGKHEPIMDEFEAIIKKFEPKMGLTSMERFAFYERANSGYAIVQTGEPRLYGNLILKKGVIRPGD

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
84 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
98 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
101 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
276 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
283 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
292 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
293 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
294 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
295 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
296 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
297 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
298 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
299 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
300 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
301 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
302 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
303 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
304 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
305 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
306 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
307 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
308 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
309 2516143018 Ensifer sp. BR816 Isolate Nodule
310 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
311 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
312 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
313 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
314 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
315 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
316 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
317 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
318 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
319 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
320 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
321 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
322 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
323 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
324 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
325 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
326 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
327 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
328 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
329 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
330 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
331 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
332 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
333 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
334 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
335 2643221557 Ensifer sp. Root558 Isolate Unclassified
336 2643221558 Rhizobium sp. Root149 Isolate Unclassified
337 2643221599 Rhizobium sp. Root708 Isolate Unclassified
338 2643221610 Ensifer sp. Root74 Isolate Unclassified
339 2643221618 Ensifer sp. Root231 Isolate Unclassified
340 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
341 2643221626 Ensifer sp. Root31 Isolate Unclassified
342 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
343 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
344 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
345 2643221655 Ensifer sp. Root1252 Isolate Unclassified
346 2643221659 Ensifer sp. Root127 Isolate Unclassified
347 2643221668 Ensifer sp. Root423 Isolate Unclassified
348 2643221675 Ensifer sp. Root1298 Isolate Unclassified
349 2643221680 Ensifer sp. Root1312 Isolate Unclassified
350 2643221698 Ensifer sp. Root142 Isolate Unclassified
351 2643221712 Ensifer sp. Root258 Isolate Unclassified
352 2643221719 Rhizobium sp. Root274 Isolate Unclassified
353 2643221723 Ensifer sp. Root278 Isolate Unclassified
354 2643221726 Ensifer sp. Root954 Isolate Unclassified
355 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
356 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
357 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
358 2718217882 Rhizobium sp. N741 Isolate Nodule
359 2718217927 Rhizobium sp. N324 Isolate Nodule
360 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
361 2718218009 Rhizobium sp. N561 Isolate Nodule
362 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
363 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
364 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
365 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
366 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
367 2718218363 Rhizobium sp. N113 Isolate Nodule
368 2718218365 Rhizobium sp. N731 Isolate Nodule
369 2718218366 Rhizobium sp. N621 Isolate Nodule
370 2718218423 Rhizobium sp. N941 Isolate Nodule
371 2721755514 Rhizobium sp. N6212 Isolate Nodule
372 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
373 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
374 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
375 2721755809 Rhizobium sp. N541 Isolate Nodule
376 2721755810 Rhizobium sp. N871 Isolate Nodule
377 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
378 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
379 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
380 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
381 2728369365 Rhizobium sp. N1341 Isolate Nodule
382 2728369397 Rhizobium sp. N1314 Isolate Nodule
383 2738541293 Rhizobium sp. GV031 Isolate Unclassified
384 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
385 2738543024 Aminobacter sp. AP02 Isolate Unclassified
386 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
387 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
388 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
389 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
390 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
391 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
392 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
393 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
394 2791355260 Rhizobium sp. L9 Isolate Nodule
395 2791355261 Rhizobium sp. J15 Isolate Nodule
396 2791355263 Rhizobium chutanense C5 Isolate Nodule
397 2791355264 Rhizobium sp. S9 Isolate Nodule
398 2791355267 Rhizobium sp. L18 Isolate Nodule
399 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
400 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
401 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
402 2802429633 Rhizobium anhuiense J3 Isolate Nodule
403 2802429634 Rhizobium anhuiense S10 Isolate Nodule
404 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
405 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
406 2802429637 Rhizobium anhuiense C15 Isolate Nodule
407 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
408 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
409 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
410 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
411 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
412 2838048938 Rhizobium pisi 27/80 Isolate Nodule
413 2838061910 Rhizobium phaseoli L15 Isolate Nodule
414 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
415 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
416 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
417 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
418 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
419 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
420 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
421 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
422 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
423 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
424 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
425 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
426 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
427 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
428 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
429 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
430 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
431 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
432 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
433 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
434 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
435 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
436 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
437 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
438 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
439 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
440 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
441 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
442 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
443 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
444 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
445 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
446 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
447 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
448 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
449 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
450 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
451 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
452 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
453 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
454 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
455 2844163670 Ensifer sp. 1H6 Isolate Unclassified
456 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
457 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
458 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
459 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
460 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
461 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
462 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
463 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
464 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
465 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
466 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
467 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
468 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
469 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
470 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
471 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
472 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
473 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
474 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
475 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
476 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
477 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
478 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
479 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
480 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
481 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
482 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
483 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
484 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
485 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
486 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
487 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
488 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
489 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
490 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
491 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
492 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
493 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
494 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
495 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
496 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
497 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
498 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
499 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
500 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
501 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
502 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
503 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
504 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
505 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
506 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
507 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
508 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
509 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
510 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
511 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
512 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
513 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
514 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
515 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
516 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
517 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
518 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
519 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
520 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
521 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
522 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
523 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
524 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
525 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
526 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
527 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
528 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
529 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
530 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
531 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
532 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
533 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
534 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
535 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
536 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
537 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
538 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
539 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
540 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
541 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
542 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
543 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
544 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
545 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
546 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
547 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
548 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
549 2933599457 Rhizobium phaseoli M3 Isolate Nodule
550 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
551 2936381700 Rhizobium chutanense C16 Isolate Unclassified
552 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
553 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
554 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
555 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
556 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
557 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
558 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
559 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
560 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
561 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
562 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
563 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
564 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
565 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
566 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
567 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
568 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
569 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
570 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
571 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
572 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
573 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
574 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
575 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
576 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
577 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
578 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
579 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
580 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
581 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
582 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
583 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
584 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
585 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
586 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
587 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
588 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
589 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
590 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
591 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
592 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
593 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
594 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
595 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
596 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
597 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
598 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
599 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
600 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
601 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
602 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
603 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
604 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
605 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
606 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
607 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
608 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
609 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
610 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
611 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
612 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
613 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
614 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
615 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
616 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
617 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
618 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
619 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
620 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
621 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
622 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
623 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
624 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
625 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
626 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
627 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
628 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
629 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
630 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
631 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
632 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
633 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
634 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
635 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
636 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
637 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
638 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
639 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
640 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
641 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
642 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
643 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
644 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
645 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
646 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
647 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
648 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
649 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
650 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
651 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
652 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
653 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
654 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
655 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
656 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
657 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
658 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
659 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
660 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
661 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
662 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
663 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
664 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
665 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
666 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
667 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
668 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
669 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
670 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
671 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
672 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
673 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
674 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
675 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
676 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
677 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
678 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
679 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
680 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
681 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
682 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
683 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
684 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
685 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
686 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
687 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
688 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
689 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
690 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
691 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
692 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
693 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
694 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
695 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
696 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
697 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
698 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
699 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
700 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
701 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
702 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
703 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
704 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
705 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
706 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
707 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
708 2996887358 Rhizobium sp. R711 Isolate Nodule
709 2996893221 Rhizobium sp. R635 Isolate Nodule
710 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
711 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
712 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
713 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
714 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
715 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
716 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
717 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
718 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
719 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
720 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
721 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
722 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
723 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
724 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
725 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
726 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
727 8005258706 Rhizobium sp. R693 Isolate Nodule
728 8005275841 Rhizobium sp. N4311 Isolate Nodule
729 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
730 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
731 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
732 8005321885 Rhizobium sp. R72 Isolate Nodule
733 8005382845 Rhizobium sp. R634 Isolate Nodule
734 8005395548 Rhizobium sp. R339 Isolate Nodule
735 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
736 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
737 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
738 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
739 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
740 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
741 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
742 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
743 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
744 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
745 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
746 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
747 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
748 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
749 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
750 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
751 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
752 8018176218 Rhizobium sp. N122 Isolate Nodule
753 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
754 8024501048 Rhizobium sp. H4 Isolate Nodule
755 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
756 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
757 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
758 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
759 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.8
Metatranscriptomes 0.75
Isolates 44.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 37.85
Rhizoplane 1.79
Rhizosphere 36.25
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10432640 3300013296 Bacteria 1316
2 JGI24735J21928_10086643 3300002067 Bacteria 897
3 JGI25158J39367_1032113 3300002739 Bacteria 588
4 JGI25157J39369_1001027 3300002741 Bacteria 12885
5 JGI25152J39213_1001483 3300002773 Bacteria 10028
6 JGI25152J39213_1003180 3300002773 Bacteria 5716
7 JGI25150J39212_1000199 3300002774 Bacteria 32990
8 JGI25159J45721_1000003 3300002987 Bacteria 274069
9 JGI25159J45721_1002037 3300002987 Bacteria 7997
10 JGI25151J46595_10001303 3300003187 Bacteria 17484
11 JGI25151J46595_10004870 3300003187 Bacteria 7012
12 JGI25151J46595_10006323 3300003187 Bacteria 5970
13 JGI25406J46586_10008349 3300003203 Bacteria 4695
14 JGI25165J46597_1000016 3300003214 Bacteria 377866
15 JGI25153J46596_10000978 3300003215 Bacteria 17322
16 rootH1_10116783 3300003316 Bacteria 1732
17 rootH2_10011781 3300003320 Bacteria 7762
18 rootH2_10049858 3300003320 Bacteria 2146
19 rootH1_10019781 3300003323 Bacteria 1356
20 rootH1_10019782 3300003323 Bacteria 2571
21 rootH1_10021120 3300003323 Bacteria 10778
22 rootH1_10107305 3300003323 Plasmid 3148
23 JGI25160J50197_1000003 3300003354 Bacteria 482719
24 JGI25160J50197_1000012 3300003354 Bacteria 267582
25 JGI25160J50197_1003267 3300003354 Bacteria 7299
26 JGI25160J50197_1027133 3300003354 Bacteria 1565
27 JGI25161J50226_1000002 3300003374 Bacteria 420324
28 JGI25161J50226_1000239 3300003374 Bacteria 32969
29 JGI25161J50226_1003433 3300003374 Bacteria 3622
30 Ga0006562J51391_1034067 3300003578 Bacteria 2200
31 Ga0055526_1003533 3300003771 Bacteria 9871
32 Ga0055526_1004786 3300003771 Bacteria 8014
33 Ga0055524_1000434 3300003775 Bacteria 34967
34 Ga0055524_1001875 3300003775 Bacteria 11451
35 Ga0055524_1002834 3300003775 Bacteria 8692
36 Ga0055524_1004206 3300003775 Bacteria 6704
37 Ga0055536_1009396 3300003781 Bacteria 4044
38 Ga0055528_1000594 3300003790 Bacteria 27215
39 Ga0055528_1006905 3300003790 Bacteria 5088
40 Ga0055528_1021981 3300003790 Bacteria 2001
41 Ga0055530_10025614 3300003791 Bacteria 1644
42 Ga0055540_1000272 3300003792 Bacteria 46628
43 Ga0055540_1026319 3300003792 Bacteria 1409
44 Ga0055540_1049979 3300003792 Bacteria 866
45 Ga0055531_10017334 3300003794 Bacteria 3047
46 Ga0055543_1000043 3300004625 Bacteria 116599
47 Ga0055543_1000050 3300004625 Bacteria 107366
48 Ga0055543_1000774 3300004625 Bacteria 15885
49 Ga0065165_1000025 3300005262 Bacteria 246909
50 Ga0065165_1000031 3300005262 Bacteria 216330
51 Ga0065165_1004348 3300005262 Bacteria 8885
52 Ga0065165_1027649 3300005262 Bacteria 1844
53 Ga0070676_10212871 3300005328 Bacteria 1273
54 Ga0070683_100057160 3300005329 Bacteria 3624
55 Ga0070670_100322704 3300005331 Bacteria 1353
56 Ga0068869_100348922 3300005334 Bacteria 1206
57 Ga0070666_10201911 3300005335 Bacteria 1399
58 Ga0070660_100027460 3300005339 Bacteria 4248
59 Ga0070660_100285741 3300005339 Bacteria 1350
60 Ga0070661_100008136 3300005344 Bacteria 7235
61 Ga0070661_100013469 3300005344 Bacteria 5741
62 Ga0070661_100205093 3300005344 Bacteria 1508
63 Ga0070661_100613857 3300005344 Bacteria 880
64 Ga0070668_100105865 3300005347 Bacteria 2234
65 Ga0070668_100178826 3300005347 Bacteria 1732
66 Ga0070675_100192304 3300005354 Bacteria 1768
67 Ga0070671_100013114 3300005355 Bacteria 6677
68 Ga0070671_100225258 3300005355 Bacteria 1591
69 Ga0070673_100018723 3300005364 Bacteria 4956
70 Ga0070659_100012347 3300005366 Bacteria 6330
71 Ga0070659_100060715 3300005366 Bacteria 2986
72 Ga0070659_100101025 3300005366 Bacteria 2321
73 Ga0070659_100555824 3300005366 Bacteria 983
74 Ga0070659_100975335 3300005366 Bacteria 743
75 Ga0070667_100270274 3300005367 Bacteria 1524
76 Ga0070700_100414507 3300005441 Bacteria 1016
77 Ga0070663_100074188 3300005455 Bacteria 2483
78 Ga0070663_100273824 3300005455 Bacteria 1343
79 Ga0070663_101093231 3300005455 Bacteria 697
80 Ga0070678_100138538 3300005456 Bacteria 1944
81 Ga0070662_100480687 3300005457 Bacteria 1034
82 Ga0068867_100392100 3300005459 Bacteria 1169
83 Ga0070679_100837402 3300005530 Bacteria 863
84 Ga0070684_100381065 3300005535 Bacteria 1299
85 Ga0068853_100039407 3300005539 Bacteria 4029
86 Ga0068853_100077154 3300005539 Bacteria 2910
87 Ga0068853_100221433 3300005539 Bacteria 1728
88 Ga0068853_101591402 3300005539 Unclassified 633
89 Ga0070672_100786425 3300005543 Unclassified 837
90 Ga0070686_100090655 3300005544 Bacteria 2044
91 Ga0070693_100718899 3300005547 Bacteria 733
92 Ga0070665_100096659 3300005548 Bacteria 2959
93 Ga0070665_100102847 3300005548 Bacteria 2860
94 Ga0068855_100025742 3300005563 Bacteria 7035
95 Ga0068855_100080077 3300005563 Bacteria 3788
96 Ga0068855_100235898 3300005563 Bacteria 2046
97 Ga0068855_101384584 3300005563 Bacteria 725
98 Ga0068855_102094299 3300005563 Bacteria 570
99 Ga0068857_100007527 3300005577 Bacteria 9369
100 Ga0068854_100066665 3300005578 Bacteria 2620
101 Ga0068854_100080736 3300005578 Bacteria 2400
102 Ga0068854_100089422 3300005578 Bacteria 2288
103 Ga0068856_100058011 3300005614 Bacteria 3823
104 Ga0068856_100112834 3300005614 Bacteria 2716
105 Ga0068856_100115814 3300005614 Bacteria 2680
106 Ga0068856_100223318 3300005614 Bacteria 1899
107 Ga0068856_100249888 3300005614 Bacteria 1788
108 Ga0068856_100498433 3300005614 Bacteria 1239
109 Ga0068856_101609399 3300005614 Bacteria 663
110 Ga0068852_100007964 3300005616 Bacteria 7769
111 Ga0068852_100045127 3300005616 Bacteria 3747
112 Ga0068852_100050929 3300005616 Bacteria 3551
113 Ga0068852_100113029 3300005616 Bacteria 2472
114 Ga0068852_100287989 3300005616 Bacteria 1586
115 Ga0068852_100591142 3300005616 Bacteria 1114
116 Ga0068866_10600330 3300005718 Bacteria 743
117 Ga0068851_10016419 3300005834 Bacteria 3542
118 Ga0068851_10058947 3300005834 Bacteria 1963
119 Ga0068858_100211506 3300005842 Bacteria 1835
120 Ga0081539_10003049 3300005985 Bacteria 21640
121 Ga0075365_10006944 3300006038 Bacteria 6289
122 Ga0075365_10008779 3300006038 Bacteria 5765
123 Ga0075365_10011572 3300006038 Bacteria 5194
124 Ga0075365_10137064 3300006038 Bacteria 1697
125 Ga0075365_10161513 3300006038 Bacteria 1561
126 Ga0075368_10020065 3300006042 Bacteria 2528
127 Ga0075363_100132438 3300006048 Bacteria 1399
128 Ga0075363_100167894 3300006048 Bacteria 1245
129 Ga0075363_100492393 3300006048 Bacteria 727
130 Ga0075362_10000690 3300006177 Bacteria 9988
131 Ga0075362_10259328 3300006177 Bacteria 856
132 Ga0075362_10267217 3300006177 Bacteria 844
133 Ga0075367_10007331 3300006178 Bacteria 5640
134 Ga0075367_10075532 3300006178 Bacteria 2033
135 Ga0075367_10500528 3300006178 Bacteria 771
136 Ga0075367_10509172 3300006178 Bacteria 764
137 Ga0075369_10014458 3300006186 Bacteria 3153
138 Ga0075369_10077459 3300006186 Bacteria 1471
139 Ga0075366_10042198 3300006195 Bacteria 2700
140 Ga0075366_10879488 3300006195 Bacteria 558
141 Ga0075370_10002201 3300006353 Bacteria 8953
142 Ga0075370_10188960 3300006353 Bacteria 1213
143 Ga0075370_10256387 3300006353 Bacteria 1037
144 Ga0068865_100392488 3300006881 Bacteria 1135
145 Ga0075435_100384299 3300007076 Bacteria 1206
146 Ga0105251_10014773 3300009011 Bacteria 4297
147 Ga0105244_10090700 3300009036 Bacteria 1503
148 Ga0105250_10027381 3300009092 Bacteria 2297
149 Ga0105240_10040307 3300009093 Bacteria 5974
150 Ga0105240_10189863 3300009093 Bacteria 2416
151 Ga0105240_10210247 3300009093 Bacteria 2274
152 Ga0105240_10410925 3300009093 Bacteria 1522
153 Ga0105240_10867834 3300009093 Bacteria 973
154 Ga0105240_12584651 3300009093 Bacteria 525
155 Ga0105245_10199319 3300009098 Bacteria 1922
156 Ga0114129_11356429 3300009147 Bacteria 879
157 Ga0105243_11233550 3300009148 Bacteria 762
158 Ga0105243_11318356 3300009148 Bacteria 740
159 Ga0105241_11294441 3300009174 Bacteria 694
160 Ga0105248_10766100 3300009177 Bacteria 1089
161 Ga0105237_10000071 3300009545 Bacteria 135695
162 Ga0105237_10026573 3300009545 Bacteria 5916
163 Ga0105237_10104123 3300009545 Bacteria 2829
164 Ga0105237_10387028 3300009545 Bacteria 1403
165 Ga0105237_10999241 3300009545 Bacteria 843
166 Ga0105238_10001439 3300009551 Bacteria 23916
167 Ga0105238_10015176 3300009551 Bacteria 7800
168 Ga0105238_10052632 3300009551 Bacteria 4093
169 Ga0105238_10211418 3300009551 Bacteria 1916
170 Ga0105249_10251127 3300009553 Bacteria 1754
171 Ga0105249_11187797 3300009553 Bacteria 834
172 Ga0123341_1000038 3300009765 Bacteria 60679
173 Ga0123341_1000054 3300009765 Bacteria 48678
174 Ga0123341_1036851 3300009765 Bacteria 3365
175 Ga0123342_1013519 3300009766 Bacteria 8150
176 Ga0123342_1018935 3300009766 Bacteria 5364
177 Ga0105239_10027474 3300010375 Bacteria 6264
178 Ga0105239_10182662 3300010375 Bacteria 2347
179 Ga0105239_10201351 3300010375 Bacteria 2231
180 Ga0105239_10201683 3300010375 Bacteria 2229
181 Ga0105239_10315656 3300010375 Bacteria 1762
182 Ga0105239_10328171 3300010375 Bacteria 1726
183 Ga0105239_10373235 3300010375 Bacteria 1612
184 Ga0157371_10043386 3300013102 Bacteria 3204
185 Ga0157371_10167960 3300013102 Bacteria 1567
186 Ga0157371_10765515 3300013102 Bacteria 726
187 Ga0157370_10148729 3300013104 Bacteria 2180
188 Ga0157370_10150919 3300013104 Bacteria 2162
189 Ga0157370_10709596 3300013104 Bacteria 918
190 Ga0157370_10729841 3300013104 Bacteria 903
191 Ga0157369_10105860 3300013105 Bacteria 2994
192 Ga0157369_10236617 3300013105 Bacteria 1908
193 Ga0157369_10568629 3300013105 Bacteria 1171
194 Ga0171463_1001 3300013249 Bacteria 1406070
195 Ga0157378_10054679 3300013297 Bacteria 3554
196 Ga0157378_10266716 3300013297 Bacteria 1645
197 Ga0157378_11196274 3300013297 Bacteria 799
198 Ga0163162_11416224 3300013306 Bacteria 791
199 Ga0157372_10208590 3300013307 Bacteria 2264
200 Ga0157372_10468223 3300013307 Bacteria 1469
201 Ga0157372_11937034 3300013307 Bacteria 677
202 Ga0157372_11951626 3300013307 Bacteria 675
203 Ga0157372_12741704 3300013307 Bacteria 565
204 Ga0157375_11133313 3300013308 Bacteria 916
205 Ga0157375_11531052 3300013308 Bacteria 788
206 Ga0182008_10072474 3300014497 Bacteria 1695
207 Ga0182008_10495417 3300014497 Bacteria 671
208 Ga0157376_10483449 3300014969 Bacteria 1214
209 Ga0182005_1004662 3300015265 Bacteria 4382
210 Ga0183362_10531 3300015683 Bacteria 817
211 Ga0183363_1081 3300015690 Bacteria 29051
212 Ga0163161_10366513 3300017792 Bacteria 1149
213 Ga0214544_1000105 3300021320 Bacteria 114109
214 Ga0214542_1000029 3300021321 Bacteria 174097
215 Ga0214543_1000040 3300021327 Bacteria 174142
216 Ga0209436_101403 3300025208 Bacteria 8484
217 Ga0209436_111980 3300025208 Bacteria 1494
218 Ga0209563_105256 3300025230 Bacteria 2371
219 Ga0207425_1000012 3300025245 Bacteria 528324
220 Ga0209129_1000110 3300025258 Bacteria 150918
221 Ga0209129_1000192 3300025258 Bacteria 83041
222 Ga0209129_1002601 3300025258 Bacteria 8623
223 Ga0209233_1000068 3300025261 Bacteria 377969
224 Ga0209565_1056866 3300025263 Bacteria 687
225 Ga0209673_1000024 3300025273 Bacteria 409632
226 Ga0209673_1016778 3300025273 Bacteria 2724
227 Ga0209673_1024184 3300025273 Bacteria 2048
228 Ga0209130_1000005 3300025284 Bacteria 599620
229 Ga0209130_1000028 3300025284 Bacteria 325668
230 Ga0209676_1001325 3300025292 Bacteria 25063
231 Ga0209025_1000024 3300025294 Bacteria 528324
232 Ga0209025_1000377 3300025294 Bacteria 92728
233 Ga0209025_1001341 3300025294 Bacteria 33186
234 Ga0209025_1002318 3300025294 Bacteria 20601
235 Ga0209025_1012802 3300025294 Bacteria 5337
236 Ga0209025_1019667 3300025294 Bacteria 3741
237 Ga0209025_1039114 3300025294 Bacteria 2074
238 Ga0209564_1000093 3300025295 Bacteria 245793
239 Ga0209564_1001378 3300025295 Bacteria 25367
240 Ga0209564_1016216 3300025295 Bacteria 2980
241 Ga0209564_1064075 3300025295 Bacteria 803
242 Ga0209564_1064569 3300025295 Bacteria 797
243 Ga0209758_1000150 3300025297 Bacteria 163494
244 Ga0209758_1013507 3300025297 Bacteria 4444
245 Ga0209758_1014803 3300025297 Bacteria 4109
246 Ga0209758_1061825 3300025297 Bacteria 1230
247 Ga0209758_1107515 3300025297 Bacteria 779
248 Ga0209050_1009758 3300025298 Bacteria 4852
249 Ga0209256_1000027 3300025299 Bacteria 423283
250 Ga0209256_1001654 3300025299 Bacteria 21679
251 Ga0209256_1001872 3300025299 Bacteria 19427
252 Ga0207426_1000012 3300025302 Bacteria 730942
253 Ga0207426_1000015 3300025302 Bacteria 599316
254 Ga0207426_1006180 3300025302 Bacteria 5268
255 Ga0209051_1008107 3300025303 Bacteria 5616
256 Ga0209051_1009004 3300025303 Bacteria 5198
257 Ga0209051_1023500 3300025303 Bacteria 2559
258 Ga0209051_1048297 3300025303 Bacteria 1444
259 Ga0209257_1001105 3300025304 Bacteria 35073
260 Ga0207656_10093476 3300025321 Bacteria 1368
261 Ga0207642_10215804 3300025899 Bacteria 1069
262 Ga0207647_10031770 3300025904 Bacteria 3396
263 Ga0207647_10558768 3300025904 Bacteria 634
264 Ga0207705_10032925 3300025909 Bacteria 3704
265 Ga0207654_10022493 3300025911 Bacteria 3364
266 Ga0207654_11167695 3300025911 Bacteria 561
267 Ga0207695_10052067 3300025913 Bacteria 4292
268 Ga0207695_10209038 3300025913 Bacteria 1863
269 Ga0207695_10590437 3300025913 Bacteria 992
270 Ga0207695_10596455 3300025913 Bacteria 986
271 Ga0207671_10000099 3300025914 Bacteria 132378
272 Ga0207671_10039420 3300025914 Bacteria 3498
273 Ga0207671_10044229 3300025914 Bacteria 3293
274 Ga0207671_10131147 3300025914 Bacteria 1924
275 Ga0207671_10134873 3300025914 Bacteria 1897
276 Ga0207657_10003404 3300025919 Bacteria 16996
277 Ga0207657_10059244 3300025919 Bacteria 3292
278 Ga0207649_10025092 3300025920 Bacteria 3472
279 Ga0207649_10025957 3300025920 Bacteria 3422
280 Ga0207649_10111513 3300025920 Bacteria 1828
281 Ga0207649_10475181 3300025920 Bacteria 947
282 Ga0207694_10013184 3300025924 Bacteria 6223
283 Ga0207694_10048161 3300025924 Bacteria 3298
284 Ga0207694_10059881 3300025924 Bacteria 2962
285 Ga0207694_10999250 3300025924 Bacteria 708
286 Ga0207650_11068244 3300025925 Bacteria 687
287 Ga0207659_10126363 3300025926 Bacteria 1967
288 Ga0207644_10129897 3300025931 Bacteria 1927
289 Ga0207644_10309605 3300025931 Bacteria 1275
290 Ga0207690_10096223 3300025932 Bacteria 2105
291 Ga0207690_10199653 3300025932 Bacteria 1518
292 Ga0207690_10638530 3300025932 Bacteria 872
293 Ga0207706_10508283 3300025933 Bacteria 1040
294 Ga0207669_10029972 3300025937 Bacteria 3017
295 Ga0207704_11032274 3300025938 Bacteria 696
296 Ga0207691_10022269 3300025940 Bacteria 5978
297 Ga0207689_10289738 3300025942 Bacteria 1356
298 Ga0207661_10156209 3300025944 Bacteria 1976
299 Ga0207679_10196903 3300025945 Bacteria 1680
300 Ga0207667_10027567 3300025949 Bacteria 6180
301 Ga0207667_10217769 3300025949 Bacteria 1956
302 Ga0207667_10644288 3300025949 Bacteria 1066
303 Ga0207667_10716407 3300025949 Bacteria 1002
304 Ga0207667_11525029 3300025949 Bacteria 639
305 Ga0207668_10044029 3300025972 Bacteria 3034
306 Ga0207668_10524986 3300025972 Bacteria 1022
307 Ga0207640_10062710 3300025981 Bacteria 2467
308 Ga0207640_11539430 3300025981 Bacteria 598
309 Ga0207658_10739460 3300025986 Bacteria 890
310 Ga0207658_11409788 3300025986 Bacteria 637
311 Ga0207677_10060700 3300026023 Bacteria 2615
312 Ga0207703_10165180 3300026035 Bacteria 1942
313 Ga0207639_10016390 3300026041 Bacteria 5241
314 Ga0207639_10237092 3300026041 Bacteria 1584
315 Ga0207639_10501444 3300026041 Bacteria 1109
316 Ga0207639_10844269 3300026041 Bacteria 855
317 Ga0207639_12268190 3300026041 Bacteria 504
318 Ga0207678_10118412 3300026067 Bacteria 2260
319 Ga0207678_10177741 3300026067 Bacteria 1817
320 Ga0207678_10223486 3300026067 Bacteria 1612
321 Ga0207678_10845446 3300026067 Bacteria 809
322 Ga0207702_10026350 3300026078 Bacteria 4827
323 Ga0207702_10083818 3300026078 Bacteria 2774
324 Ga0207702_10114212 3300026078 Bacteria 2406
325 Ga0207702_10321314 3300026078 Bacteria 1474
326 Ga0207648_10221475 3300026089 Bacteria 1682
327 Ga0207648_10592794 3300026089 Bacteria 1021
328 Ga0207674_10004838 3300026116 Bacteria 16125
329 Ga0207674_10201622 3300026116 Bacteria 1939
330 Ga0207674_10231188 3300026116 Bacteria 1797
331 Ga0207674_10404515 3300026116 Bacteria 1319
332 Ga0207674_10698860 3300026116 Bacteria 979
333 Ga0207683_10088066 3300026121 Bacteria 2762
334 Ga0207683_10321178 3300026121 Bacteria 1418
335 Ga0207698_10015331 3300026142 Bacteria 5128
336 Ga0207698_10041703 3300026142 Bacteria 3423
337 Ga0207698_10072190 3300026142 Bacteria 2743
338 Ga0207698_10512156 3300026142 Bacteria 1169
339 Ga0209281_1000809 3300027111 Bacteria 28568
340 Ga0268266_10000391 3300028379 Bacteria 66400
341 Ga0268266_10742379 3300028379 Bacteria 947
342 Ga0265318_10031577 3300028577 Bacteria 2053
343 Ga0307515_10026670 3300028794 Bacteria 9929
344 Ga0307515_10422696 3300028794 Bacteria 953
345 Ga0265338_10008348 3300028800 Bacteria 12595
346 Ga0265330_10033192 3300031235 Bacteria 2310
347 Ga0265340_10218257 3300031247 Bacteria 855
348 Ga0265339_10051730 3300031249 Bacteria 2240
349 Ga0265331_10012154 3300031250 Bacteria 4677
350 Ga0265327_10032300 3300031251 Bacteria 2931
351 Ga0265316_10015330 3300031344 Bacteria 6705
352 Ga0307513_10006535 3300031456 Bacteria 15225
353 Ga0307513_10189961 3300031456 Bacteria 1907
354 Ga0307513_10497487 3300031456 Bacteria 937
355 Ga0265313_10000962 3300031595 Bacteria 28567
356 Ga0265314_10046761 3300031711 Bacteria 3051
357 Ga0265342_10026094 3300031712 Bacteria 3665
358 Ga0307516_10093184 3300031730 Bacteria 2838
359 Ga0307405_10001510 3300031731 Bacteria 9858
360 Ga0307405_11131470 3300031731 Unclassified 674
361 Ga0307410_10264206 3300031852 Bacteria 1343
362 Ga0307410_10401307 3300031852 Bacteria 1108
363 Ga0307410_12001072 3300031852 Bacteria 517
364 Ga0307406_10002121 3300031901 Bacteria 10797
365 Ga0307406_10907914 3300031901 Unclassified 750
366 Ga0307407_10209930 3300031903 Bacteria 1310
367 Ga0307412_10000777 3300031911 Bacteria 18415
368 Ga0307409_100700544 3300031995 Bacteria 1012
369 Ga0307409_100700652 3300031995 Bacteria 1012
370 Ga0307416_100281989 3300032002 Bacteria 1639
371 Ga0307416_100316647 3300032002 Unclassified 1560
372 Ga0373930_0022221 3300034816 Bacteria 1253
373 Ga0373949_0019242 3300035090 Bacteria 1554
374 Ga0373952_0042611 3300035092 Bacteria 1055
375 Ga0373932_0042040 3300035112 Bacteria 1324
376 Ga0373941_0165943 3300035115 Bacteria 820
377 Ga0373946_0160169 3300035171 Bacteria 1056
378 Ga0373931_0202569 3300035691 Bacteria 1186
379 Ga0373927_0612003 3300035695 Bacteria 720
380 Ga0373925_0147774 3300037068 Bacteria 1843
381 Ga0373925_0848465 3300037068 Bacteria 753
382 Ga0395899_0071063 3300037312 Bacteria 2547
383 Ga0395899_0555648 3300037312 Bacteria 737
384 Ga0395900_0042983 3300037418 Bacteria 4656
385 Ga0395900_0073589 3300037418 Bacteria 3513
386 Ga0395900_0086703 3300037418 Bacteria 3217
387 Ga0395900_0194679 3300037418 Bacteria 2054
388 Ga0395898_1162714 3300037466 Bacteria 703
389 Ga0395905_0157381 3300037471 Bacteria 2136
390 Ga0395905_0205572 3300037471 Bacteria 1845
391 Ga0395905_0817723 3300037471 Bacteria 835
392 Ga0395901_0036925 3300038443 Bacteria 5052
393 Ga0395901_0067508 3300038443 Bacteria 3724
394 Ga0395901_0443448 3300038443 Bacteria 1328
395 Ga0395901_0537010 3300038443 Bacteria 1186
396 Ga0395901_1619437 3300038443 Bacteria 600
397 Ga0439436_0007013 3300041404 Bacteria 3467
398 Ga0439439_0023748 3300041406 Bacteria 1537
399 Ga0439439_0171214 3300041406 Bacteria 622
400 Ga0439465_0004886 3300041413 Bacteria 4308
401 Ga0439465_0010793 3300041413 Bacteria 2865
402 Ga0451837_0747757 3300041494 Bacteria 1746
403 Ga0439432_020030 3300042006 Bacteria 2226
404 Ga0439432_057550 3300042006 Bacteria 1203
405 Ga0439449_0204367 3300042007 Bacteria 739
406 Ga0439455_0171371 3300042012 Bacteria 623
407 Ga0439434_0048484 3300042435 Bacteria 1314
408 Ga0466972_0051082 3300044658 Bacteria 1995
409 Ga0466972_0203778 3300044658 Bacteria 926
410 Ga0466965_0275141 3300044683 Bacteria 908
411 Ga0466957_0220052 3300044842 Bacteria 1253
412 Ga0466960_0622413 3300044901 Bacteria 642
413 Ga0466967_0672632 3300045976 Bacteria 1025
414 Ga0495638_0000418 3300046460 Bacteria 51339
415 Ga0495650_0028711 3300046471 Bacteria 2547
416 Ga0495583_0033574 3300046506 Bacteria 2467
417 Ga0495606_0068359 3300046507 Bacteria 2248
418 Ga0495606_0145157 3300046507 Bacteria 1398
419 Ga0495606_0354703 3300046507 Bacteria 777
420 Ga0495606_0426763 3300046507 Bacteria 684
421 Ga0495610_0026586 3300046512 Bacteria 3088
422 Ga0495618_0182095 3300046514 Bacteria 1335
423 Ga0495620_0048549 3300046515 Bacteria 1821
424 Ga0495620_0063464 3300046515 Bacteria 1531
425 Ga0495632_0015362 3300046519 Bacteria 4298
426 Ga0495632_0030319 3300046519 Bacteria 2808
427 Ga0495654_0369164 3300046530 Bacteria 574
428 Ga0495587_0336131 3300046536 Bacteria 843
429 Ga0495668_0039174 3300046616 Bacteria 2647
430 Ga0495625_0025590 3300046660 Bacteria 4474
431 Ga0495625_0148169 3300046660 Bacteria 1579
432 Ga0495661_0020237 3300046665 Bacteria 4349
433 Ga0495661_0259876 3300046665 Bacteria 883
434 Ga0495673_0061921 3300047469 Bacteria 1600
435 Ga0495686_0057666 3300047472 Bacteria 2423
436 Ga0495686_0099734 3300047472 Bacteria 1753
437 Ga0495686_0234225 3300047472 Bacteria 1038
438 Ga0496100_0577560 3300048903 Bacteria 871
439 Ga0496101_0422335 3300048904 Bacteria 1051
440 Ga0496101_0517342 3300048904 Bacteria 943
441 Ga0496102_0502503 3300048905 Bacteria 1135
442 Ga0496102_0542638 3300048905 Bacteria 1085
443 Ga0496102_0558831 3300048905 Bacteria 1067
444 Ga0496103_0901182 3300048906 Bacteria 554
445 Ga0496104_0323568 3300048907 Bacteria 1455
446 Ga0496105_0327317 3300048908 Bacteria 1227
447 Ga0496107_0087497 3300048910 Bacteria 2275
448 Ga0496110_0372368 3300048913 Bacteria 1301
449 Ga0496111_0835875 3300048914 Bacteria 665
450 Ga0496112_0295832 3300048915 Bacteria 1565
451 Ga0496113_1235776 3300048916 Bacteria 582
452 Ga0496114_0234461 3300048917 Bacteria 1613
453 Ga0496114_1404330 3300048917 Bacteria 585
454 Ga0496116_0006249 3300048919 Bacteria 10859
455 Ga0496116_0022947 3300048919 Bacteria 4658
456 Ga0496116_0045989 3300048919 Bacteria 2949
457 Ga0496116_0100424 3300048919 Bacteria 1730
458 Ga0496116_0181923 3300048919 Bacteria 1124
459 Ga0496117_0001790 3300048920 Bacteria 29267
460 Ga0496117_0004943 3300048920 Bacteria 14321
461 Ga0496117_0052807 3300048920 Bacteria 2860
462 Ga0496117_0491919 3300048920 Bacteria 597
463 Ga0496118_0128595 3300048921 Bacteria 1632
464 Ga0496118_0198479 3300048921 Bacteria 1191
465 Ga0496119_0134812 3300048922 Bacteria 1341
466 Ga0496119_0153309 3300048922 Bacteria 1232
467 Ga0496119_0194681 3300048922 Bacteria 1054
468 Ga0496119_0288868 3300048922 Bacteria 813
469 Ga0496119_0421791 3300048922 Bacteria 633
470 Ga0496120_0008764 3300048923 Bacteria 7273
471 Ga0496120_0250315 3300048923 Bacteria 832
472 Ga0496121_0063986 3300048924 Bacteria 3001
473 Ga0496121_0123153 3300048924 Bacteria 1954
474 Ga0496121_0146228 3300048924 Bacteria 1746
475 Ga0496121_0151447 3300048924 Bacteria 1706
476 Ga0496121_0174972 3300048924 Bacteria 1555
477 Ga0496121_0286228 3300048924 Bacteria 1125
478 Ga0496121_0398412 3300048924 Bacteria 902
479 Ga0496121_0466751 3300048924 Bacteria 809
480 Ga0496122_0000321 3300048925 Bacteria 105353
481 Ga0496122_0040256 3300048925 Bacteria 3717
482 Ga0496122_0084848 3300048925 Bacteria 2188
483 Ga0496122_0120196 3300048925 Bacteria 1696
484 Ga0496122_0150948 3300048925 Bacteria 1434
485 Ga0496122_0205082 3300048925 Bacteria 1148
486 Ga0496122_0497265 3300048925 Bacteria 593
487 Ga0496123_0002294 3300048926 Bacteria 24023
488 Ga0496123_0002453 3300048926 Bacteria 22987
489 Ga0496123_0054291 3300048926 Bacteria 2639
490 Ga0496123_0097863 3300048926 Bacteria 1717
491 Ga0496124_0000558 3300048927 Bacteria 63070
492 Ga0496124_0002598 3300048927 Bacteria 23360
493 Ga0496124_0004301 3300048927 Bacteria 16726
494 Ga0496124_0088748 3300048927 Bacteria 2526
495 Ga0496124_0490525 3300048927 Bacteria 827
496 Ga0496124_0563234 3300048927 Bacteria 749
497 Ga0496124_0789793 3300048927 Bacteria 589
498 Ga0496125_0000628 3300048928 Bacteria 59302
499 Ga0496125_0006143 3300048928 Bacteria 13095
500 Ga0496125_0090448 3300048928 Bacteria 2297
501 Ga0496125_0216091 3300048928 Bacteria 1240
502 Ga0496126_0000378 3300048929 Bacteria 92187
503 Ga0496126_0030068 3300048929 Bacteria 5153
504 Ga0496126_0086643 3300048929 Bacteria 2760
505 Ga0496126_0446599 3300048929 Bacteria 1041
506 Ga0496126_0625952 3300048929 Bacteria 845
507 Ga0496126_0636267 3300048929 Bacteria 836
508 Ga0501031_0075511 3300049568 Bacteria 2194
509 Ga0501031_0715757 3300049568 Bacteria 643
510 Ga0501032_0006049 3300049569 Bacteria 8924
511 Ga0501032_0044975 3300049569 Bacteria 2987
512 Ga0501032_0090992 3300049569 Bacteria 2025
513 Ga0501032_0940381 3300049569 Bacteria 544
514 Ga0501033_0001198 3300049570 Bacteria 23371
515 Ga0501033_0002685 3300049570 Bacteria 14934
516 Ga0501033_0146538 3300049570 Bacteria 1704
517 Ga0501033_1104080 3300049570 Bacteria 527
518 Ga0501034_0000611 3300049571 Bacteria 56186
519 Ga0501034_0080065 3300049571 Bacteria 3270
520 Ga0501034_1699161 3300049571 Bacteria 504
521 Ga0501037_0000077 3300049573 Bacteria 91081
522 Ga0501037_0068581 3300049573 Bacteria 2582
523 Ga0501038_0054421 3300049574 Bacteria 3442
524 Ga0501038_0146394 3300049574 Bacteria 1928
525 Ga0501039_0013172 3300049575 Bacteria 6320
526 Ga0501042_0540034 3300049578 Bacteria 847
527 Ga0501043_0000114 3300049579 Bacteria 75782
528 Ga0501043_0021577 3300049579 Bacteria 5050
529 Ga0501043_0301776 3300049579 Bacteria 1223
530 Ga0501043_0301906 3300049579 Bacteria 1223
531 Ga0501046_0443277 3300049580 Bacteria 934
532 Ga0501047_0137210 3300049581 Bacteria 2326
533 Ga0501048_0403341 3300049582 Bacteria 977
534 Ga0501068_0075333 3300049584 Bacteria 2064
535 Ga0501068_0089463 3300049584 Bacteria 1898
536 Ga0501068_0126439 3300049584 Bacteria 1597
537 Ga0501068_0594196 3300049584 Bacteria 721
538 Ga0501069_0000016 3300049585 Bacteria 142565
539 Ga0501070_0000450 3300049586 Bacteria 37447
540 Ga0501070_0153410 3300049586 Bacteria 1900
541 Ga0501070_1523495 3300049586 Bacteria 505
542 Ga0501071_0002157 3300049587 Bacteria 11818
543 Ga0501072_0597904 3300049588 Bacteria 870
544 Ga0501073_0015087 3300049589 Bacteria 5606
545 Ga0501074_0000067 3300049590 Bacteria 49686
546 Ga0501080_0002371 3300049742 Bacteria 16432
547 Ga0501080_0475688 3300049742 Bacteria 1118
548 Ga0501080_0680795 3300049742 Bacteria 908
549 Ga0501083_0000111 3300049744 Bacteria 55529
550 Ga0501280_015862 3300049776 Bacteria 1082
551 Ga0501035_0000048 3300049822 Bacteria 146466
552 Ga0501035_0001858 3300049822 Bacteria 21271
553 Ga0501035_0094160 3300049822 Bacteria 2634
554 Ga0501044_0000003 3300049823 Bacteria 345647
555 Ga0501044_0354038 3300049823 Bacteria 1387
556 Ga0501044_0610175 3300049823 Bacteria 983
557 nmdc:mga03683_168965_c1 3300050489 Bacteria 993
558 nmdc:mga03n38_173897_c1 3300050490 Bacteria 1099
559 nmdc:mga03n38_319631_c1 3300050490 Bacteria 838
560 nmdc:mga03n38_560094_c1 3300050490 Bacteria 647
561 nmdc:mga03n38_564302_c1 3300050490 Bacteria 645
562 nmdc:mga0yw44_13252_c1 3300050492 Bacteria 4334
563 nmdc:mga0yw44_492430_c1 3300050492 Bacteria 832
564 nmdc:mga06z11_208041_c1 3300050494 Bacteria 1139
565 nmdc:mga06z11_812958_c1 3300050494 Bacteria 569
566 nmdc:mga06z11_896727_c1 3300050494 Bacteria 540
567 nmdc:mga07m45_380889_c1 3300050496 Bacteria 819
568 nmdc:mga07m45_599695_c1 3300050496 Bacteria 636
569 nmdc:mga05p37_1161233_c1 3300050507 Bacteria 802
570 nmdc:mga0n895_1204254_c1 3300050512 Bacteria 731
571 Ga0500647_0403096 3300053091 Bacteria 554
572 Ga0500562_113988 3300053108 Bacteria 736
573 Ga0500592_024372 3300053116 Bacteria 976
574 Ga0500618_008381 3300053125 Bacteria 2888
575 Ga0500568_0077674 3300053139 Bacteria 1263
576 Ga0500573_0006984 3300053140 Bacteria 6132
577 Ga0500573_0298534 3300053140 Bacteria 806
578 Ga0500616_0061423 3300053153 Bacteria 1945
579 Ga0500627_0038334 3300053158 Bacteria 2048
580 Ga0501084_0392713 3300054114 Bacteria 1172
581 Ga0501084_0402871 3300054114 Bacteria 1156
582 Ga0500661_030783 3300055283 Bacteria 947
583 Ga0587086_114302 3300059507 Bacteria 510
584 Ga0587088_016135 3300059508 Bacteria 1186
585 Ga0587128_139212 3300059630 Bacteria 544
586 Ga0587068_106416 3300059641 Bacteria 594
587 Ga0587075_013271 3300059644 Bacteria 1131
588 Ga0587076_045237 3300059645 Bacteria 838
589 Ga0587071_029025 3300060344 Bacteria 1056
590 Ga0501082_0006930 3300060353 Bacteria 9794
591 2509109045 2508501122 Bacteria 6292184
592 2509388704 2509276021 Bacteria 7634384
593 2509444292 2509276033 Bacteria 7180565
594 2510131145 2510065019 Bacteria 6903379
595 2510303438 2510065057 Bacteria 6649661
596 2510839443 2510461069 Bacteria 5505000
597 2511186902 2510917028 Bacteria 6185411
598 2513582351 2513237086 Bacteria 7265287
599 2513597362 2513237088 Bacteria 6927906
600 2513608194 2513237090 Bacteria 7096802
601 2513616054 2513237091 Bacteria 6900273
602 2513869081 2513237138 Bacteria 7368160
603 2513884744 2513237140 Bacteria 7076289
604 2513905139 2513237143 Bacteria 6664116
605 2513911253 2513237144 Bacteria 7530820
606 2513924549 2513237146 Bacteria 7166346
607 2515110077 2515075009 Bacteria 7288508
608 2515607510 2515154107 Bacteria 6795637
609 2516204544 2516143018 Bacteria 6951533
610 2516891638 2516653046 Bacteria 6989037
611 2524450756 2524023207 Bacteria 6813453
612 2524458180 2524023209 Bacteria 6679728
613 2530648079 2529292951 Bacteria 6916614
614 2535514836 2534681796 Bacteria 7146037
615 2551680036 2551306084 Bacteria 8942552
616 2551683609 2551306085 Bacteria 7347181
617 2551690905 2551306086 Bacteria 6843938
618 2551713684 2551306089 Bacteria 7162724
619 2551727619 2551306091 Bacteria 7086830
620 2551737134 2551306092 Bacteria 6992595
621 2551742365 2551306093 Bacteria 7064773
622 2558866323 2558860100 Bacteria 8458965
623 2585205568 2582581294 Bacteria 6626667
624 2585229582 2582581299 Bacteria 6518058
625 2585398821 2582581867 Bacteria 7184437
626 2585541942 2585427528 Bacteria 6842387
627 2585819059 2585427590 Bacteria 6824633
628 2585840410 2585427593 Bacteria 7141551
629 2585843974 2585427594 Bacteria 6180594
630 2599332805 2599185156 Bacteria 5403036
631 2599419487 2599185170 Bacteria 7295545
632 2599939897 2599185301 Bacteria 6161860
633 2600191173 2599185352 Bacteria 7228948
634 2616293687 2615840624 Bacteria 6557588
635 2643806059 2643221557 Bacteria 7184309
636 2643813883 2643221558 Bacteria 5460675
637 2644004665 2643221599 Bacteria 6292121
638 2644066236 2643221610 Bacteria 7480339
639 2644103522 2643221618 Bacteria 7717186
640 2644132708 2643221623 Bacteria 5239945
641 2644144401 2643221626 Bacteria 8069654
642 2644194537 2643221634 Bacteria 6705461
643 2644237421 2643221643 Bacteria 5749658
644 2644297861 2643221653 Bacteria 4569637
645 2644306452 2643221655 Bacteria 7722067
646 2644330642 2643221659 Bacteria 7890716
647 2644377320 2643221668 Bacteria 7306521
648 2644417567 2643221675 Bacteria 7473456
649 2644450963 2643221680 Bacteria 7473610
650 2644542554 2643221698 Bacteria 7756764
651 2644612063 2643221712 Bacteria 7729434
652 2644656114 2643221719 Bacteria 4568197
653 2644671743 2643221723 Bacteria 7095460
654 2644692614 2643221726 Bacteria 7455827
655 2657683000 2657244999 Bacteria 5946535
656 2694632522 2693429783 Bacteria 7019804
657 2694639747 2693429784 Bacteria 7241525
658 2719179293 2718217882 Bacteria 6556348
659 2719383863 2718217927 Bacteria 6972593
660 2719663653 2718217997 Bacteria 6740740
661 2719729963 2718218009 Bacteria 6478651
662 2720490072 2718218199 Bacteria 6740745
663 2720611452 2718218232 Bacteria 6720332
664 2720618302 2718218233 Bacteria 6662049
665 2720629705 2718218235 Bacteria 6630699
666 2720773401 2718218269 Bacteria 6906114
667 2721145386 2718218363 Bacteria 6524337
668 2721156902 2718218365 Bacteria 6274507
669 2721162281 2718218366 Bacteria 6425255
670 2721397633 2718218423 Bacteria 6438183
671 2722838451 2721755514 Bacteria 6424414
672 2723025075 2721755556 Bacteria 6745503
673 2723558657 2721755684 Bacteria 6859907
674 2723565227 2721755685 Bacteria 6704835
675 2724036443 2721755809 Bacteria 6438790
676 2724042719 2721755810 Bacteria 6479005
677 2724088008 2721755819 Bacteria 6906405
678 2724102492 2721755822 Bacteria 6726041
679 2724108392 2721755823 Bacteria 6752556
680 2730106011 2728369352 Bacteria 6745171
681 2730162530 2728369365 Bacteria 6555560
682 2730296534 2728369397 Bacteria 6274511
683 2738804511 2738541293 Bacteria 7065685
684 2739036833 2738541333 Bacteria 7106503
685 2739308607 2738543024 Bacteria 5603683
686 2753462663 2751185821 Bacteria 6189929
687 2776911795 2775507049 Bacteria 6284736
688 2792583124 2791355082 Bacteria 5973319
689 2792621203 2791355091 Bacteria 6135441
690 2792625418 2791355092 Bacteria 6248105
691 2792637850 2791355094 Bacteria 7011481
692 2793283396 2791355253 Bacteria 5171699
693 2793313935 2791355259 Bacteria 7254731
694 2793322229 2791355260 Bacteria 6598818
695 2793329950 2791355261 Bacteria 6661293
696 2793344853 2791355263 Bacteria 6872478
697 2793348405 2791355264 Bacteria 6429314
698 2793365620 2791355267 Bacteria 7222458
699 2804750717 2802429268 Bacteria 6094027
700 2805928083 2802429605 Bacteria 6875453
701 2805935444 2802429606 Bacteria 6346811
702 2806046759 2802429633 Bacteria 7341974
703 2806051520 2802429634 Bacteria 7083200
704 2806059509 2802429635 Bacteria 7650140
705 2806066526 2802429636 Bacteria 7597525
706 2806073584 2802429637 Bacteria 7067217
707 2819245105 2818991272 Bacteria 4622173
708 2838022536 2838016132 Bacteria 6577831
709 2838028479 2838022645 Bacteria 6494267
710 2838039981 2838035591 Bacteria 7166484
711 2838048798 2838042994 Bacteria 6046894
712 2838053852 2838048938 Bacteria 6044578
713 2838065936 2838061910 Bacteria 6794874
714 2838070808 2838068647 Bacteria 6208656
715 2838075134 2838074704 Bacteria 6785777
716 2838666134 2838661181 Bacteria 7385261
717 2838680319 2838680041 Bacteria 6545511
718 2838695649 2838694306 Bacteria 6853137
719 2838709025 2838707686 Bacteria 6619912
720 2841868816 2841864319 Bacteria 6742987
721 2842079740 2842077413 Bacteria 6508645
722 2842120358 2842118031 Bacteria 7033875
723 2842198085 2842192696 Bacteria 6147454
724 2842204507 2842198810 Bacteria 6608673
725 2842211108 2842205361 Bacteria 6340321
726 2842238436 2842237096 Bacteria 6620661
727 2842270379 2842264693 Bacteria 6472963
728 2842284561 2842278818 Bacteria 6340002
729 2842286567 2842285085 Bacteria 6011953
730 2842293401 2842291075 Bacteria 7076806
731 2842299635 2842298080 Bacteria 6123127
732 2842317201 2842311132 Bacteria 6616990
733 2842323735 2842317721 Bacteria 6793725
734 2842344348 2842341865 Bacteria 7003929
735 2842361064 2842357229 Bacteria 6485165
736 2842367393 2842363717 Bacteria 6844742
737 2842370782 2842370503 Bacteria 7038661
738 2842379798 2842377471 Bacteria 7140707
739 2842386869 2842384541 Bacteria 7057858
740 2842401779 2842395702 Bacteria 6780583
741 2842403880 2842402390 Bacteria 6681310
742 2842410417 2842409023 Bacteria 6687331
743 2842417065 2842415677 Bacteria 6596907
744 2842424423 2842422224 Bacteria 6239196
745 2842434201 2842428310 Bacteria 6767288
746 2842440534 2842434925 Bacteria 6502746
747 2842447186 2842441272 Bacteria 6769273
748 2842452920 2842447887 Bacteria 6754142
749 2842468629 2842462802 Bacteria 6588055
750 2842475139 2842469257 Bacteria 6752936
751 2842486180 2842482326 Bacteria 7212537
752 2842495406 2842489311 Bacteria 6620893
753 2842499990 2842495871 Bacteria 6820686
754 2842512858 2842509118 Bacteria 6850950
755 2844170208 2844163670 Bacteria 7266046
756 2847672032 2847670302 Bacteria 6165597
757 2847688342 2847686936 Bacteria 6278406
758 2850079717 2850079185 Bacteria 6848280
759 2855828005 2855825444 Bacteria 6785811
760 2855839775 2855839649 Bacteria 7135830
761 2856318228 2856314179 Bacteria 6477897
762 2856358857 2856356410 Bacteria 6297484
763 2856364875 2856364286 Bacteria 6939991
764 2857354869 2857349434 Bacteria 7926032
765 2858803650 2858800743 Bacteria 6603254
766 2869289676 2869285874 Bacteria 6901219
767 2871431742 2871429161 Bacteria 6547891
768 2871449466 2871444079 Bacteria 6423508
769 2871494142 2871488783 Bacteria 6929816
770 2871499004 2871495908 Bacteria 6935695
771 2874103966 2874102143 Bacteria 6342645
772 2874155420 2874146452 Bacteria 7533118
773 2874162277 2874155637 Bacteria 6724144
774 2876375286 2876369609 Bacteria 6807521
775 2876383631 2876377896 Bacteria 6565995
776 2876398821 2876392853 Bacteria 6660880
777 2876420765 2876413966 Bacteria 6831344
778 2878037540 2878035449 Bacteria 6555736
779 2878748348 2878745973 Bacteria 6867388
780 2878756717 2878753008 Bacteria 6922523
781 2878763214 2878760144 Bacteria 6823465
782 2878770192 2878767105 Bacteria 6898628
783 2881163034 2881161766 Bacteria 7127907
784 2881851061 2881845957 Bacteria 6611900
785 2881862540 2881861095 Bacteria 7128710
786 2882915407 2882912400 Bacteria 6801539
787 2885311969 2885305155 Bacteria 7348390
788 2885325345 2885318864 Bacteria 6729568
789 2885329516 2885326080 Bacteria 7134805
790 2885342080 2885334103 Bacteria 7216818
791 2888350867 2888350351 Bacteria 7372807
792 2889013214 2889010040 Bacteria 6749192
793 2889021934 2889016732 Bacteria 6700763
794 2891374758 2891373044 Bacteria 5202277
795 2896388543 2896384573 Bacteria 7700774
796 2899808785 2899803654 Bacteria 5577784
797 2903502354 2903492973 Bacteria 13473544
798 2903506025 2903492973 Bacteria 13473544
799 2903543805 2903540706 Bacteria 7062119
800 2904665353 2904659560 Bacteria 6685615
801 2906311965 2906308376 Bacteria 6841989
802 2906323703 2906321335 Bacteria 6579571
803 2906331506 2906328253 Bacteria 6585166
804 2906355129 2906354277 Bacteria 6991324
805 2906418265 2906414383 Bacteria 6580790
806 2913298194 2913295892 Bacteria 6333755
807 2915987790 2915986958 Bacteria 6739310
808 2915997218 2915993759 Bacteria 7016183
809 2916000876 2916000859 Bacteria 6865702
810 2916014112 2916007675 Bacteria 6898660
811 2916021237 2916014648 Bacteria 6946486
812 2916021932 2916021584 Bacteria 6854472
813 2916034159 2916028427 Bacteria 6748433
814 2916040798 2916035215 Bacteria 6755766
815 2916042643 2916041962 Bacteria 6820487
816 2916053606 2916048683 Bacteria 6543552
817 2916057018 2916055098 Bacteria 6758838
818 2916072744 2916068649 Bacteria 6943657
819 2916078433 2916076590 Bacteria 6596108
820 2919451392 2919450847 Bacteria 5631160
821 2920763614 2920760137 Bacteria 7427611
822 2920823093 2920822456 Bacteria 6897201
823 2921207090 2921201388 Bacteria 6926299
824 2921213751 2921208531 Bacteria 6745326
825 2921241468 2921237296 Bacteria 6876710
826 2921247032 2921244191 Bacteria 6568419
827 2921262781 2921257292 Bacteria 6808382
828 2921268764 2921263974 Bacteria 6864552
829 2921288161 2921282425 Bacteria 6826397
830 2921293740 2921289301 Bacteria 7316391
831 2922136673 2922130491 Bacteria 7173936
832 2922190562 2922185730 Bacteria 7113964
833 2923556453 2923556063 Bacteria 6793593
834 2924150712 2924144063 Bacteria 6883928
835 2924154276 2924150972 Bacteria 7169444
836 2924164695 2924158325 Bacteria 7188855
837 2924166478 2924165586 Bacteria 7260590
838 2924178899 2924172951 Bacteria 6749356
839 2924184911 2924179722 Bacteria 6843264
840 2924190386 2924186466 Bacteria 6876637
841 2924198939 2924193448 Bacteria 6955718
842 2924200807 2924200457 Bacteria 6757188
843 2924209312 2924207177 Bacteria 6917007
844 2924215019 2924214083 Bacteria 7080103
845 2924228245 2924221636 Bacteria 7113495
846 2924232699 2924228884 Bacteria 6633132
847 2924733135 2924726620 Bacteria 6271473
848 2924788306 2924784321 Bacteria 7416538
849 2933020263 2933016740 Bacteria 6355406
850 2933601611 2933599457 Bacteria 5858799
851 2935896171 2935894831 Bacteria 6620579
852 2936387157 2936381700 Bacteria 7006523
853 2936998505 2936996657 Bacteria 6298727
854 2937007755 2937002841 Bacteria 6934057
855 2937015004 2937009748 Bacteria 6746052
856 2937022252 2937016420 Bacteria 6782579
857 2937023424 2937023124 Bacteria 6815156
858 2937046267 2937042894 Bacteria 6741576
859 2937053316 2937049772 Bacteria 6757901
860 2937057587 2937056579 Bacteria 7107896
861 2937065390 2937063883 Bacteria 7199456
862 2937077168 2937071275 Bacteria 6984483
863 2937098917 2937091812 Bacteria 6979387
864 2937102750 2937098957 Bacteria 7249374
865 2937106464 2937106411 Bacteria 6947143
866 2937119423 2937113482 Bacteria 6505872
867 2937126238 2937119839 Bacteria 6597547
868 2937131661 2937126314 Bacteria 6771275
869 2937818212 2937813078 Bacteria 7783518
870 2937819584 2937813078 Bacteria 7783518
871 2937896415 2937891427 Bacteria 6357007
872 2937997655 2937994558 Bacteria 7036190
873 2938022371 2938014810 Bacteria 6700592
874 2939674137 2939669807 Bacteria 5028511
875 2941500945 2941499720 Bacteria 7599444
876 2957387102 2957382221 Bacteria 6737050
877 2957393331 2957388812 Bacteria 6778072
878 2957397777 2957395598 Bacteria 6822399
879 2957407249 2957402308 Bacteria 6741770
880 2957413370 2957408893 Bacteria 6558585
881 2957417724 2957415311 Bacteria 6991633
882 2957425290 2957422303 Bacteria 7172205
883 2957436838 2957430029 Bacteria 7022557
884 2957447346 2957443900 Bacteria 6869977
885 2957456631 2957450854 Bacteria 6765715
886 2957460649 2957457609 Bacteria 6967680
887 2957469512 2957464669 Bacteria 6568877
888 2957471711 2957471148 Bacteria 6797643
889 2957481931 2957478035 Bacteria 6756658
890 2957490955 2957484790 Bacteria 6703082
891 2957495731 2957491536 Bacteria 6695180
892 2957500717 2957498199 Bacteria 7126688
893 2957508075 2957505466 Bacteria 7253085
894 2958045475 2958041894 Bacteria 13082850
895 2958104015 2958100919 Bacteria 6800575
896 2958116698 2958115193 Bacteria 6923548
897 2958134049 2958130278 Bacteria 6897202
898 2958168129 2958165035 Bacteria 6906348
899 2958179178 2958172287 Bacteria 6716688
900 2958183695 2958179912 Bacteria 6874908
901 2960590279 2960584000 Bacteria 6864594
902 2960603335 2960597568 Bacteria 6550735
903 2960607858 2960603979 Bacteria 6898737
904 2960611674 2960610863 Bacteria 6691244
905 2960620075 2960617483 Bacteria 6727748
906 2960626721 2960624210 Bacteria 6875384
907 2960639144 2960637947 Bacteria 7296468
908 2960648134 2960645483 Bacteria 7211087
909 2960654427 2960652885 Bacteria 7083688
910 2960660630 2960660292 Bacteria 7041660
911 2960672135 2960667422 Bacteria 6763020
912 2960678670 2960674078 Bacteria 6609048
913 2960687453 2960687367 Bacteria 6535474
914 2961081661 2961077736 Bacteria 7079850
915 2961120353 2961114664 Bacteria 6680456
916 2961166594 2961163497 Bacteria 6901077
917 2961173007 2961170736 Bacteria 7072258
918 2964613464 2964607997 Bacteria 7101408
919 2964618377 2964615318 Bacteria 6809089
920 2964625504 2964621998 Bacteria 6834995
921 2964633736 2964628898 Bacteria 7083044
922 2964643099 2964636051 Bacteria 7091832
923 2964649560 2964643177 Bacteria 6820887
924 2964650114 2964649959 Bacteria 6675118
925 2964663130 2964656573 Bacteria 7100150
926 2964668044 2964663802 Bacteria 7019362
927 2964671341 2964670856 Bacteria 6851364
928 2964682635 2964678106 Bacteria 6792020
929 2964687637 2964685014 Bacteria 6839111
930 2964696618 2964691889 Bacteria 6802758
931 2964703997 2964698721 Bacteria 6765331
932 2964710274 2964705432 Bacteria 7114648
933 2964714318 2964712639 Bacteria 6695970
934 2964721982 2964719344 Bacteria 7286602
935 2965021417 2965018300 Bacteria 6883036
936 2965070151 2965062239 Bacteria 7412989
937 2965122593 2965119406 Bacteria 6956431
938 2967671425 2967664464 Bacteria 6948836
939 2967678474 2967671571 Bacteria 7021409
940 2967682542 2967678726 Bacteria 7264382
941 2967694852 2967693043 Bacteria 6804451
942 2967703586 2967699805 Bacteria 6854538
943 2967712725 2967706974 Bacteria 7186053
944 2967714446 2967714385 Bacteria 7000047
945 2967723770 2967721400 Bacteria 7073753
946 2967739196 2967735183 Bacteria 6827012
947 2967746353 2967742019 Bacteria 6794534
948 2967754717 2967748971 Bacteria 6733771
949 2967758199 2967755722 Bacteria 6814706
950 2967766607 2967762386 Bacteria 6923502
951 2967769888 2967769361 Bacteria 6587838
952 2967776460 2967775926 Bacteria 6738189
953 2967998218 2967996073 Bacteria 6787468
954 2968008870 2968003550 Bacteria 6929263
955 2968095694 2968091066 Bacteria 6052692
956 2968099614 2968097103 Bacteria 6107094
957 2968116820 2968110612 Bacteria 6814636
958 2968118546 2968117919 Bacteria 6536078
959 2968131878 2968128360 Bacteria 6270294
960 2968174999 2968171901 Bacteria 6894245
961 2970021285 2970019648 Bacteria 7072033
962 2970034751 2970033650 Bacteria 7118744
963 2970041063 2970040964 Bacteria 6731123
964 2970054035 2970047711 Bacteria 7088379
965 2970056901 2970054988 Bacteria 6611507
966 2970062215 2970061556 Bacteria 7099761
967 2970069774 2970068827 Bacteria 7123112
968 2970080804 2970076120 Bacteria 6697332
969 2970088136 2970082768 Bacteria 6183754
970 2970089449 2970088815 Bacteria 6933825
971 2970098843 2970095765 Bacteria 6936963
972 2970106036 2970102677 Bacteria 6812532
973 2970110958 2970109326 Bacteria 6863976
974 2970118211 2970116247 Bacteria 6501857
975 2970131350 2970129317 Bacteria 6806560
976 2970142087 2970136068 Bacteria 7207982
977 2970154565 2970149975 Bacteria 6779706
978 2970163740 2970156795 Bacteria 7168044
979 2970170169 2970164137 Bacteria 6861252
980 2970177667 2970170962 Bacteria 6876229
981 2970183606 2970177841 Bacteria 6768001
982 2970188745 2970184632 Bacteria 7054431
983 2970197505 2970191845 Bacteria 7032787
984 2970505601 2970503327 Bacteria 7099517
985 2970558058 2970554993 Bacteria 6814252
986 2977521062 2977516862 Bacteria 6940108
987 2977528493 2977523885 Bacteria 6960446
988 2977543738 2977537788 Bacteria 6929320
989 2977554769 2977551784 Bacteria 7125765
990 2977563778 2977558990 Bacteria 6863948
991 2977571509 2977565890 Bacteria 6901543
992 2977574735 2977572785 Bacteria 6763888
993 2977584387 2977579622 Bacteria 6772100
994 2977825897 2977821940 Bacteria 6906439
995 2977851308 2977843712 Bacteria 6753583
996 2977860283 2977858184 Bacteria 6215359
997 2977869127 2977864932 Bacteria 7534097
998 2977946652 2977942078 Bacteria 7570577
999 2977974629 2977971508 Bacteria 7472917
1000 2979717344 2979710463 Bacteria 6785254
1001 2979744935 2979742915 Bacteria 7301278
1002 2979781245 2979779861 Bacteria 6219781
1003 2979810322 2979808191 Bacteria 7179355
1004 2987643471 2987636660 Bacteria 8088555
1005 2987654952 2987652177 Bacteria 6969023
1006 2987662605 2987659509 Bacteria 6966464
1007 2989351922 2989349275 Bacteria 6349068
1008 2989777192 2989776772 Bacteria 4843317
1009 2996347094 2996341866 Bacteria 6643098
1010 2996888255 2996887358 Bacteria 5795980
1011 2996897864 2996893221 Bacteria 5823108
1012 3003931474 3003930520 Bacteria 5667563
1013 3004191656 3004188549 Bacteria 6952365
1014 3004207016 3004203850 Bacteria 7307914
1015 3005410906 3005409236 Bacteria 7188837
1016 3005445945 3005445848 Bacteria 6906074
1017 3005456622 3005452660 Bacteria 5889319
1018 648736824 648276728 Bacteria 6968865
1019 8001847917 8001845381 Bacteria 5804942
1020 8002288015 8002285264 Bacteria 6717907
1021 8003992228 8003992118 Bacteria 7266902
1022 8004378305 8004374579 Bacteria 6898112
1023 8004391554 8004387939 Bacteria 7049250
1024 8004449249 8004445564 Bacteria 6322258
1025 8004646143 8004640170 Bacteria 6723001
1026 8004705043 8004703790 Bacteria 8006957
1027 8004716923 8004714634 Bacteria 6776161
1028 8005247660 8005246636 Bacteria 4933972
1029 8005261193 8005258706 Bacteria 6184835
1030 8005263228 8005258706 Bacteria 6184835
1031 8005278569 8005275841 Bacteria 6929066
1032 8005282891 8005282627 Bacteria 6675747
1033 8005291363 8005289223 Bacteria 6634003
1034 8005305736 8005301065 Bacteria 6614431
1035 8005322782 8005321885 Bacteria 5795980
1036 8005385053 8005382845 Bacteria 6732062
1037 8005399870 8005395548 Bacteria 6806915
1038 8005432668 8005430974 Bacteria 6689030
1039 8005460713 8005460587 Bacteria 7157962
1040 8005484760 8005484373 Bacteria 6297373
1041 8005498397 8005497431 Bacteria 6477605
1042 8005543508 8005542996 Bacteria 7077758
1043 8005560321 8005556819 Bacteria 6908598
1044 8005564218 8005563573 Bacteria 7153261
1045 8005573782 8005570704 Bacteria 6957481
1046 8005619588 8005619151 Bacteria 7030230
1047 8005628154 8005626139 Bacteria 6534237
1048 8005669806 8005668836 Bacteria 6953162
1049 8005685304 8005682033 Bacteria 6726518
1050 8005692509 8005688590 Bacteria 6610080
1051 8005699553 8005695170 Bacteria 6912330
1052 8018132830 8018127388 Bacteria 7351159
1053 8018153484 8018150411 Bacteria 5549903
1054 8018167297 8018163183 Bacteria 7277977
1055 8018181782 8018176218 Bacteria 6896178
1056 8024480004 8024479707 Bacteria 6954785
1057 8024502273 8024501048 Bacteria 6427847
1058 8046770890 8046767195 Bacteria 7547379
1059 8049293269 8049293176 Bacteria 6128433
1060 8054562432 8054558443 Bacteria 5204801
1061 8056376213 8056375014 Bacteria 7006639
1062 8057580501 8057575449 Bacteria 7367519
1063 Ga0157374_10432640
1064 JGI24735J21928_10086643
1065 JGI25158J39367_1032113
1066 JGI25157J39369_1001027
1067 JGI25152J39213_1001483
1068 JGI25152J39213_1003180
1069 JGI25150J39212_1000199
1070 JGI25159J45721_1000003
1071 JGI25159J45721_1002037
1072 JGI25151J46595_10001303
1073 JGI25151J46595_10004870
1074 JGI25151J46595_10006323
1075 JGI25406J46586_10008349
1076 JGI25165J46597_1000016
1077 JGI25153J46596_10000978
1078 rootH1_10116783
1079 rootH2_10011781
1080 rootH2_10049858
1081 rootH1_10019781
1082 rootH1_10019782
1083 rootH1_10021120
1084 rootH1_10107305
1085 JGI25160J50197_1000003
1086 JGI25160J50197_1000012
1087 JGI25160J50197_1003267
1088 JGI25160J50197_1027133
1089 JGI25161J50226_1000002
1090 JGI25161J50226_1000239
1091 JGI25161J50226_1003433
1092 Ga0006562J51391_1034067
1093 Ga0055526_1003533
1094 Ga0055526_1004786
1095 Ga0055524_1000434
1096 Ga0055524_1001875
1097 Ga0055524_1002834
1098 Ga0055524_1004206
1099 Ga0055536_1009396
1100 Ga0055528_1000594
1101 Ga0055528_1006905
1102 Ga0055528_1021981
1103 Ga0055530_10025614
1104 Ga0055540_1000272
1105 Ga0055540_1026319
1106 Ga0055540_1049979
1107 Ga0055531_10017334
1108 Ga0055543_1000043
1109 Ga0055543_1000050
1110 Ga0055543_1000774
1111 Ga0065165_1000025
1112 Ga0065165_1000031
1113 Ga0065165_1004348
1114 Ga0065165_1027649
1115 Ga0070676_10212871
1116 Ga0070683_100057160
1117 Ga0070670_100322704
1118 Ga0068869_100348922
1119 Ga0070666_10201911
1120 Ga0070660_100027460
1121 Ga0070660_100285741
1122 Ga0070661_100008136
1123 Ga0070661_100013469
1124 Ga0070661_100205093
1125 Ga0070661_100613857
1126 Ga0070668_100105865
1127 Ga0070668_100178826
1128 Ga0070675_100192304
1129 Ga0070671_100013114
1130 Ga0070671_100225258
1131 Ga0070673_100018723
1132 Ga0070659_100012347
1133 Ga0070659_100060715
1134 Ga0070659_100101025
1135 Ga0070659_100555824
1136 Ga0070659_100975335
1137 Ga0070667_100270274
1138 Ga0070700_100414507
1139 Ga0070663_100074188
1140 Ga0070663_100273824
1141 Ga0070663_101093231
1142 Ga0070678_100138538
1143 Ga0070662_100480687
1144 Ga0068867_100392100
1145 Ga0070679_100837402
1146 Ga0070684_100381065
1147 Ga0068853_100039407
1148 Ga0068853_100077154
1149 Ga0068853_100221433
1150 Ga0068853_101591402
1151 Ga0070672_100786425
1152 Ga0070686_100090655
1153 Ga0070693_100718899
1154 Ga0070665_100096659
1155 Ga0070665_100102847
1156 Ga0068855_100025742
1157 Ga0068855_100080077
1158 Ga0068855_100235898
1159 Ga0068855_101384584
1160 Ga0068855_102094299
1161 Ga0068857_100007527
1162 Ga0068854_100066665
1163 Ga0068854_100080736
1164 Ga0068854_100089422
1165 Ga0068856_100058011
1166 Ga0068856_100112834
1167 Ga0068856_100115814
1168 Ga0068856_100223318
1169 Ga0068856_100249888
1170 Ga0068856_100498433
1171 Ga0068856_101609399
1172 Ga0068852_100007964
1173 Ga0068852_100045127
1174 Ga0068852_100050929
1175 Ga0068852_100113029
1176 Ga0068852_100287989
1177 Ga0068852_100591142
1178 Ga0068866_10600330
1179 Ga0068851_10016419
1180 Ga0068851_10058947
1181 Ga0068858_100211506
1182 Ga0081539_10003049
1183 Ga0075365_10006944
1184 Ga0075365_10008779
1185 Ga0075365_10011572
1186 Ga0075365_10137064
1187 Ga0075365_10161513
1188 Ga0075368_10020065
1189 Ga0075363_100132438
1190 Ga0075363_100167894
1191 Ga0075363_100492393
1192 Ga0075362_10000690
1193 Ga0075362_10259328
1194 Ga0075362_10267217
1195 Ga0075367_10007331
1196 Ga0075367_10075532
1197 Ga0075367_10500528
1198 Ga0075367_10509172
1199 Ga0075369_10014458
1200 Ga0075369_10077459
1201 Ga0075366_10042198
1202 Ga0075366_10879488
1203 Ga0075370_10002201
1204 Ga0075370_10188960
1205 Ga0075370_10256387
1206 Ga0068865_100392488
1207 Ga0075435_100384299
1208 Ga0105251_10014773
1209 Ga0105244_10090700
1210 Ga0105250_10027381
1211 Ga0105240_10040307
1212 Ga0105240_10189863
1213 Ga0105240_10210247
1214 Ga0105240_10410925
1215 Ga0105240_10867834
1216 Ga0105240_12584651
1217 Ga0105245_10199319
1218 Ga0114129_11356429
1219 Ga0105243_11233550
1220 Ga0105243_11318356
1221 Ga0105241_11294441
1222 Ga0105248_10766100
1223 Ga0105237_10000071
1224 Ga0105237_10026573
1225 Ga0105237_10104123
1226 Ga0105237_10387028
1227 Ga0105237_10999241
1228 Ga0105238_10001439
1229 Ga0105238_10015176
1230 Ga0105238_10052632
1231 Ga0105238_10211418
1232 Ga0105249_10251127
1233 Ga0105249_11187797
1234 Ga0123341_1000038
1235 Ga0123341_1000054
1236 Ga0123341_1036851
1237 Ga0123342_1013519
1238 Ga0123342_1018935
1239 Ga0105239_10027474
1240 Ga0105239_10182662
1241 Ga0105239_10201351
1242 Ga0105239_10201683
1243 Ga0105239_10315656
1244 Ga0105239_10328171
1245 Ga0105239_10373235
1246 Ga0157371_10043386
1247 Ga0157371_10167960
1248 Ga0157371_10765515
1249 Ga0157370_10148729
1250 Ga0157370_10150919
1251 Ga0157370_10709596
1252 Ga0157370_10729841
1253 Ga0157369_10105860
1254 Ga0157369_10236617
1255 Ga0157369_10568629
1256 Ga0171463_1001
1257 Ga0157378_10054679
1258 Ga0157378_10266716
1259 Ga0157378_11196274
1260 Ga0163162_11416224
1261 Ga0157372_10208590
1262 Ga0157372_10468223
1263 Ga0157372_11937034
1264 Ga0157372_11951626
1265 Ga0157372_12741704
1266 Ga0157375_11133313
1267 Ga0157375_11531052
1268 Ga0182008_10072474
1269 Ga0182008_10495417
1270 Ga0157376_10483449
1271 Ga0182005_1004662
1272 Ga0183362_10531
1273 Ga0183363_1081
1274 Ga0163161_10366513
1275 Ga0214544_1000105
1276 Ga0214542_1000029
1277 Ga0214543_1000040
1278 Ga0209436_101403
1279 Ga0209436_111980
1280 Ga0209563_105256
1281 Ga0207425_1000012
1282 Ga0209129_1000110
1283 Ga0209129_1000192
1284 Ga0209129_1002601
1285 Ga0209233_1000068
1286 Ga0209565_1056866
1287 Ga0209673_1000024
1288 Ga0209673_1016778
1289 Ga0209673_1024184
1290 Ga0209130_1000005
1291 Ga0209130_1000028
1292 Ga0209676_1001325
1293 Ga0209025_1000024
1294 Ga0209025_1000377
1295 Ga0209025_1001341
1296 Ga0209025_1002318
1297 Ga0209025_1012802
1298 Ga0209025_1019667
1299 Ga0209025_1039114
1300 Ga0209564_1000093
1301 Ga0209564_1001378
1302 Ga0209564_1016216
1303 Ga0209564_1064075
1304 Ga0209564_1064569
1305 Ga0209758_1000150
1306 Ga0209758_1013507
1307 Ga0209758_1014803
1308 Ga0209758_1061825
1309 Ga0209758_1107515
1310 Ga0209050_1009758
1311 Ga0209256_1000027
1312 Ga0209256_1001654
1313 Ga0209256_1001872
1314 Ga0207426_1000012
1315 Ga0207426_1000015
1316 Ga0207426_1006180
1317 Ga0209051_1008107
1318 Ga0209051_1009004
1319 Ga0209051_1023500
1320 Ga0209051_1048297
1321 Ga0209257_1001105
1322 Ga0207656_10093476
1323 Ga0207642_10215804
1324 Ga0207647_10031770
1325 Ga0207647_10558768
1326 Ga0207705_10032925
1327 Ga0207654_10022493
1328 Ga0207654_11167695
1329 Ga0207695_10052067
1330 Ga0207695_10209038
1331 Ga0207695_10590437
1332 Ga0207695_10596455
1333 Ga0207671_10000099
1334 Ga0207671_10039420
1335 Ga0207671_10044229
1336 Ga0207671_10131147
1337 Ga0207671_10134873
1338 Ga0207657_10003404
1339 Ga0207657_10059244
1340 Ga0207649_10025092
1341 Ga0207649_10025957
1342 Ga0207649_10111513
1343 Ga0207649_10475181
1344 Ga0207694_10013184
1345 Ga0207694_10048161
1346 Ga0207694_10059881
1347 Ga0207694_10999250
1348 Ga0207650_11068244
1349 Ga0207659_10126363
1350 Ga0207644_10129897
1351 Ga0207644_10309605
1352 Ga0207690_10096223
1353 Ga0207690_10199653
1354 Ga0207690_10638530
1355 Ga0207706_10508283
1356 Ga0207669_10029972
1357 Ga0207704_11032274
1358 Ga0207691_10022269
1359 Ga0207689_10289738
1360 Ga0207661_10156209
1361 Ga0207679_10196903
1362 Ga0207667_10027567
1363 Ga0207667_10217769
1364 Ga0207667_10644288
1365 Ga0207667_10716407
1366 Ga0207667_11525029
1367 Ga0207668_10044029
1368 Ga0207668_10524986
1369 Ga0207640_10062710
1370 Ga0207640_11539430
1371 Ga0207658_10739460
1372 Ga0207658_11409788
1373 Ga0207677_10060700
1374 Ga0207703_10165180
1375 Ga0207639_10016390
1376 Ga0207639_10237092
1377 Ga0207639_10501444
1378 Ga0207639_10844269
1379 Ga0207639_12268190
1380 Ga0207678_10118412
1381 Ga0207678_10177741
1382 Ga0207678_10223486
1383 Ga0207678_10845446
1384 Ga0207702_10026350
1385 Ga0207702_10083818
1386 Ga0207702_10114212
1387 Ga0207702_10321314
1388 Ga0207648_10221475
1389 Ga0207648_10592794
1390 Ga0207674_10004838
1391 Ga0207674_10201622
1392 Ga0207674_10231188
1393 Ga0207674_10404515
1394 Ga0207674_10698860
1395 Ga0207683_10088066
1396 Ga0207683_10321178
1397 Ga0207698_10015331
1398 Ga0207698_10041703
1399 Ga0207698_10072190
1400 Ga0207698_10512156
1401 Ga0209281_1000809
1402 Ga0268266_10000391
1403 Ga0268266_10742379
1404 Ga0265318_10031577
1405 Ga0307515_10026670
1406 Ga0307515_10422696
1407 Ga0265338_10008348
1408 Ga0265330_10033192
1409 Ga0265340_10218257
1410 Ga0265339_10051730
1411 Ga0265331_10012154
1412 Ga0265327_10032300
1413 Ga0265316_10015330
1414 Ga0307513_10006535
1415 Ga0307513_10189961
1416 Ga0307513_10497487
1417 Ga0265313_10000962
1418 Ga0265314_10046761
1419 Ga0265342_10026094
1420 Ga0307516_10093184
1421 Ga0307405_10001510
1422 Ga0307405_11131470
1423 Ga0307410_10264206
1424 Ga0307410_10401307
1425 Ga0307410_12001072
1426 Ga0307406_10002121
1427 Ga0307406_10907914
1428 Ga0307407_10209930
1429 Ga0307412_10000777
1430 Ga0307409_100700544
1431 Ga0307409_100700652
1432 Ga0307416_100281989
1433 Ga0307416_100316647
1434 Ga0373930_0022221
1435 Ga0373949_0019242
1436 Ga0373952_0042611
1437 Ga0373932_0042040
1438 Ga0373941_0165943
1439 Ga0373946_0160169
1440 Ga0373931_0202569
1441 Ga0373927_0612003
1442 Ga0373925_0147774
1443 Ga0373925_0848465
1444 Ga0395899_0071063
1445 Ga0395899_0555648
1446 Ga0395900_0042983
1447 Ga0395900_0073589
1448 Ga0395900_0086703
1449 Ga0395900_0194679
1450 Ga0395898_1162714
1451 Ga0395905_0157381
1452 Ga0395905_0205572
1453 Ga0395905_0817723
1454 Ga0395901_0036925
1455 Ga0395901_0067508
1456 Ga0395901_0443448
1457 Ga0395901_0537010
1458 Ga0395901_1619437
1459 Ga0439436_0007013
1460 Ga0439439_0023748
1461 Ga0439439_0171214
1462 Ga0439465_0004886
1463 Ga0439465_0010793
1464 Ga0451837_0747757
1465 Ga0439432_020030
1466 Ga0439432_057550
1467 Ga0439449_0204367
1468 Ga0439455_0171371
1469 Ga0439434_0048484
1470 Ga0466972_0051082
1471 Ga0466972_0203778
1472 Ga0466965_0275141
1473 Ga0466957_0220052
1474 Ga0466960_0622413
1475 Ga0466967_0672632
1476 Ga0495638_0000418
1477 Ga0495650_0028711
1478 Ga0495583_0033574
1479 Ga0495606_0068359
1480 Ga0495606_0145157
1481 Ga0495606_0354703
1482 Ga0495606_0426763
1483 Ga0495610_0026586
1484 Ga0495618_0182095
1485 Ga0495620_0048549
1486 Ga0495620_0063464
1487 Ga0495632_0015362
1488 Ga0495632_0030319
1489 Ga0495654_0369164
1490 Ga0495587_0336131
1491 Ga0495668_0039174
1492 Ga0495625_0025590
1493 Ga0495625_0148169
1494 Ga0495661_0020237
1495 Ga0495661_0259876
1496 Ga0495673_0061921
1497 Ga0495686_0057666
1498 Ga0495686_0099734
1499 Ga0495686_0234225
1500 Ga0496100_0577560
1501 Ga0496101_0422335
1502 Ga0496101_0517342
1503 Ga0496102_0502503
1504 Ga0496102_0542638
1505 Ga0496102_0558831
1506 Ga0496103_0901182
1507 Ga0496104_0323568
1508 Ga0496105_0327317
1509 Ga0496107_0087497
1510 Ga0496110_0372368
1511 Ga0496111_0835875
1512 Ga0496112_0295832
1513 Ga0496113_1235776
1514 Ga0496114_0234461
1515 Ga0496114_1404330
1516 Ga0496116_0006249
1517 Ga0496116_0022947
1518 Ga0496116_0045989
1519 Ga0496116_0100424
1520 Ga0496116_0181923
1521 Ga0496117_0001790
1522 Ga0496117_0004943
1523 Ga0496117_0052807
1524 Ga0496117_0491919
1525 Ga0496118_0128595
1526 Ga0496118_0198479
1527 Ga0496119_0134812
1528 Ga0496119_0153309
1529 Ga0496119_0194681
1530 Ga0496119_0288868
1531 Ga0496119_0421791
1532 Ga0496120_0008764
1533 Ga0496120_0250315
1534 Ga0496121_0063986
1535 Ga0496121_0123153
1536 Ga0496121_0146228
1537 Ga0496121_0151447
1538 Ga0496121_0174972
1539 Ga0496121_0286228
1540 Ga0496121_0398412
1541 Ga0496121_0466751
1542 Ga0496122_0000321
1543 Ga0496122_0040256
1544 Ga0496122_0084848
1545 Ga0496122_0120196
1546 Ga0496122_0150948
1547 Ga0496122_0205082
1548 Ga0496122_0497265
1549 Ga0496123_0002294
1550 Ga0496123_0002453
1551 Ga0496123_0054291
1552 Ga0496123_0097863
1553 Ga0496124_0000558
1554 Ga0496124_0002598
1555 Ga0496124_0004301
1556 Ga0496124_0088748
1557 Ga0496124_0490525
1558 Ga0496124_0563234
1559 Ga0496124_0789793
1560 Ga0496125_0000628
1561 Ga0496125_0006143
1562 Ga0496125_0090448
1563 Ga0496125_0216091
1564 Ga0496126_0000378
1565 Ga0496126_0030068
1566 Ga0496126_0086643
1567 Ga0496126_0446599
1568 Ga0496126_0625952
1569 Ga0496126_0636267
1570 Ga0501031_0075511
1571 Ga0501031_0715757
1572 Ga0501032_0006049
1573 Ga0501032_0044975
1574 Ga0501032_0090992
1575 Ga0501032_0940381
1576 Ga0501033_0001198
1577 Ga0501033_0002685
1578 Ga0501033_0146538
1579 Ga0501033_1104080
1580 Ga0501034_0000611
1581 Ga0501034_0080065
1582 Ga0501034_1699161
1583 Ga0501037_0000077
1584 Ga0501037_0068581
1585 Ga0501038_0054421
1586 Ga0501038_0146394
1587 Ga0501039_0013172
1588 Ga0501042_0540034
1589 Ga0501043_0000114
1590 Ga0501043_0021577
1591 Ga0501043_0301776
1592 Ga0501043_0301906
1593 Ga0501046_0443277
1594 Ga0501047_0137210
1595 Ga0501048_0403341
1596 Ga0501068_0075333
1597 Ga0501068_0089463
1598 Ga0501068_0126439
1599 Ga0501068_0594196
1600 Ga0501069_0000016
1601 Ga0501070_0000450
1602 Ga0501070_0153410
1603 Ga0501070_1523495
1604 Ga0501071_0002157
1605 Ga0501072_0597904
1606 Ga0501073_0015087
1607 Ga0501074_0000067
1608 Ga0501080_0002371
1609 Ga0501080_0475688
1610 Ga0501080_0680795
1611 Ga0501083_0000111
1612 Ga0501280_015862
1613 Ga0501035_0000048
1614 Ga0501035_0001858
1615 Ga0501035_0094160
1616 Ga0501044_0000003
1617 Ga0501044_0354038
1618 Ga0501044_0610175
1619 nmdc:mga03683_168965_c1
1620 nmdc:mga03n38_173897_c1
1621 nmdc:mga03n38_319631_c1
1622 nmdc:mga03n38_560094_c1
1623 nmdc:mga03n38_564302_c1
1624 nmdc:mga0yw44_13252_c1
1625 nmdc:mga0yw44_492430_c1
1626 nmdc:mga06z11_208041_c1
1627 nmdc:mga06z11_812958_c1
1628 nmdc:mga06z11_896727_c1
1629 nmdc:mga07m45_380889_c1
1630 nmdc:mga07m45_599695_c1
1631 nmdc:mga05p37_1161233_c1
1632 nmdc:mga0n895_1204254_c1
1633 Ga0500647_0403096
1634 Ga0500562_113988
1635 Ga0500592_024372
1636 Ga0500618_008381
1637 Ga0500568_0077674
1638 Ga0500573_0006984
1639 Ga0500573_0298534
1640 Ga0500616_0061423
1641 Ga0500627_0038334
1642 Ga0501084_0392713
1643 Ga0501084_0402871
1644 Ga0500661_030783
1645 Ga0587086_114302
1646 Ga0587088_016135
1647 Ga0587128_139212
1648 Ga0587068_106416
1649 Ga0587075_013271
1650 Ga0587076_045237
1651 Ga0587071_029025
1652 Ga0501082_0006930
1653 2509109045
1654 2509388704
1655 2509444292
1656 2510131145
1657 2510303438
1658 2510839443
1659 2511186902
1660 2513582351
1661 2513597362
1662 2513608194
1663 2513616054
1664 2513869081
1665 2513884744
1666 2513905139
1667 2513911253
1668 2513924549
1669 2515110077
1670 2515607510
1671 2516204544
1672 2516891638
1673 2524450756
1674 2524458180
1675 2530648079
1676 2535514836
1677 2551680036
1678 2551683609
1679 2551690905
1680 2551713684
1681 2551727619
1682 2551737134
1683 2551742365
1684 2558866323
1685 2585205568
1686 2585229582
1687 2585398821
1688 2585541942
1689 2585819059
1690 2585840410
1691 2585843974
1692 2599332805
1693 2599419487
1694 2599939897
1695 2600191173
1696 2616293687
1697 2643806059
1698 2643813883
1699 2644004665
1700 2644066236
1701 2644103522
1702 2644132708
1703 2644144401
1704 2644194537
1705 2644237421
1706 2644297861
1707 2644306452
1708 2644330642
1709 2644377320
1710 2644417567
1711 2644450963
1712 2644542554
1713 2644612063
1714 2644656114
1715 2644671743
1716 2644692614
1717 2657683000
1718 2694632522
1719 2694639747
1720 2719179293
1721 2719383863
1722 2719663653
1723 2719729963
1724 2720490072
1725 2720611452
1726 2720618302
1727 2720629705
1728 2720773401
1729 2721145386
1730 2721156902
1731 2721162281
1732 2721397633
1733 2722838451
1734 2723025075
1735 2723558657
1736 2723565227
1737 2724036443
1738 2724042719
1739 2724088008
1740 2724102492
1741 2724108392
1742 2730106011
1743 2730162530
1744 2730296534
1745 2738804511
1746 2739036833
1747 2739308607
1748 2753462663
1749 2776911795
1750 2792583124
1751 2792621203
1752 2792625418
1753 2792637850
1754 2793283396
1755 2793313935
1756 2793322229
1757 2793329950
1758 2793344853
1759 2793348405
1760 2793365620
1761 2804750717
1762 2805928083
1763 2805935444
1764 2806046759
1765 2806051520
1766 2806059509
1767 2806066526
1768 2806073584
1769 2819245105
1770 2838022536
1771 2838028479
1772 2838039981
1773 2838048798
1774 2838053852
1775 2838065936
1776 2838070808
1777 2838075134
1778 2838666134
1779 2838680319
1780 2838695649
1781 2838709025
1782 2841868816
1783 2842079740
1784 2842120358
1785 2842198085
1786 2842204507
1787 2842211108
1788 2842238436
1789 2842270379
1790 2842284561
1791 2842286567
1792 2842293401
1793 2842299635
1794 2842317201
1795 2842323735
1796 2842344348
1797 2842361064
1798 2842367393
1799 2842370782
1800 2842379798
1801 2842386869
1802 2842401779
1803 2842403880
1804 2842410417
1805 2842417065
1806 2842424423
1807 2842434201
1808 2842440534
1809 2842447186
1810 2842452920
1811 2842468629
1812 2842475139
1813 2842486180
1814 2842495406
1815 2842499990
1816 2842512858
1817 2844170208
1818 2847672032
1819 2847688342
1820 2850079717
1821 2855828005
1822 2855839775
1823 2856318228
1824 2856358857
1825 2856364875
1826 2857354869
1827 2858803650
1828 2869289676
1829 2871431742
1830 2871449466
1831 2871494142
1832 2871499004
1833 2874103966
1834 2874155420
1835 2874162277
1836 2876375286
1837 2876383631
1838 2876398821
1839 2876420765
1840 2878037540
1841 2878748348
1842 2878756717
1843 2878763214
1844 2878770192
1845 2881163034
1846 2881851061
1847 2881862540
1848 2882915407
1849 2885311969
1850 2885325345
1851 2885329516
1852 2885342080
1853 2888350867
1854 2889013214
1855 2889021934
1856 2891374758
1857 2896388543
1858 2899808785
1859 2903502354
1860 2903506025
1861 2903543805
1862 2904665353
1863 2906311965
1864 2906323703
1865 2906331506
1866 2906355129
1867 2906418265
1868 2913298194
1869 2915987790
1870 2915997218
1871 2916000876
1872 2916014112
1873 2916021237
1874 2916021932
1875 2916034159
1876 2916040798
1877 2916042643
1878 2916053606
1879 2916057018
1880 2916072744
1881 2916078433
1882 2919451392
1883 2920763614
1884 2920823093
1885 2921207090
1886 2921213751
1887 2921241468
1888 2921247032
1889 2921262781
1890 2921268764
1891 2921288161
1892 2921293740
1893 2922136673
1894 2922190562
1895 2923556453
1896 2924150712
1897 2924154276
1898 2924164695
1899 2924166478
1900 2924178899
1901 2924184911
1902 2924190386
1903 2924198939
1904 2924200807
1905 2924209312
1906 2924215019
1907 2924228245
1908 2924232699
1909 2924733135
1910 2924788306
1911 2933020263
1912 2933601611
1913 2935896171
1914 2936387157
1915 2936998505
1916 2937007755
1917 2937015004
1918 2937022252
1919 2937023424
1920 2937046267
1921 2937053316
1922 2937057587
1923 2937065390
1924 2937077168
1925 2937098917
1926 2937102750
1927 2937106464
1928 2937119423
1929 2937126238
1930 2937131661
1931 2937818212
1932 2937819584
1933 2937896415
1934 2937997655
1935 2938022371
1936 2939674137
1937 2941500945
1938 2957387102
1939 2957393331
1940 2957397777
1941 2957407249
1942 2957413370
1943 2957417724
1944 2957425290
1945 2957436838
1946 2957447346
1947 2957456631
1948 2957460649
1949 2957469512
1950 2957471711
1951 2957481931
1952 2957490955
1953 2957495731
1954 2957500717
1955 2957508075
1956 2958045475
1957 2958104015
1958 2958116698
1959 2958134049
1960 2958168129
1961 2958179178
1962 2958183695
1963 2960590279
1964 2960603335
1965 2960607858
1966 2960611674
1967 2960620075
1968 2960626721
1969 2960639144
1970 2960648134
1971 2960654427
1972 2960660630
1973 2960672135
1974 2960678670
1975 2960687453
1976 2961081661
1977 2961120353
1978 2961166594
1979 2961173007
1980 2964613464
1981 2964618377
1982 2964625504
1983 2964633736
1984 2964643099
1985 2964649560
1986 2964650114
1987 2964663130
1988 2964668044
1989 2964671341
1990 2964682635
1991 2964687637
1992 2964696618
1993 2964703997
1994 2964710274
1995 2964714318
1996 2964721982
1997 2965021417
1998 2965070151
1999 2965122593
2000 2967671425
2001 2967678474
2002 2967682542
2003 2967694852
2004 2967703586
2005 2967712725
2006 2967714446
2007 2967723770
2008 2967739196
2009 2967746353
2010 2967754717
2011 2967758199
2012 2967766607
2013 2967769888
2014 2967776460
2015 2967998218
2016 2968008870
2017 2968095694
2018 2968099614
2019 2968116820
2020 2968118546
2021 2968131878
2022 2968174999
2023 2970021285
2024 2970034751
2025 2970041063
2026 2970054035
2027 2970056901
2028 2970062215
2029 2970069774
2030 2970080804
2031 2970088136
2032 2970089449
2033 2970098843
2034 2970106036
2035 2970110958
2036 2970118211
2037 2970131350
2038 2970142087
2039 2970154565
2040 2970163740
2041 2970170169
2042 2970177667
2043 2970183606
2044 2970188745
2045 2970197505
2046 2970505601
2047 2970558058
2048 2977521062
2049 2977528493
2050 2977543738
2051 2977554769
2052 2977563778
2053 2977571509
2054 2977574735
2055 2977584387
2056 2977825897
2057 2977851308
2058 2977860283
2059 2977869127
2060 2977946652
2061 2977974629
2062 2979717344
2063 2979744935
2064 2979781245
2065 2979810322
2066 2987643471
2067 2987654952
2068 2987662605
2069 2989351922
2070 2989777192
2071 2996347094
2072 2996888255
2073 2996897864
2074 3003931474
2075 3004191656
2076 3004207016
2077 3005410906
2078 3005445945
2079 3005456622
2080 648736824
2081 8001847917
2082 8002288015
2083 8003992228
2084 8004378305
2085 8004391554
2086 8004449249
2087 8004646143
2088 8004705043
2089 8004716923
2090 8005247660
2091 8005261193
2092 8005263228
2093 8005278569
2094 8005282891
2095 8005291363
2096 8005305736
2097 8005322782
2098 8005385053
2099 8005399870
2100 8005432668
2101 8005460713
2102 8005484760
2103 8005498397
2104 8005543508
2105 8005560321
2106 8005564218
2107 8005573782
2108 8005619588
2109 8005628154
2110 8005669806
2111 8005685304
2112 8005692509
2113 8005699553
2114 8018132830
2115 8018153484
2116 8018167297
2117 8018181782
2118 8024480004
2119 8024502273
2120 8046770890
2121 8049293269
2122 8054562432
2123 8056376213
2124 8057580501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05025

RbsD_FucU

RbsD / FucU transport protein family

30

167

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.8414 1 116
2wcv-assembly1.cif.gz_E-2 crystal structure of bacterial fucu 0.8148 1 116
3mvk-assembly1.cif.gz_G the crystal structure of fucu from bifidobacterium longum to 1.65a 0.8132 4 116
2wcv-assembly1.cif.gz_B crystal structure of bacterial fucu 0.8101 1 116
2wcv-assembly1.cif.gz_A-2 crystal structure of bacterial fucu 0.8093 1 118
ID Description Score Start End Superfamily
af_D4ACG8_1_149_3.40.1650.10 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8338 1 116 3.40.1650.10
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8027 1 116 3.40.1650.10
2wcvA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8001 11 118 3.40.1650.10
af_D4ACG8_1_149_3.40.1650.10 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.7472 1 116 3.40.1650.10
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.7212 1 116 3.40.1650.10
ID Description Score Start End GO Terms
AF-A0A529Q7L9-F1-model_v4 Transporter 0.9562 1 111 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A529Q7L9-F1-model_v4 Transporter 0.948 1 111 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A352JY90-F1-model_v4 Uncharacterized protein 0.9331 1 67 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A529ZEA1-F1-model_v4 Transporter 0.9204 1 57 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A7C5C158-F1-model_v4 Fucose isomerase 0.918 1 68 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193

Map