F489333

General Info

Members Datasets Scaffolds Average Seq Length
1063 834 2124 304

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0015192|Ga0496119_0015192_2901_3857
Length 309
Sequence MMNDTASIKAPVRNNVPKQDRRSFLQRLAHASEPYLYSAPALILIGAVMLVPLILGVSYAFRDIQLLNPFSGGYVGLDHFRELATDQAFYRSLKNTLWWTGCSVLLQFVFGLILALLLDKPFAGRGLAQALIFLPWAVPTFLTGLNFAWLFNPVIGPLPHWLHAIGILSAPDNILSDPNLAMWGIITAGVWWGIPFFAITMLAALQAIPRDLYEAAAIDGAGPFQRFLSITLPYLAPTMAITILLRTVWIANSADLIVVMTGGGPADRTQIVASYIFTQAFKRLDFGYASAIAMVLLIVLLRQTLLNKD

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
66 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
78 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
79 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
80 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
81 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
82 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
83 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
84 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
145 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
152 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
153 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
156 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
159 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
160 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
231 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
232 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
236 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
240 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
241 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 2508501050 Microvirga lupini Lut6 Isolate Nodule
246 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
247 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
248 2509276019 Ensifer aridi TW10 Isolate Nodule
249 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
250 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
251 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
252 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
253 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
254 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
255 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
256 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
257 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
258 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
259 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
260 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
261 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
262 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
263 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
264 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
265 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
266 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
267 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
268 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
269 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
270 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
271 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
272 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
273 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
274 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
275 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
276 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
277 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
278 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
279 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
280 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
281 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
282 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
283 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
284 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
285 2516143018 Ensifer sp. BR816 Isolate Nodule
286 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
287 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
288 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
289 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
290 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
291 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
292 2519899620 Rhizobium sp. Pop5 Isolate Nodule
293 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
294 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
295 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
296 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
297 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
298 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
299 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
300 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
301 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
302 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
303 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
304 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
305 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
306 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
307 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
308 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
309 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
310 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
311 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
312 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
313 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
314 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
315 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
316 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
317 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
318 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
319 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
320 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
321 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
322 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
323 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
324 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
325 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
326 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
327 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
328 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
329 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
330 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
331 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
332 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
333 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
334 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
335 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
336 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
337 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
338 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
339 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
340 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
341 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
342 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
343 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
344 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
345 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
346 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
347 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
348 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
349 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
350 2643221557 Ensifer sp. Root558 Isolate Unclassified
351 2643221568 Rhizobium sp. Root564 Isolate Unclassified
352 2643221582 Rhizobium sp. Root651 Isolate Unclassified
353 2643221599 Rhizobium sp. Root708 Isolate Unclassified
354 2643221607 Rhizobium sp. Root73 Isolate Unclassified
355 2643221610 Ensifer sp. Root74 Isolate Unclassified
356 2643221618 Ensifer sp. Root231 Isolate Unclassified
357 2643221626 Ensifer sp. Root31 Isolate Unclassified
358 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
359 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
360 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
361 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
362 2643221655 Ensifer sp. Root1252 Isolate Unclassified
363 2643221659 Ensifer sp. Root127 Isolate Unclassified
364 2643221668 Ensifer sp. Root423 Isolate Unclassified
365 2643221675 Ensifer sp. Root1298 Isolate Unclassified
366 2643221680 Ensifer sp. Root1312 Isolate Unclassified
367 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
368 2643221688 Rhizobium sp. Root482 Isolate Unclassified
369 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
370 2643221693 Rhizobium sp. Root491 Isolate Unclassified
371 2643221698 Ensifer sp. Root142 Isolate Unclassified
372 2643221712 Ensifer sp. Root258 Isolate Unclassified
373 2643221718 Rhizobium sp. Root268 Isolate Unclassified
374 2643221723 Ensifer sp. Root278 Isolate Unclassified
375 2643221726 Ensifer sp. Root954 Isolate Unclassified
376 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
377 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
378 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
379 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
380 2718217882 Rhizobium sp. N741 Isolate Nodule
381 2718217927 Rhizobium sp. N324 Isolate Nodule
382 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
383 2718218009 Rhizobium sp. N561 Isolate Nodule
384 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
385 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
386 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
387 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
388 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
389 2718218363 Rhizobium sp. N113 Isolate Nodule
390 2718218365 Rhizobium sp. N731 Isolate Nodule
391 2718218366 Rhizobium sp. N621 Isolate Nodule
392 2718218423 Rhizobium sp. N941 Isolate Nodule
393 2721755514 Rhizobium sp. N6212 Isolate Nodule
394 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
395 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
396 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
397 2721755809 Rhizobium sp. N541 Isolate Nodule
398 2721755810 Rhizobium sp. N871 Isolate Nodule
399 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
400 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
401 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
402 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
403 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
404 2728369365 Rhizobium sp. N1341 Isolate Nodule
405 2728369397 Rhizobium sp. N1314 Isolate Nodule
406 2738541293 Rhizobium sp. GV031 Isolate Unclassified
407 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
408 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
409 2751185800 Brucella pituitosa AA2 Isolate Unclassified
410 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
411 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
412 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
413 2773857925 Microvirga vignae BR3299 Isolate Unclassified
414 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
415 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
416 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
417 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
418 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
419 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
420 2791355256 Rhizobium sp. M10 Isolate Nodule
421 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
422 2791355260 Rhizobium sp. L9 Isolate Nodule
423 2791355261 Rhizobium sp. J15 Isolate Nodule
424 2791355262 Rhizobium sp. M1 Isolate Nodule
425 2791355263 Rhizobium chutanense C5 Isolate Nodule
426 2791355264 Rhizobium sp. S9 Isolate Nodule
427 2791355265 Rhizobium sp. H4 Isolate Nodule
428 2791355266 Rhizobium sp. L43 Isolate Nodule
429 2791355267 Rhizobium sp. L18 Isolate Nodule
430 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
431 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
432 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
433 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
434 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
435 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
436 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
437 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
438 2802429633 Rhizobium anhuiense J3 Isolate Nodule
439 2802429634 Rhizobium anhuiense S10 Isolate Nodule
440 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
441 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
442 2802429637 Rhizobium anhuiense C15 Isolate Nodule
443 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
444 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
445 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
446 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
447 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
448 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
449 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
450 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
451 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
452 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
453 2838048938 Rhizobium pisi 27/80 Isolate Nodule
454 2838061910 Rhizobium phaseoli L15 Isolate Nodule
455 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
456 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
457 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
458 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
459 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
460 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
461 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
462 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
463 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
464 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
465 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
466 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
467 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
468 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
469 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
470 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
471 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
472 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
473 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
474 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
475 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
476 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
477 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
478 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
479 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
480 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
481 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
482 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
483 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
484 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
485 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
486 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
487 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
488 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
489 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
490 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
491 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
492 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
493 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
494 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
495 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
496 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
497 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
498 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
499 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
500 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
501 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
502 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
503 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
504 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
505 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
506 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
507 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
508 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
509 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
510 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
511 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
512 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
513 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
514 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
515 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
516 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
517 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
518 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
519 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
520 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
521 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
522 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
523 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
524 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
525 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
526 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
527 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
528 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
529 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
530 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
531 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
532 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
533 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
534 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
535 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
536 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
537 2844163670 Ensifer sp. 1H6 Isolate Unclassified
538 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
539 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
540 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
541 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
542 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
543 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
544 2854911287 Brucella lupini LUP21 Isolate Unclassified
545 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
546 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
547 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
548 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
549 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
550 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
551 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
552 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
553 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
554 2876601092 Pantoea endophytica 596 Isolate Unclassified
555 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
556 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
557 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
558 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
559 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
560 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
561 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
562 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
563 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
564 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
565 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
566 2909042592 Labrys sp. LIt4 Isolate Nodule
567 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
568 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
569 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
570 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
571 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
572 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
573 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
574 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
575 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
576 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
577 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
578 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
579 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
580 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
581 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
582 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
583 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
584 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
585 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
586 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
587 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
588 2919150387 Rahnella aceris 1817 Isolate Unclassified
589 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
590 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
591 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
592 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
593 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
594 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
595 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
596 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
597 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
598 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
599 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
600 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
601 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
602 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
603 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
604 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
605 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
606 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
607 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
608 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
609 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
610 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
611 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
612 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
613 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
614 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
615 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
616 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
617 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
618 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
619 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
620 2927143783 Rahnella sp. 2050 Isolate Unclassified
621 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
622 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
623 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
624 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
625 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
626 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
627 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
628 2933599457 Rhizobium phaseoli M3 Isolate Nodule
629 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
630 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
631 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
632 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
633 2936381700 Rhizobium chutanense C16 Isolate Unclassified
634 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
635 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
636 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
637 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
638 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
639 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
640 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
641 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
642 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
643 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
644 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
645 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
646 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
647 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
648 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
649 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
650 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
651 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
652 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
653 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
654 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
655 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
656 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
657 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
658 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
659 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
660 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
661 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
662 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
663 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
664 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
665 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
666 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
667 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
668 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
669 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
670 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
671 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
672 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
673 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
674 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
675 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
676 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
677 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
678 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
679 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
680 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
681 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
682 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
683 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
684 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
685 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
686 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
687 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
688 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
689 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
690 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
691 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
692 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
693 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
694 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
695 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
696 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
697 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
698 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
699 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
700 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
701 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
702 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
703 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
704 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
705 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
706 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
707 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
708 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
709 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
710 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
711 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
712 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
713 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
714 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
715 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
716 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
717 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
718 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
719 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
720 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
721 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
722 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
723 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
724 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
725 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
726 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
727 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
728 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
729 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
730 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
731 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
732 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
733 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
734 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
735 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
736 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
737 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
738 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
739 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
740 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
741 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
742 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
743 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
744 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
745 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
746 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
747 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
748 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
749 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
750 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
751 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
752 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
753 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
754 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
755 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
756 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
757 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
758 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
759 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
760 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
761 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
762 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
763 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
764 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
765 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
766 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
767 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
768 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
769 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
770 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
771 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
772 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
773 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
774 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
775 2996887358 Rhizobium sp. R711 Isolate Nodule
776 2996893221 Rhizobium sp. R635 Isolate Nodule
777 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
778 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
779 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
780 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
781 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
782 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
783 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
784 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
785 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
786 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
787 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
788 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
789 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
790 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
791 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
792 8005258706 Rhizobium sp. R693 Isolate Nodule
793 8005275841 Rhizobium sp. N4311 Isolate Nodule
794 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
795 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
796 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
797 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
798 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
799 8005321885 Rhizobium sp. R72 Isolate Nodule
800 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
801 8005382845 Rhizobium sp. R634 Isolate Nodule
802 8005395548 Rhizobium sp. R339 Isolate Nodule
803 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
804 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
805 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
806 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
807 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
808 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
809 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
810 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
811 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
812 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
813 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
814 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
815 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
816 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
817 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
818 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
819 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
820 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
821 8018176218 Rhizobium sp. N122 Isolate Nodule
822 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
823 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
824 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
825 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
826 8024501048 Rhizobium sp. H4 Isolate Nodule
827 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
828 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
829 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
830 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
831 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
832 8056382006 Rhizobium croatiense 13T Isolate Nodule
833 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
834 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.31
Metatranscriptomes 0.09
Isolates 55.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 17.5
Nodule 42.24
Rhizoplane 1.03
Rhizosphere 21.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0015192 3300048922 Bacteria 5957
2 SwRhRL2b_contig_999527 2162886007 Bacteria 5204
3 JGI25155J39150_1000015 3300002704 Bacteria 178839
4 JGI25156J39149_1000007 3300002705 Bacteria 252108
5 JGI25162J39368_1000009 3300002737 Bacteria 389795
6 JGI25162J39368_1000119 3300002737 Bacteria 87157
7 JGI25162J39368_1000489 3300002737 Bacteria 30241
8 JGI25154J39366_1000145 3300002738 Bacteria 55861
9 JGI25158J39367_1000094 3300002739 Bacteria 20606
10 JGI25158J39367_1007632 3300002739 Bacteria 1520
11 JGI25157J39369_1000012 3300002741 Bacteria 205167
12 JGI25163J39215_1000765 3300002771 Bacteria 7902
13 JGI25164J39214_1000002 3300002772 Bacteria 406570
14 JGI25152J39213_1001079 3300002773 Bacteria 12856
15 JGI25152J39213_1002953 3300002773 Bacteria 6053
16 JGI25152J39213_1007983 3300002773 Bacteria 2676
17 JGI25150J39212_1000103 3300002774 Bacteria 49029
18 JGI25150J39212_1006873 3300002774 Bacteria 2318
19 JGI25159J45721_1000008 3300002987 Bacteria 172667
20 JGI25159J45721_1000089 3300002987 Bacteria 43695
21 JGI25159J45721_1001078 3300002987 Bacteria 11655
22 JGI25151J46595_10000085 3300003187 Bacteria 127212
23 JGI25151J46595_10000450 3300003187 Bacteria 39793
24 JGI25151J46595_10023743 3300003187 Bacteria 2520
25 JGI25151J46595_10042716 3300003187 Bacteria 1630
26 JGI25165J46597_1000211 3300003214 Bacteria 82463
27 JGI25165J46597_1001070 3300003214 Bacteria 17582
28 JGI25153J46596_10000103 3300003215 Bacteria 96279
29 JGI25153J46596_10001488 3300003215 Bacteria 13974
30 JGI25153J46596_10005550 3300003215 Bacteria 6594
31 JGI25153J46596_10009848 3300003215 Bacteria 4386
32 rootH1_10002325 3300003323 Bacteria 1954
33 rootH1_10114926 3300003323 Bacteria 2568
34 JGI25160J50197_1000023 3300003354 Bacteria 200692
35 JGI25160J50197_1000033 3300003354 Bacteria 172667
36 JGI25160J50197_1001657 3300003354 Bacteria 10887
37 JGI25160J50197_1005696 3300003354 Bacteria 5147
38 JGI25161J50226_1000012 3300003374 Bacteria 200668
39 JGI25161J50226_1000508 3300003374 Bacteria 17047
40 JGI25161J50226_1001989 3300003374 Bacteria 5608
41 Ga0006562J51391_1050521 3300003578 Bacteria 2458
42 Ga0055538_1000015 3300003751 Bacteria 311166
43 Ga0055539_1000009 3300003752 Bacteria 406566
44 Ga0055533_1000012 3300003756 Bacteria 406566
45 Ga0055525_1000014 3300003759 Bacteria 406566
46 Ga0055526_1007886 3300003771 Bacteria 5425
47 Ga0055526_1008170 3300003771 Bacteria 5268
48 Ga0055526_1012891 3300003771 Bacteria 3593
49 Ga0055526_1016912 3300003771 Bacteria 2820
50 Ga0055524_1002358 3300003775 Bacteria 9823
51 Ga0055524_1003993 3300003775 Bacteria 6961
52 Ga0055524_1004703 3300003775 Bacteria 6253
53 Ga0055524_1014578 3300003775 Bacteria 2906
54 Ga0055528_1000519 3300003790 Bacteria 30154
55 Ga0055528_1004148 3300003790 Bacteria 7059
56 Ga0055528_1014232 3300003790 Bacteria 2957
57 Ga0055540_1000050 3300003792 Bacteria 145565
58 Ga0055540_1005332 3300003792 Bacteria 5457
59 Ga0055540_1022935 3300003792 Bacteria 1584
60 Ga0055531_10016516 3300003794 Bacteria 3179
61 Ga0055531_10017593 3300003794 Bacteria 3006
62 Ga0055541_1000006 3300003841 Bacteria 406566
63 Ga0058692_1003232 3300003856 Bacteria 5114
64 Ga0058692_1008266 3300003856 Bacteria 2693
65 Ga0055543_1000009 3300004625 Bacteria 200706
66 Ga0055543_1000021 3300004625 Bacteria 150116
67 Ga0055543_1000315 3300004625 Bacteria 33655
68 Ga0055543_1003043 3300004625 Bacteria 5170
69 Ga0065165_1000064 3300005262 Bacteria 175153
70 Ga0065165_1000513 3300005262 Bacteria 59506
71 Ga0065165_1006135 3300005262 Bacteria 6429
72 Ga0065165_1008941 3300005262 Bacteria 4588
73 Ga0065704_10000959 3300005289 Bacteria 34794
74 Ga0070670_100000287 3300005331 Bacteria 44454
75 Ga0070666_10038630 3300005335 Bacteria 3177
76 Ga0070689_100327329 3300005340 Bacteria 1281
77 Ga0070674_100001722 3300005356 Bacteria 11851
78 Ga0070667_100530015 3300005367 Bacteria 1081
79 Ga0070665_100177473 3300005548 Bacteria 2131
80 Ga0068854_100067701 3300005578 Bacteria 2602
81 Ga0068861_100033057 3300005719 Bacteria 3813
82 Ga0068862_100090252 3300005844 Bacteria 2667
83 Ga0081455_10107643 3300005937 Bacteria 2222
84 Ga0081538_10002181 3300005981 Bacteria 19427
85 Ga0075365_10010840 3300006038 Bacteria 5331
86 Ga0075365_10041025 3300006038 Bacteria 3021
87 Ga0075365_10102459 3300006038 Bacteria 1961
88 Ga0075363_100105762 3300006048 Bacteria 1561
89 Ga0075364_10013563 3300006051 Bacteria 5014
90 Ga0075367_10021014 3300006178 Bacteria 3643
91 Ga0075367_10209952 3300006178 Bacteria 1217
92 Ga0075369_10007134 3300006186 Bacteria 4247
93 Ga0075369_10035944 3300006186 Bacteria 2106
94 Ga0075369_10060762 3300006186 Bacteria 1649
95 Ga0075366_10003448 3300006195 Bacteria 8344
96 Ga0075366_10066583 3300006195 Bacteria 2143
97 Ga0075370_10003108 3300006353 Bacteria 7837
98 Ga0075431_100414289 3300006847 Bacteria 1347
99 Ga0099826_10000181 3300006948 Bacteria 26466
100 Ga0105244_10001340 3300009036 Bacteria 20097
101 Ga0105244_10001791 3300009036 Bacteria 16834
102 Ga0105244_10014154 3300009036 Bacteria 4625
103 Ga0105244_10113787 3300009036 Bacteria 1314
104 Ga0105250_10004385 3300009092 Bacteria 6501
105 Ga0105250_10016611 3300009092 Bacteria 2997
106 Ga0105240_10000217 3300009093 Bacteria 115649
107 Ga0105240_10326015 3300009093 Bacteria 1749
108 Ga0111539_10000123 3300009094 Bacteria 87000
109 Ga0114129_10338648 3300009147 Bacteria 1996
110 Ga0105243_10032808 3300009148 Bacteria 4014
111 Ga0105248_10046083 3300009177 Bacteria 4887
112 Ga0105237_10001458 3300009545 Bacteria 31192
113 Ga0105238_10586861 3300009551 Bacteria 1121
114 Ga0105249_10239161 3300009553 Bacteria 1794
115 Ga0123341_1000109 3300009765 Bacteria 36496
116 Ga0123342_1011498 3300009766 Bacteria 9644
117 Ga0123342_1014735 3300009766 Bacteria 7361
118 Ga0105239_10001164 3300010375 Bacteria 36154
119 Ga0105239_10331429 3300010375 Bacteria 1717
120 Ga0105246_10133406 3300011119 Bacteria 1858
121 Ga0157373_10004331 3300013100 Bacteria 10686
122 Ga0157373_10030840 3300013100 Bacteria 3858
123 Ga0157371_10000002 3300013102 Bacteria 665040
124 Ga0157371_10001454 3300013102 Bacteria 24558
125 Ga0157371_10010601 3300013102 Bacteria 7161
126 Ga0157370_10001923 3300013104 Bacteria 25548
127 Ga0171463_1007 3300013249 Bacteria 301198
128 Ga0163162_10064478 3300013306 Bacteria 3708
129 Ga0182008_10038396 3300014497 Bacteria 2394
130 Ga0182007_10000324 3300015262 Bacteria 30329
131 Ga0182005_1001504 3300015265 Bacteria 9294
132 Ga0182005_1001516 3300015265 Bacteria 9254
133 Ga0183363_1153 3300015690 Bacteria 17205
134 Ga0214544_1000010 3300021320 Bacteria 270164
135 Ga0214542_1000023 3300021321 Bacteria 191557
136 Ga0214543_1000019 3300021327 Bacteria 267908
137 Ga0214543_1001578 3300021327 Bacteria 44277
138 Ga0228711_1000017 3300022739 Bacteria 121084
139 Ga0228710_1000005 3300022740 Bacteria 233531
140 Ga0209435_100006 3300025206 Bacteria 542459
141 Ga0209760_100051 3300025207 Bacteria 105257
142 Ga0209784_100001 3300025224 Bacteria 3600592
143 Ga0209566_100001 3300025225 Bacteria 3600765
144 Ga0209674_100002 3300025226 Bacteria 3600592
145 Ga0209563_100002 3300025230 Bacteria 2045675
146 Ga0207427_100020 3300025231 Bacteria 507515
147 Ga0209437_100001 3300025233 Bacteria 2045675
148 Ga0209437_100042 3300025233 Bacteria 444095
149 Ga0209437_100062 3300025233 Bacteria 336900
150 Ga0207425_1000065 3300025245 Bacteria 127264
151 Ga0207425_1002970 3300025245 Bacteria 5671
152 Ga0207425_1008240 3300025245 Bacteria 2684
153 Ga0207425_1008594 3300025245 Bacteria 2599
154 Ga0207425_1009532 3300025245 Bacteria 2408
155 Ga0209646_1000015 3300025246 Bacteria 542459
156 Ga0209646_1003792 3300025246 Bacteria 2894
157 Ga0209026_1000046 3300025250 Bacteria 262031
158 Ga0209677_100002 3300025253 Bacteria 2045675
159 Ga0209677_100429 3300025253 Bacteria 24814
160 Ga0209759_1000005 3300025256 Bacteria 542459
161 Ga0209129_1000019 3300025258 Bacteria 460802
162 Ga0209129_1000132 3300025258 Bacteria 127262
163 Ga0209129_1001521 3300025258 Bacteria 12809
164 Ga0209129_1002872 3300025258 Bacteria 7945
165 Ga0209129_1004004 3300025258 Bacteria 6048
166 Ga0209129_1006071 3300025258 Bacteria 4038
167 Ga0209129_1008177 3300025258 Bacteria 2959
168 Ga0209233_1000082 3300025261 Bacteria 336320
169 Ga0209233_1000103 3300025261 Bacteria 284123
170 Ga0209233_1000288 3300025261 Bacteria 66882
171 Ga0209565_1009149 3300025263 Bacteria 2542
172 Ga0209673_1000023 3300025273 Bacteria 411385
173 Ga0209673_1000132 3300025273 Bacteria 162349
174 Ga0209673_1001968 3300025273 Bacteria 16055
175 Ga0209673_1002729 3300025273 Bacteria 11649
176 Ga0209673_1002876 3300025273 Bacteria 10948
177 Ga0209673_1013630 3300025273 Bacteria 3196
178 Ga0209130_1000001 3300025284 Bacteria 831557
179 Ga0209130_1000017 3300025284 Bacteria 388431
180 Ga0209130_1000048 3300025284 Bacteria 233357
181 Ga0209130_1010463 3300025284 Bacteria 2552
182 Ga0209676_1016266 3300025292 Bacteria 2695
183 Ga0209676_1019746 3300025292 Bacteria 2309
184 Ga0209676_1051628 3300025292 Bacteria 1077
185 Ga0209025_1000072 3300025294 Bacteria 283452
186 Ga0209025_1000153 3300025294 Bacteria 170548
187 Ga0209025_1000247 3300025294 Bacteria 127264
188 Ga0209025_1000666 3300025294 Bacteria 59408
189 Ga0209025_1002519 3300025294 Bacteria 19180
190 Ga0209025_1005892 3300025294 Bacteria 9796
191 Ga0209025_1019188 3300025294 Bacteria 3817
192 Ga0209025_1041861 3300025294 Bacteria 1955
193 Ga0209564_1000100 3300025295 Bacteria 224016
194 Ga0209564_1000372 3300025295 Bacteria 83053
195 Ga0209564_1001437 3300025295 Bacteria 24420
196 Ga0209564_1002441 3300025295 Bacteria 14707
197 Ga0209564_1011402 3300025295 Bacteria 3987
198 Ga0209758_1000053 3300025297 Bacteria 337751
199 Ga0209758_1000212 3300025297 Bacteria 127597
200 Ga0209758_1000239 3300025297 Bacteria 114761
201 Ga0209758_1000712 3300025297 Bacteria 49095
202 Ga0209758_1002735 3300025297 Bacteria 17345
203 Ga0209758_1004308 3300025297 Bacteria 11994
204 Ga0209758_1014984 3300025297 Bacteria 4056
205 Ga0209758_1030212 3300025297 Bacteria 2249
206 Ga0209050_1003849 3300025298 Bacteria 10688
207 Ga0209050_1009761 3300025298 Bacteria 4848
208 Ga0209256_1000401 3300025299 Bacteria 68618
209 Ga0209256_1000458 3300025299 Bacteria 61611
210 Ga0209256_1000735 3300025299 Bacteria 43205
211 Ga0209256_1002923 3300025299 Bacteria 12843
212 Ga0209256_1003989 3300025299 Bacteria 9683
213 Ga0209256_1034706 3300025299 Bacteria 1339
214 Ga0207426_1000005 3300025302 Bacteria 1037188
215 Ga0207426_1000006 3300025302 Bacteria 1025969
216 Ga0207426_1000035 3300025302 Bacteria 448327
217 Ga0207426_1000136 3300025302 Bacteria 201401
218 Ga0207426_1008593 3300025302 Bacteria 4103
219 Ga0209051_1000062 3300025303 Bacteria 251081
220 Ga0209051_1003152 3300025303 Bacteria 11077
221 Ga0209051_1005006 3300025303 Bacteria 7897
222 Ga0209051_1049963 3300025303 Bacteria 1404
223 Ga0209257_1001119 3300025304 Bacteria 34613
224 Ga0209257_1003325 3300025304 Bacteria 13918
225 Ga0209257_1010746 3300025304 Bacteria 4556
226 Ga0209257_1019784 3300025304 Bacteria 2519
227 Ga0207696_1000076 3300025711 Bacteria 210418
228 Ga0207696_1000396 3300025711 Bacteria 40779
229 Ga0207655_1000413 3300025728 Bacteria 58877
230 Ga0207643_10216081 3300025908 Bacteria 1172
231 Ga0207695_10000613 3300025913 Bacteria 71568
232 Ga0207671_10001160 3300025914 Bacteria 31428
233 Ga0207681_10180050 3300025923 Bacteria 1609
234 Ga0207650_10001289 3300025925 Bacteria 18184
235 Ga0207644_10129395 3300025931 Bacteria 1931
236 Ga0207709_10036345 3300025935 Bacteria 2919
237 Ga0207669_10006701 3300025937 Bacteria 5282
238 Ga0207640_10041416 3300025981 Bacteria 2929
239 Ga0207678_10193672 3300026067 Bacteria 1738
240 Ga0207678_10419430 3300026067 Bacteria 1160
241 Ga0207708_10168432 3300026075 Bacteria 1733
242 Ga0207702_10014348 3300026078 Bacteria 6578
243 Ga0207675_100011538 3300026118 Bacteria 8263
244 Ga0207698_10019310 3300026142 Bacteria 4664
245 Ga0209281_1000082 3300027111 Bacteria 257684
246 Ga0209281_1001229 3300027111 Bacteria 17082
247 Ga0209371_1004328 3300027312 Bacteria 6261
248 Ga0209371_1004561 3300027312 Bacteria 5941
249 Ga0209371_1004841 3300027312 Bacteria 5645
250 Ga0209371_1012154 3300027312 Bacteria 2511
251 Ga0209282_1000006 3300027666 Bacteria 276998
252 Ga0209282_1000176 3300027666 Bacteria 35300
253 Ga0209813_10003863 3300027866 Bacteria 3545
254 Ga0207428_10000133 3300027907 Bacteria 100902
255 Ga0268266_10005342 3300028379 Bacteria 12018
256 Ga0268266_10173894 3300028379 Bacteria 1956
257 Ga0268266_10210065 3300028379 Bacteria 1785
258 Ga0268266_10385997 3300028379 Bacteria 1322
259 Ga0307515_10002150 3300028794 Bacteria 43260
260 Ga0307515_10003918 3300028794 Bacteria 31060
261 Ga0307515_10033865 3300028794 Bacteria 8393
262 Ga0307515_10174626 3300028794 Bacteria 2125
263 Ga0307515_10178036 3300028794 Bacteria 2089
264 Ga0268256_1003641 3300030500 Bacteria 6841
265 Ga0268256_1003966 3300030500 Bacteria 6378
266 Ga0268256_1004619 3300030500 Bacteria 5645
267 Ga0268256_1015885 3300030500 Bacteria 2178
268 Ga0307513_10000463 3300031456 Bacteria 58389
269 Ga0307513_10028096 3300031456 Bacteria 6441
270 Ga0307513_10260744 3300031456 Bacteria 1523
271 Ga0307408_100123412 3300031548 Bacteria 2010
272 Ga0307408_100505965 3300031548 Bacteria 1058
273 Ga0307508_10081823 3300031616 Bacteria 2810
274 Ga0265314_10018857 3300031711 Bacteria 5359
275 Ga0307516_10312986 3300031730 Bacteria 1243
276 Ga0307405_10042032 3300031731 Bacteria 2780
277 Ga0307406_10009475 3300031901 Bacteria 5462
278 Ga0307406_10173760 3300031901 Bacteria 1562
279 Ga0315914_1000003 3300031967 Bacteria 314370
280 Ga0307409_100033770 3300031995 Bacteria 3727
281 Ga0307414_10231532 3300032004 Bacteria 1524
282 Ga0315913_1000001 3300033430 Bacteria 284459
283 Ga0315915_1000008 3300033464 Bacteria 258517
284 Ga0373946_0073534 3300035171 Bacteria 1482
285 Ga0373927_0000266 3300035695 Bacteria 41356
286 Ga0373925_0001672 3300037068 Bacteria 18664
287 Ga0395900_0195811 3300037418 Bacteria 2048
288 Ga0395905_0002837 3300037471 Bacteria 18981
289 Ga0395905_0003927 3300037471 Bacteria 15643
290 Ga0395905_0048313 3300037471 Bacteria 3988
291 Ga0439436_0000195 3300041404 Bacteria 14462
292 Ga0439438_033911 3300041405 Bacteria 1347
293 Ga0439465_0011745 3300041413 Bacteria 2745
294 Ga0439465_0018667 3300041413 Bacteria 2167
295 Ga0451841_0975768 3300041498 Bacteria 1921
296 Ga0451845_0189427 3300041501 Bacteria 2701
297 Ga0451855_0850854 3300041511 Bacteria 2133
298 Ga0439449_0017545 3300042007 Bacteria 2688
299 Ga0450918_013129 3300042531 Bacteria 1441
300 Ga0450893_0010090 3300042532 Bacteria 1548
301 Ga0495591_000803 3300046458 Bacteria 22249
302 Ga0495629_0040880 3300046459 Bacteria 3262
303 Ga0495638_0003868 3300046460 Bacteria 11612
304 Ga0495650_0000043 3300046471 Bacteria 357197
305 Ga0495650_0000113 3300046471 Bacteria 196536
306 Ga0495605_0062038 3300046474 Bacteria 1787
307 Ga0495584_0002744 3300046491 Bacteria 9858
308 Ga0495607_0020421 3300046501 Bacteria 4188
309 Ga0495607_0135549 3300046501 Bacteria 1276
310 Ga0495583_0027699 3300046506 Bacteria 2794
311 Ga0495606_0000374 3300046507 Bacteria 76132
312 Ga0495606_0001618 3300046507 Bacteria 29389
313 Ga0495610_0003039 3300046512 Bacteria 13434
314 Ga0495631_0036456 3300046518 Bacteria 2196
315 Ga0495632_0000181 3300046519 Bacteria 64344
316 Ga0495632_0069804 3300046519 Bacteria 1691
317 Ga0495643_0074995 3300046522 Bacteria 1770
318 Ga0495643_0149540 3300046522 Bacteria 1157
319 Ga0495644_0001112 3300046523 Bacteria 11067
320 Ga0495648_0018790 3300046524 Bacteria 4878
321 Ga0495654_0000124 3300046530 Bacteria 86154
322 Ga0495609_0095443 3300046538 Bacteria 1291
323 Ga0495597_0130276 3300046542 Bacteria 1044
324 Ga0495622_0023211 3300046557 Bacteria 2892
325 Ga0495633_0005760 3300046558 Bacteria 7486
326 Ga0495668_0084825 3300046616 Bacteria 1737
327 Ga0495634_0083991 3300046642 Bacteria 2077
328 Ga0495611_0050843 3300046648 Bacteria 1867
329 Ga0495625_0045083 3300046660 Bacteria 3190
330 Ga0495625_0082577 3300046660 Bacteria 2234
331 Ga0495670_0114601 3300046691 Bacteria 1397
332 Ga0495649_0014383 3300046694 Bacteria 4538
333 Ga0495660_0000012 3300046810 Bacteria 350701
334 Ga0495660_0000034 3300046810 Bacteria 201261
335 Ga0495660_0051547 3300046810 Bacteria 2239
336 Ga0495604_0021553 3300047317 Bacteria 5143
337 Ga0495672_0000029 3300047320 Bacteria 305231
338 Ga0495673_0000092 3300047469 Bacteria 187963
339 Ga0495681_0002695 3300047470 Bacteria 12583
340 Ga0495686_0000795 3300047472 Bacteria 41055
341 Ga0495686_0082322 3300047472 Bacteria 1964
342 Ga0495686_0098028 3300047472 Bacteria 1772
343 Ga0495602_0233377 3300048088 Bacteria 1381
344 Ga0496101_0000023 3300048904 Bacteria 209923
345 Ga0496102_0141483 3300048905 Bacteria 2256
346 Ga0496104_0002678 3300048907 Bacteria 15329
347 Ga0496116_0000042 3300048919 Bacteria 330516
348 Ga0496116_0000066 3300048919 Bacteria 264035
349 Ga0496116_0005820 3300048919 Bacteria 11323
350 Ga0496116_0007217 3300048919 Bacteria 9916
351 Ga0496116_0009455 3300048919 Bacteria 8303
352 Ga0496116_0019687 3300048919 Bacteria 5159
353 Ga0496116_0061839 3300048919 Bacteria 2421
354 Ga0496116_0104620 3300048919 Bacteria 1681
355 Ga0496117_0000036 3300048920 Bacteria 325635
356 Ga0496117_0013982 3300048920 Bacteria 6954
357 Ga0496117_0019866 3300048920 Bacteria 5499
358 Ga0496117_0032851 3300048920 Bacteria 3934
359 Ga0496117_0129192 3300048920 Bacteria 1535
360 Ga0496118_0008573 3300048921 Bacteria 10526
361 Ga0496118_0015347 3300048921 Bacteria 7096
362 Ga0496118_0022829 3300048921 Bacteria 5454
363 Ga0496118_0086250 3300048921 Bacteria 2182
364 Ga0496118_0169496 3300048921 Bacteria 1336
365 Ga0496119_0004655 3300048922 Bacteria 13530
366 Ga0496119_0010451 3300048922 Bacteria 7812
367 Ga0496119_0016484 3300048922 Bacteria 5621
368 Ga0496119_0056647 3300048922 Bacteria 2374
369 Ga0496119_0095065 3300048922 Bacteria 1684
370 Ga0496120_0000032 3300048923 Bacteria 220255
371 Ga0496120_0000777 3300048923 Bacteria 46134
372 Ga0496120_0001086 3300048923 Bacteria 35695
373 Ga0496120_0001949 3300048923 Bacteria 22617
374 Ga0496120_0008032 3300048923 Bacteria 7762
375 Ga0496120_0008096 3300048923 Bacteria 7725
376 Ga0496121_0000001 3300048924 Bacteria 1830318
377 Ga0496121_0000239 3300048924 Bacteria 118051
378 Ga0496121_0002342 3300048924 Bacteria 29248
379 Ga0496121_0018876 3300048924 Bacteria 6922
380 Ga0496121_0089900 3300048924 Bacteria 2402
381 Ga0496121_0114540 3300048924 Bacteria 2049
382 Ga0496121_0149639 3300048924 Bacteria 1720
383 Ga0496122_0000002 3300048925 Bacteria 905834
384 Ga0496122_0000072 3300048925 Bacteria 222436
385 Ga0496122_0000110 3300048925 Bacteria 190142
386 Ga0496122_0006562 3300048925 Bacteria 13298
387 Ga0496122_0024700 3300048925 Bacteria 5250
388 Ga0496122_0038214 3300048925 Bacteria 3850
389 Ga0496122_0048082 3300048925 Bacteria 3285
390 Ga0496122_0055595 3300048925 Bacteria 2959
391 Ga0496122_0089123 3300048925 Bacteria 2111
392 Ga0496122_0102534 3300048925 Bacteria 1907
393 Ga0496122_0171152 3300048925 Bacteria 1309
394 Ga0496123_0000002 3300048926 Bacteria 1811682
395 Ga0496123_0000035 3300048926 Bacteria 267288
396 Ga0496123_0000081 3300048926 Bacteria 190142
397 Ga0496123_0019603 3300048926 Bacteria 5327
398 Ga0496123_0022001 3300048926 Bacteria 4931
399 Ga0496123_0088410 3300048926 Bacteria 1850
400 Ga0496123_0125553 3300048926 Bacteria 1433
401 Ga0496124_0000530 3300048927 Bacteria 65033
402 Ga0496124_0003541 3300048927 Bacteria 18992
403 Ga0496124_0010305 3300048927 Bacteria 9485
404 Ga0496124_0015678 3300048927 Bacteria 7249
405 Ga0496124_0018541 3300048927 Bacteria 6514
406 Ga0496124_0166198 3300048927 Bacteria 1714
407 Ga0496124_0183488 3300048927 Bacteria 1608
408 Ga0496125_0000001 3300048928 Bacteria 1766138
409 Ga0496125_0000033 3300048928 Bacteria 351850
410 Ga0496125_0329482 3300048928 Bacteria 921
411 Ga0496126_0000053 3300048929 Bacteria 311989
412 Ga0496126_0001066 3300048929 Bacteria 46225
413 Ga0496126_0061199 3300048929 Bacteria 3382
414 Ga0496126_0066054 3300048929 Bacteria 3235
415 Ga0496126_0068946 3300048929 Bacteria 3156
416 Ga0496126_0082583 3300048929 Bacteria 2838
417 Ga0495678_001299 3300049459 Bacteria 20174
418 Ga0495682_0000003 3300049460 Bacteria 515787
419 Ga0501032_0189669 3300049569 Bacteria 1344
420 Ga0501033_0175589 3300049570 Bacteria 1537
421 Ga0501034_0001016 3300049571 Bacteria 40222
422 Ga0501034_0127468 3300049571 Bacteria 2530
423 Ga0501034_0156497 3300049571 Bacteria 2252
424 Ga0501034_0170942 3300049571 Bacteria 2140
425 Ga0501037_0050168 3300049573 Bacteria 3055
426 Ga0501067_0060623 3300049583 Bacteria 2094
427 Ga0501067_0081931 3300049583 Bacteria 1789
428 Ga0501070_0240193 3300049586 Bacteria 1483
429 Ga0501073_0001099 3300049589 Bacteria 19587
430 Ga0501073_0129401 3300049589 Bacteria 1750
431 Ga0501073_0254413 3300049589 Bacteria 1212
432 Ga0501238_003722 3300049671 Bacteria 1884
433 Ga0501080_0401518 3300049742 Bacteria 1233
434 Ga0501280_004682 3300049776 Bacteria 1993
435 Ga0501035_0112926 3300049822 Bacteria 2380
436 Ga0501044_0007436 3300049823 Bacteria 12046
437 Ga0501044_0017995 3300049823 Bacteria 7577
438 Ga0501044_0019019 3300049823 Bacteria 7355
439 Ga0501044_0434355 3300049823 Bacteria 1222
440 nmdc:mga03n38_21958_c1 3300050490 Bacteria 2576
441 nmdc:mga00v17_18899_c1 3300050491 Bacteria 3923
442 nmdc:mga00v17_230_c1 3300050491 Bacteria 33351
443 nmdc:mga00v17_24964_c1 3300050491 Bacteria 3469
444 nmdc:mga0yw44_53094_c1 3300050492 Bacteria 2460
445 nmdc:mga0yw44_64092_c1 3300050492 Bacteria 2261
446 nmdc:mga0k408_76185_c1 3300050493 Bacteria 1960
447 nmdc:mga06r32_399024_c1 3300050510 Bacteria 1357
448 nmdc:mga08y16_44_c1 3300050511 Bacteria 121496
449 nmdc:mga0sz30_27459_c1 3300050516 Bacteria 2338
450 Ga0500646_0002763 3300053090 Bacteria 4529
451 Ga0500560_000282 3300053107 Bacteria 6409
452 Ga0500595_006666 3300053119 Bacteria 4871
453 Ga0500618_009881 3300053125 Bacteria 2586
454 Ga0500621_000006 3300053126 Bacteria 245480
455 Ga0500642_0002981 3300053130 Bacteria 5046
456 Ga0500658_0001819 3300053134 Bacteria 8407
457 Ga0500559_0058507 3300053136 Bacteria 1714
458 Ga0500561_0000110 3300053137 Bacteria 15825
459 Ga0500590_000792 3300053148 Bacteria 11720
460 Ga0500616_0001121 3300053153 Bacteria 27611
461 Ga0500616_0002733 3300053153 Bacteria 14294
462 Ga0500622_0002690 3300053156 Bacteria 12594
463 Ga0500624_000296 3300053157 Bacteria 17030
464 Ga0500624_003077 3300053157 Bacteria 2200
465 Ga0500627_0145969 3300053158 Bacteria 1069
466 Ga0500634_0000796 3300053161 Bacteria 11018
467 Ga0500634_0010247 3300053161 Bacteria 4780
468 Ga0500636_0000026 3300053177 Bacteria 84046
469 Ga0500636_0000083 3300053177 Bacteria 47142
470 Ga0500609_000048 3300053731 Bacteria 15782
471 Ga0501084_0206468 3300054114 Bacteria 1658
472 2508733345 2508501050 Bacteria 9633614
473 2509107965 2508501122 Bacteria 6292184
474 2509141455 2508501127 Bacteria 7037543
475 2509376859 2509276019 Bacteria 6802256
476 2509385492 2509276021 Bacteria 7634384
477 2509448467 2509276033 Bacteria 7180565
478 2510136502 2510065019 Bacteria 6903379
479 2510304150 2510065057 Bacteria 6649661
480 2510839080 2510461069 Bacteria 5505000
481 2510900236 2510461076 Bacteria 8618824
482 2511135647 2510917022 Bacteria 6504556
483 2511184342 2510917028 Bacteria 6185411
484 2511197551 2510917030 Bacteria 7460662
485 2511435637 2511231035 Bacteria 5341610
486 2511502587 2511231052 Bacteria 6974333
487 2512533956 2512047086 Bacteria 6850303
488 2512970285 2512875026 Bacteria 6861065
489 2513569647 2513237084 Bacteria 7231967
490 2513576472 2513237085 Bacteria 7695351
491 2513583218 2513237086 Bacteria 7265287
492 2513595061 2513237088 Bacteria 6927906
493 2513601349 2513237089 Bacteria 6553624
494 2513620916 2513237091 Bacteria 6900273
495 2513635125 2513237093 Bacteria 7545552
496 2513709793 2513237103 Bacteria 7647401
497 2513871327 2513237138 Bacteria 7368160
498 2513881730 2513237140 Bacteria 7076289
499 2513904874 2513237143 Bacteria 6664116
500 2513911557 2513237144 Bacteria 7530820
501 2513929074 2513237146 Bacteria 7166346
502 2513986638 2513237156 Bacteria 6402557
503 2513999226 2513237159 Bacteria 6810126
504 2514003204 2513237160 Bacteria 6650282
505 2514018771 2513237162 Bacteria 7468464
506 2515115073 2515075009 Bacteria 7288508
507 2515609370 2515154107 Bacteria 6795637
508 2515633249 2515154113 Bacteria 7807172
509 2515642475 2515154114 Bacteria 7848616
510 2515658451 2515154116 Bacteria 7552979
511 2515741925 2515154134 Bacteria 7220242
512 2516205992 2516143018 Bacteria 6951533
513 2516893963 2516653046 Bacteria 6989037
514 2517041926 2516653077 Bacteria 7555578
515 2517081043 2516653085 Bacteria 7346596
516 2517098617 2517093000 Bacteria 7412387
517 2517410835 2517287029 Bacteria 6905599
518 2517570677 2517487022 Bacteria 7227575
519 2520380738 2519899620 Bacteria 6499161
520 2523468243 2523231067 Bacteria 5230452
521 2524448217 2524023207 Bacteria 6813453
522 2524457343 2524023209 Bacteria 6679728
523 2530644494 2529292951 Bacteria 6916614
524 2535520001 2534681796 Bacteria 7146037
525 2537877751 2537561587 Bacteria 5425293
526 2551675352 2551306084 Bacteria 8942552
527 2551676762 2551306084 Bacteria 8942552
528 2551689364 2551306085 Bacteria 7347181
529 2551695506 2551306086 Bacteria 6843938
530 2551700997 2551306087 Bacteria 7351905
531 2551711111 2551306089 Bacteria 7162724
532 2551722008 2551306090 Bacteria 7953713
533 2551724379 2551306091 Bacteria 7086830
534 2551736475 2551306092 Bacteria 6992595
535 2551739981 2551306093 Bacteria 7064773
536 2554245786 2554235003 Bacteria 5877155
537 2558865783 2558860100 Bacteria 8458965
538 2559296447 2558860242 Bacteria 5568029
539 2585169050 2582581283 Bacteria 6030556
540 2585202768 2582581294 Bacteria 6626667
541 2585221617 2582581298 Bacteria 7315509
542 2585233304 2582581299 Bacteria 6518058
543 2585255304 2582581304 Bacteria 5831370
544 2585270228 2582581306 Bacteria 6450535
545 2585272722 2582581307 Bacteria 6597605
546 2585281238 2582581308 Bacteria 7413247
547 2585327346 2582581315 Bacteria 7318924
548 2585335302 2582581316 Bacteria 7774528
549 2585390450 2582581865 Bacteria 6644329
550 2585395811 2582581866 Bacteria 6859583
551 2585401687 2582581867 Bacteria 7184437
552 2585524175 2585427526 Bacteria 7258840
553 2585536101 2585427527 Bacteria 7273426
554 2585539211 2585427528 Bacteria 6842387
555 2585544213 2585427529 Bacteria 7395659
556 2585557412 2585427530 Bacteria 7383882
557 2585562390 2585427531 Bacteria 6992870
558 2585821382 2585427590 Bacteria 6824633
559 2585829463 2585427591 Bacteria 5482980
560 2585834828 2585427592 Bacteria 5370892
561 2585837164 2585427593 Bacteria 7141551
562 2585842472 2585427594 Bacteria 6180594
563 2585896830 2585427608 Bacteria 6544331
564 2585906443 2585427609 Bacteria 6667127
565 2587981865 2585428125 Bacteria 6662905
566 2597815000 2597489875 Bacteria 7010078
567 2599334021 2599185156 Bacteria 5403036
568 2599414713 2599185170 Bacteria 7295545
569 2599603065 2599185210 Bacteria 5624189
570 2599717817 2599185236 Bacteria 6875203
571 2600196890 2599185352 Bacteria 7228948
572 2601610682 2600255279 Bacteria 5605316
573 2601746988 2600255308 Bacteria 5611129
574 2616295199 2615840624 Bacteria 6557588
575 2616310960 2615840626 Bacteria 7921970
576 2616551886 2615840698 Bacteria 7319877
577 2617382882 2617270742 Bacteria 6808054
578 2643804483 2643221557 Bacteria 7184309
579 2643857038 2643221568 Bacteria 5187270
580 2643922191 2643221582 Bacteria 5804683
581 2644003365 2643221599 Bacteria 6292121
582 2644051209 2643221607 Bacteria 6314006
583 2644065254 2643221610 Bacteria 7480339
584 2644105547 2643221618 Bacteria 7717186
585 2644146550 2643221626 Bacteria 8069654
586 2644194444 2643221634 Bacteria 6705461
587 2644200880 2643221636 Bacteria 6583769
588 2644210825 2643221637 Bacteria 5345260
589 2644240820 2643221643 Bacteria 5749658
590 2644308298 2643221655 Bacteria 7722067
591 2644334125 2643221659 Bacteria 7890716
592 2644377663 2643221668 Bacteria 7306521
593 2644418140 2643221675 Bacteria 7473456
594 2644451396 2643221680 Bacteria 7473610
595 2644484113 2643221686 Bacteria 6310811
596 2644494937 2643221688 Bacteria 5260751
597 2644497934 2643221689 Bacteria 6042950
598 2644520573 2643221693 Bacteria 5513853
599 2644541719 2643221698 Bacteria 7756764
600 2644615580 2643221712 Bacteria 7729434
601 2644654359 2643221718 Bacteria 5345506
602 2644672680 2643221723 Bacteria 7095460
603 2644691624 2643221726 Bacteria 7455827
604 2671109942 2667528173 Bacteria 5375747
605 2671116757 2667528174 Bacteria 6435400
606 2671693576 2671180139 Bacteria 4196045
607 2692315092 2690316117 Bacteria 6800650
608 2719183760 2718217882 Bacteria 6556348
609 2719388439 2718217927 Bacteria 6972593
610 2719668059 2718217997 Bacteria 6740740
611 2719728201 2718218009 Bacteria 6478651
612 2720494822 2718218199 Bacteria 6740745
613 2720611144 2718218232 Bacteria 6720332
614 2720616316 2718218233 Bacteria 6662049
615 2720629391 2718218235 Bacteria 6630699
616 2720771962 2718218269 Bacteria 6906114
617 2721145062 2718218363 Bacteria 6524337
618 2721155799 2718218365 Bacteria 6274507
619 2721167149 2718218366 Bacteria 6425255
620 2721403062 2718218423 Bacteria 6438183
621 2722838127 2721755514 Bacteria 6424414
622 2723029392 2721755556 Bacteria 6745503
623 2723563008 2721755684 Bacteria 6859907
624 2723570989 2721755685 Bacteria 6704835
625 2724035419 2721755809 Bacteria 6438790
626 2724042395 2721755810 Bacteria 6479005
627 2724086782 2721755819 Bacteria 6906405
628 2724106940 2721755822 Bacteria 6726041
629 2724107749 2721755823 Bacteria 6752556
630 2725952225 2724679232 Bacteria 7646494
631 2730105706 2728369352 Bacteria 6745171
632 2730161900 2728369365 Bacteria 6555560
633 2730300906 2728369397 Bacteria 6274511
634 2738802542 2738541293 Bacteria 7065685
635 2738944976 2738541317 Bacteria 5340176
636 2739033658 2738541333 Bacteria 7106503
637 2753358608 2751185800 Bacteria 5467370
638 2753463268 2751185821 Bacteria 6189929
639 2758640844 2758568016 Bacteria 5645291
640 2766068381 2765235942 Bacteria 7445910
641 2774872486 2773857925 Bacteria 6472445
642 2778175157 2775507266 Bacteria 7392367
643 2792581603 2791355082 Bacteria 5973319
644 2792620399 2791355091 Bacteria 6135441
645 2792625757 2791355092 Bacteria 6248105
646 2792641828 2791355094 Bacteria 7011481
647 2793281229 2791355253 Bacteria 5171699
648 2793296423 2791355256 Bacteria 6798008
649 2793317211 2791355259 Bacteria 7254731
650 2793324055 2791355260 Bacteria 6598818
651 2793325641 2791355261 Bacteria 6661293
652 2793333064 2791355262 Bacteria 6774204
653 2793340131 2791355263 Bacteria 6872478
654 2793346236 2791355264 Bacteria 6429314
655 2793355456 2791355265 Bacteria 6539969
656 2793357803 2791355266 Bacteria 7116587
657 2793366541 2791355267 Bacteria 7222458
658 2802716642 2802428858 Bacteria 6636079
659 2802725453 2802428859 Bacteria 6667919
660 2802730455 2802428860 Bacteria 6525526
661 2802737573 2802428861 Bacteria 6534206
662 2802743037 2802428862 Bacteria 6633353
663 2802750461 2802428863 Bacteria 6410669
664 2805929050 2802429605 Bacteria 6875453
665 2805937248 2802429606 Bacteria 6346811
666 2806044843 2802429633 Bacteria 7341974
667 2806053997 2802429634 Bacteria 7083200
668 2806059911 2802429635 Bacteria 7650140
669 2806066036 2802429636 Bacteria 7597525
670 2806073382 2802429637 Bacteria 7067217
671 2808990161 2808606387 Bacteria 5697198
672 2819244925 2818991272 Bacteria 4622173
673 2819607524 2818991448 Bacteria 6772224
674 2819643923 2818991453 Bacteria 7181617
675 2821126608 2821123053 Bacteria 7836056
676 2838019454 2838016132 Bacteria 6577831
677 2838025080 2838022645 Bacteria 6494267
678 2838032023 2838029111 Bacteria 6603031
679 2838039568 2838035591 Bacteria 7166484
680 2838045956 2838042994 Bacteria 6046894
681 2838050560 2838048938 Bacteria 6044578
682 2838062854 2838061910 Bacteria 6794874
683 2838071802 2838068647 Bacteria 6208656
684 2838080551 2838074704 Bacteria 6785777
685 2838667955 2838661181 Bacteria 7385261
686 2838671488 2838668709 Bacteria 6671819
687 2838679984 2838675328 Bacteria 4909118
688 2838684409 2838680041 Bacteria 6545511
689 2838693561 2838686498 Bacteria 7807632
690 2838699900 2838694306 Bacteria 6853137
691 2838704245 2838701080 Bacteria 6669771
692 2838711815 2838707686 Bacteria 6619912
693 2838717397 2838714209 Bacteria 5525906
694 2838721993 2838719591 Bacteria 5523910
695 2838728147 2838724970 Bacteria 4908691
696 2838735454 2838729681 Bacteria 7400765
697 2838739990 2838736955 Bacteria 5760694
698 2838748356 2838742623 Bacteria 7396178
699 2841741109 2841734538 Bacteria 6784580
700 2841843886 2841840854 Bacteria 5761912
701 2841850708 2841846520 Bacteria 5345850
702 2841858420 2841851746 Bacteria 7532261
703 2841864184 2841859092 Bacteria 5436171
704 2841869755 2841864319 Bacteria 6742987
705 2842081876 2842077413 Bacteria 6508645
706 2842117608 2842110456 Bacteria 7656360
707 2842122452 2842118031 Bacteria 7033875
708 2842129513 2842124991 Bacteria 5346824
709 2842134887 2842130223 Bacteria 4909145
710 2842143607 2842140634 Bacteria 5759631
711 2842149137 2842146304 Bacteria 5957337
712 2842156902 2842152218 Bacteria 4908957
713 2842162668 2842156927 Bacteria 6894975
714 2842167039 2842163707 Bacteria 6916235
715 2842173082 2842170452 Bacteria 5525737
716 2842180520 2842175837 Bacteria 4908771
717 2842186172 2842180545 Bacteria 6888678
718 2842190504 2842187318 Bacteria 5524014
719 2842195255 2842192696 Bacteria 6147454
720 2842203280 2842198810 Bacteria 6608673
721 2842210271 2842205361 Bacteria 6340321
722 2842214818 2842211629 Bacteria 5523832
723 2842222261 2842217011 Bacteria 7497767
724 2842227539 2842224351 Bacteria 5524473
725 2842236047 2842229732 Bacteria 7475766
726 2842241227 2842237096 Bacteria 6620661
727 2842249978 2842243621 Bacteria 7421798
728 2842253696 2842250916 Bacteria 6579627
729 2842263274 2842257432 Bacteria 7401195
730 2842268005 2842264693 Bacteria 6472963
731 2842278030 2842271015 Bacteria 7807131
732 2842283725 2842278818 Bacteria 6340002
733 2842289698 2842285085 Bacteria 6011953
734 2842295531 2842291075 Bacteria 7076806
735 2842299101 2842298080 Bacteria 6123127
736 2842310048 2842304105 Bacteria 7023636
737 2842311774 2842311132 Bacteria 6616990
738 2842318997 2842317721 Bacteria 6793725
739 2842343993 2842341865 Bacteria 7003929
740 2842358567 2842357229 Bacteria 6485165
741 2842369695 2842363717 Bacteria 6844742
742 2842376677 2842370503 Bacteria 7038661
743 2842381693 2842377471 Bacteria 7140707
744 2842389000 2842384541 Bacteria 7057858
745 2842396354 2842395702 Bacteria 6780583
746 2842407161 2842402390 Bacteria 6681310
747 2842414053 2842409023 Bacteria 6687331
748 2842420694 2842415677 Bacteria 6596907
749 2842425435 2842422224 Bacteria 6239196
750 2842432168 2842428310 Bacteria 6767288
751 2842438280 2842434925 Bacteria 6502746
752 2842443976 2842441272 Bacteria 6769273
753 2842450152 2842447887 Bacteria 6754142
754 2842466266 2842462802 Bacteria 6588055
755 2842472750 2842469257 Bacteria 6752936
756 2842478755 2842475841 Bacteria 6603183
757 2842487523 2842482326 Bacteria 7212537
758 2842491447 2842489311 Bacteria 6620893
759 2842499515 2842495871 Bacteria 6820686
760 2842505926 2842502639 Bacteria 6604161
761 2842511960 2842509118 Bacteria 6850950
762 2842521069 2842515876 Bacteria 5436280
763 2842524973 2842521101 Bacteria 6569494
764 2842925699 2842922631 Bacteria 5824079
765 2844166463 2844163670 Bacteria 7266046
766 2844461107 2844454524 Bacteria 7952546
767 2847419847 2847417321 Bacteria 6913799
768 2848994864 2848992105 Bacteria 6810864
769 2850081863 2850079185 Bacteria 6848280
770 2852394990 2852387548 Bacteria 8025568
771 2854899984 2854896431 Bacteria 5869725
772 2854914165 2854911287 Bacteria 5582813
773 2854921103 2854916844 Bacteria 5725939
774 2855826684 2855825444 Bacteria 6785811
775 2855842077 2855839649 Bacteria 7135830
776 2855877363 2855872281 Bacteria 6964271
777 2856346835 2856342000 Bacteria 7176905
778 2857519182 2857516855 Bacteria 7787325
779 2857536700 2857531043 Bacteria 6754041
780 2858802752 2858800743 Bacteria 6603254
781 2871478496 2871474448 Bacteria 6806570
782 2876604990 2876601092 Bacteria 5114497
783 2882460009 2882456835 Bacteria 6863978
784 2885316412 2885312484 Bacteria 6415165
785 2888348475 2888343758 Bacteria 6611049
786 2889790743 2889790730 Bacteria 5689708
787 2889915127 2889914905 Bacteria 5702301
788 2894236835 2894232714 Bacteria 8834183
789 2894821316 2894817345 Bacteria 4892941
790 2896391297 2896384573 Bacteria 7700774
791 2899793444 2899792073 Bacteria 4926588
792 2899847645 2899845264 Bacteria 5672268
793 2904477226 2904474040 Bacteria 5504324
794 2909043880 2909042592 Bacteria 6499737
795 2913301711 2913295892 Bacteria 6333755
796 2913309601 2913308742 Bacteria 5350706
797 2915651049 2915650412 Bacteria 4288180
798 2915981221 2915980308 Bacteria 6624279
799 2915992232 2915986958 Bacteria 6739310
800 2915998592 2915993759 Bacteria 7016183
801 2916005668 2916000859 Bacteria 6865702
802 2916013522 2916007675 Bacteria 6898660
803 2916021439 2916014648 Bacteria 6946486
804 2916026841 2916021584 Bacteria 6854472
805 2916033035 2916028427 Bacteria 6748433
806 2916039280 2916035215 Bacteria 6755766
807 2916046501 2916041962 Bacteria 6820487
808 2916050503 2916048683 Bacteria 6543552
809 2916055952 2916055098 Bacteria 6758838
810 2916062082 2916061851 Bacteria 6737736
811 2916070756 2916068649 Bacteria 6943657
812 2916082654 2916076590 Bacteria 6596108
813 2917556393 2917554339 Bacteria 4987857
814 2919103462 2919100787 Bacteria 7710546
815 2919119150 2919114240 Bacteria 5700270
816 2919153393 2919150387 Bacteria 5500879
817 2919170184 2919166419 Bacteria 4952238
818 2919413119 2919408235 Bacteria 6149349
819 2920761100 2920760137 Bacteria 7427611
820 2920825721 2920822456 Bacteria 6897201
821 2921204233 2921201388 Bacteria 6926299
822 2921210304 2921208531 Bacteria 6745326
823 2921239340 2921237296 Bacteria 6876710
824 2921249950 2921244191 Bacteria 6568419
825 2921251727 2921250672 Bacteria 6677771
826 2921258883 2921257292 Bacteria 6808382
827 2921270255 2921263974 Bacteria 6864552
828 2921287216 2921282425 Bacteria 6826397
829 2921292026 2921289301 Bacteria 7316391
830 2921302384 2921296804 Bacteria 7176999
831 2923556727 2923556063 Bacteria 6793593
832 2924144923 2924144063 Bacteria 6883928
833 2924156116 2924150972 Bacteria 7169444
834 2924159967 2924158325 Bacteria 7188855
835 2924169481 2924165586 Bacteria 7260590
836 2924173546 2924172951 Bacteria 6749356
837 2924183368 2924179722 Bacteria 6843264
838 2924193171 2924186466 Bacteria 6876637
839 2924195094 2924193448 Bacteria 6955718
840 2924201594 2924200457 Bacteria 6757188
841 2924208207 2924207177 Bacteria 6917007
842 2924216931 2924214083 Bacteria 7080103
843 2924227451 2924221636 Bacteria 7113495
844 2924235220 2924228884 Bacteria 6633132
845 2924756722 2924754689 Bacteria 6774424
846 2926759179 2926754445 Bacteria 5964435
847 2926763395 2926760298 Bacteria 5505990
848 2927144019 2927143783 Bacteria 5504251
849 2929138669 2929138655 Bacteria 5810547
850 2933010032 2933006813 Bacteria 4912075
851 2933011519 2933011516 Bacteria 5439334
852 2933017613 2933016740 Bacteria 6355406
853 2933576489 2933570622 Bacteria 7023390
854 2933591784 2933586486 Bacteria 7667493
855 2933595993 2933594066 Bacteria 5594265
856 2933602597 2933599457 Bacteria 5858799
857 2935898251 2935894831 Bacteria 6620579
858 2935905751 2935901341 Bacteria 7341747
859 2936370189 2936367885 Bacteria 7324495
860 2936377861 2936375103 Bacteria 6652732
861 2936384151 2936381700 Bacteria 7006523
862 2937001223 2936996657 Bacteria 6298727
863 2937003933 2937002841 Bacteria 6934057
864 2937010757 2937009748 Bacteria 6746052
865 2937021796 2937016420 Bacteria 6782579
866 2937027410 2937023124 Bacteria 6815156
867 2937035709 2937029754 Bacteria 6424026
868 2937039372 2937036028 Bacteria 6846469
869 2937042929 2937042894 Bacteria 6741576
870 2937050360 2937049772 Bacteria 6757901
871 2937062851 2937056579 Bacteria 7107896
872 2937064568 2937063883 Bacteria 7199456
873 2937073261 2937071275 Bacteria 6984483
874 2937080771 2937078374 Bacteria 6610289
875 2937085375 2937084907 Bacteria 6618516
876 2937098125 2937091812 Bacteria 6979387
877 2937105569 2937098957 Bacteria 7249374
878 2937110905 2937106411 Bacteria 6947143
879 2937117605 2937113482 Bacteria 6505872
880 2937124436 2937119839 Bacteria 6597547
881 2937131494 2937126314 Bacteria 6771275
882 2937840484 2937836603 Bacteria 6811263
883 2939605382 2939602548 Bacteria 4950493
884 2939673711 2939669807 Bacteria 5028511
885 2941504508 2941499720 Bacteria 7599444
886 2957380616 2957375807 Bacteria 6425588
887 2957382592 2957382221 Bacteria 6737050
888 2957389430 2957388812 Bacteria 6778072
889 2957401972 2957395598 Bacteria 6822399
890 2957408394 2957402308 Bacteria 6741770
891 2957410151 2957408893 Bacteria 6558585
892 2957420040 2957415311 Bacteria 6991633
893 2957424792 2957422303 Bacteria 7172205
894 2957433655 2957430029 Bacteria 7022557
895 2957437526 2957437181 Bacteria 6568994
896 2957450646 2957443900 Bacteria 6869977
897 2957452241 2957450854 Bacteria 6765715
898 2957462657 2957457609 Bacteria 6967680
899 2957465612 2957464669 Bacteria 6568877
900 2957475714 2957471148 Bacteria 6797643
901 2957478982 2957478035 Bacteria 6756658
902 2957488883 2957484790 Bacteria 6703082
903 2957497916 2957491536 Bacteria 6695180
904 2957501766 2957498199 Bacteria 7126688
905 2957509919 2957505466 Bacteria 7253085
906 2958071391 2958071322 Bacteria 6815895
907 2960590584 2960584000 Bacteria 6864594
908 2960591884 2960591022 Bacteria 6622873
909 2960602032 2960597568 Bacteria 6550735
910 2960607909 2960603979 Bacteria 6898737
911 2960614791 2960610863 Bacteria 6691244
912 2960618072 2960617483 Bacteria 6727748
913 2960630025 2960624210 Bacteria 6875384
914 2960633905 2960631154 Bacteria 6732508
915 2960642602 2960637947 Bacteria 7296468
916 2960651187 2960645483 Bacteria 7211087
917 2960659470 2960652885 Bacteria 7083688
918 2960667201 2960660292 Bacteria 7041660
919 2960669931 2960667422 Bacteria 6763020
920 2960675288 2960674078 Bacteria 6609048
921 2960680730 2960680706 Bacteria 6624464
922 2960688670 2960687367 Bacteria 6535474
923 2960696513 2960693952 Bacteria 6749742
924 2964614880 2964607997 Bacteria 7101408
925 2964617100 2964615318 Bacteria 6809089
926 2964627195 2964621998 Bacteria 6834995
927 2964630390 2964628898 Bacteria 7083044
928 2964637709 2964636051 Bacteria 7091832
929 2964646324 2964643177 Bacteria 6820887
930 2964651174 2964649959 Bacteria 6675118
931 2964663288 2964656573 Bacteria 7100150
932 2964666284 2964663802 Bacteria 7019362
933 2964672665 2964670856 Bacteria 6851364
934 2964682452 2964678106 Bacteria 6792020
935 2964689376 2964685014 Bacteria 6839111
936 2964693916 2964691889 Bacteria 6802758
937 2964704778 2964698721 Bacteria 6765331
938 2964706425 2964705432 Bacteria 7114648
939 2964716460 2964712639 Bacteria 6695970
940 2964725739 2964719344 Bacteria 7286602
941 2967668424 2967664464 Bacteria 6948836
942 2967676208 2967671571 Bacteria 7021409
943 2967685897 2967678726 Bacteria 7264382
944 2967691002 2967686174 Bacteria 6678622
945 2967698985 2967693043 Bacteria 6804451
946 2967704341 2967699805 Bacteria 6854538
947 2967711602 2967706974 Bacteria 7186053
948 2967720460 2967714385 Bacteria 7000047
949 2967724395 2967721400 Bacteria 7073753
950 2967730998 2967728569 Bacteria 6641507
951 2967739937 2967735183 Bacteria 6827012
952 2967744522 2967742019 Bacteria 6794534
953 2967749381 2967748971 Bacteria 6733771
954 2967759581 2967755722 Bacteria 6814706
955 2967767207 2967762386 Bacteria 6923502
956 2967770501 2967769361 Bacteria 6587838
957 2967782432 2967775926 Bacteria 6738189
958 2970025758 2970019648 Bacteria 7072033
959 2970027510 2970026789 Bacteria 6785236
960 2970036057 2970033650 Bacteria 7118744
961 2970046116 2970040964 Bacteria 6731123
962 2970048397 2970047711 Bacteria 7088379
963 2970057259 2970054988 Bacteria 6611507
964 2970064735 2970061556 Bacteria 7099761
965 2970071066 2970068827 Bacteria 7123112
966 2970082492 2970076120 Bacteria 6697332
967 2970083633 2970082768 Bacteria 6183754
968 2970094198 2970088815 Bacteria 6933825
969 2970102145 2970095765 Bacteria 6936963
970 2970104444 2970102677 Bacteria 6812532
971 2970115034 2970109326 Bacteria 6863976
972 2970120632 2970116247 Bacteria 6501857
973 2970123418 2970122695 Bacteria 6625855
974 2970135924 2970129317 Bacteria 6806560
975 2970140851 2970136068 Bacteria 7207982
976 2970144805 2970143518 Bacteria 6446480
977 2970154925 2970149975 Bacteria 6779706
978 2970161341 2970156795 Bacteria 7168044
979 2970168348 2970164137 Bacteria 6861252
980 2970173879 2970170962 Bacteria 6876229
981 2970181034 2970177841 Bacteria 6768001
982 2970184971 2970184632 Bacteria 7054431
983 2970196076 2970191845 Bacteria 7032787
984 2970529722 2970524798 Bacteria 6840927
985 2970545326 2970540015 Bacteria 6977556
986 2977519384 2977516862 Bacteria 6940108
987 2977530475 2977523885 Bacteria 6960446
988 2977536320 2977530762 Bacteria 6951399
989 2977543264 2977537788 Bacteria 6929320
990 2977546457 2977544691 Bacteria 6875412
991 2977553098 2977551784 Bacteria 7125765
992 2977565218 2977558990 Bacteria 6863948
993 2977567021 2977565890 Bacteria 6901543
994 2977574371 2977572785 Bacteria 6763888
995 2977585873 2977579622 Bacteria 6772100
996 2978970188 2978969890 Bacteria 5400756
997 2979091572 2979089926 Bacteria 5670289
998 2979097093 2979095461 Bacteria 5669583
999 2984587215 2984587000 Bacteria 5263363
1000 2989352530 2989349275 Bacteria 6349068
1001 2989773982 2989771324 Bacteria 5605128
1002 2989780770 2989776772 Bacteria 4843317
1003 2996888651 2996887358 Bacteria 5795980
1004 2996896962 2996893221 Bacteria 5823108
1005 3003935538 3003930520 Bacteria 5667563
1006 3005416288 3005409236 Bacteria 7188837
1007 3005421942 3005416602 Bacteria 7064308
1008 3005451459 3005445848 Bacteria 6906074
1009 3005456760 3005452660 Bacteria 5889319
1010 639651714 639633055 Bacteria 7751309
1011 643826743 643692032 Bacteria 6891900
1012 648738781 648276728 Bacteria 6968865
1013 650842844 650716007 Bacteria 5573770
1014 8003574442 8003570095 Bacteria 5747666
1015 8003994520 8003992118 Bacteria 7266902
1016 8004002215 8003999396 Bacteria 7063185
1017 8004395864 8004395343 Bacteria 6620908
1018 8004633319 8004633249 Bacteria 6723080
1019 8005250598 8005246636 Bacteria 4933972
1020 8005264417 8005258706 Bacteria 6184835
1021 8005277154 8005275841 Bacteria 6929066
1022 8005287842 8005282627 Bacteria 6675747
1023 8005290652 8005289223 Bacteria 6634003
1024 8005305026 8005301065 Bacteria 6614431
1025 8005313121 8005307578 Bacteria 7395396
1026 8005321224 8005314921 Bacteria 7072929
1027 8005323178 8005321885 Bacteria 5795980
1028 8005381870 8005376324 Bacteria 6590079
1029 8005388480 8005382845 Bacteria 6732062
1030 8005397646 8005395548 Bacteria 6806915
1031 8005436997 8005430974 Bacteria 6689030
1032 8005466800 8005460587 Bacteria 7157962
1033 8005490035 8005484373 Bacteria 6297373
1034 8005503071 8005497431 Bacteria 6477605
1035 8005547731 8005542996 Bacteria 7077758
1036 8005562112 8005556819 Bacteria 6908598
1037 8005567132 8005563573 Bacteria 7153261
1038 8005576297 8005570704 Bacteria 6957481
1039 8005625590 8005619151 Bacteria 7030230
1040 8005630613 8005626139 Bacteria 6534237
1041 8005650911 8005645114 Bacteria 6950293
1042 8005674989 8005668836 Bacteria 6953162
1043 8005688171 8005682033 Bacteria 6726518
1044 8005689430 8005688590 Bacteria 6610080
1045 8005701934 8005695170 Bacteria 6912330
1046 8016738590 8016733728 Bacteria 5274317
1047 8018130456 8018127388 Bacteria 7351159
1048 8018165903 8018163183 Bacteria 7277977
1049 8018182229 8018176218 Bacteria 6896178
1050 8019500237 8019499862 Bacteria 5169538
1051 8023682366 8023680758 Bacteria 7729763
1052 8024484154 8024479707 Bacteria 6954785
1053 8024492854 8024486573 Bacteria 6540512
1054 8024505580 8024501048 Bacteria 6427847
1055 8046773916 8046767195 Bacteria 7547379
1056 8049295687 8049293176 Bacteria 6128433
1057 8054560446 8054558443 Bacteria 5204801
1058 8055622684 8055617313 Bacteria 7548464
1059 8056375188 8056375014 Bacteria 7006639
1060 8056383515 8056382006 Bacteria 6408074
1061 8057576257 8057575449 Bacteria 7367519
1062 8057878336 8057874678 Bacteria 7494653
1063 Ga0496119_0015192
1064 SwRhRL2b_contig_999527
1065 JGI25155J39150_1000015
1066 JGI25156J39149_1000007
1067 JGI25162J39368_1000009
1068 JGI25162J39368_1000119
1069 JGI25162J39368_1000489
1070 JGI25154J39366_1000145
1071 JGI25158J39367_1000094
1072 JGI25158J39367_1007632
1073 JGI25157J39369_1000012
1074 JGI25163J39215_1000765
1075 JGI25164J39214_1000002
1076 JGI25152J39213_1001079
1077 JGI25152J39213_1002953
1078 JGI25152J39213_1007983
1079 JGI25150J39212_1000103
1080 JGI25150J39212_1006873
1081 JGI25159J45721_1000008
1082 JGI25159J45721_1000089
1083 JGI25159J45721_1001078
1084 JGI25151J46595_10000085
1085 JGI25151J46595_10000450
1086 JGI25151J46595_10023743
1087 JGI25151J46595_10042716
1088 JGI25165J46597_1000211
1089 JGI25165J46597_1001070
1090 JGI25153J46596_10000103
1091 JGI25153J46596_10001488
1092 JGI25153J46596_10005550
1093 JGI25153J46596_10009848
1094 rootH1_10002325
1095 rootH1_10114926
1096 JGI25160J50197_1000023
1097 JGI25160J50197_1000033
1098 JGI25160J50197_1001657
1099 JGI25160J50197_1005696
1100 JGI25161J50226_1000012
1101 JGI25161J50226_1000508
1102 JGI25161J50226_1001989
1103 Ga0006562J51391_1050521
1104 Ga0055538_1000015
1105 Ga0055539_1000009
1106 Ga0055533_1000012
1107 Ga0055525_1000014
1108 Ga0055526_1007886
1109 Ga0055526_1008170
1110 Ga0055526_1012891
1111 Ga0055526_1016912
1112 Ga0055524_1002358
1113 Ga0055524_1003993
1114 Ga0055524_1004703
1115 Ga0055524_1014578
1116 Ga0055528_1000519
1117 Ga0055528_1004148
1118 Ga0055528_1014232
1119 Ga0055540_1000050
1120 Ga0055540_1005332
1121 Ga0055540_1022935
1122 Ga0055531_10016516
1123 Ga0055531_10017593
1124 Ga0055541_1000006
1125 Ga0058692_1003232
1126 Ga0058692_1008266
1127 Ga0055543_1000009
1128 Ga0055543_1000021
1129 Ga0055543_1000315
1130 Ga0055543_1003043
1131 Ga0065165_1000064
1132 Ga0065165_1000513
1133 Ga0065165_1006135
1134 Ga0065165_1008941
1135 Ga0065704_10000959
1136 Ga0070670_100000287
1137 Ga0070666_10038630
1138 Ga0070689_100327329
1139 Ga0070674_100001722
1140 Ga0070667_100530015
1141 Ga0070665_100177473
1142 Ga0068854_100067701
1143 Ga0068861_100033057
1144 Ga0068862_100090252
1145 Ga0081455_10107643
1146 Ga0081538_10002181
1147 Ga0075365_10010840
1148 Ga0075365_10041025
1149 Ga0075365_10102459
1150 Ga0075363_100105762
1151 Ga0075364_10013563
1152 Ga0075367_10021014
1153 Ga0075367_10209952
1154 Ga0075369_10007134
1155 Ga0075369_10035944
1156 Ga0075369_10060762
1157 Ga0075366_10003448
1158 Ga0075366_10066583
1159 Ga0075370_10003108
1160 Ga0075431_100414289
1161 Ga0099826_10000181
1162 Ga0105244_10001340
1163 Ga0105244_10001791
1164 Ga0105244_10014154
1165 Ga0105244_10113787
1166 Ga0105250_10004385
1167 Ga0105250_10016611
1168 Ga0105240_10000217
1169 Ga0105240_10326015
1170 Ga0111539_10000123
1171 Ga0114129_10338648
1172 Ga0105243_10032808
1173 Ga0105248_10046083
1174 Ga0105237_10001458
1175 Ga0105238_10586861
1176 Ga0105249_10239161
1177 Ga0123341_1000109
1178 Ga0123342_1011498
1179 Ga0123342_1014735
1180 Ga0105239_10001164
1181 Ga0105239_10331429
1182 Ga0105246_10133406
1183 Ga0157373_10004331
1184 Ga0157373_10030840
1185 Ga0157371_10000002
1186 Ga0157371_10001454
1187 Ga0157371_10010601
1188 Ga0157370_10001923
1189 Ga0171463_1007
1190 Ga0163162_10064478
1191 Ga0182008_10038396
1192 Ga0182007_10000324
1193 Ga0182005_1001504
1194 Ga0182005_1001516
1195 Ga0183363_1153
1196 Ga0214544_1000010
1197 Ga0214542_1000023
1198 Ga0214543_1000019
1199 Ga0214543_1001578
1200 Ga0228711_1000017
1201 Ga0228710_1000005
1202 Ga0209435_100006
1203 Ga0209760_100051
1204 Ga0209784_100001
1205 Ga0209566_100001
1206 Ga0209674_100002
1207 Ga0209563_100002
1208 Ga0207427_100020
1209 Ga0209437_100001
1210 Ga0209437_100042
1211 Ga0209437_100062
1212 Ga0207425_1000065
1213 Ga0207425_1002970
1214 Ga0207425_1008240
1215 Ga0207425_1008594
1216 Ga0207425_1009532
1217 Ga0209646_1000015
1218 Ga0209646_1003792
1219 Ga0209026_1000046
1220 Ga0209677_100002
1221 Ga0209677_100429
1222 Ga0209759_1000005
1223 Ga0209129_1000019
1224 Ga0209129_1000132
1225 Ga0209129_1001521
1226 Ga0209129_1002872
1227 Ga0209129_1004004
1228 Ga0209129_1006071
1229 Ga0209129_1008177
1230 Ga0209233_1000082
1231 Ga0209233_1000103
1232 Ga0209233_1000288
1233 Ga0209565_1009149
1234 Ga0209673_1000023
1235 Ga0209673_1000132
1236 Ga0209673_1001968
1237 Ga0209673_1002729
1238 Ga0209673_1002876
1239 Ga0209673_1013630
1240 Ga0209130_1000001
1241 Ga0209130_1000017
1242 Ga0209130_1000048
1243 Ga0209130_1010463
1244 Ga0209676_1016266
1245 Ga0209676_1019746
1246 Ga0209676_1051628
1247 Ga0209025_1000072
1248 Ga0209025_1000153
1249 Ga0209025_1000247
1250 Ga0209025_1000666
1251 Ga0209025_1002519
1252 Ga0209025_1005892
1253 Ga0209025_1019188
1254 Ga0209025_1041861
1255 Ga0209564_1000100
1256 Ga0209564_1000372
1257 Ga0209564_1001437
1258 Ga0209564_1002441
1259 Ga0209564_1011402
1260 Ga0209758_1000053
1261 Ga0209758_1000212
1262 Ga0209758_1000239
1263 Ga0209758_1000712
1264 Ga0209758_1002735
1265 Ga0209758_1004308
1266 Ga0209758_1014984
1267 Ga0209758_1030212
1268 Ga0209050_1003849
1269 Ga0209050_1009761
1270 Ga0209256_1000401
1271 Ga0209256_1000458
1272 Ga0209256_1000735
1273 Ga0209256_1002923
1274 Ga0209256_1003989
1275 Ga0209256_1034706
1276 Ga0207426_1000005
1277 Ga0207426_1000006
1278 Ga0207426_1000035
1279 Ga0207426_1000136
1280 Ga0207426_1008593
1281 Ga0209051_1000062
1282 Ga0209051_1003152
1283 Ga0209051_1005006
1284 Ga0209051_1049963
1285 Ga0209257_1001119
1286 Ga0209257_1003325
1287 Ga0209257_1010746
1288 Ga0209257_1019784
1289 Ga0207696_1000076
1290 Ga0207696_1000396
1291 Ga0207655_1000413
1292 Ga0207643_10216081
1293 Ga0207695_10000613
1294 Ga0207671_10001160
1295 Ga0207681_10180050
1296 Ga0207650_10001289
1297 Ga0207644_10129395
1298 Ga0207709_10036345
1299 Ga0207669_10006701
1300 Ga0207640_10041416
1301 Ga0207678_10193672
1302 Ga0207678_10419430
1303 Ga0207708_10168432
1304 Ga0207702_10014348
1305 Ga0207675_100011538
1306 Ga0207698_10019310
1307 Ga0209281_1000082
1308 Ga0209281_1001229
1309 Ga0209371_1004328
1310 Ga0209371_1004561
1311 Ga0209371_1004841
1312 Ga0209371_1012154
1313 Ga0209282_1000006
1314 Ga0209282_1000176
1315 Ga0209813_10003863
1316 Ga0207428_10000133
1317 Ga0268266_10005342
1318 Ga0268266_10173894
1319 Ga0268266_10210065
1320 Ga0268266_10385997
1321 Ga0307515_10002150
1322 Ga0307515_10003918
1323 Ga0307515_10033865
1324 Ga0307515_10174626
1325 Ga0307515_10178036
1326 Ga0268256_1003641
1327 Ga0268256_1003966
1328 Ga0268256_1004619
1329 Ga0268256_1015885
1330 Ga0307513_10000463
1331 Ga0307513_10028096
1332 Ga0307513_10260744
1333 Ga0307408_100123412
1334 Ga0307408_100505965
1335 Ga0307508_10081823
1336 Ga0265314_10018857
1337 Ga0307516_10312986
1338 Ga0307405_10042032
1339 Ga0307406_10009475
1340 Ga0307406_10173760
1341 Ga0315914_1000003
1342 Ga0307409_100033770
1343 Ga0307414_10231532
1344 Ga0315913_1000001
1345 Ga0315915_1000008
1346 Ga0373946_0073534
1347 Ga0373927_0000266
1348 Ga0373925_0001672
1349 Ga0395900_0195811
1350 Ga0395905_0002837
1351 Ga0395905_0003927
1352 Ga0395905_0048313
1353 Ga0439436_0000195
1354 Ga0439438_033911
1355 Ga0439465_0011745
1356 Ga0439465_0018667
1357 Ga0451841_0975768
1358 Ga0451845_0189427
1359 Ga0451855_0850854
1360 Ga0439449_0017545
1361 Ga0450918_013129
1362 Ga0450893_0010090
1363 Ga0495591_000803
1364 Ga0495629_0040880
1365 Ga0495638_0003868
1366 Ga0495650_0000043
1367 Ga0495650_0000113
1368 Ga0495605_0062038
1369 Ga0495584_0002744
1370 Ga0495607_0020421
1371 Ga0495607_0135549
1372 Ga0495583_0027699
1373 Ga0495606_0000374
1374 Ga0495606_0001618
1375 Ga0495610_0003039
1376 Ga0495631_0036456
1377 Ga0495632_0000181
1378 Ga0495632_0069804
1379 Ga0495643_0074995
1380 Ga0495643_0149540
1381 Ga0495644_0001112
1382 Ga0495648_0018790
1383 Ga0495654_0000124
1384 Ga0495609_0095443
1385 Ga0495597_0130276
1386 Ga0495622_0023211
1387 Ga0495633_0005760
1388 Ga0495668_0084825
1389 Ga0495634_0083991
1390 Ga0495611_0050843
1391 Ga0495625_0045083
1392 Ga0495625_0082577
1393 Ga0495670_0114601
1394 Ga0495649_0014383
1395 Ga0495660_0000012
1396 Ga0495660_0000034
1397 Ga0495660_0051547
1398 Ga0495604_0021553
1399 Ga0495672_0000029
1400 Ga0495673_0000092
1401 Ga0495681_0002695
1402 Ga0495686_0000795
1403 Ga0495686_0082322
1404 Ga0495686_0098028
1405 Ga0495602_0233377
1406 Ga0496101_0000023
1407 Ga0496102_0141483
1408 Ga0496104_0002678
1409 Ga0496116_0000042
1410 Ga0496116_0000066
1411 Ga0496116_0005820
1412 Ga0496116_0007217
1413 Ga0496116_0009455
1414 Ga0496116_0019687
1415 Ga0496116_0061839
1416 Ga0496116_0104620
1417 Ga0496117_0000036
1418 Ga0496117_0013982
1419 Ga0496117_0019866
1420 Ga0496117_0032851
1421 Ga0496117_0129192
1422 Ga0496118_0008573
1423 Ga0496118_0015347
1424 Ga0496118_0022829
1425 Ga0496118_0086250
1426 Ga0496118_0169496
1427 Ga0496119_0004655
1428 Ga0496119_0010451
1429 Ga0496119_0016484
1430 Ga0496119_0056647
1431 Ga0496119_0095065
1432 Ga0496120_0000032
1433 Ga0496120_0000777
1434 Ga0496120_0001086
1435 Ga0496120_0001949
1436 Ga0496120_0008032
1437 Ga0496120_0008096
1438 Ga0496121_0000001
1439 Ga0496121_0000239
1440 Ga0496121_0002342
1441 Ga0496121_0018876
1442 Ga0496121_0089900
1443 Ga0496121_0114540
1444 Ga0496121_0149639
1445 Ga0496122_0000002
1446 Ga0496122_0000072
1447 Ga0496122_0000110
1448 Ga0496122_0006562
1449 Ga0496122_0024700
1450 Ga0496122_0038214
1451 Ga0496122_0048082
1452 Ga0496122_0055595
1453 Ga0496122_0089123
1454 Ga0496122_0102534
1455 Ga0496122_0171152
1456 Ga0496123_0000002
1457 Ga0496123_0000035
1458 Ga0496123_0000081
1459 Ga0496123_0019603
1460 Ga0496123_0022001
1461 Ga0496123_0088410
1462 Ga0496123_0125553
1463 Ga0496124_0000530
1464 Ga0496124_0003541
1465 Ga0496124_0010305
1466 Ga0496124_0015678
1467 Ga0496124_0018541
1468 Ga0496124_0166198
1469 Ga0496124_0183488
1470 Ga0496125_0000001
1471 Ga0496125_0000033
1472 Ga0496125_0329482
1473 Ga0496126_0000053
1474 Ga0496126_0001066
1475 Ga0496126_0061199
1476 Ga0496126_0066054
1477 Ga0496126_0068946
1478 Ga0496126_0082583
1479 Ga0495678_001299
1480 Ga0495682_0000003
1481 Ga0501032_0189669
1482 Ga0501033_0175589
1483 Ga0501034_0001016
1484 Ga0501034_0127468
1485 Ga0501034_0156497
1486 Ga0501034_0170942
1487 Ga0501037_0050168
1488 Ga0501067_0060623
1489 Ga0501067_0081931
1490 Ga0501070_0240193
1491 Ga0501073_0001099
1492 Ga0501073_0129401
1493 Ga0501073_0254413
1494 Ga0501238_003722
1495 Ga0501080_0401518
1496 Ga0501280_004682
1497 Ga0501035_0112926
1498 Ga0501044_0007436
1499 Ga0501044_0017995
1500 Ga0501044_0019019
1501 Ga0501044_0434355
1502 nmdc:mga03n38_21958_c1
1503 nmdc:mga00v17_18899_c1
1504 nmdc:mga00v17_230_c1
1505 nmdc:mga00v17_24964_c1
1506 nmdc:mga0yw44_53094_c1
1507 nmdc:mga0yw44_64092_c1
1508 nmdc:mga0k408_76185_c1
1509 nmdc:mga06r32_399024_c1
1510 nmdc:mga08y16_44_c1
1511 nmdc:mga0sz30_27459_c1
1512 Ga0500646_0002763
1513 Ga0500560_000282
1514 Ga0500595_006666
1515 Ga0500618_009881
1516 Ga0500621_000006
1517 Ga0500642_0002981
1518 Ga0500658_0001819
1519 Ga0500559_0058507
1520 Ga0500561_0000110
1521 Ga0500590_000792
1522 Ga0500616_0001121
1523 Ga0500616_0002733
1524 Ga0500622_0002690
1525 Ga0500624_000296
1526 Ga0500624_003077
1527 Ga0500627_0145969
1528 Ga0500634_0000796
1529 Ga0500634_0010247
1530 Ga0500636_0000026
1531 Ga0500636_0000083
1532 Ga0500609_000048
1533 Ga0501084_0206468
1534 2508733345
1535 2509107965
1536 2509141455
1537 2509376859
1538 2509385492
1539 2509448467
1540 2510136502
1541 2510304150
1542 2510839080
1543 2510900236
1544 2511135647
1545 2511184342
1546 2511197551
1547 2511435637
1548 2511502587
1549 2512533956
1550 2512970285
1551 2513569647
1552 2513576472
1553 2513583218
1554 2513595061
1555 2513601349
1556 2513620916
1557 2513635125
1558 2513709793
1559 2513871327
1560 2513881730
1561 2513904874
1562 2513911557
1563 2513929074
1564 2513986638
1565 2513999226
1566 2514003204
1567 2514018771
1568 2515115073
1569 2515609370
1570 2515633249
1571 2515642475
1572 2515658451
1573 2515741925
1574 2516205992
1575 2516893963
1576 2517041926
1577 2517081043
1578 2517098617
1579 2517410835
1580 2517570677
1581 2520380738
1582 2523468243
1583 2524448217
1584 2524457343
1585 2530644494
1586 2535520001
1587 2537877751
1588 2551675352
1589 2551676762
1590 2551689364
1591 2551695506
1592 2551700997
1593 2551711111
1594 2551722008
1595 2551724379
1596 2551736475
1597 2551739981
1598 2554245786
1599 2558865783
1600 2559296447
1601 2585169050
1602 2585202768
1603 2585221617
1604 2585233304
1605 2585255304
1606 2585270228
1607 2585272722
1608 2585281238
1609 2585327346
1610 2585335302
1611 2585390450
1612 2585395811
1613 2585401687
1614 2585524175
1615 2585536101
1616 2585539211
1617 2585544213
1618 2585557412
1619 2585562390
1620 2585821382
1621 2585829463
1622 2585834828
1623 2585837164
1624 2585842472
1625 2585896830
1626 2585906443
1627 2587981865
1628 2597815000
1629 2599334021
1630 2599414713
1631 2599603065
1632 2599717817
1633 2600196890
1634 2601610682
1635 2601746988
1636 2616295199
1637 2616310960
1638 2616551886
1639 2617382882
1640 2643804483
1641 2643857038
1642 2643922191
1643 2644003365
1644 2644051209
1645 2644065254
1646 2644105547
1647 2644146550
1648 2644194444
1649 2644200880
1650 2644210825
1651 2644240820
1652 2644308298
1653 2644334125
1654 2644377663
1655 2644418140
1656 2644451396
1657 2644484113
1658 2644494937
1659 2644497934
1660 2644520573
1661 2644541719
1662 2644615580
1663 2644654359
1664 2644672680
1665 2644691624
1666 2671109942
1667 2671116757
1668 2671693576
1669 2692315092
1670 2719183760
1671 2719388439
1672 2719668059
1673 2719728201
1674 2720494822
1675 2720611144
1676 2720616316
1677 2720629391
1678 2720771962
1679 2721145062
1680 2721155799
1681 2721167149
1682 2721403062
1683 2722838127
1684 2723029392
1685 2723563008
1686 2723570989
1687 2724035419
1688 2724042395
1689 2724086782
1690 2724106940
1691 2724107749
1692 2725952225
1693 2730105706
1694 2730161900
1695 2730300906
1696 2738802542
1697 2738944976
1698 2739033658
1699 2753358608
1700 2753463268
1701 2758640844
1702 2766068381
1703 2774872486
1704 2778175157
1705 2792581603
1706 2792620399
1707 2792625757
1708 2792641828
1709 2793281229
1710 2793296423
1711 2793317211
1712 2793324055
1713 2793325641
1714 2793333064
1715 2793340131
1716 2793346236
1717 2793355456
1718 2793357803
1719 2793366541
1720 2802716642
1721 2802725453
1722 2802730455
1723 2802737573
1724 2802743037
1725 2802750461
1726 2805929050
1727 2805937248
1728 2806044843
1729 2806053997
1730 2806059911
1731 2806066036
1732 2806073382
1733 2808990161
1734 2819244925
1735 2819607524
1736 2819643923
1737 2821126608
1738 2838019454
1739 2838025080
1740 2838032023
1741 2838039568
1742 2838045956
1743 2838050560
1744 2838062854
1745 2838071802
1746 2838080551
1747 2838667955
1748 2838671488
1749 2838679984
1750 2838684409
1751 2838693561
1752 2838699900
1753 2838704245
1754 2838711815
1755 2838717397
1756 2838721993
1757 2838728147
1758 2838735454
1759 2838739990
1760 2838748356
1761 2841741109
1762 2841843886
1763 2841850708
1764 2841858420
1765 2841864184
1766 2841869755
1767 2842081876
1768 2842117608
1769 2842122452
1770 2842129513
1771 2842134887
1772 2842143607
1773 2842149137
1774 2842156902
1775 2842162668
1776 2842167039
1777 2842173082
1778 2842180520
1779 2842186172
1780 2842190504
1781 2842195255
1782 2842203280
1783 2842210271
1784 2842214818
1785 2842222261
1786 2842227539
1787 2842236047
1788 2842241227
1789 2842249978
1790 2842253696
1791 2842263274
1792 2842268005
1793 2842278030
1794 2842283725
1795 2842289698
1796 2842295531
1797 2842299101
1798 2842310048
1799 2842311774
1800 2842318997
1801 2842343993
1802 2842358567
1803 2842369695
1804 2842376677
1805 2842381693
1806 2842389000
1807 2842396354
1808 2842407161
1809 2842414053
1810 2842420694
1811 2842425435
1812 2842432168
1813 2842438280
1814 2842443976
1815 2842450152
1816 2842466266
1817 2842472750
1818 2842478755
1819 2842487523
1820 2842491447
1821 2842499515
1822 2842505926
1823 2842511960
1824 2842521069
1825 2842524973
1826 2842925699
1827 2844166463
1828 2844461107
1829 2847419847
1830 2848994864
1831 2850081863
1832 2852394990
1833 2854899984
1834 2854914165
1835 2854921103
1836 2855826684
1837 2855842077
1838 2855877363
1839 2856346835
1840 2857519182
1841 2857536700
1842 2858802752
1843 2871478496
1844 2876604990
1845 2882460009
1846 2885316412
1847 2888348475
1848 2889790743
1849 2889915127
1850 2894236835
1851 2894821316
1852 2896391297
1853 2899793444
1854 2899847645
1855 2904477226
1856 2909043880
1857 2913301711
1858 2913309601
1859 2915651049
1860 2915981221
1861 2915992232
1862 2915998592
1863 2916005668
1864 2916013522
1865 2916021439
1866 2916026841
1867 2916033035
1868 2916039280
1869 2916046501
1870 2916050503
1871 2916055952
1872 2916062082
1873 2916070756
1874 2916082654
1875 2917556393
1876 2919103462
1877 2919119150
1878 2919153393
1879 2919170184
1880 2919413119
1881 2920761100
1882 2920825721
1883 2921204233
1884 2921210304
1885 2921239340
1886 2921249950
1887 2921251727
1888 2921258883
1889 2921270255
1890 2921287216
1891 2921292026
1892 2921302384
1893 2923556727
1894 2924144923
1895 2924156116
1896 2924159967
1897 2924169481
1898 2924173546
1899 2924183368
1900 2924193171
1901 2924195094
1902 2924201594
1903 2924208207
1904 2924216931
1905 2924227451
1906 2924235220
1907 2924756722
1908 2926759179
1909 2926763395
1910 2927144019
1911 2929138669
1912 2933010032
1913 2933011519
1914 2933017613
1915 2933576489
1916 2933591784
1917 2933595993
1918 2933602597
1919 2935898251
1920 2935905751
1921 2936370189
1922 2936377861
1923 2936384151
1924 2937001223
1925 2937003933
1926 2937010757
1927 2937021796
1928 2937027410
1929 2937035709
1930 2937039372
1931 2937042929
1932 2937050360
1933 2937062851
1934 2937064568
1935 2937073261
1936 2937080771
1937 2937085375
1938 2937098125
1939 2937105569
1940 2937110905
1941 2937117605
1942 2937124436
1943 2937131494
1944 2937840484
1945 2939605382
1946 2939673711
1947 2941504508
1948 2957380616
1949 2957382592
1950 2957389430
1951 2957401972
1952 2957408394
1953 2957410151
1954 2957420040
1955 2957424792
1956 2957433655
1957 2957437526
1958 2957450646
1959 2957452241
1960 2957462657
1961 2957465612
1962 2957475714
1963 2957478982
1964 2957488883
1965 2957497916
1966 2957501766
1967 2957509919
1968 2958071391
1969 2960590584
1970 2960591884
1971 2960602032
1972 2960607909
1973 2960614791
1974 2960618072
1975 2960630025
1976 2960633905
1977 2960642602
1978 2960651187
1979 2960659470
1980 2960667201
1981 2960669931
1982 2960675288
1983 2960680730
1984 2960688670
1985 2960696513
1986 2964614880
1987 2964617100
1988 2964627195
1989 2964630390
1990 2964637709
1991 2964646324
1992 2964651174
1993 2964663288
1994 2964666284
1995 2964672665
1996 2964682452
1997 2964689376
1998 2964693916
1999 2964704778
2000 2964706425
2001 2964716460
2002 2964725739
2003 2967668424
2004 2967676208
2005 2967685897
2006 2967691002
2007 2967698985
2008 2967704341
2009 2967711602
2010 2967720460
2011 2967724395
2012 2967730998
2013 2967739937
2014 2967744522
2015 2967749381
2016 2967759581
2017 2967767207
2018 2967770501
2019 2967782432
2020 2970025758
2021 2970027510
2022 2970036057
2023 2970046116
2024 2970048397
2025 2970057259
2026 2970064735
2027 2970071066
2028 2970082492
2029 2970083633
2030 2970094198
2031 2970102145
2032 2970104444
2033 2970115034
2034 2970120632
2035 2970123418
2036 2970135924
2037 2970140851
2038 2970144805
2039 2970154925
2040 2970161341
2041 2970168348
2042 2970173879
2043 2970181034
2044 2970184971
2045 2970196076
2046 2970529722
2047 2970545326
2048 2977519384
2049 2977530475
2050 2977536320
2051 2977543264
2052 2977546457
2053 2977553098
2054 2977565218
2055 2977567021
2056 2977574371
2057 2977585873
2058 2978970188
2059 2979091572
2060 2979097093
2061 2984587215
2062 2989352530
2063 2989773982
2064 2989780770
2065 2996888651
2066 2996896962
2067 3003935538
2068 3005416288
2069 3005421942
2070 3005451459
2071 3005456760
2072 639651714
2073 643826743
2074 648738781
2075 650842844
2076 8003574442
2077 8003994520
2078 8004002215
2079 8004395864
2080 8004633319
2081 8005250598
2082 8005264417
2083 8005277154
2084 8005287842
2085 8005290652
2086 8005305026
2087 8005313121
2088 8005321224
2089 8005323178
2090 8005381870
2091 8005388480
2092 8005397646
2093 8005436997
2094 8005466800
2095 8005490035
2096 8005503071
2097 8005547731
2098 8005562112
2099 8005567132
2100 8005576297
2101 8005625590
2102 8005630613
2103 8005650911
2104 8005674989
2105 8005688171
2106 8005689430
2107 8005701934
2108 8016738590
2109 8018130456
2110 8018165903
2111 8018182229
2112 8019500237
2113 8023682366
2114 8024484154
2115 8024492854
2116 8024505580
2117 8046773916
2118 8049295687
2119 8054560446
2120 8055622684
2121 8056375188
2122 8056383515
2123 8057576257
2124 8057878336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

107

307

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8117 15 301
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.809 15 301
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8088 16 301
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8037 15 301
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7977 15 300
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8163 64 303 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8132 64 304 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8044 64 304 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8041 64 303 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8035 32 307 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V3X9Z6-F1-model_v4 Sugar ABC transporter permease 0.8618 41 304 GO:0005886
GO:0055085
AF-A0A6P1F6V1-F1-model_v4 ABC transporter permease subunit 0.859 51 307 GO:0005886
GO:0055085
AF-A0A0C2V792-F1-model_v4 deleted 0.8564 26 300
AF-A0A6P1F6V1-F1-model_v4 ABC transporter permease subunit 0.8528 51 307 GO:0005886
GO:0055085
AF-A0A6M5IXV0-F1-model_v4 Sugar ABC transporter permease 0.8524 20 304 GO:0005886
GO:0055085

Map