F489336

General Info

Members Datasets Scaffolds Average Seq Length
1063 316 1064 209

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_517578_c1|nmdc:mga0n895_517578_c1_288_962
Length 224
Sequence MGAAPFIATAAQTRQSQENEMFDQIRPYDPLTSENAALVLIDHQVGLMTGVRDYSTGELKHNVVALAKAAKALKLPIVATTTARDSMWGPTFPELVVALPGVQIIDRSSVNAFDDTRVAQATGRKKLIFAGISLEVCAAFPAITAVGKGYSAYVAVDASGTFSETKRQVGLLRMLQAGVIVSDYATLMVEILKDNARPEAGAVYGTIDMPWAKLVGQIAQAYGK

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
136 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
137 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
138 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
139 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
140 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0.38
Rhizoplane 5.93
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001022 3300002737 Bacteria 17340
2 JGI25150J39212_1000044 3300002774 Bacteria 83125
3 JGI25150J39212_1000132 3300002774 Bacteria 41803
4 JGI25159J45721_1016594 3300002987 Bacteria 1563
5 JGI25151J46595_10021401 3300003187 Bacteria 2706
6 JGI25165J46597_1000276 3300003214 Bacteria 66076
7 JGI25153J46596_10000043 3300003215 Bacteria 156407
8 JGI25153J46596_10000265 3300003215 Bacteria 41811
9 rootH1_10042237 3300003316 Bacteria 2968
10 rootH1_10016176 3300003316 Bacteria 26999
11 rootH1_10016176 3300003323 Bacteria 2806
12 rootH1_10077686 3300003323 Bacteria 3548
13 JGI25160J50197_1032623 3300003354 Bacteria 1320
14 JGI25407J50210_10054340 3300003373 Bacteria 1012
15 JGI25404J52841_10028741 3300003659 Bacteria 1193
16 Ga0055526_1008793 3300003771 Bacteria 4971
17 Ga0055526_1043098 3300003771 Bacteria 1103
18 Ga0055537_1000553 3300003773 Bacteria 21212
19 Ga0055524_1000017 3300003775 Bacteria 235608
20 Ga0055536_1000393 3300003781 Bacteria 31775
21 Ga0055530_10009972 3300003791 Bacteria 3574
22 Ga0055540_1041615 3300003792 Bacteria 988
23 Ga0055531_10000805 3300003794 Bacteria 26002
24 Ga0055531_10002275 3300003794 Bacteria 12993
25 JGI25405J52794_10001047 3300003911 Bacteria 4401
26 Ga0065165_1001283 3300005262 Bacteria 28362
27 Ga0065165_1011885 3300005262 Bacteria 3585
28 Ga0065704_10105882 3300005289 Bacteria 2098
29 Ga0065712_10001241 3300005290 Bacteria 6376
30 Ga0065712_10295978 3300005290 Bacteria 869
31 Ga0065715_10095973 3300005293 Bacteria 3970
32 Ga0065715_10150025 3300005293 Bacteria 1740
33 Ga0065715_10300473 3300005293 Bacteria 1042
34 Ga0065715_10344713 3300005293 Bacteria 961
35 Ga0065707_10066515 3300005295 Bacteria 975
36 Ga0065707_10084964 3300005295 Bacteria 6594
37 Ga0070666_10040482 3300005335 Bacteria 3111
38 Ga0070682_100003792 3300005337 Bacteria 8402
39 Ga0070682_100080519 3300005337 Unclassified 2106
40 Ga0070682_100598915 3300005337 Bacteria 870
41 Ga0068868_100201975 3300005338 Bacteria 1657
42 Ga0068868_101277302 3300005338 Bacteria 681
43 Ga0070660_100023777 3300005339 Unclassified 4541
44 Ga0070689_100018067 3300005340 Bacteria 5188
45 Ga0070689_100027619 3300005340 Bacteria 4279
46 Ga0070691_10009813 3300005341 Bacteria 4366
47 Ga0070691_10017350 3300005341 Unclassified 3312
48 Ga0070687_100017106 3300005343 Bacteria 3326
49 Ga0070661_100288636 3300005344 Bacteria 1274
50 Ga0070668_100019648 3300005347 Bacteria 5086
51 Ga0070668_100414151 3300005347 Bacteria 1153
52 Ga0070668_100514818 3300005347 Bacteria 1037
53 Ga0070668_100836728 3300005347 Bacteria 819
54 Ga0070669_100037023 3300005353 Bacteria 3538
55 Ga0070669_100120918 3300005353 Bacteria 1998
56 Ga0070669_100667130 3300005353 Bacteria 876
57 Ga0070671_100078248 3300005355 Bacteria 2764
58 Ga0070671_100492473 3300005355 Unclassified 1054
59 Ga0070671_100807460 3300005355 Bacteria 817
60 Ga0070674_100142987 3300005356 Bacteria 1798
61 Ga0070688_100042784 3300005365 Bacteria 2788
62 Ga0070688_100534970 3300005365 Bacteria 889
63 Ga0070667_100140252 3300005367 Bacteria 2116
64 Ga0070667_100141623 3300005367 Bacteria 2106
65 Ga0070703_10064253 3300005406 Bacteria 1209
66 Ga0070703_10151273 3300005406 Bacteria 872
67 Ga0070703_10160910 3300005406 Unclassified 852
68 Ga0070703_10196478 3300005406 Bacteria 789
69 Ga0070709_10004844 3300005434 Bacteria 7276
70 Ga0070714_100074415 3300005435 Bacteria 2944
71 Ga0070714_100074880 3300005435 Bacteria 2936
72 Ga0070714_100153402 3300005435 Bacteria 2078
73 Ga0070714_100839701 3300005435 Bacteria 890
74 Ga0070713_100027663 3300005436 Bacteria 4467
75 Ga0070713_100060530 3300005436 Bacteria 3165
76 Ga0070713_100080320 3300005436 Bacteria 2780
77 Ga0070713_100081033 3300005436 Bacteria 2769
78 Ga0070713_100176424 3300005436 Bacteria 1918
79 Ga0070713_100334988 3300005436 Bacteria 1401
80 Ga0070713_100446178 3300005436 Bacteria 1214
81 Ga0070713_100581494 3300005436 Bacteria 1063
82 Ga0070713_100754813 3300005436 Bacteria 931
83 Ga0070713_101282739 3300005436 Bacteria 710
84 Ga0070710_10012689 3300005437 Bacteria 4193
85 Ga0070710_10051571 3300005437 Bacteria 2310
86 Ga0070710_10066255 3300005437 Bacteria 2070
87 Ga0070710_10075010 3300005437 Bacteria 1958
88 Ga0070710_10075659 3300005437 Bacteria 1952
89 Ga0070710_10236370 3300005437 Bacteria 1169
90 Ga0070711_100001412 3300005439 Bacteria 13173
91 Ga0070711_100042018 3300005439 Bacteria 3089
92 Ga0070711_100229132 3300005439 Bacteria 1448
93 Ga0070711_100246346 3300005439 Bacteria 1400
94 Ga0070705_100079313 3300005440 Bacteria 2011
95 Ga0070705_100523006 3300005440 Bacteria 904
96 Ga0070705_100710452 3300005440 Bacteria 790
97 Ga0070694_100017290 3300005444 Bacteria 4555
98 Ga0070694_100382885 3300005444 Bacteria 1097
99 Ga0070694_100463437 3300005444 Bacteria 1003
100 Ga0070694_100508519 3300005444 Bacteria 959
101 Ga0070708_100000327 3300005445 Bacteria 35749
102 Ga0070708_100011819 3300005445 Bacteria 7104
103 Ga0070708_100024936 3300005445 Bacteria 5110
104 Ga0070708_100039861 3300005445 Bacteria 4112
105 Ga0070708_100086373 3300005445 Bacteria 2849
106 Ga0070708_100097597 3300005445 Unclassified 2686
107 Ga0070708_100124707 3300005445 Bacteria 2379
108 Ga0070708_100150992 3300005445 Bacteria 2160
109 Ga0070708_100152133 3300005445 Bacteria 2152
110 Ga0070708_100195530 3300005445 Bacteria 1892
111 Ga0070708_100198356 3300005445 Bacteria 1878
112 Ga0070708_100203302 3300005445 Bacteria 1855
113 Ga0070708_100262275 3300005445 Bacteria 1624
114 Ga0070708_100262598 3300005445 Bacteria 1623
115 Ga0070708_100332498 3300005445 Bacteria 1431
116 Ga0070708_100355751 3300005445 Bacteria 1380
117 Ga0070708_100556719 3300005445 Bacteria 1082
118 Ga0070663_100011764 3300005455 Bacteria 5508
119 Ga0070663_100016703 3300005455 Bacteria 4775
120 Ga0070678_100002534 3300005456 Bacteria 10017
121 Ga0070662_100009553 3300005457 Bacteria 6348
122 Ga0068867_100045742 3300005459 Bacteria 3211
123 Ga0070685_10064247 3300005466 Bacteria 2157
124 Ga0070706_100004540 3300005467 Bacteria 13358
125 Ga0070706_100006358 3300005467 Bacteria 11157
126 Ga0070706_100007422 3300005467 Bacteria 10282
127 Ga0070706_100009362 3300005467 Bacteria 9120
128 Ga0070706_100019204 3300005467 Bacteria 6306
129 Ga0070706_100029868 3300005467 Bacteria 5020
130 Ga0070706_100141986 3300005467 Unclassified 2241
131 Ga0070706_100157119 3300005467 Unclassified 2123
132 Ga0070706_100159878 3300005467 Bacteria 2103
133 Ga0070706_100214579 3300005467 Unclassified 1796
134 Ga0070706_100344381 3300005467 Bacteria 1390
135 Ga0070706_100643487 3300005467 Unclassified 984
136 Ga0070707_100009021 3300005468 Bacteria 9251
137 Ga0070707_100009843 3300005468 Bacteria 8896
138 Ga0070707_100018493 3300005468 Bacteria 6556
139 Ga0070707_100030862 3300005468 Bacteria 5104
140 Ga0070707_100033453 3300005468 Bacteria 4902
141 Ga0070707_100065091 3300005468 Bacteria 3501
142 Ga0070707_100126479 3300005468 Bacteria 2484
143 Ga0070707_100139495 3300005468 Bacteria 2359
144 Ga0070707_100258676 3300005468 Bacteria 1694
145 Ga0070707_100261425 3300005468 Bacteria 1684
146 Ga0070707_100373945 3300005468 Bacteria 1384
147 Ga0070707_100444884 3300005468 Bacteria 1256
148 Ga0070707_100487286 3300005468 Bacteria 1194
149 Ga0070707_100621527 3300005468 Bacteria 1043
150 Ga0070707_100675305 3300005468 Bacteria 996
151 Ga0070707_100700568 3300005468 Bacteria 976
152 Ga0070698_100008194 3300005471 Bacteria 11303
153 Ga0070698_100014041 3300005471 Bacteria 8470
154 Ga0070698_100029756 3300005471 Bacteria 5667
155 Ga0070698_100034175 3300005471 Bacteria 5266
156 Ga0070698_100054828 3300005471 Bacteria 4046
157 Ga0070698_100061029 3300005471 Bacteria 3803
158 Ga0070698_100064612 3300005471 Bacteria 3686
159 Ga0070698_100087994 3300005471 Bacteria 3091
160 Ga0070698_100089099 3300005471 Bacteria 3070
161 Ga0070698_100109669 3300005471 Unclassified 2726
162 Ga0070698_100114191 3300005471 Bacteria 2665
163 Ga0070698_100214036 3300005471 Bacteria 1861
164 Ga0070698_100303321 3300005471 Bacteria 1528
165 Ga0070698_100334536 3300005471 Bacteria 1445
166 Ga0070698_100454634 3300005471 Bacteria 1216
167 Ga0070698_100557483 3300005471 Bacteria 1085
168 Ga0070698_100868048 3300005471 Bacteria 847
169 Ga0070698_100892199 3300005471 Unclassified 834
170 Ga0070699_100004190 3300005518 Bacteria 12763
171 Ga0070699_100017176 3300005518 Bacteria 6213
172 Ga0070699_100054650 3300005518 Bacteria 3456
173 Ga0070699_100077202 3300005518 Bacteria 2899
174 Ga0070699_100078547 3300005518 Bacteria 2874
175 Ga0070699_100137897 3300005518 Bacteria 2152
176 Ga0070699_100210749 3300005518 Bacteria 1730
177 Ga0070699_100274525 3300005518 Bacteria 1509
178 Ga0070699_100347088 3300005518 Bacteria 1336
179 Ga0070699_100358408 3300005518 Bacteria 1315
180 Ga0070699_100398865 3300005518 Bacteria 1243
181 Ga0070699_100401805 3300005518 Bacteria 1239
182 Ga0070699_100453804 3300005518 Bacteria 1162
183 Ga0070699_100505170 3300005518 Bacteria 1098
184 Ga0070699_100545237 3300005518 Bacteria 1055
185 Ga0070699_100948268 3300005518 Bacteria 788
186 Ga0070697_100007293 3300005536 Bacteria 8600
187 Ga0070697_100007757 3300005536 Bacteria 8357
188 Ga0070697_100017733 3300005536 Bacteria 5608
189 Ga0070697_100032620 3300005536 Bacteria 4192
190 Ga0070697_100041917 3300005536 Bacteria 3705
191 Ga0070697_100101570 3300005536 Unclassified 2389
192 Ga0070697_100116022 3300005536 Bacteria 2236
193 Ga0070697_100131380 3300005536 Bacteria 2100
194 Ga0070697_100200865 3300005536 Bacteria 1695
195 Ga0070697_100254396 3300005536 Bacteria 1502
196 Ga0070697_100353426 3300005536 Bacteria 1269
197 Ga0070697_100385229 3300005536 Bacteria 1215
198 Ga0070697_100438865 3300005536 Bacteria 1136
199 Ga0070697_100523208 3300005536 Unclassified 1038
200 Ga0070697_100565601 3300005536 Bacteria 998
201 Ga0070697_100986311 3300005536 Bacteria 749
202 Ga0068853_100017172 3300005539 Bacteria 5971
203 Ga0068853_100231603 3300005539 Bacteria 1690
204 Ga0070672_100030559 3300005543 Bacteria 4048
205 Ga0070686_100006693 3300005544 Bacteria 6415
206 Ga0070695_100027617 3300005545 Unclassified 3517
207 Ga0070695_100027867 3300005545 Bacteria 3502
208 Ga0070695_100065982 3300005545 Bacteria 2358
209 Ga0070695_100435303 3300005545 Bacteria 1001
210 Ga0070695_100562165 3300005545 Bacteria 890
211 Ga0070695_100844889 3300005545 Bacteria 736
212 Ga0070696_100034202 3300005546 Bacteria 3495
213 Ga0070696_100036799 3300005546 Bacteria 3375
214 Ga0070696_100046895 3300005546 Bacteria 2998
215 Ga0070696_100103608 3300005546 Bacteria 2042
216 Ga0070696_100148354 3300005546 Bacteria 1719
217 Ga0070696_100181210 3300005546 Bacteria 1563
218 Ga0070696_100196543 3300005546 Bacteria 1504
219 Ga0070696_100244947 3300005546 Bacteria 1353
220 Ga0070696_100316303 3300005546 Bacteria 1200
221 Ga0070696_100528193 3300005546 Bacteria 942
222 Ga0070665_100005888 3300005548 Bacteria 12561
223 Ga0070665_100099412 3300005548 Bacteria 2913
224 Ga0070665_100488105 3300005548 Bacteria 1243
225 Ga0070665_100766005 3300005548 Unclassified 978
226 Ga0070704_100020569 3300005549 Bacteria 4258
227 Ga0070704_100022009 3300005549 Bacteria 4143
228 Ga0070704_100030427 3300005549 Bacteria 3617
229 Ga0070704_100226560 3300005549 Bacteria 1522
230 Ga0070704_100243905 3300005549 Bacteria 1472
231 Ga0070704_100265153 3300005549 Bacteria 1417
232 Ga0070704_100377307 3300005549 Bacteria 1204
233 Ga0070704_100573656 3300005549 Bacteria 988
234 Ga0070704_100596189 3300005549 Bacteria 971
235 Ga0070664_100211057 3300005564 Unclassified 1735
236 Ga0068857_100017155 3300005577 Bacteria 6341
237 Ga0068854_100011429 3300005578 Bacteria 5781
238 Ga0068854_100049570 3300005578 Bacteria 3000
239 Ga0068854_100523771 3300005578 Bacteria 1002
240 Ga0070702_100001810 3300005615 Bacteria 8892
241 Ga0068852_100012556 3300005616 Bacteria 6434
242 Ga0068859_100362090 3300005617 Bacteria 1545
243 Ga0068864_100269485 3300005618 Unclassified 1586
244 Ga0068866_10469634 3300005718 Bacteria 826
245 Ga0068861_100034650 3300005719 Bacteria 3734
246 Ga0068861_100119064 3300005719 Bacteria 2128
247 Ga0068861_100271996 3300005719 Bacteria 1455
248 Ga0068861_100475677 3300005719 Bacteria 1124
249 Ga0068863_100012142 3300005841 Bacteria 8322
250 Ga0068858_100228910 3300005842 Bacteria 1762
251 Ga0068860_100016584 3300005843 Bacteria 7184
252 Ga0068860_100892269 3300005843 Bacteria 905
253 Ga0068862_100009669 3300005844 Bacteria 7969
254 Ga0081455_10006446 3300005937 Bacteria 12576
255 Ga0081455_10010595 3300005937 Bacteria 9330
256 Ga0081455_10116873 3300005937 Bacteria 2109
257 Ga0081538_10003905 3300005981 Bacteria 13909
258 Ga0081538_10008589 3300005981 Bacteria 8643
259 Ga0081538_10012492 3300005981 Bacteria 6804
260 Ga0081538_10135447 3300005981 Bacteria 1148
261 Ga0081540_1000494 3300005983 Bacteria 38779
262 Ga0081540_1052217 3300005983 Bacteria 2015
263 Ga0081539_10061200 3300005985 Bacteria 2063
264 Ga0070717_10011227 3300006028 Bacteria 6793
265 Ga0070717_10013507 3300006028 Bacteria 6260
266 Ga0070717_10111075 3300006028 Bacteria 2338
267 Ga0070717_10111664 3300006028 Bacteria 2332
268 Ga0070717_10153964 3300006028 Bacteria 1990
269 Ga0070717_10163817 3300006028 Bacteria 1930
270 Ga0070717_10325851 3300006028 Bacteria 1369
271 Ga0070717_10470178 3300006028 Bacteria 1135
272 Ga0070717_10548576 3300006028 Unclassified 1047
273 Ga0070717_10642939 3300006028 Bacteria 963
274 Ga0070717_10906287 3300006028 Bacteria 803
275 Ga0075365_10141022 3300006038 Unclassified 1673
276 Ga0075368_10013725 3300006042 Bacteria 2979
277 Ga0075363_100000487 3300006048 Bacteria 12588
278 Ga0075364_10048714 3300006051 Bacteria 2762
279 Ga0075364_10536748 3300006051 Bacteria 800
280 Ga0070715_10019337 3300006163 Unclassified 2611
281 Ga0070715_10019458 3300006163 Bacteria 2605
282 Ga0070715_10094818 3300006163 Bacteria 1380
283 Ga0070715_10307258 3300006163 Bacteria 851
284 Ga0070716_100002178 3300006173 Bacteria 9012
285 Ga0070716_100011404 3300006173 Bacteria 4473
286 Ga0070716_100023382 3300006173 Bacteria 3277
287 Ga0070716_100086870 3300006173 Bacteria 1883
288 Ga0070716_100151142 3300006173 Bacteria 1494
289 Ga0070716_100225498 3300006173 Bacteria 1262
290 Ga0070716_100228945 3300006173 Bacteria 1253
291 Ga0070716_100241319 3300006173 Bacteria 1225
292 Ga0070716_100564528 3300006173 Bacteria 851
293 Ga0070716_100610680 3300006173 Bacteria 822
294 Ga0070712_100003950 3300006175 Bacteria 9122
295 Ga0070712_100006417 3300006175 Bacteria 7296
296 Ga0070712_100058515 3300006175 Bacteria 2711
297 Ga0070712_100059493 3300006175 Bacteria 2691
298 Ga0070712_100709512 3300006175 Bacteria 858
299 Ga0070712_100820479 3300006175 Bacteria 799
300 Ga0075367_10177329 3300006178 Bacteria 1328
301 Ga0097621_100761348 3300006237 Bacteria 895
302 Ga0075370_10011330 3300006353 Bacteria 4682
303 Ga0068871_100228670 3300006358 Bacteria 1614
304 Ga0068871_100273776 3300006358 Bacteria 1475
305 Ga0075428_100026406 3300006844 Bacteria 6429
306 Ga0075428_100027761 3300006844 Bacteria 6262
307 Ga0075428_100044754 3300006844 Bacteria 4863
308 Ga0075428_100068519 3300006844 Bacteria 3881
309 Ga0075428_100097710 3300006844 Bacteria 3201
310 Ga0075428_100099150 3300006844 Bacteria 3176
311 Ga0075428_100122741 3300006844 Bacteria 2827
312 Ga0075428_100156310 3300006844 Bacteria 2477
313 Ga0075428_100162662 3300006844 Bacteria 2422
314 Ga0075428_100192864 3300006844 Unclassified 2203
315 Ga0075428_100219793 3300006844 Bacteria 2052
316 Ga0075428_100226376 3300006844 Bacteria 2018
317 Ga0075428_100279629 3300006844 Bacteria 1796
318 Ga0075428_100353716 3300006844 Bacteria 1576
319 Ga0075428_100355340 3300006844 Bacteria 1572
320 Ga0075428_100402237 3300006844 Bacteria 1467
321 Ga0075428_100573948 3300006844 Bacteria 1205
322 Ga0075428_100778339 3300006844 Unclassified 1017
323 Ga0075430_100020140 3300006846 Bacteria 5676
324 Ga0075430_100054534 3300006846 Bacteria 3363
325 Ga0075430_100059465 3300006846 Bacteria 3213
326 Ga0075430_100278704 3300006846 Unclassified 1383
327 Ga0075430_100362592 3300006846 Bacteria 1197
328 Ga0075431_100022859 3300006847 Bacteria 6391
329 Ga0075431_100065686 3300006847 Bacteria 3746
330 Ga0075431_100287923 3300006847 Bacteria 1662
331 Ga0075431_100319715 3300006847 Bacteria 1565
332 Ga0075431_100360776 3300006847 Bacteria 1460
333 Ga0075431_100557529 3300006847 Bacteria 1133
334 Ga0075433_10001320 3300006852 Bacteria 18149
335 Ga0075433_10002036 3300006852 Bacteria 15269
336 Ga0075433_10003541 3300006852 Bacteria 12056
337 Ga0075433_10006871 3300006852 Bacteria 9017
338 Ga0075433_10010320 3300006852 Bacteria 7491
339 Ga0075433_10011565 3300006852 Bacteria 7108
340 Ga0075433_10034231 3300006852 Bacteria 4361
341 Ga0075433_10053330 3300006852 Bacteria 3525
342 Ga0075433_10076139 3300006852 Bacteria 2955
343 Ga0075433_10127900 3300006852 Bacteria 2256
344 Ga0075433_10148695 3300006852 Unclassified 2083
345 Ga0075433_10152514 3300006852 Bacteria 2055
346 Ga0075433_10194662 3300006852 Bacteria 1803
347 Ga0075433_10231520 3300006852 Bacteria 1641
348 Ga0075433_10261307 3300006852 Bacteria 1535
349 Ga0075433_10288162 3300006852 Bacteria 1454
350 Ga0075433_10459230 3300006852 Bacteria 1122
351 Ga0075433_10459672 3300006852 Bacteria 1122
352 Ga0075433_10496308 3300006852 Bacteria 1075
353 Ga0075433_10681852 3300006852 Bacteria 900
354 Ga0075433_10801193 3300006852 Unclassified 823
355 Ga0075434_100005686 3300006871 Bacteria 11379
356 Ga0075434_100007695 3300006871 Bacteria 9974
357 Ga0075434_100019749 3300006871 Bacteria 6524
358 Ga0075434_100034636 3300006871 Bacteria 4988
359 Ga0075434_100046970 3300006871 Bacteria 4284
360 Ga0075434_100057121 3300006871 Bacteria 3879
361 Ga0075434_100114024 3300006871 Bacteria 2715
362 Ga0075434_100145351 3300006871 Bacteria 2391
363 Ga0075434_100161118 3300006871 Bacteria 2263
364 Ga0075434_100210425 3300006871 Unclassified 1965
365 Ga0075434_100212061 3300006871 Bacteria 1956
366 Ga0075434_100248425 3300006871 Bacteria 1798
367 Ga0075434_100254674 3300006871 Bacteria 1774
368 Ga0075434_100278393 3300006871 Unclassified 1692
369 Ga0075434_100306409 3300006871 Bacteria 1608
370 Ga0075434_100354064 3300006871 Bacteria 1489
371 Ga0075434_100429004 3300006871 Bacteria 1343
372 Ga0075434_100495667 3300006871 Bacteria 1242
373 Ga0075434_100649057 3300006871 Bacteria 1074
374 Ga0075434_100707807 3300006871 Bacteria 1024
375 Ga0075434_100724323 3300006871 Bacteria 1012
376 Ga0075434_100747756 3300006871 Unclassified 995
377 Ga0075434_100766494 3300006871 Bacteria 981
378 Ga0075434_101076223 3300006871 Bacteria 817
379 Ga0075429_100019033 3300006880 Bacteria 5948
380 Ga0075429_100037493 3300006880 Bacteria 4220
381 Ga0075429_100049459 3300006880 Bacteria 3656
382 Ga0075429_100050141 3300006880 Bacteria 3632
383 Ga0075429_100149788 3300006880 Unclassified 2043
384 Ga0075429_100173732 3300006880 Bacteria 1887
385 Ga0075429_100256636 3300006880 Bacteria 1531
386 Ga0075429_100425021 3300006880 Unclassified 1164
387 Ga0075429_100786033 3300006880 Bacteria 834
388 Ga0068865_100183944 3300006881 Bacteria 1611
389 Ga0075436_100003400 3300006914 Bacteria 10905
390 Ga0075436_100033969 3300006914 Unclassified 3515
391 Ga0075436_100065982 3300006914 Bacteria 2501
392 Ga0075436_100067224 3300006914 Bacteria 2477
393 Ga0075436_100198226 3300006914 Bacteria 1421
394 Ga0075436_100235642 3300006914 Bacteria 1301
395 Ga0075436_100296316 3300006914 Bacteria 1158
396 Ga0075436_100665177 3300006914 Bacteria 770
397 Ga0075436_100669369 3300006914 Bacteria 768
398 Ga0075436_100856380 3300006914 Bacteria 679
399 Ga0097620_100362080 3300006931 Bacteria 1545
400 Ga0075435_100007201 3300007076 Bacteria 7913
401 Ga0075435_100013765 3300007076 Bacteria 6029
402 Ga0075435_100024448 3300007076 Bacteria 4689
403 Ga0075435_100055694 3300007076 Bacteria 3194
404 Ga0075435_100067152 3300007076 Bacteria 2919
405 Ga0075435_100071188 3300007076 Bacteria 2839
406 Ga0075435_100072577 3300007076 Bacteria 2812
407 Ga0075435_100098896 3300007076 Bacteria 2415
408 Ga0075435_100152434 3300007076 Bacteria 1944
409 Ga0075435_100164266 3300007076 Bacteria 1872
410 Ga0075435_100228569 3300007076 Bacteria 1580
411 Ga0075435_100232000 3300007076 Bacteria 1568
412 Ga0075435_100313066 3300007076 Bacteria 1343
413 Ga0075435_100403072 3300007076 Bacteria 1176
414 Ga0075435_100408508 3300007076 Bacteria 1168
415 Ga0075435_100459042 3300007076 Bacteria 1099
416 Ga0075435_100480993 3300007076 Bacteria 1072
417 Ga0075435_100585129 3300007076 Bacteria 967
418 Ga0075435_100601046 3300007076 Bacteria 954
419 Ga0075435_100893735 3300007076 Bacteria 774
420 Ga0099794_10001962 3300007265 Bacteria 7402
421 Ga0099794_10002095 3300007265 Bacteria 7253
422 Ga0099794_10020880 3300007265 Bacteria 2969
423 Ga0099794_10193834 3300007265 Bacteria 1040
424 Ga0099794_10229070 3300007265 Bacteria 956
425 Ga0099795_10225537 3300007788 Bacteria 799
426 Ga0105244_10005771 3300009036 Bacteria 8157
427 Ga0105250_10030786 3300009092 Bacteria 2157
428 Ga0105240_10663574 3300009093 Bacteria 1142
429 Ga0111539_10048581 3300009094 Bacteria 5065
430 Ga0111539_10085334 3300009094 Bacteria 3711
431 Ga0111539_10168166 3300009094 Bacteria 2562
432 Ga0111539_10203521 3300009094 Bacteria 2308
433 Ga0111539_10243809 3300009094 Bacteria 2092
434 Ga0111539_10390786 3300009094 Bacteria 1620
435 Ga0111539_10459093 3300009094 Bacteria 1483
436 Ga0111539_10486766 3300009094 Bacteria 1437
437 Ga0111539_10781032 3300009094 Unclassified 1112
438 Ga0111539_10793818 3300009094 Bacteria 1102
439 Ga0105245_10013776 3300009098 Bacteria 7042
440 Ga0105247_10038209 3300009101 Bacteria 2930
441 Ga0114129_10002492 3300009147 Bacteria 25557
442 Ga0114129_10004475 3300009147 Bacteria 19706
443 Ga0114129_10004685 3300009147 Bacteria 19321
444 Ga0114129_10007203 3300009147 Bacteria 15828
445 Ga0114129_10017425 3300009147 Bacteria 10230
446 Ga0114129_10017478 3300009147 Bacteria 10211
447 Ga0114129_10019037 3300009147 Bacteria 9779
448 Ga0114129_10021529 3300009147 Bacteria 9153
449 Ga0114129_10041514 3300009147 Bacteria 6481
450 Ga0114129_10060267 3300009147 Bacteria 5306
451 Ga0114129_10090140 3300009147 Bacteria 4251
452 Ga0114129_10118447 3300009147 Bacteria 3647
453 Ga0114129_10184200 3300009147 Bacteria 2839
454 Ga0114129_10185627 3300009147 Bacteria 2826
455 Ga0114129_10296831 3300009147 Bacteria 2155
456 Ga0114129_10359204 3300009147 Bacteria 1928
457 Ga0114129_10378370 3300009147 Unclassified 1870
458 Ga0114129_10455247 3300009147 Bacteria 1678
459 Ga0114129_10472099 3300009147 Bacteria 1642
460 Ga0114129_10483623 3300009147 Bacteria 1619
461 Ga0114129_10619674 3300009147 Bacteria 1400
462 Ga0114129_10653232 3300009147 Bacteria 1357
463 Ga0114129_10675847 3300009147 Bacteria 1330
464 Ga0114129_10727537 3300009147 Bacteria 1273
465 Ga0114129_10812272 3300009147 Bacteria 1192
466 Ga0114129_10902255 3300009147 Bacteria 1120
467 Ga0114129_11076102 3300009147 Bacteria 1008
468 Ga0114129_11078018 3300009147 Bacteria 1007
469 Ga0114129_11638466 3300009147 Bacteria 787
470 Ga0105243_10848832 3300009148 Bacteria 904
471 Ga0105241_10040941 3300009174 Bacteria 3499
472 Ga0105241_10048446 3300009174 Bacteria 3234
473 Ga0105242_10297612 3300009176 Unclassified 1471
474 Ga0105242_10593919 3300009176 Bacteria 1068
475 Ga0105242_10607719 3300009176 Bacteria 1057
476 Ga0105248_10011651 3300009177 Bacteria 9686
477 Ga0105248_10752314 3300009177 Bacteria 1100
478 Ga0105237_10000964 3300009545 Bacteria 38709
479 Ga0105237_10966098 3300009545 Bacteria 859
480 Ga0105238_10426422 3300009551 Bacteria 1321
481 Ga0105249_10268839 3300009553 Bacteria 1698
482 Ga0105249_10314419 3300009553 Bacteria 1576
483 Ga0105249_10394120 3300009553 Bacteria 1413
484 Ga0105249_11097431 3300009553 Bacteria 866
485 Ga0099796_10017097 3300010159 Bacteria 2154
486 Ga0099796_10085032 3300010159 Bacteria 1167
487 Ga0105239_10000025 3300010375 Bacteria 254049
488 Ga0105239_10090735 3300010375 Bacteria 3371
489 Ga0105239_11317040 3300010375 Bacteria 833
490 Ga0105239_11352899 3300010375 Bacteria 822
491 Ga0105246_10214239 3300011119 Unclassified 1505
492 Ga0157373_10077541 3300013100 Bacteria 2344
493 Ga0157369_10108106 3300013105 Bacteria 2958
494 Ga0157374_10241514 3300013296 Bacteria 1776
495 Ga0157378_10021295 3300013297 Bacteria 5700
496 Ga0157378_10491278 3300013297 Bacteria 1225
497 Ga0157378_10873191 3300013297 Bacteria 929
498 Ga0163162_10181078 3300013306 Bacteria 2233
499 Ga0157372_10744394 3300013307 Bacteria 1140
500 Ga0157375_10091370 3300013308 Bacteria 3106
501 Ga0157375_10266665 3300013308 Bacteria 1874
502 Ga0157375_10963889 3300013308 Bacteria 994
503 Ga0163163_10017144 3300014325 Bacteria 6748
504 Ga0163163_10986678 3300014325 Bacteria 906
505 Ga0157380_10009890 3300014326 Bacteria 6847
506 Ga0157380_10338927 3300014326 Unclassified 1402
507 Ga0157379_10312860 3300014968 Bacteria 1433
508 Ga0157379_10544289 3300014968 Unclassified 1080
509 Ga0157376_10009199 3300014969 Bacteria 7167
510 Ga0163161_11047058 3300017792 Bacteria 699
511 Ga0214544_1000424 3300021320 Bacteria 75924
512 Ga0214542_1000412 3300021321 Bacteria 75924
513 Ga0214545_1000242 3300021324 Bacteria 75924
514 Ga0214543_1000327 3300021327 Bacteria 75924
515 Ga0224572_1002353 3300024225 Bacteria 3033
516 Ga0228598_1002567 3300024227 Bacteria 3941
517 Ga0228598_1016185 3300024227 Bacteria 1472
518 Ga0209437_100023 3300025233 Bacteria 614195
519 Ga0207425_1000037 3300025245 Bacteria 224645
520 Ga0207425_1000047 3300025245 Bacteria 189158
521 Ga0209129_1000378 3300025258 Bacteria 36183
522 Ga0209129_1000480 3300025258 Bacteria 29248
523 Ga0209233_1000062 3300025261 Bacteria 399685
524 Ga0209565_1000062 3300025263 Bacteria 184007
525 Ga0209565_1002595 3300025263 Bacteria 6408
526 Ga0209565_1037884 3300025263 Bacteria 910
527 Ga0209130_1000318 3300025284 Bacteria 56545
528 Ga0209676_1000291 3300025292 Bacteria 102996
529 Ga0209676_1001816 3300025292 Bacteria 17808
530 Ga0209025_1000117 3300025294 Bacteria 215073
531 Ga0209025_1000150 3300025294 Bacteria 172834
532 Ga0209025_1045233 3300025294 Bacteria 1828
533 Ga0209564_1002021 3300025295 Bacteria 17638
534 Ga0209564_1013326 3300025295 Bacteria 3505
535 Ga0209564_1020233 3300025295 Bacteria 2447
536 Ga0209758_1000009 3300025297 Bacteria 1123483
537 Ga0209758_1000103 3300025297 Bacteria 223968
538 Ga0209758_1001241 3300025297 Bacteria 31750
539 Ga0209050_1000327 3300025298 Bacteria 95283
540 Ga0209050_1002490 3300025298 Bacteria 15572
541 Ga0209050_1003020 3300025298 Bacteria 13031
542 Ga0209256_1000018 3300025299 Bacteria 568467
543 Ga0207426_1000512 3300025302 Bacteria 56516
544 Ga0207426_1001703 3300025302 Bacteria 16900
545 Ga0207426_1030352 3300025302 Bacteria 1773
546 Ga0209051_1017824 3300025303 Bacteria 3161
547 Ga0209257_1000345 3300025304 Bacteria 96513
548 Ga0209257_1001353 3300025304 Bacteria 29628
549 Ga0207653_10055869 3300025885 Bacteria 1323
550 Ga0207692_10042639 3300025898 Bacteria 2254
551 Ga0207692_10072078 3300025898 Bacteria 1824
552 Ga0207692_10651571 3300025898 Bacteria 680
553 Ga0207642_10371252 3300025899 Bacteria 849
554 Ga0207688_10008540 3300025901 Bacteria 5574
555 Ga0207647_10008876 3300025904 Bacteria 7170
556 Ga0207685_10007770 3300025905 Bacteria 3012
557 Ga0207685_10030721 3300025905 Bacteria 1916
558 Ga0207685_10037116 3300025905 Bacteria 1792
559 Ga0207685_10063917 3300025905 Bacteria 1468
560 Ga0207685_10161923 3300025905 Bacteria 1022
561 Ga0207699_10076719 3300025906 Bacteria 2059
562 Ga0207699_10087391 3300025906 Bacteria 1949
563 Ga0207699_10090359 3300025906 Bacteria 1921
564 Ga0207699_10592016 3300025906 Bacteria 807
565 Ga0207645_10031716 3300025907 Bacteria 3398
566 Ga0207645_10285027 3300025907 Bacteria 1097
567 Ga0207684_10000181 3300025910 Bacteria 101122
568 Ga0207684_10000507 3300025910 Bacteria 48732
569 Ga0207684_10000684 3300025910 Bacteria 40135
570 Ga0207684_10003189 3300025910 Bacteria 16104
571 Ga0207684_10005711 3300025910 Bacteria 11427
572 Ga0207684_10007743 3300025910 Bacteria 9619
573 Ga0207684_10013300 3300025910 Bacteria 7119
574 Ga0207684_10019354 3300025910 Bacteria 5825
575 Ga0207684_10026415 3300025910 Bacteria 4949
576 Ga0207684_10027978 3300025910 Bacteria 4802
577 Ga0207684_10074280 3300025910 Bacteria 2888
578 Ga0207684_10079262 3300025910 Bacteria 2794
579 Ga0207684_10084698 3300025910 Bacteria 2700
580 Ga0207684_10085947 3300025910 Bacteria 2679
581 Ga0207684_10113533 3300025910 Bacteria 2319
582 Ga0207684_10116903 3300025910 Bacteria 2285
583 Ga0207684_10144603 3300025910 Bacteria 2045
584 Ga0207684_10150699 3300025910 Bacteria 2001
585 Ga0207684_10193612 3300025910 Unclassified 1754
586 Ga0207684_10481299 3300025910 Bacteria 1065
587 Ga0207684_10498204 3300025910 Bacteria 1044
588 Ga0207684_10550516 3300025910 Bacteria 987
589 Ga0207684_10626499 3300025910 Bacteria 917
590 Ga0207654_10044067 3300025911 Bacteria 2532
591 Ga0207695_10000347 3300025913 Bacteria 107013
592 Ga0207671_10001460 3300025914 Bacteria 27305
593 Ga0207693_10000898 3300025915 Bacteria 26695
594 Ga0207693_10006516 3300025915 Bacteria 9662
595 Ga0207693_10008253 3300025915 Bacteria 8527
596 Ga0207693_10037532 3300025915 Bacteria 3819
597 Ga0207693_10095563 3300025915 Bacteria 2330
598 Ga0207693_10689661 3300025915 Bacteria 792
599 Ga0207663_10001824 3300025916 Bacteria 10047
600 Ga0207663_10017487 3300025916 Bacteria 3996
601 Ga0207663_10027262 3300025916 Bacteria 3327
602 Ga0207663_10105923 3300025916 Unclassified 1899
603 Ga0207663_10145373 3300025916 Bacteria 1657
604 Ga0207663_10267973 3300025916 Bacteria 1264
605 Ga0207662_10040450 3300025918 Bacteria 2741
606 Ga0207657_10009972 3300025919 Bacteria 9507
607 Ga0207646_10000165 3300025922 Bacteria 89540
608 Ga0207646_10000663 3300025922 Bacteria 44694
609 Ga0207646_10006466 3300025922 Bacteria 12098
610 Ga0207646_10006994 3300025922 Bacteria 11555
611 Ga0207646_10008284 3300025922 Bacteria 10435
612 Ga0207646_10011592 3300025922 Bacteria 8523
613 Ga0207646_10015133 3300025922 Bacteria 7298
614 Ga0207646_10021846 3300025922 Bacteria 5905
615 Ga0207646_10029826 3300025922 Bacteria 4952
616 Ga0207646_10030282 3300025922 Bacteria 4908
617 Ga0207646_10059603 3300025922 Bacteria 3409
618 Ga0207646_10084655 3300025922 Bacteria 2837
619 Ga0207646_10205860 3300025922 Bacteria 1777
620 Ga0207646_10497438 3300025922 Bacteria 1099
621 Ga0207646_10527683 3300025922 Bacteria 1063
622 Ga0207646_10666228 3300025922 Bacteria 932
623 Ga0207646_10804948 3300025922 Bacteria 837
624 Ga0207681_10026959 3300025923 Bacteria 3711
625 Ga0207681_10059934 3300025923 Bacteria 2610
626 Ga0207681_10419507 3300025923 Unclassified 1084
627 Ga0207694_10331642 3300025924 Bacteria 1257
628 Ga0207650_10083604 3300025925 Bacteria 2425
629 Ga0207659_10288409 3300025926 Bacteria 1344
630 Ga0207687_10142857 3300025927 Bacteria 1818
631 Ga0207700_10036148 3300025928 Bacteria 3564
632 Ga0207700_10084701 3300025928 Bacteria 2486
633 Ga0207700_10151733 3300025928 Bacteria 1915
634 Ga0207700_10186891 3300025928 Bacteria 1739
635 Ga0207700_10224733 3300025928 Bacteria 1593
636 Ga0207700_10775811 3300025928 Bacteria 857
637 Ga0207664_10086255 3300025929 Bacteria 2564
638 Ga0207664_10189227 3300025929 Bacteria 1771
639 Ga0207664_10685140 3300025929 Unclassified 922
640 Ga0207664_10903034 3300025929 Bacteria 793
641 Ga0207644_10067356 3300025931 Bacteria 2609
642 Ga0207644_10729361 3300025931 Bacteria 827
643 Ga0207706_10028247 3300025933 Bacteria 5010
644 Ga0207706_10406090 3300025933 Bacteria 1181
645 Ga0207706_10430626 3300025933 Unclassified 1142
646 Ga0207686_10361276 3300025934 Bacteria 1096
647 Ga0207709_10134917 3300025935 Bacteria 1688
648 Ga0207670_10019485 3300025936 Bacteria 4146
649 Ga0207670_10099245 3300025936 Bacteria 2077
650 Ga0207669_10130770 3300025937 Bacteria 1724
651 Ga0207704_10184947 3300025938 Bacteria 1509
652 Ga0207704_10879087 3300025938 Bacteria 753
653 Ga0207665_10000887 3300025939 Bacteria 20188
654 Ga0207665_10014732 3300025939 Bacteria 5143
655 Ga0207665_10045875 3300025939 Bacteria 2927
656 Ga0207665_10051130 3300025939 Unclassified 2781
657 Ga0207665_10059603 3300025939 Bacteria 2584
658 Ga0207665_10119703 3300025939 Bacteria 1859
659 Ga0207665_10121938 3300025939 Bacteria 1842
660 Ga0207665_10262680 3300025939 Bacteria 1279
661 Ga0207665_10306822 3300025939 Bacteria 1188
662 Ga0207665_10395603 3300025939 Bacteria 1051
663 Ga0207691_10360324 3300025940 Bacteria 1243
664 Ga0207711_10050722 3300025941 Bacteria 3552
665 Ga0207711_10744232 3300025941 Bacteria 914
666 Ga0207679_10357158 3300025945 Bacteria 1275
667 Ga0207679_10665272 3300025945 Bacteria 943
668 Ga0207667_10679476 3300025949 Bacteria 1033
669 Ga0207712_10189122 3300025961 Bacteria 1624
670 Ga0207712_10377086 3300025961 Bacteria 1186
671 Ga0207668_10017069 3300025972 Bacteria 4541
672 Ga0207668_10534655 3300025972 Unclassified 1013
673 Ga0207668_10826589 3300025972 Bacteria 821
674 Ga0207640_10031502 3300025981 Bacteria 3277
675 Ga0207640_10137884 3300025981 Bacteria 1774
676 Ga0207640_10270490 3300025981 Bacteria 1329
677 Ga0207658_10232312 3300025986 Bacteria 1558
678 Ga0207658_10300761 3300025986 Bacteria 1382
679 Ga0207658_10446389 3300025986 Bacteria 1144
680 Ga0207677_10266446 3300026023 Bacteria 1399
681 Ga0207677_10492097 3300026023 Bacteria 1059
682 Ga0207703_10176207 3300026035 Bacteria 1884
683 Ga0207639_10357378 3300026041 Bacteria 1306
684 Ga0207639_10719125 3300026041 Bacteria 927
685 Ga0207678_10002089 3300026067 Bacteria 18095
686 Ga0207678_10011677 3300026067 Bacteria 7713
687 Ga0207708_10015629 3300026075 Bacteria 5693
688 Ga0207708_10147078 3300026075 Bacteria 1852
689 Ga0207641_10009040 3300026088 Bacteria 8232
690 Ga0207648_10037907 3300026089 Bacteria 4243
691 Ga0207648_10043366 3300026089 Bacteria 3949
692 Ga0207648_10220721 3300026089 Bacteria 1685
693 Ga0207676_11060287 3300026095 Unclassified 800
694 Ga0207674_10018861 3300026116 Bacteria 7482
695 Ga0207675_100072478 3300026118 Bacteria 3222
696 Ga0207675_100203694 3300026118 Bacteria 1901
697 Ga0207675_100469956 3300026118 Bacteria 1248
698 Ga0207675_100577786 3300026118 Bacteria 1125
699 Ga0207675_101038825 3300026118 Bacteria 838
700 Ga0207683_10006916 3300026121 Bacteria 9711
701 Ga0207683_11175321 3300026121 Bacteria 711
702 Ga0207698_11125597 3300026142 Bacteria 798
703 Ga0209588_1000024 3300027671 Bacteria 86158
704 Ga0209588_1004440 3300027671 Bacteria 3954
705 Ga0209813_10123432 3300027866 Bacteria 904
706 Ga0207428_10016868 3300027907 Bacteria 6276
707 Ga0207428_10065007 3300027907 Bacteria 2879
708 Ga0265356_1000449 3300028017 Bacteria 7523
709 Ga0268266_10002394 3300028379 Bacteria 20226
710 Ga0268266_10031920 3300028379 Bacteria 4475
711 Ga0268266_10569836 3300028379 Unclassified 1086
712 Ga0268265_10086808 3300028380 Bacteria 2488
713 Ga0268264_10040316 3300028381 Bacteria 3859
714 Ga0268264_10111426 3300028381 Bacteria 2397
715 Ga0268264_10193494 3300028381 Unclassified 1855
716 Ga0268264_11025120 3300028381 Bacteria 832
717 Ga0265762_1001022 3300030760 Bacteria 5025
718 Ga0265762_1002005 3300030760 Bacteria 3707
719 Ga0265763_1000002 3300030763 Bacteria 10269
720 Ga0265763_1007364 3300030763 Bacteria 964
721 Ga0265773_1002492 3300031018 Bacteria 1121
722 Ga0265760_10001288 3300031090 Bacteria 7325
723 Ga0265760_10109242 3300031090 Bacteria 880
724 Ga0307510_10275516 3300033180 Bacteria 1156
725 Ga0373950_0016769 3300034818 Bacteria 1256
726 Ga0373926_0075173 3300035083 Bacteria 1245
727 Ga0373926_0216179 3300035083 Bacteria 739
728 Ga0373940_0125668 3300035088 Bacteria 799
729 Ga0373951_0064816 3300035091 Bacteria 921
730 Ga0373951_0122752 3300035091 Bacteria 708
731 Ga0373931_0575102 3300035691 Bacteria 734
732 Ga0373931_0609514 3300035691 Bacteria 714
733 Ga0373927_0053694 3300035695 Bacteria 2607
734 Ga0373927_0552959 3300035695 Bacteria 761
735 Ga0373947_0186141 3300035725 Bacteria 1354
736 Ga0373937_0041832 3300036401 Bacteria 4181
737 Ga0372808_025127 3300036459 Bacteria 855
738 Ga0395900_0112472 3300037418 Bacteria 2796
739 Ga0400483_083970 3300039062 Bacteria 12648
740 Ga0400483_108458 3300039062 Bacteria 2257
741 Ga0451577_0153436 3300042876 Bacteria 2072
742 Ga0453683_0000258 3300044673 Bacteria 69739
743 Ga0453683_0006130 3300044673 Bacteria 8285
744 Ga0453683_0011802 3300044673 Bacteria 5751
745 Ga0453683_0032817 3300044673 Bacteria 3273
746 Ga0453683_0080866 3300044673 Bacteria 2035
747 Ga0453683_0150096 3300044673 Bacteria 1472
748 Ga0453683_0234905 3300044673 Bacteria 1167
749 Ga0453683_0329663 3300044673 Bacteria 979
750 Ga0453684_0046569 3300044712 Bacteria 5766
751 Ga0453684_0320630 3300044712 Bacteria 1755
752 Ga0453684_0378649 3300044712 Bacteria 1590
753 Ga0466968_0097739 3300044735 Bacteria 1308
754 Ga0451576_0033734 3300045051 Bacteria 5439
755 Ga0451576_0055389 3300045051 Bacteria 4149
756 Ga0451576_0108565 3300045051 Bacteria 2887
757 Ga0495590_0041523 3300046457 Bacteria 1604
758 Ga0495629_0243094 3300046459 Bacteria 1239
759 Ga0495651_0394046 3300046462 Unclassified 905
760 Ga0495580_0078824 3300046472 Bacteria 2298
761 Ga0495580_0141575 3300046472 Bacteria 1667
762 Ga0495582_0367625 3300046473 Bacteria 828
763 Ga0495605_0000749 3300046474 Bacteria 23822
764 Ga0495605_0269777 3300046474 Bacteria 725
765 Ga0495664_0173357 3300046477 Bacteria 1308
766 Ga0495584_0037238 3300046491 Bacteria 2458
767 Ga0495584_0042612 3300046491 Bacteria 2291
768 Ga0495594_0137711 3300046499 Bacteria 1384
769 Ga0495606_0009794 3300046507 Bacteria 8052
770 Ga0495608_0067086 3300046511 Bacteria 2348
771 Ga0495618_0042290 3300046514 Bacteria 2872
772 Ga0495628_0242951 3300046516 Bacteria 1346
773 Ga0495630_0098949 3300046517 Bacteria 2206
774 Ga0495630_0565111 3300046517 Bacteria 872
775 Ga0495631_0116266 3300046518 Bacteria 1150
776 Ga0495632_0206032 3300046519 Bacteria 894
777 Ga0495663_0206691 3300046525 Bacteria 687
778 Ga0495642_0154502 3300046528 Bacteria 994
779 Ga0495665_0157712 3300046531 Bacteria 1183
780 Ga0495640_0056854 3300046533 Bacteria 2671
781 Ga0495609_0190288 3300046538 Bacteria 861
782 Ga0495645_0067270 3300046543 Bacteria 2587
783 Ga0495633_0142795 3300046558 Bacteria 1107
784 Ga0495634_0040100 3300046642 Bacteria 3187
785 Ga0495635_0630366 3300046663 Bacteria 698
786 Ga0495635_0651942 3300046663 Unclassified 685
787 Ga0495659_0053397 3300046664 Bacteria 1477
788 Ga0495659_0162846 3300046664 Bacteria 901
789 Ga0495599_0089005 3300046678 Bacteria 1927
790 Ga0495646_0339900 3300046680 Bacteria 788
791 Ga0495669_0359874 3300046684 Bacteria 704
792 Ga0495613_0202390 3300046689 Bacteria 1399
793 Ga0495613_0217992 3300046689 Bacteria 1340
794 Ga0495624_0385143 3300046690 Bacteria 842
795 Ga0495624_0482935 3300046690 Bacteria 742
796 Ga0495670_0399061 3300046691 Bacteria 743
797 Ga0495660_0220296 3300046810 Bacteria 895
798 Ga0495660_0282831 3300046810 Bacteria 758
799 Ga0495581_0082110 3300047315 Bacteria 1867
800 Ga0495636_0178267 3300047318 Bacteria 963
801 Ga0495636_0250903 3300047318 Bacteria 818
802 Ga0495674_0064432 3300047319 Bacteria 3186
803 Ga0495674_0085525 3300047319 Bacteria 2701
804 Ga0495672_0364999 3300047320 Bacteria 667
805 Ga0495673_0067809 3300047469 Bacteria 1509
806 Ga0495684_0037983 3300047471 Bacteria 3693
807 Ga0496100_0007168 3300048903 Bacteria 6125
808 Ga0496100_0390539 3300048903 Bacteria 1058
809 Ga0496101_0224338 3300048904 Bacteria 1459
810 Ga0496101_0597398 3300048904 Bacteria 873
811 Ga0496102_0141169 3300048905 Unclassified 2259
812 Ga0496102_0175044 3300048905 Bacteria 2020
813 Ga0496102_0193307 3300048905 Bacteria 1918
814 Ga0496102_0199132 3300048905 Unclassified 1888
815 Ga0496102_0956093 3300048905 Unclassified 778
816 Ga0496104_0000339 3300048907 Bacteria 41808
817 Ga0496104_0008489 3300048907 Bacteria 9135
818 Ga0496104_0034057 3300048907 Bacteria 4748
819 Ga0496104_0050418 3300048907 Bacteria 3928
820 Ga0496104_0076052 3300048907 Bacteria 3197
821 Ga0496105_0002897 3300048908 Bacteria 12589
822 Ga0496105_0006320 3300048908 Bacteria 9101
823 Ga0496105_0111260 3300048908 Bacteria 2260
824 Ga0496106_0037970 3300048909 Bacteria 3603
825 Ga0496106_0385457 3300048909 Bacteria 1126
826 Ga0496106_0626156 3300048909 Unclassified 861
827 Ga0496107_0032183 3300048910 Bacteria 3747
828 Ga0496107_0393475 3300048910 Bacteria 1031
829 Ga0496107_0765576 3300048910 Bacteria 708
830 Ga0496107_0817709 3300048910 Bacteria 682
831 Ga0496108_0033772 3300048911 Bacteria 4249
832 Ga0496108_0040429 3300048911 Bacteria 3887
833 Ga0496108_0395786 3300048911 Bacteria 1207
834 Ga0496108_0880321 3300048911 Bacteria 769
835 Ga0496108_0901547 3300048911 Bacteria 759
836 Ga0496109_0000191 3300048912 Bacteria 61025
837 Ga0496109_0077982 3300048912 Bacteria 3049
838 Ga0496109_0109696 3300048912 Bacteria 2565
839 Ga0496110_0014344 3300048913 Bacteria 6575
840 Ga0496110_0063097 3300048913 Bacteria 3273
841 Ga0496110_0093278 3300048913 Bacteria 2695
842 Ga0496110_1062316 3300048913 Bacteria 717
843 Ga0496111_0016400 3300048914 Bacteria 5103
844 Ga0496111_0089040 3300048914 Bacteria 2260
845 Ga0496111_0145166 3300048914 Bacteria 1759
846 Ga0496112_0081626 3300048915 Bacteria 3197
847 Ga0496112_0296383 3300048915 Unclassified 1563
848 Ga0496112_0547969 3300048915 Bacteria 1090
849 Ga0496113_0071636 3300048916 Bacteria 2636
850 Ga0496113_0089240 3300048916 Bacteria 2372
851 Ga0496113_0193187 3300048916 Bacteria 1616
852 Ga0496113_0298504 3300048916 Bacteria 1290
853 Ga0496113_0389564 3300048916 Bacteria 1118
854 Ga0496113_0470367 3300048916 Bacteria 1010
855 Ga0496114_0000527 3300048917 Bacteria 28173
856 Ga0496114_0058277 3300048917 Bacteria 3225
857 Ga0496114_0349343 3300048917 Bacteria 1308
858 Ga0496115_0020011 3300048918 Bacteria 5157
859 Ga0496115_0028961 3300048918 Unclassified 4345
860 Ga0496115_0080307 3300048918 Bacteria 2655
861 Ga0496115_0096450 3300048918 Bacteria 2421
862 Ga0496115_0100313 3300048918 Bacteria 2373
863 Ga0496115_0132347 3300048918 Bacteria 2056
864 Ga0496115_0138419 3300048918 Bacteria 2008
865 Ga0496115_0148030 3300048918 Bacteria 1938
866 Ga0496115_0260607 3300048918 Bacteria 1426
867 Ga0496115_0295940 3300048918 Bacteria 1327
868 Ga0496115_0500395 3300048918 Bacteria 977
869 Ga0496115_0694642 3300048918 Bacteria 800
870 Ga0496117_0010943 3300048920 Bacteria 8176
871 Ga0496118_0009623 3300048921 Bacteria 9727
872 Ga0496118_0082947 3300048921 Bacteria 2243
873 Ga0496119_0072377 3300048922 Bacteria 2014
874 Ga0496121_0000245 3300048924 Bacteria 116316
875 Ga0496121_0011345 3300048924 Bacteria 9909
876 Ga0496122_0000043 3300048925 Bacteria 280333
877 Ga0496123_0000090 3300048926 Bacteria 179735
878 Ga0496123_0114209 3300048926 Bacteria 1536
879 Ga0496123_0160171 3300048926 Bacteria 1201
880 Ga0496125_0051918 3300048928 Bacteria 3377
881 Ga0496126_0005254 3300048929 Bacteria 14879
882 Ga0496126_0040027 3300048929 Bacteria 4346
883 Ga0496126_0137305 3300048929 Bacteria 2108
884 Ga0496126_0439338 3300048929 Bacteria 1052
885 nmdc:mga00v17_339830_c1 3300050491 Bacteria 976
886 nmdc:mga0yw44_128213_c1 3300050492 Unclassified 1640
887 nmdc:mga0k408_169626_c1 3300050493 Bacteria 1301
888 nmdc:mga07m45_7474_c1 3300050496 Bacteria 5586
889 nmdc:mga05p37_103593_c2 3300050507 Bacteria 3069
890 nmdc:mga05p37_10_c1 3300050507 Bacteria 113461
891 nmdc:mga05p37_11608_c1 3300050507 Bacteria 10498
892 nmdc:mga05p37_116479_c1 3300050507 Bacteria 2559
893 nmdc:mga05p37_1238_c1 3300050507 Bacteria 29628
894 nmdc:mga05p37_1315154_c1 3300050507 Bacteria 736
895 nmdc:mga05p37_13336_c1 3300050507 Bacteria 9846
896 nmdc:mga05p37_13888_c1 3300050507 Bacteria 9652
897 nmdc:mga05p37_155369_c1 3300050507 Bacteria 2796
898 nmdc:mga05p37_169056_c1 3300050507 Bacteria 2667
899 nmdc:mga05p37_208979_c1 3300050507 Bacteria 2360
900 nmdc:mga05p37_21714_c1 3300050507 Bacteria 7776
901 nmdc:mga05p37_2264_c1 3300050507 Bacteria 22435
902 nmdc:mga05p37_260198_c1 3300050507 Bacteria 2077
903 nmdc:mga05p37_284012_c1 3300050507 Bacteria 1973
904 nmdc:mga05p37_29334_c1 3300050507 Bacteria 6714
905 nmdc:mga05p37_2985_c1 3300050507 Bacteria 19650
906 nmdc:mga05p37_308166_c1 3300050507 Bacteria 1878
907 nmdc:mga05p37_352059_c1 3300050507 Bacteria 1734
908 nmdc:mga05p37_352769_c1 3300050507 Bacteria 1732
909 nmdc:mga05p37_37533_c1 3300050507 Bacteria 5941
910 nmdc:mga05p37_38691_c1 3300050507 Bacteria 5853
911 nmdc:mga05p37_441644_c1 3300050507 Bacteria 1509
912 nmdc:mga05p37_461039_c1 3300050507 Unclassified 1469
913 nmdc:mga05p37_491_c1 3300050507 Bacteria 43356
914 nmdc:mga05p37_511488_c1 3300050507 Bacteria 1376
915 nmdc:mga05p37_527792_c1 3300050507 Bacteria 912
916 nmdc:mga05p37_554389_c1 3300050507 Bacteria 1307
917 nmdc:mga05p37_58271_c1 3300050507 Bacteria 4757
918 nmdc:mga05p37_708888_c1 3300050507 Bacteria 1116
919 nmdc:mga05p37_720571_c1 3300050507 Bacteria 1105
920 nmdc:mga05p37_79_c1 3300050507 Bacteria 85182
921 nmdc:mga05p37_876178_c1 3300050507 Bacteria 971
922 nmdc:mga05p37_991_c1 3300050507 Bacteria 32378
923 nmdc:mga09592_11547_c1 3300050508 Bacteria 7185
924 nmdc:mga09592_14031_c1 3300050508 Bacteria 6541
925 nmdc:mga09592_170190_c1 3300050508 Bacteria 1884
926 nmdc:mga09592_172832_c1 3300050508 Bacteria 1868
927 nmdc:mga09592_256747_c1 3300050508 Unclassified 1515
928 nmdc:mga09592_305656_c1 3300050508 Bacteria 1379
929 nmdc:mga09592_370636_c1 3300050508 Bacteria 1238
930 nmdc:mga09592_433519_c1 3300050508 Bacteria 1135
931 nmdc:mga09592_507597_c1 3300050508 Bacteria 1038
932 nmdc:mga09592_687080_c1 3300050508 Unclassified 872
933 nmdc:mga09592_75905_c1 3300050508 Bacteria 2858
934 nmdc:mga0qj67_339787_c1 3300050509 Bacteria 1214
935 nmdc:mga0qj67_35067_c1 3300050509 Bacteria 3922
936 nmdc:mga0qj67_377543_c1 3300050509 Unclassified 1145
937 nmdc:mga0qj67_413768_c1 3300050509 Bacteria 1087
938 nmdc:mga0qj67_487064_c1 3300050509 Bacteria 992
939 nmdc:mga0qj67_52444_c1 3300050509 Bacteria 3228
940 nmdc:mga0qj67_7248_c1 3300050509 Bacteria 8193
941 nmdc:mga06r32_101683_c1 3300050510 Bacteria 2821
942 nmdc:mga06r32_176367_c1 3300050510 Bacteria 2122
943 nmdc:mga06r32_176801_c1 3300050510 Bacteria 2119
944 nmdc:mga06r32_202958_c1 3300050510 Bacteria 1970
945 nmdc:mga06r32_21017_c1 3300050510 Bacteria 6021
946 nmdc:mga06r32_283685_c1 3300050510 Bacteria 1643
947 nmdc:mga06r32_312514_c1 3300050510 Bacteria 1557
948 nmdc:mga06r32_354590_c1 3300050510 Bacteria 1451
949 nmdc:mga06r32_45076_c1 3300050510 Bacteria 4202
950 nmdc:mga06r32_653011_c1 3300050510 Bacteria 1020
951 nmdc:mga06r32_6852_c1 3300050510 Bacteria 10241
952 nmdc:mga08y16_1318648_c1 3300050511 Bacteria 688
953 nmdc:mga08y16_200287_c1 3300050511 Bacteria 2069
954 nmdc:mga08y16_463068_c1 3300050511 Unclassified 1292
955 nmdc:mga08y16_572158_c1 3300050511 Bacteria 1141
956 nmdc:mga08y16_594252_c1 3300050511 Bacteria 1116
957 nmdc:mga08y16_741248_c1 3300050511 Unclassified 979
958 nmdc:mga08y16_78900_c1 3300050511 Bacteria 3432
959 nmdc:mga08y16_872464_c1 3300050511 Bacteria 888
960 nmdc:mga08y16_89545_c1 3300050511 Bacteria 3207
961 nmdc:mga08y16_9772_c1 3300050511 Bacteria 10075
962 nmdc:mga0n895_10664_c1 3300050512 Bacteria 8138
963 nmdc:mga0n895_1123_c1 3300050512 Bacteria 19550
964 nmdc:mga0n895_127369_c1 3300050512 Bacteria 2570
965 nmdc:mga0n895_129603_c1 3300050512 Bacteria 2547
966 nmdc:mga0n895_1338814_c1 3300050512 Bacteria 686
967 nmdc:mga0n895_172180_c1 3300050512 Bacteria 2197
968 nmdc:mga0n895_177204_c1 3300050512 Bacteria 2163
969 nmdc:mga0n895_194258_c1 3300050512 Bacteria 2061
970 nmdc:mga0n895_22284_c1 3300050512 Bacteria 5939
971 nmdc:mga0n895_233540_c1 3300050512 Bacteria 1867
972 nmdc:mga0n895_266001_c1 3300050512 Bacteria 1740
973 nmdc:mga0n895_31868_c1 3300050512 Bacteria 5053
974 nmdc:mga0n895_332683_c1 3300050512 Bacteria 1539
975 nmdc:mga0n895_344847_c1 3300050512 Bacteria 1509
976 nmdc:mga0n895_368247_c1 3300050512 Bacteria 1455
977 nmdc:mga0n895_39905_c1 3300050512 Bacteria 4559
978 nmdc:mga0n895_403302_c1 3300050512 Bacteria 1383
979 nmdc:mga0n895_42084_c1 3300050512 Bacteria 4444
980 nmdc:mga0n895_453875_c1 3300050512 Unclassified 1294
981 nmdc:mga0n895_482075_c1 3300050512 Bacteria 1251
982 nmdc:mga0n895_486897_c1 3300050512 Bacteria 1244
983 nmdc:mga0n895_517578_c1 3300050512 Bacteria 1201
984 nmdc:mga0n895_585369_c1 3300050512 Bacteria 1119
985 nmdc:mga0n895_623932_c1 3300050512 Bacteria 1079
986 nmdc:mga0n895_645233_c1 3300050512 Bacteria 1058
987 nmdc:mga0n895_700_c1 3300050512 Bacteria 23549
988 nmdc:mga0n895_716247_c1 3300050512 Bacteria 996
989 nmdc:mga0n895_86186_c1 3300050512 Bacteria 3137
990 nmdc:mga0n895_97034_c1 3300050512 Unclassified 2953
991 nmdc:mga0rr50_124979_c1 3300050513 Bacteria 2053
992 nmdc:mga0rr50_1261_c1 3300050513 Bacteria 13788
993 nmdc:mga0rr50_129763_c1 3300050513 Bacteria 2017
994 nmdc:mga0rr50_154421_c1 3300050513 Bacteria 1858
995 nmdc:mga0rr50_162833_c1 3300050513 Bacteria 1812
996 nmdc:mga0rr50_189173_c1 3300050513 Bacteria 1686
997 nmdc:mga0rr50_198472_c1 3300050513 Bacteria 1648
998 nmdc:mga0rr50_255069_c1 3300050513 Bacteria 1458
999 nmdc:mga0rr50_2634_c1 3300050513 Bacteria 10164
1000 nmdc:mga0rr50_29527_c1 3300050513 Bacteria 3869
1001 nmdc:mga0rr50_30672_c1 3300050513 Bacteria 3810
1002 nmdc:mga0rr50_328189_c1 3300050513 Bacteria 1284
1003 nmdc:mga0rr50_339854_c1 3300050513 Bacteria 1261
1004 nmdc:mga0rr50_404737_c1 3300050513 Bacteria 1153
1005 nmdc:mga0rr50_411500_c1 3300050513 Unclassified 1143
1006 nmdc:mga0rr50_418565_c1 3300050513 Bacteria 1133
1007 nmdc:mga0rr50_420213_c1 3300050513 Bacteria 1131
1008 nmdc:mga0rr50_4367_c1 3300050513 Bacteria 8304
1009 nmdc:mga0rr50_5505_c1 3300050513 Bacteria 7562
1010 nmdc:mga0rr50_573584_c1 3300050513 Bacteria 961
1011 nmdc:mga0rr50_589072_c1 3300050513 Bacteria 948
1012 nmdc:mga0rr50_68445_c1 3300050513 Bacteria 2360
1013 nmdc:mga0rr50_753288_c1 3300050513 Bacteria 831
1014 nmdc:mga0rr50_9648_c1 3300050513 Bacteria 6084
1015 nmdc:mga08x19_13343_c1 3300050514 Bacteria 4965
1016 nmdc:mga08x19_1479_c1 3300050514 Bacteria 14556
1017 nmdc:mga08x19_148088_c1 3300050514 Bacteria 1588
1018 nmdc:mga08x19_193062_c1 3300050514 Bacteria 1394
1019 nmdc:mga08x19_204887_c1 3300050514 Bacteria 1353
1020 nmdc:mga08x19_219599_c1 3300050514 Bacteria 1306
1021 nmdc:mga08x19_220521_c1 3300050514 Bacteria 1303
1022 nmdc:mga08x19_225258_c1 3300050514 Bacteria 1289
1023 nmdc:mga08x19_232105_c1 3300050514 Bacteria 1270
1024 nmdc:mga08x19_256775_c1 3300050514 Bacteria 1207
1025 nmdc:mga08x19_272945_c1 3300050514 Bacteria 1170
1026 nmdc:mga08x19_3476_c1 3300050514 Bacteria 9387
1027 nmdc:mga08x19_450771_c1 3300050514 Unclassified 906
1028 nmdc:mga08x19_45717_c1 3300050514 Bacteria 2798
1029 nmdc:mga08x19_633567_c1 3300050514 Bacteria 758
1030 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
1031 nmdc:mga0a205_143966_c1 3300050515 Bacteria 2284
1032 nmdc:mga0a205_152988_c1 3300050515 Bacteria 2206
1033 nmdc:mga0a205_173009_c1 3300050515 Bacteria 2055
1034 nmdc:mga0a205_18021_c1 3300050515 Bacteria 6631
1035 nmdc:mga0a205_187531_c1 3300050515 Bacteria 1961
1036 nmdc:mga0a205_19381_c1 3300050515 Bacteria 6412
1037 nmdc:mga0a205_204353_c1 3300050515 Bacteria 1865
1038 nmdc:mga0a205_222345_c1 3300050515 Bacteria 1773
1039 nmdc:mga0a205_241335_c1 3300050515 Bacteria 1688
1040 nmdc:mga0a205_285366_c1 3300050515 Bacteria 1526
1041 nmdc:mga0a205_3019_c1 3300050515 Bacteria 14915
1042 nmdc:mga0a205_302010_c1 3300050515 Bacteria 1474
1043 nmdc:mga0a205_343167_c1 3300050515 Bacteria 1362
1044 nmdc:mga0a205_3796_c2 3300050515 Bacteria 12079
1045 nmdc:mga0a205_42037_c1 3300050515 Bacteria 4404
1046 nmdc:mga0a205_42924_c1 3300050515 Bacteria 4359
1047 nmdc:mga0a205_443829_c1 3300050515 Bacteria 1158
1048 nmdc:mga0a205_457504_c1 3300050515 Unclassified 1136
1049 nmdc:mga0a205_4777_c1 3300050515 Bacteria 12170
1050 nmdc:mga0a205_488759_c1 3300050515 Bacteria 1088
1051 nmdc:mga0a205_54934_c1 3300050515 Bacteria 3846
1052 nmdc:mga0a205_598624_c1 3300050515 Bacteria 956
1053 nmdc:mga0a205_659212_c1 3300050515 Bacteria 898
1054 nmdc:mga0a205_6966_c1 3300050515 Bacteria 10226
1055 nmdc:mga0a205_704444_c1 3300050515 Bacteria 859
1056 nmdc:mga0a205_758506_c1 3300050515 Bacteria 819
1057 nmdc:mga0a205_76307_c1 3300050515 Bacteria 3239
1058 nmdc:mga0a205_88431_c1 3300050515 Bacteria 2994
1059 nmdc:mga0sz30_310680_c1 3300050516 Unclassified 703
1060 Ga0495601_0125076 3300053077 Bacteria 1672
1061 Ga0495612_0102120 3300053078 Unclassified 1222
1062 Ga0495595_0107367 3300053084 Bacteria 1351
1063 Ga0495619_0050521 3300053085 Bacteria 2745
1064 Ga0500618_001429 3300053125 Bacteria 10652

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100011819 Ga0070708_1000118192 191
2 3300009176 Ga0105242_10593919 Ga0105242_105939192 197
3 3300003323 rootH1_10077686 rootH1_100776863 201
4 3300005467 Ga0070706_100214579 Ga0070706_1002145792 201
5 3300005468 Ga0070707_100675305 Ga0070707_1006753052 201
6 3300031090 Ga0265760_10109242 Ga0265760_101092421 202
7 3300003354 JGI25160J50197_1032623 JGI25160J50197_10326232 203
8 3300003775 Ga0055524_1000017 Ga0055524_1000017156 203
9 3300005262 Ga0065165_1001283 Ga0065165_10012839 203
10 3300025263 Ga0209565_1002595 Ga0209565_10025956 203
11 3300025295 Ga0209564_1020233 Ga0209564_10202334 203
12 3300025297 Ga0209758_1001241 Ga0209758_100124126 203
13 3300025299 Ga0209256_1000018 Ga0209256_1000018322 203
14 3300025302 Ga0207426_1001703 Ga0207426_10017038 203
15 3300050511 nmdc:mga08y16_572158_c1 nmdc:mga08y16_572158_c1_473_1084 203
16 3300003771 Ga0055526_1008793 Ga0055526_10087934 204
17 3300009147 Ga0114129_10727537 Ga0114129_107275372 204
18 3300025295 Ga0209564_1002021 Ga0209564_10020214 204
19 3300044673 Ga0453683_0150096 Ga0453683_0150096_42_656 204
20 3300050507 nmdc:mga05p37_527792_c1 nmdc:mga05p37_527792_c1_62_676 204
21 3300050512 nmdc:mga0n895_517578_c1 nmdc:mga0n895_517578_c1_288_962 204
22 3300002774 JGI25150J39212_1000044 JGI25150J39212_100004447 205
23 3300002774 JGI25150J39212_1000132 JGI25150J39212_100013216 205
24 3300002987 JGI25159J45721_1016594 JGI25159J45721_10165941 205
25 3300003187 JGI25151J46595_10021401 JGI25151J46595_100214013 205
26 3300003215 JGI25153J46596_10000043 JGI25153J46596_1000004324 205
27 3300003215 JGI25153J46596_10000265 JGI25153J46596_1000026516 205
28 3300003316 rootH1_10042237 rootH1_100422373 205
29 3300003323 rootH1_10016176 rootH1_100161762 205
30 3300003659 JGI25404J52841_10028741 JGI25404J52841_100287411 205
31 3300003771 Ga0055526_1043098 Ga0055526_10430981 205
32 3300003773 Ga0055537_1000553 Ga0055537_100055311 205
33 3300003781 Ga0055536_1000393 Ga0055536_10003933 205
34 3300003791 Ga0055530_10009972 Ga0055530_100099723 205
35 3300003792 Ga0055540_1041615 Ga0055540_10416152 205
36 3300003794 Ga0055531_10000805 Ga0055531_1000080522 205
37 3300003794 Ga0055531_10002275 Ga0055531_1000227511 205
38 3300005262 Ga0065165_1011885 Ga0065165_10118851 205
39 3300005337 Ga0070682_100080519 Ga0070682_1000805192 205
40 3300005337 Ga0070682_100598915 Ga0070682_1005989151 205
41 3300005344 Ga0070661_100288636 Ga0070661_1002886362 205
42 3300005347 Ga0070668_100836728 Ga0070668_1008367281 205
43 3300005436 Ga0070713_100027663 Ga0070713_1000276635 205
44 3300005437 Ga0070710_10012689 Ga0070710_100126892 205
45 3300005439 Ga0070711_100042018 Ga0070711_1000420184 205
46 3300005455 Ga0070663_100011764 Ga0070663_1000117643 205
47 3300005539 Ga0068853_100231603 Ga0068853_1002316032 205
48 3300005548 Ga0070665_100005888 Ga0070665_1000058883 205
49 3300005564 Ga0070664_100211057 Ga0070664_1002110572 205
50 3300005578 Ga0068854_100049570 Ga0068854_1000495701 205
51 3300005578 Ga0068854_100523771 Ga0068854_1005237712 205
52 3300005719 Ga0068861_100271996 Ga0068861_1002719962 205
53 3300005983 Ga0081540_1000494 Ga0081540_100049424 205
54 3300005983 Ga0081540_1052217 Ga0081540_10522172 205
55 3300006038 Ga0075365_10141022 Ga0075365_101410222 205
56 3300006042 Ga0075368_10013725 Ga0075368_100137253 205
57 3300006048 Ga0075363_100000487 Ga0075363_1000004878 205
58 3300006051 Ga0075364_10048714 Ga0075364_100487142 205
59 3300006051 Ga0075364_10536748 Ga0075364_105367481 205
60 3300006175 Ga0070712_100003950 Ga0070712_1000039503 205
61 3300006175 Ga0070712_100709512 Ga0070712_1007095121 205
62 3300006178 Ga0075367_10177329 Ga0075367_101773292 205
63 3300006353 Ga0075370_10011330 Ga0075370_100113301 205
64 3300006358 Ga0068871_100273776 Ga0068871_1002737762 205
65 3300009036 Ga0105244_10005771 Ga0105244_100057715 205
66 3300009093 Ga0105240_10663574 Ga0105240_106635741 205
67 3300009545 Ga0105237_10000964 Ga0105237_1000096430 205
68 3300009551 Ga0105238_10426422 Ga0105238_104264222 205
69 3300010375 Ga0105239_10000025 Ga0105239_10000025110 205
70 3300021320 Ga0214544_1000424 Ga0214544_100042475 205
71 3300021321 Ga0214542_1000412 Ga0214542_100041275 205
72 3300021324 Ga0214545_1000242 Ga0214545_100024275 205
73 3300021327 Ga0214543_1000327 Ga0214543_100032712 205
74 3300025245 Ga0207425_1000037 Ga0207425_1000037169 205
75 3300025245 Ga0207425_1000047 Ga0207425_1000047126 205
76 3300025258 Ga0209129_1000378 Ga0209129_100037822 205
77 3300025258 Ga0209129_1000480 Ga0209129_10004807 205
78 3300025263 Ga0209565_1000062 Ga0209565_100006287 205
79 3300025263 Ga0209565_1037884 Ga0209565_10378841 205
80 3300025284 Ga0209130_1000318 Ga0209130_100031837 205
81 3300025292 Ga0209676_1000291 Ga0209676_100029112 205
82 3300025292 Ga0209676_1001816 Ga0209676_10018163 205
83 3300025294 Ga0209025_1000117 Ga0209025_10001173 205
84 3300025294 Ga0209025_1000150 Ga0209025_100015024 205
85 3300025294 Ga0209025_1045233 Ga0209025_10452332 205
86 3300025295 Ga0209564_1013326 Ga0209564_10133261 205
87 3300025297 Ga0209758_1000009 Ga0209758_1000009854 205
88 3300025297 Ga0209758_1000103 Ga0209758_1000103169 205
89 3300025298 Ga0209050_1000327 Ga0209050_1000327107 205
90 3300025298 Ga0209050_1002490 Ga0209050_100249012 205
91 3300025298 Ga0209050_1003020 Ga0209050_10030203 205
92 3300025302 Ga0207426_1000512 Ga0207426_100051237 205
93 3300025302 Ga0207426_1030352 Ga0207426_10303523 205
94 3300025303 Ga0209051_1017824 Ga0209051_10178243 205
95 3300025304 Ga0209257_1000345 Ga0209257_10003458 205
96 3300025304 Ga0209257_1001353 Ga0209257_10013536 205
97 3300025898 Ga0207692_10651571 Ga0207692_106515711 205
98 3300025913 Ga0207695_10000347 Ga0207695_1000034711 205
99 3300025914 Ga0207671_10001460 Ga0207671_1000146011 205
100 3300025915 Ga0207693_10008253 Ga0207693_100082531 205
101 3300025915 Ga0207693_10689661 Ga0207693_106896612 205
102 3300025916 Ga0207663_10145373 Ga0207663_101453732 205
103 3300025924 Ga0207694_10331642 Ga0207694_103316421 205
104 3300025928 Ga0207700_10084701 Ga0207700_100847013 205
105 3300025931 Ga0207644_10729361 Ga0207644_107293611 205
106 3300025945 Ga0207679_10665272 Ga0207679_106652721 205
107 3300025972 Ga0207668_10826589 Ga0207668_108265891 205
108 3300025981 Ga0207640_10031502 Ga0207640_100315021 205
109 3300026041 Ga0207639_10719125 Ga0207639_107191251 205
110 3300026067 Ga0207678_10002089 Ga0207678_1000208915 205
111 3300026142 Ga0207698_11125597 Ga0207698_111255971 205
112 3300027866 Ga0209813_10123432 Ga0209813_101234322 205
113 3300028379 Ga0268266_10002394 Ga0268266_1000239417 205
114 3300037418 Ga0395900_0112472 Ga0395900_0112472_215_832 205
115 3300039062 Ga0400483_083970 Ga0400483_083970_4339_4956 205
116 3300044735 Ga0466968_0097739 Ga0466968_0097739_296_958 205
117 3300046474 Ga0495605_0000749 Ga0495605_0000749_4427_5044 205
118 3300046507 Ga0495606_0009794 Ga0495606_0009794_5448_6065 205
119 3300046810 Ga0495660_0220296 Ga0495660_0220296_140_757 205
120 3300046810 Ga0495660_0282831 Ga0495660_0282831_41_658 205
121 3300047320 Ga0495672_0364999 Ga0495672_0364999_39_656 205
122 3300047469 Ga0495673_0067809 Ga0495673_0067809_572_1189 205
123 3300048905 Ga0496102_0193307 Ga0496102_0193307_710_1327 205
124 3300048907 Ga0496104_0050418 Ga0496104_0050418_1657_2274 205
125 3300048910 Ga0496107_0765576 Ga0496107_0765576_47_664 205
126 3300048916 Ga0496113_0193187 Ga0496113_0193187_194_811 205
127 3300048918 Ga0496115_0080307 Ga0496115_0080307_1536_2153 205
128 3300048918 Ga0496115_0500395 Ga0496115_0500395_210_839 205
129 3300048921 Ga0496118_0082947 Ga0496118_0082947_809_1426 205
130 3300048924 Ga0496121_0000245 Ga0496121_0000245_28731_29360 205
131 3300048924 Ga0496121_0011345 Ga0496121_0011345_5668_6285 205
132 3300048925 Ga0496122_0000043 Ga0496122_0000043_162883_163500 205
133 3300048926 Ga0496123_0000090 Ga0496123_0000090_116827_117444 205
134 3300048926 Ga0496123_0114209 Ga0496123_0114209_898_1515 205
135 3300048926 Ga0496123_0160171 Ga0496123_0160171_564_1181 205
136 3300048929 Ga0496126_0005254 Ga0496126_0005254_11619_12248 205
137 3300048929 Ga0496126_0137305 Ga0496126_0137305_1000_1617 205
138 3300048929 Ga0496126_0439338 Ga0496126_0439338_31_648 205
139 3300050491 nmdc:mga00v17_339830_c1 nmdc:mga00v17_339830_c1_302_919 205
140 3300050492 nmdc:mga0yw44_128213_c1 nmdc:mga0yw44_128213_c1_368_985 205
141 3300050493 nmdc:mga0k408_169626_c1 nmdc:mga0k408_169626_c1_243_860 205
142 3300050496 nmdc:mga07m45_7474_c1 nmdc:mga07m45_7474_c1_1578_2195 205
143 3300050512 nmdc:mga0n895_42084_c1 nmdc:mga0n895_42084_c1_1765_2496 205
144 3300050512 nmdc:mga0n895_585369_c1 nmdc:mga0n895_585369_c1_364_987 205
145 3300050515 nmdc:mga0a205_704444_c1 nmdc:mga0a205_704444_c1_55_672 205
146 3300050515 nmdc:mga0a205_758506_c1 nmdc:mga0a205_758506_c1_58_675 205
147 3300050516 nmdc:mga0sz30_310680_c1 nmdc:mga0sz30_310680_c1_71_688 205
148 3300006844 Ga0075428_100219793 Ga0075428_1002197933 206
149 3300006844 Ga0075428_100573948 Ga0075428_1005739481 206
150 3300006847 Ga0075431_100557529 Ga0075431_1005575292 206
151 3300006852 Ga0075433_10127900 Ga0075433_101279002 206
152 3300006852 Ga0075433_10801193 Ga0075433_108011931 206
153 3300006871 Ga0075434_100161118 Ga0075434_1001611184 206
154 3300007076 Ga0075435_100098896 Ga0075435_1000988964 206
155 3300007076 Ga0075435_100459042 Ga0075435_1004590422 206
156 3300009147 Ga0114129_10004475 Ga0114129_100044753 206
157 3300009147 Ga0114129_10004685 Ga0114129_100046859 206
158 3300009147 Ga0114129_10483623 Ga0114129_104836233 206
159 3300028381 Ga0268264_11025120 Ga0268264_110251201 206
160 3300046474 Ga0495605_0269777 Ga0495605_0269777_21_641 206
161 3300048910 Ga0496107_0817709 Ga0496107_0817709_37_657 206
162 3300048918 Ga0496115_0132347 Ga0496115_0132347_1419_2039 206
163 3300048918 Ga0496115_0260607 Ga0496115_0260607_184_804 206
164 3300048918 Ga0496115_0694642 Ga0496115_0694642_46_666 206
165 3300050507 nmdc:mga05p37_352059_c1 nmdc:mga05p37_352059_c1_261_881 206
166 3300050507 nmdc:mga05p37_79_c1 nmdc:mga05p37_79_c1_62156_62776 206
167 3300050507 nmdc:mga05p37_991_c1 nmdc:mga05p37_991_c1_9913_10533 206
168 3300050510 nmdc:mga06r32_354590_c1 nmdc:mga06r32_354590_c1_221_841 206
169 3300050511 nmdc:mga08y16_594252_c1 nmdc:mga08y16_594252_c1_123_743 206
170 3300050512 nmdc:mga0n895_194258_c1 nmdc:mga0n895_194258_c1_1421_2041 206
171 3300050513 nmdc:mga0rr50_411500_c1 nmdc:mga0rr50_411500_c1_471_1091 206
172 3300050513 nmdc:mga0rr50_5505_c1 nmdc:mga0rr50_5505_c1_998_1618 206
173 3300050515 nmdc:mga0a205_88431_c1 nmdc:mga0a205_88431_c1_1122_1742 206
174 3300002737 JGI25162J39368_1001022 JGI25162J39368_100102218 207
175 3300003214 JGI25165J46597_1000276 JGI25165J46597_100027654 207
176 3300003373 JGI25407J50210_10054340 JGI25407J50210_100543402 207
177 3300003911 JGI25405J52794_10001047 JGI25405J52794_100010472 207
178 3300005289 Ga0065704_10105882 Ga0065704_101058822 207
179 3300005290 Ga0065712_10001241 Ga0065712_100012417 207
180 3300005290 Ga0065712_10295978 Ga0065712_102959781 207
181 3300005293 Ga0065715_10095973 Ga0065715_100959733 207
182 3300005293 Ga0065715_10150025 Ga0065715_101500252 207
183 3300005293 Ga0065715_10300473 Ga0065715_103004732 207
184 3300005293 Ga0065715_10344713 Ga0065715_103447131 207
185 3300005295 Ga0065707_10066515 Ga0065707_100665151 207
186 3300005295 Ga0065707_10084964 Ga0065707_100849647 207
187 3300005335 Ga0070666_10040482 Ga0070666_100404823 207
188 3300005337 Ga0070682_100003792 Ga0070682_1000037923 207
189 3300005338 Ga0068868_100201975 Ga0068868_1002019753 207
190 3300005338 Ga0068868_101277302 Ga0068868_1012773021 207
191 3300005339 Ga0070660_100023777 Ga0070660_1000237776 207
192 3300005340 Ga0070689_100018067 Ga0070689_1000180673 207
193 3300005340 Ga0070689_100027619 Ga0070689_1000276197 207
194 3300005341 Ga0070691_10009813 Ga0070691_100098134 207
195 3300005341 Ga0070691_10017350 Ga0070691_100173502 207
196 3300005343 Ga0070687_100017106 Ga0070687_1000171064 207
197 3300005347 Ga0070668_100019648 Ga0070668_1000196484 207
198 3300005347 Ga0070668_100414151 Ga0070668_1004141512 207
199 3300005347 Ga0070668_100514818 Ga0070668_1005148181 207
200 3300005353 Ga0070669_100037023 Ga0070669_1000370232 207
201 3300005353 Ga0070669_100120918 Ga0070669_1001209182 207
202 3300005353 Ga0070669_100667130 Ga0070669_1006671301 207
203 3300005355 Ga0070671_100078248 Ga0070671_1000782482 207
204 3300005355 Ga0070671_100492473 Ga0070671_1004924731 207
205 3300005355 Ga0070671_100807460 Ga0070671_1008074602 207
206 3300005356 Ga0070674_100142987 Ga0070674_1001429872 207
207 3300005365 Ga0070688_100042784 Ga0070688_1000427842 207
208 3300005365 Ga0070688_100534970 Ga0070688_1005349701 207
209 3300005367 Ga0070667_100140252 Ga0070667_1001402524 207
210 3300005367 Ga0070667_100141623 Ga0070667_1001416232 207
211 3300005406 Ga0070703_10064253 Ga0070703_100642531 207
212 3300005406 Ga0070703_10151273 Ga0070703_101512731 207
213 3300005406 Ga0070703_10160910 Ga0070703_101609101 207
214 3300005406 Ga0070703_10196478 Ga0070703_101964781 207
215 3300005434 Ga0070709_10004844 Ga0070709_100048444 207
216 3300005435 Ga0070714_100074415 Ga0070714_1000744151 207
217 3300005435 Ga0070714_100074880 Ga0070714_1000748803 207
218 3300005435 Ga0070714_100153402 Ga0070714_1001534023 207
219 3300005435 Ga0070714_100839701 Ga0070714_1008397011 207
220 3300005436 Ga0070713_100060530 Ga0070713_1000605303 207
221 3300005436 Ga0070713_100080320 Ga0070713_1000803203 207
222 3300005436 Ga0070713_100081033 Ga0070713_1000810335 207
223 3300005436 Ga0070713_100176424 Ga0070713_1001764243 207
224 3300005436 Ga0070713_100334988 Ga0070713_1003349882 207
225 3300005436 Ga0070713_100446178 Ga0070713_1004461781 207
226 3300005436 Ga0070713_100581494 Ga0070713_1005814941 207
227 3300005436 Ga0070713_100754813 Ga0070713_1007548131 207
228 3300005436 Ga0070713_101282739 Ga0070713_1012827391 207
229 3300005437 Ga0070710_10051571 Ga0070710_100515713 207
230 3300005437 Ga0070710_10066255 Ga0070710_100662551 207
231 3300005437 Ga0070710_10075010 Ga0070710_100750102 207
232 3300005437 Ga0070710_10075659 Ga0070710_100756592 207
233 3300005437 Ga0070710_10236370 Ga0070710_102363701 207
234 3300005439 Ga0070711_100001412 Ga0070711_10000141216 207
235 3300005439 Ga0070711_100229132 Ga0070711_1002291321 207
236 3300005439 Ga0070711_100246346 Ga0070711_1002463461 207
237 3300005440 Ga0070705_100079313 Ga0070705_1000793131 207
238 3300005440 Ga0070705_100523006 Ga0070705_1005230061 207
239 3300005440 Ga0070705_100710452 Ga0070705_1007104521 207
240 3300005444 Ga0070694_100017290 Ga0070694_1000172903 207
241 3300005444 Ga0070694_100382885 Ga0070694_1003828851 207
242 3300005444 Ga0070694_100463437 Ga0070694_1004634371 207
243 3300005444 Ga0070694_100508519 Ga0070694_1005085192 207
244 3300005445 Ga0070708_100000327 Ga0070708_10000032726 207
245 3300005445 Ga0070708_100024936 Ga0070708_1000249367 207
246 3300005445 Ga0070708_100039861 Ga0070708_1000398612 207
247 3300005445 Ga0070708_100086373 Ga0070708_1000863733 207
248 3300005445 Ga0070708_100097597 Ga0070708_1000975973 207
249 3300005445 Ga0070708_100124707 Ga0070708_1001247072 207
250 3300005445 Ga0070708_100150992 Ga0070708_1001509922 207
251 3300005445 Ga0070708_100152133 Ga0070708_1001521332 207
252 3300005445 Ga0070708_100195530 Ga0070708_1001955303 207
253 3300005445 Ga0070708_100198356 Ga0070708_1001983562 207
254 3300005445 Ga0070708_100203302 Ga0070708_1002033022 207
255 3300005445 Ga0070708_100262275 Ga0070708_1002622752 207
256 3300005445 Ga0070708_100262598 Ga0070708_1002625981 207
257 3300005445 Ga0070708_100332498 Ga0070708_1003324982 207
258 3300005445 Ga0070708_100355751 Ga0070708_1003557512 207
259 3300005445 Ga0070708_100556719 Ga0070708_1005567191 207
260 3300005455 Ga0070663_100016703 Ga0070663_1000167032 207
261 3300005456 Ga0070678_100002534 Ga0070678_1000025344 207
262 3300005457 Ga0070662_100009553 Ga0070662_1000095534 207
263 3300005459 Ga0068867_100045742 Ga0068867_1000457421 207
264 3300005466 Ga0070685_10064247 Ga0070685_100642472 207
265 3300005467 Ga0070706_100004540 Ga0070706_10000454014 207
266 3300005467 Ga0070706_100006358 Ga0070706_1000063583 207
267 3300005467 Ga0070706_100007422 Ga0070706_1000074227 207
268 3300005467 Ga0070706_100009362 Ga0070706_1000093628 207
269 3300005467 Ga0070706_100019204 Ga0070706_1000192043 207
270 3300005467 Ga0070706_100029868 Ga0070706_1000298685 207
271 3300005467 Ga0070706_100141986 Ga0070706_1001419862 207
272 3300005467 Ga0070706_100157119 Ga0070706_1001571193 207
273 3300005467 Ga0070706_100159878 Ga0070706_1001598783 207
274 3300005467 Ga0070706_100344381 Ga0070706_1003443811 207
275 3300005467 Ga0070706_100643487 Ga0070706_1006434872 207
276 3300005468 Ga0070707_100009021 Ga0070707_1000090216 207
277 3300005468 Ga0070707_100009843 Ga0070707_1000098436 207
278 3300005468 Ga0070707_100018493 Ga0070707_1000184933 207
279 3300005468 Ga0070707_100030862 Ga0070707_1000308623 207
280 3300005468 Ga0070707_100033453 Ga0070707_1000334533 207
281 3300005468 Ga0070707_100065091 Ga0070707_1000650913 207
282 3300005468 Ga0070707_100126479 Ga0070707_1001264792 207
283 3300005468 Ga0070707_100139495 Ga0070707_1001394951 207
284 3300005468 Ga0070707_100258676 Ga0070707_1002586762 207
285 3300005468 Ga0070707_100261425 Ga0070707_1002614252 207
286 3300005468 Ga0070707_100373945 Ga0070707_1003739451 207
287 3300005468 Ga0070707_100444884 Ga0070707_1004448842 207
288 3300005468 Ga0070707_100487286 Ga0070707_1004872862 207
289 3300005468 Ga0070707_100621527 Ga0070707_1006215272 207
290 3300005468 Ga0070707_100700568 Ga0070707_1007005682 207
291 3300005471 Ga0070698_100008194 Ga0070698_1000081948 207
292 3300005471 Ga0070698_100014041 Ga0070698_1000140415 207
293 3300005471 Ga0070698_100029756 Ga0070698_1000297563 207
294 3300005471 Ga0070698_100034175 Ga0070698_1000341754 207
295 3300005471 Ga0070698_100054828 Ga0070698_1000548282 207
296 3300005471 Ga0070698_100061029 Ga0070698_1000610294 207
297 3300005471 Ga0070698_100064612 Ga0070698_1000646122 207
298 3300005471 Ga0070698_100087994 Ga0070698_1000879944 207
299 3300005471 Ga0070698_100089099 Ga0070698_1000890996 207
300 3300005471 Ga0070698_100109669 Ga0070698_1001096692 207
301 3300005471 Ga0070698_100114191 Ga0070698_1001141913 207
302 3300005471 Ga0070698_100214036 Ga0070698_1002140362 207
303 3300005471 Ga0070698_100303321 Ga0070698_1003033212 207
304 3300005471 Ga0070698_100334536 Ga0070698_1003345361 207
305 3300005471 Ga0070698_100454634 Ga0070698_1004546341 207
306 3300005471 Ga0070698_100557483 Ga0070698_1005574832 207
307 3300005471 Ga0070698_100868048 Ga0070698_1008680481 207
308 3300005471 Ga0070698_100892199 Ga0070698_1008921991 207
309 3300005518 Ga0070699_100004190 Ga0070699_1000041902 207
310 3300005518 Ga0070699_100017176 Ga0070699_1000171762 207
311 3300005518 Ga0070699_100054650 Ga0070699_1000546504 207
312 3300005518 Ga0070699_100077202 Ga0070699_1000772024 207
313 3300005518 Ga0070699_100078547 Ga0070699_1000785472 207
314 3300005518 Ga0070699_100137897 Ga0070699_1001378973 207
315 3300005518 Ga0070699_100210749 Ga0070699_1002107492 207
316 3300005518 Ga0070699_100274525 Ga0070699_1002745251 207
317 3300005518 Ga0070699_100347088 Ga0070699_1003470882 207
318 3300005518 Ga0070699_100358408 Ga0070699_1003584082 207
319 3300005518 Ga0070699_100398865 Ga0070699_1003988651 207
320 3300005518 Ga0070699_100401805 Ga0070699_1004018051 207
321 3300005518 Ga0070699_100453804 Ga0070699_1004538042 207
322 3300005518 Ga0070699_100505170 Ga0070699_1005051701 207
323 3300005518 Ga0070699_100545237 Ga0070699_1005452372 207
324 3300005518 Ga0070699_100948268 Ga0070699_1009482681 207
325 3300005536 Ga0070697_100007293 Ga0070697_1000072938 207
326 3300005536 Ga0070697_100007757 Ga0070697_1000077573 207
327 3300005536 Ga0070697_100017733 Ga0070697_1000177334 207
328 3300005536 Ga0070697_100032620 Ga0070697_1000326204 207
329 3300005536 Ga0070697_100041917 Ga0070697_1000419172 207
330 3300005536 Ga0070697_100101570 Ga0070697_1001015703 207
331 3300005536 Ga0070697_100116022 Ga0070697_1001160222 207
332 3300005536 Ga0070697_100131380 Ga0070697_1001313801 207
333 3300005536 Ga0070697_100200865 Ga0070697_1002008651 207
334 3300005536 Ga0070697_100254396 Ga0070697_1002543962 207
335 3300005536 Ga0070697_100353426 Ga0070697_1003534262 207
336 3300005536 Ga0070697_100385229 Ga0070697_1003852291 207
337 3300005536 Ga0070697_100438865 Ga0070697_1004388652 207
338 3300005536 Ga0070697_100523208 Ga0070697_1005232081 207
339 3300005536 Ga0070697_100565601 Ga0070697_1005656011 207
340 3300005536 Ga0070697_100986311 Ga0070697_1009863111 207
341 3300005539 Ga0068853_100017172 Ga0068853_1000171721 207
342 3300005543 Ga0070672_100030559 Ga0070672_1000305598 207
343 3300005544 Ga0070686_100006693 Ga0070686_1000066936 207
344 3300005545 Ga0070695_100027617 Ga0070695_1000276174 207
345 3300005545 Ga0070695_100027867 Ga0070695_1000278675 207
346 3300005545 Ga0070695_100065982 Ga0070695_1000659822 207
347 3300005545 Ga0070695_100435303 Ga0070695_1004353031 207
348 3300005545 Ga0070695_100562165 Ga0070695_1005621652 207
349 3300005545 Ga0070695_100844889 Ga0070695_1008448891 207
350 3300005546 Ga0070696_100034202 Ga0070696_1000342022 207
351 3300005546 Ga0070696_100036799 Ga0070696_1000367996 207
352 3300005546 Ga0070696_100046895 Ga0070696_1000468951 207
353 3300005546 Ga0070696_100103608 Ga0070696_1001036083 207
354 3300005546 Ga0070696_100148354 Ga0070696_1001483542 207
355 3300005546 Ga0070696_100181210 Ga0070696_1001812103 207
356 3300005546 Ga0070696_100196543 Ga0070696_1001965432 207
357 3300005546 Ga0070696_100244947 Ga0070696_1002449471 207
358 3300005546 Ga0070696_100316303 Ga0070696_1003163032 207
359 3300005546 Ga0070696_100528193 Ga0070696_1005281932 207
360 3300005548 Ga0070665_100099412 Ga0070665_1000994123 207
361 3300005548 Ga0070665_100488105 Ga0070665_1004881052 207
362 3300005548 Ga0070665_100766005 Ga0070665_1007660051 207
363 3300005549 Ga0070704_100020569 Ga0070704_1000205692 207
364 3300005549 Ga0070704_100022009 Ga0070704_1000220096 207
365 3300005549 Ga0070704_100030427 Ga0070704_1000304271 207
366 3300005549 Ga0070704_100226560 Ga0070704_1002265602 207
367 3300005549 Ga0070704_100243905 Ga0070704_1002439052 207
368 3300005549 Ga0070704_100265153 Ga0070704_1002651533 207
369 3300005549 Ga0070704_100377307 Ga0070704_1003773072 207
370 3300005549 Ga0070704_100573656 Ga0070704_1005736562 207
371 3300005549 Ga0070704_100596189 Ga0070704_1005961892 207
372 3300005577 Ga0068857_100017155 Ga0068857_1000171554 207
373 3300005578 Ga0068854_100011429 Ga0068854_10001142910 207
374 3300005615 Ga0070702_100001810 Ga0070702_10000181010 207
375 3300005616 Ga0068852_100012556 Ga0068852_1000125566 207
376 3300005617 Ga0068859_100362090 Ga0068859_1003620903 207
377 3300005618 Ga0068864_100269485 Ga0068864_1002694851 207
378 3300005718 Ga0068866_10469634 Ga0068866_104696341 207
379 3300005719 Ga0068861_100034650 Ga0068861_1000346505 207
380 3300005719 Ga0068861_100119064 Ga0068861_1001190642 207
381 3300005719 Ga0068861_100475677 Ga0068861_1004756771 207
382 3300005841 Ga0068863_100012142 Ga0068863_1000121423 207
383 3300005842 Ga0068858_100228910 Ga0068858_1002289102 207
384 3300005843 Ga0068860_100016584 Ga0068860_1000165846 207
385 3300005843 Ga0068860_100892269 Ga0068860_1008922692 207
386 3300005844 Ga0068862_100009669 Ga0068862_1000096696 207
387 3300005937 Ga0081455_10006446 Ga0081455_100064464 207
388 3300005937 Ga0081455_10010595 Ga0081455_100105958 207
389 3300005937 Ga0081455_10116873 Ga0081455_101168732 207
390 3300005981 Ga0081538_10003905 Ga0081538_100039056 207
391 3300005981 Ga0081538_10008589 Ga0081538_100085897 207
392 3300005981 Ga0081538_10012492 Ga0081538_100124922 207
393 3300005981 Ga0081538_10135447 Ga0081538_101354472 207
394 3300005985 Ga0081539_10061200 Ga0081539_100612003 207
395 3300006028 Ga0070717_10011227 Ga0070717_100112272 207
396 3300006028 Ga0070717_10013507 Ga0070717_100135075 207
397 3300006028 Ga0070717_10111075 Ga0070717_101110752 207
398 3300006028 Ga0070717_10111664 Ga0070717_101116644 207
399 3300006028 Ga0070717_10153964 Ga0070717_101539642 207
400 3300006028 Ga0070717_10163817 Ga0070717_101638171 207
401 3300006028 Ga0070717_10325851 Ga0070717_103258512 207
402 3300006028 Ga0070717_10470178 Ga0070717_104701782 207
403 3300006028 Ga0070717_10548576 Ga0070717_105485761 207
404 3300006028 Ga0070717_10642939 Ga0070717_106429391 207
405 3300006028 Ga0070717_10906287 Ga0070717_109062871 207
406 3300006163 Ga0070715_10019337 Ga0070715_100193374 207
407 3300006163 Ga0070715_10019458 Ga0070715_100194582 207
408 3300006163 Ga0070715_10094818 Ga0070715_100948183 207
409 3300006163 Ga0070715_10307258 Ga0070715_103072581 207
410 3300006173 Ga0070716_100002178 Ga0070716_1000021786 207
411 3300006173 Ga0070716_100011404 Ga0070716_1000114043 207
412 3300006173 Ga0070716_100023382 Ga0070716_1000233826 207
413 3300006173 Ga0070716_100086870 Ga0070716_1000868702 207
414 3300006173 Ga0070716_100151142 Ga0070716_1001511421 207
415 3300006173 Ga0070716_100225498 Ga0070716_1002254982 207
416 3300006173 Ga0070716_100228945 Ga0070716_1002289452 207
417 3300006173 Ga0070716_100241319 Ga0070716_1002413192 207
418 3300006173 Ga0070716_100564528 Ga0070716_1005645281 207
419 3300006173 Ga0070716_100610680 Ga0070716_1006106801 207
420 3300006175 Ga0070712_100006417 Ga0070712_1000064178 207
421 3300006175 Ga0070712_100058515 Ga0070712_1000585152 207
422 3300006175 Ga0070712_100059493 Ga0070712_1000594933 207
423 3300006175 Ga0070712_100820479 Ga0070712_1008204791 207
424 3300006237 Ga0097621_100761348 Ga0097621_1007613481 207
425 3300006358 Ga0068871_100228670 Ga0068871_1002286702 207
426 3300006844 Ga0075428_100026406 Ga0075428_1000264066 207
427 3300006844 Ga0075428_100027761 Ga0075428_1000277615 207
428 3300006844 Ga0075428_100044754 Ga0075428_1000447547 207
429 3300006844 Ga0075428_100068519 Ga0075428_1000685193 207
430 3300006844 Ga0075428_100097710 Ga0075428_1000977105 207
431 3300006844 Ga0075428_100099150 Ga0075428_1000991504 207
432 3300006844 Ga0075428_100122741 Ga0075428_1001227413 207
433 3300006844 Ga0075428_100156310 Ga0075428_1001563104 207
434 3300006844 Ga0075428_100162662 Ga0075428_1001626623 207
435 3300006844 Ga0075428_100192864 Ga0075428_1001928643 207
436 3300006844 Ga0075428_100226376 Ga0075428_1002263763 207
437 3300006844 Ga0075428_100279629 Ga0075428_1002796292 207
438 3300006844 Ga0075428_100353716 Ga0075428_1003537162 207
439 3300006844 Ga0075428_100355340 Ga0075428_1003553402 207
440 3300006844 Ga0075428_100402237 Ga0075428_1004022372 207
441 3300006844 Ga0075428_100778339 Ga0075428_1007783391 207
442 3300006846 Ga0075430_100020140 Ga0075430_1000201402 207
443 3300006846 Ga0075430_100054534 Ga0075430_1000545343 207
444 3300006846 Ga0075430_100059465 Ga0075430_1000594654 207
445 3300006846 Ga0075430_100278704 Ga0075430_1002787043 207
446 3300006846 Ga0075430_100362592 Ga0075430_1003625922 207
447 3300006847 Ga0075431_100022859 Ga0075431_1000228597 207
448 3300006847 Ga0075431_100065686 Ga0075431_1000656861 207
449 3300006847 Ga0075431_100287923 Ga0075431_1002879231 207
450 3300006847 Ga0075431_100319715 Ga0075431_1003197152 207
451 3300006847 Ga0075431_100360776 Ga0075431_1003607762 207
452 3300006852 Ga0075433_10001320 Ga0075433_1000132017 207
453 3300006852 Ga0075433_10002036 Ga0075433_1000203612 207
454 3300006852 Ga0075433_10003541 Ga0075433_100035418 207
455 3300006852 Ga0075433_10006871 Ga0075433_100068713 207
456 3300006852 Ga0075433_10010320 Ga0075433_100103202 207
457 3300006852 Ga0075433_10011565 Ga0075433_100115654 207
458 3300006852 Ga0075433_10034231 Ga0075433_100342314 207
459 3300006852 Ga0075433_10053330 Ga0075433_100533301 207
460 3300006852 Ga0075433_10076139 Ga0075433_100761393 207
461 3300006852 Ga0075433_10148695 Ga0075433_101486952 207
462 3300006852 Ga0075433_10152514 Ga0075433_101525142 207
463 3300006852 Ga0075433_10194662 Ga0075433_101946622 207
464 3300006852 Ga0075433_10231520 Ga0075433_102315203 207
465 3300006852 Ga0075433_10261307 Ga0075433_102613072 207
466 3300006852 Ga0075433_10288162 Ga0075433_102881623 207
467 3300006852 Ga0075433_10459230 Ga0075433_104592302 207
468 3300006852 Ga0075433_10459672 Ga0075433_104596721 207
469 3300006852 Ga0075433_10496308 Ga0075433_104963082 207
470 3300006852 Ga0075433_10681852 Ga0075433_106818521 207
471 3300006871 Ga0075434_100005686 Ga0075434_1000056867 207
472 3300006871 Ga0075434_100007695 Ga0075434_10000769510 207
473 3300006871 Ga0075434_100019749 Ga0075434_1000197495 207
474 3300006871 Ga0075434_100034636 Ga0075434_1000346363 207
475 3300006871 Ga0075434_100046970 Ga0075434_1000469705 207
476 3300006871 Ga0075434_100057121 Ga0075434_1000571212 207
477 3300006871 Ga0075434_100114024 Ga0075434_1001140243 207
478 3300006871 Ga0075434_100145351 Ga0075434_1001453512 207
479 3300006871 Ga0075434_100210425 Ga0075434_1002104251 207
480 3300006871 Ga0075434_100212061 Ga0075434_1002120612 207
481 3300006871 Ga0075434_100248425 Ga0075434_1002484252 207
482 3300006871 Ga0075434_100254674 Ga0075434_1002546742 207
483 3300006871 Ga0075434_100278393 Ga0075434_1002783932 207
484 3300006871 Ga0075434_100306409 Ga0075434_1003064092 207
485 3300006871 Ga0075434_100354064 Ga0075434_1003540642 207
486 3300006871 Ga0075434_100429004 Ga0075434_1004290042 207
487 3300006871 Ga0075434_100495667 Ga0075434_1004956672 207
488 3300006871 Ga0075434_100649057 Ga0075434_1006490572 207
489 3300006871 Ga0075434_100707807 Ga0075434_1007078072 207
490 3300006871 Ga0075434_100724323 Ga0075434_1007243232 207
491 3300006871 Ga0075434_100747756 Ga0075434_1007477562 207
492 3300006871 Ga0075434_100766494 Ga0075434_1007664942 207
493 3300006871 Ga0075434_101076223 Ga0075434_1010762231 207
494 3300006880 Ga0075429_100019033 Ga0075429_1000190332 207
495 3300006880 Ga0075429_100037493 Ga0075429_1000374933 207
496 3300006880 Ga0075429_100049459 Ga0075429_1000494593 207
497 3300006880 Ga0075429_100050141 Ga0075429_1000501415 207
498 3300006880 Ga0075429_100149788 Ga0075429_1001497881 207
499 3300006880 Ga0075429_100173732 Ga0075429_1001737321 207
500 3300006880 Ga0075429_100256636 Ga0075429_1002566363 207
501 3300006880 Ga0075429_100425021 Ga0075429_1004250212 207
502 3300006880 Ga0075429_100786033 Ga0075429_1007860332 207
503 3300006881 Ga0068865_100183944 Ga0068865_1001839442 207
504 3300006914 Ga0075436_100003400 Ga0075436_1000034006 207
505 3300006914 Ga0075436_100033969 Ga0075436_1000339692 207
506 3300006914 Ga0075436_100065982 Ga0075436_1000659822 207
507 3300006914 Ga0075436_100067224 Ga0075436_1000672242 207
508 3300006914 Ga0075436_100198226 Ga0075436_1001982263 207
509 3300006914 Ga0075436_100235642 Ga0075436_1002356422 207
510 3300006914 Ga0075436_100296316 Ga0075436_1002963162 207
511 3300006914 Ga0075436_100665177 Ga0075436_1006651771 207
512 3300006914 Ga0075436_100669369 Ga0075436_1006693691 207
513 3300006914 Ga0075436_100856380 Ga0075436_1008563801 207
514 3300006931 Ga0097620_100362080 Ga0097620_1003620803 207
515 3300007076 Ga0075435_100007201 Ga0075435_1000072016 207
516 3300007076 Ga0075435_100013765 Ga0075435_1000137656 207
517 3300007076 Ga0075435_100024448 Ga0075435_1000244486 207
518 3300007076 Ga0075435_100055694 Ga0075435_1000556943 207
519 3300007076 Ga0075435_100067152 Ga0075435_1000671522 207
520 3300007076 Ga0075435_100071188 Ga0075435_1000711882 207
521 3300007076 Ga0075435_100072577 Ga0075435_1000725773 207
522 3300007076 Ga0075435_100152434 Ga0075435_1001524342 207
523 3300007076 Ga0075435_100164266 Ga0075435_1001642662 207
524 3300007076 Ga0075435_100228569 Ga0075435_1002285691 207
525 3300007076 Ga0075435_100232000 Ga0075435_1002320002 207
526 3300007076 Ga0075435_100313066 Ga0075435_1003130662 207
527 3300007076 Ga0075435_100403072 Ga0075435_1004030722 207
528 3300007076 Ga0075435_100408508 Ga0075435_1004085082 207
529 3300007076 Ga0075435_100480993 Ga0075435_1004809931 207
530 3300007076 Ga0075435_100585129 Ga0075435_1005851291 207
531 3300007076 Ga0075435_100601046 Ga0075435_1006010461 207
532 3300007076 Ga0075435_100893735 Ga0075435_1008937351 207
533 3300007265 Ga0099794_10001962 Ga0099794_100019626 207
534 3300007265 Ga0099794_10002095 Ga0099794_100020954 207
535 3300007265 Ga0099794_10020880 Ga0099794_100208803 207
536 3300007265 Ga0099794_10193834 Ga0099794_101938341 207
537 3300007265 Ga0099794_10229070 Ga0099794_102290701 207
538 3300007788 Ga0099795_10225537 Ga0099795_102255371 207
539 3300009092 Ga0105250_10030786 Ga0105250_100307863 207
540 3300009094 Ga0111539_10048581 Ga0111539_100485811 207
541 3300009094 Ga0111539_10085334 Ga0111539_100853342 207
542 3300009094 Ga0111539_10168166 Ga0111539_101681663 207
543 3300009094 Ga0111539_10203521 Ga0111539_102035211 207
544 3300009094 Ga0111539_10243809 Ga0111539_102438092 207
545 3300009094 Ga0111539_10390786 Ga0111539_103907862 207
546 3300009094 Ga0111539_10459093 Ga0111539_104590931 207
547 3300009094 Ga0111539_10486766 Ga0111539_104867662 207
548 3300009094 Ga0111539_10781032 Ga0111539_107810321 207
549 3300009094 Ga0111539_10793818 Ga0111539_107938181 207
550 3300009098 Ga0105245_10013776 Ga0105245_100137768 207
551 3300009101 Ga0105247_10038209 Ga0105247_100382093 207
552 3300009147 Ga0114129_10002492 Ga0114129_1000249221 207
553 3300009147 Ga0114129_10007203 Ga0114129_100072035 207
554 3300009147 Ga0114129_10017425 Ga0114129_100174252 207
555 3300009147 Ga0114129_10017478 Ga0114129_100174783 207
556 3300009147 Ga0114129_10019037 Ga0114129_100190374 207
557 3300009147 Ga0114129_10021529 Ga0114129_100215292 207
558 3300009147 Ga0114129_10041514 Ga0114129_100415145 207
559 3300009147 Ga0114129_10060267 Ga0114129_100602672 207
560 3300009147 Ga0114129_10090140 Ga0114129_100901402 207
561 3300009147 Ga0114129_10118447 Ga0114129_101184474 207
562 3300009147 Ga0114129_10184200 Ga0114129_101842002 207
563 3300009147 Ga0114129_10185627 Ga0114129_101856273 207
564 3300009147 Ga0114129_10296831 Ga0114129_102968312 207
565 3300009147 Ga0114129_10359204 Ga0114129_103592042 207
566 3300009147 Ga0114129_10378370 Ga0114129_103783702 207
567 3300009147 Ga0114129_10455247 Ga0114129_104552471 207
568 3300009147 Ga0114129_10472099 Ga0114129_104720993 207
569 3300009147 Ga0114129_10619674 Ga0114129_106196742 207
570 3300009147 Ga0114129_10653232 Ga0114129_106532322 207
571 3300009147 Ga0114129_10675847 Ga0114129_106758472 207
572 3300009147 Ga0114129_10812272 Ga0114129_108122722 207
573 3300009147 Ga0114129_10902255 Ga0114129_109022551 207
574 3300009147 Ga0114129_11076102 Ga0114129_110761021 207
575 3300009147 Ga0114129_11078018 Ga0114129_110780181 207
576 3300009147 Ga0114129_11638466 Ga0114129_116384661 207
577 3300009148 Ga0105243_10848832 Ga0105243_108488321 207
578 3300009174 Ga0105241_10040941 Ga0105241_100409414 207
579 3300009174 Ga0105241_10048446 Ga0105241_100484462 207
580 3300009176 Ga0105242_10297612 Ga0105242_102976122 207
581 3300009176 Ga0105242_10607719 Ga0105242_106077192 207
582 3300009177 Ga0105248_10011651 Ga0105248_100116514 207
583 3300009177 Ga0105248_10752314 Ga0105248_107523142 207
584 3300009545 Ga0105237_10966098 Ga0105237_109660982 207
585 3300009553 Ga0105249_10268839 Ga0105249_102688392 207
586 3300009553 Ga0105249_10314419 Ga0105249_103144192 207
587 3300009553 Ga0105249_10394120 Ga0105249_103941202 207
588 3300009553 Ga0105249_11097431 Ga0105249_110974311 207
589 3300010159 Ga0099796_10017097 Ga0099796_100170972 207
590 3300010159 Ga0099796_10085032 Ga0099796_100850322 207
591 3300010375 Ga0105239_10090735 Ga0105239_100907351 207
592 3300010375 Ga0105239_11317040 Ga0105239_113170402 207
593 3300010375 Ga0105239_11352899 Ga0105239_113528991 207
594 3300011119 Ga0105246_10214239 Ga0105246_102142392 207
595 3300013100 Ga0157373_10077541 Ga0157373_100775412 207
596 3300013105 Ga0157369_10108106 Ga0157369_101081063 207
597 3300013296 Ga0157374_10241514 Ga0157374_102415142 207
598 3300013297 Ga0157378_10021295 Ga0157378_100212957 207
599 3300013297 Ga0157378_10491278 Ga0157378_104912781 207
600 3300013297 Ga0157378_10873191 Ga0157378_108731912 207
601 3300013306 Ga0163162_10181078 Ga0163162_101810782 207
602 3300013307 Ga0157372_10744394 Ga0157372_107443942 207
603 3300013308 Ga0157375_10091370 Ga0157375_100913704 207
604 3300013308 Ga0157375_10266665 Ga0157375_102666651 207
605 3300013308 Ga0157375_10963889 Ga0157375_109638892 207
606 3300014325 Ga0163163_10017144 Ga0163163_100171443 207
607 3300014325 Ga0163163_10986678 Ga0163163_109866782 207
608 3300014326 Ga0157380_10009890 Ga0157380_100098906 207
609 3300014326 Ga0157380_10338927 Ga0157380_103389272 207
610 3300014968 Ga0157379_10312860 Ga0157379_103128602 207
611 3300014968 Ga0157379_10544289 Ga0157379_105442891 207
612 3300014969 Ga0157376_10009199 Ga0157376_100091996 207
613 3300017792 Ga0163161_11047058 Ga0163161_110470581 207
614 3300024225 Ga0224572_1002353 Ga0224572_10023532 207
615 3300024227 Ga0228598_1002567 Ga0228598_10025675 207
616 3300024227 Ga0228598_1016185 Ga0228598_10161851 207
617 3300025233 Ga0209437_100023 Ga0209437_100023423 207
618 3300025261 Ga0209233_1000062 Ga0209233_100006252 207
619 3300025885 Ga0207653_10055869 Ga0207653_100558692 207
620 3300025898 Ga0207692_10042639 Ga0207692_100426392 207
621 3300025898 Ga0207692_10072078 Ga0207692_100720782 207
622 3300025899 Ga0207642_10371252 Ga0207642_103712521 207
623 3300025901 Ga0207688_10008540 Ga0207688_100085409 207
624 3300025904 Ga0207647_10008876 Ga0207647_100088764 207
625 3300025905 Ga0207685_10007770 Ga0207685_100077701 207
626 3300025905 Ga0207685_10030721 Ga0207685_100307213 207
627 3300025905 Ga0207685_10037116 Ga0207685_100371162 207
628 3300025905 Ga0207685_10063917 Ga0207685_100639172 207
629 3300025905 Ga0207685_10161923 Ga0207685_101619231 207
630 3300025906 Ga0207699_10076719 Ga0207699_100767192 207
631 3300025906 Ga0207699_10087391 Ga0207699_100873912 207
632 3300025906 Ga0207699_10090359 Ga0207699_100903592 207
633 3300025906 Ga0207699_10592016 Ga0207699_105920161 207
634 3300025907 Ga0207645_10031716 Ga0207645_100317165 207
635 3300025907 Ga0207645_10285027 Ga0207645_102850272 207
636 3300025910 Ga0207684_10000181 Ga0207684_1000018191 207
637 3300025910 Ga0207684_10000507 Ga0207684_1000050755 207
638 3300025910 Ga0207684_10000684 Ga0207684_1000068440 207
639 3300025910 Ga0207684_10003189 Ga0207684_1000318912 207
640 3300025910 Ga0207684_10005711 Ga0207684_100057116 207
641 3300025910 Ga0207684_10007743 Ga0207684_100077438 207
642 3300025910 Ga0207684_10013300 Ga0207684_100133006 207
643 3300025910 Ga0207684_10019354 Ga0207684_100193542 207
644 3300025910 Ga0207684_10026415 Ga0207684_100264153 207
645 3300025910 Ga0207684_10027978 Ga0207684_100279785 207
646 3300025910 Ga0207684_10074280 Ga0207684_100742801 207
647 3300025910 Ga0207684_10079262 Ga0207684_100792624 207
648 3300025910 Ga0207684_10084698 Ga0207684_100846983 207
649 3300025910 Ga0207684_10085947 Ga0207684_100859474 207
650 3300025910 Ga0207684_10113533 Ga0207684_101135332 207
651 3300025910 Ga0207684_10116903 Ga0207684_101169033 207
652 3300025910 Ga0207684_10144603 Ga0207684_101446032 207
653 3300025910 Ga0207684_10150699 Ga0207684_101506993 207
654 3300025910 Ga0207684_10193612 Ga0207684_101936121 207
655 3300025910 Ga0207684_10481299 Ga0207684_104812991 207
656 3300025910 Ga0207684_10498204 Ga0207684_104982042 207
657 3300025910 Ga0207684_10550516 Ga0207684_105505163 207
658 3300025910 Ga0207684_10626499 Ga0207684_106264992 207
659 3300025911 Ga0207654_10044067 Ga0207654_100440673 207
660 3300025915 Ga0207693_10000898 Ga0207693_1000089827 207
661 3300025915 Ga0207693_10006516 Ga0207693_1000651615 207
662 3300025915 Ga0207693_10037532 Ga0207693_100375325 207
663 3300025915 Ga0207693_10095563 Ga0207693_100955632 207
664 3300025916 Ga0207663_10001824 Ga0207663_100018246 207
665 3300025916 Ga0207663_10017487 Ga0207663_100174874 207
666 3300025916 Ga0207663_10027262 Ga0207663_100272623 207
667 3300025916 Ga0207663_10105923 Ga0207663_101059232 207
668 3300025916 Ga0207663_10267973 Ga0207663_102679732 207
669 3300025918 Ga0207662_10040450 Ga0207662_100404503 207
670 3300025919 Ga0207657_10009972 Ga0207657_100099726 207
671 3300025922 Ga0207646_10000165 Ga0207646_1000016530 207
672 3300025922 Ga0207646_10000663 Ga0207646_100006636 207
673 3300025922 Ga0207646_10006466 Ga0207646_100064662 207
674 3300025922 Ga0207646_10006994 Ga0207646_100069948 207
675 3300025922 Ga0207646_10008284 Ga0207646_1000828410 207
676 3300025922 Ga0207646_10011592 Ga0207646_100115923 207
677 3300025922 Ga0207646_10015133 Ga0207646_100151336 207
678 3300025922 Ga0207646_10021846 Ga0207646_100218466 207
679 3300025922 Ga0207646_10029826 Ga0207646_100298266 207
680 3300025922 Ga0207646_10030282 Ga0207646_100302828 207
681 3300025922 Ga0207646_10059603 Ga0207646_100596032 207
682 3300025922 Ga0207646_10084655 Ga0207646_100846552 207
683 3300025922 Ga0207646_10205860 Ga0207646_102058602 207
684 3300025922 Ga0207646_10497438 Ga0207646_104974382 207
685 3300025922 Ga0207646_10527683 Ga0207646_105276832 207
686 3300025922 Ga0207646_10666228 Ga0207646_106662281 207
687 3300025922 Ga0207646_10804948 Ga0207646_108049482 207
688 3300025923 Ga0207681_10026959 Ga0207681_100269592 207
689 3300025923 Ga0207681_10059934 Ga0207681_100599342 207
690 3300025923 Ga0207681_10419507 Ga0207681_104195071 207
691 3300025925 Ga0207650_10083604 Ga0207650_100836042 207
692 3300025926 Ga0207659_10288409 Ga0207659_102884092 207
693 3300025927 Ga0207687_10142857 Ga0207687_101428572 207
694 3300025928 Ga0207700_10036148 Ga0207700_100361482 207
695 3300025928 Ga0207700_10151733 Ga0207700_101517332 207
696 3300025928 Ga0207700_10186891 Ga0207700_101868912 207
697 3300025928 Ga0207700_10224733 Ga0207700_102247332 207
698 3300025928 Ga0207700_10775811 Ga0207700_107758111 207
699 3300025929 Ga0207664_10086255 Ga0207664_100862553 207
700 3300025929 Ga0207664_10189227 Ga0207664_101892272 207
701 3300025929 Ga0207664_10685140 Ga0207664_106851401 207
702 3300025929 Ga0207664_10903034 Ga0207664_109030341 207
703 3300025931 Ga0207644_10067356 Ga0207644_100673563 207
704 3300025933 Ga0207706_10028247 Ga0207706_100282475 207
705 3300025933 Ga0207706_10406090 Ga0207706_104060901 207
706 3300025933 Ga0207706_10430626 Ga0207706_104306262 207
707 3300025934 Ga0207686_10361276 Ga0207686_103612761 207
708 3300025935 Ga0207709_10134917 Ga0207709_101349172 207
709 3300025936 Ga0207670_10019485 Ga0207670_100194852 207
710 3300025936 Ga0207670_10099245 Ga0207670_100992452 207
711 3300025937 Ga0207669_10130770 Ga0207669_101307703 207
712 3300025938 Ga0207704_10184947 Ga0207704_101849472 207
713 3300025938 Ga0207704_10879087 Ga0207704_108790871 207
714 3300025939 Ga0207665_10000887 Ga0207665_1000088720 207
715 3300025939 Ga0207665_10014732 Ga0207665_100147324 207
716 3300025939 Ga0207665_10045875 Ga0207665_100458753 207
717 3300025939 Ga0207665_10051130 Ga0207665_100511303 207
718 3300025939 Ga0207665_10059603 Ga0207665_100596032 207
719 3300025939 Ga0207665_10119703 Ga0207665_101197032 207
720 3300025939 Ga0207665_10121938 Ga0207665_101219382 207
721 3300025939 Ga0207665_10262680 Ga0207665_102626802 207
722 3300025939 Ga0207665_10306822 Ga0207665_103068222 207
723 3300025939 Ga0207665_10395603 Ga0207665_103956031 207
724 3300025940 Ga0207691_10360324 Ga0207691_103603241 207
725 3300025941 Ga0207711_10050722 Ga0207711_100507223 207
726 3300025941 Ga0207711_10744232 Ga0207711_107442321 207
727 3300025945 Ga0207679_10357158 Ga0207679_103571581 207
728 3300025949 Ga0207667_10679476 Ga0207667_106794761 207
729 3300025961 Ga0207712_10189122 Ga0207712_101891222 207
730 3300025961 Ga0207712_10377086 Ga0207712_103770861 207
731 3300025972 Ga0207668_10017069 Ga0207668_100170694 207
732 3300025972 Ga0207668_10534655 Ga0207668_105346552 207
733 3300025981 Ga0207640_10137884 Ga0207640_101378842 207
734 3300025981 Ga0207640_10270490 Ga0207640_102704902 207
735 3300025986 Ga0207658_10232312 Ga0207658_102323121 207
736 3300025986 Ga0207658_10300761 Ga0207658_103007612 207
737 3300025986 Ga0207658_10446389 Ga0207658_104463892 207
738 3300026023 Ga0207677_10266446 Ga0207677_102664462 207
739 3300026023 Ga0207677_10492097 Ga0207677_104920971 207
740 3300026035 Ga0207703_10176207 Ga0207703_101762072 207
741 3300026041 Ga0207639_10357378 Ga0207639_103573782 207
742 3300026067 Ga0207678_10011677 Ga0207678_100116772 207
743 3300026075 Ga0207708_10015629 Ga0207708_100156296 207
744 3300026075 Ga0207708_10147078 Ga0207708_101470782 207
745 3300026088 Ga0207641_10009040 Ga0207641_100090403 207
746 3300026089 Ga0207648_10037907 Ga0207648_100379073 207
747 3300026089 Ga0207648_10043366 Ga0207648_100433663 207
748 3300026089 Ga0207648_10220721 Ga0207648_102207211 207
749 3300026095 Ga0207676_11060287 Ga0207676_110602871 207
750 3300026116 Ga0207674_10018861 Ga0207674_100188617 207
751 3300026118 Ga0207675_100072478 Ga0207675_1000724785 207
752 3300026118 Ga0207675_100203694 Ga0207675_1002036941 207
753 3300026118 Ga0207675_100469956 Ga0207675_1004699562 207
754 3300026118 Ga0207675_100577786 Ga0207675_1005777861 207
755 3300026118 Ga0207675_101038825 Ga0207675_1010388251 207
756 3300026121 Ga0207683_10006916 Ga0207683_100069169 207
757 3300026121 Ga0207683_11175321 Ga0207683_111753211 207
758 3300027671 Ga0209588_1000024 Ga0209588_100002474 207
759 3300027671 Ga0209588_1004440 Ga0209588_10044404 207
760 3300027907 Ga0207428_10016868 Ga0207428_100168687 207
761 3300027907 Ga0207428_10065007 Ga0207428_100650071 207
762 3300028017 Ga0265356_1000449 Ga0265356_10004494 207
763 3300028379 Ga0268266_10031920 Ga0268266_100319203 207
764 3300028379 Ga0268266_10569836 Ga0268266_105698362 207
765 3300028380 Ga0268265_10086808 Ga0268265_100868082 207
766 3300028381 Ga0268264_10040316 Ga0268264_100403162 207
767 3300028381 Ga0268264_10111426 Ga0268264_101114262 207
768 3300028381 Ga0268264_10193494 Ga0268264_101934942 207
769 3300030760 Ga0265762_1001022 Ga0265762_10010224 207
770 3300030760 Ga0265762_1002005 Ga0265762_10020054 207
771 3300030763 Ga0265763_1000002 Ga0265763_10000022 207
772 3300030763 Ga0265763_1007364 Ga0265763_10073641 207
773 3300031018 Ga0265773_1002492 Ga0265773_10024922 207
774 3300031090 Ga0265760_10001288 Ga0265760_100012886 207
775 3300033180 Ga0307510_10275516 Ga0307510_102755162 207
776 3300034818 Ga0373950_0016769 Ga0373950_0016769_131_754 207
777 3300035083 Ga0373926_0075173 Ga0373926_0075173_409_1056 207
778 3300035083 Ga0373926_0216179 Ga0373926_0216179_30_653 207
779 3300035088 Ga0373940_0125668 Ga0373940_0125668_92_718 207
780 3300035091 Ga0373951_0064816 Ga0373951_0064816_157_780 207
781 3300035091 Ga0373951_0122752 Ga0373951_0122752_13_636 207
782 3300035691 Ga0373931_0575102 Ga0373931_0575102_20_694 207
783 3300035691 Ga0373931_0609514 Ga0373931_0609514_31_654 207
784 3300035695 Ga0373927_0053694 Ga0373927_0053694_1524_2147 207
785 3300035695 Ga0373927_0552959 Ga0373927_0552959_105_728 207
786 3300035725 Ga0373947_0186141 Ga0373947_0186141_365_988 207
787 3300036401 Ga0373937_0041832 Ga0373937_0041832_1329_2027 207
788 3300036459 Ga0372808_025127 Ga0372808_025127_38_772 207
789 3300039062 Ga0400483_108458 Ga0400483_108458_285_923 207
790 3300042876 Ga0451577_0153436 Ga0451577_0153436_874_1497 207
791 3300044673 Ga0453683_0000258 Ga0453683_0000258_11884_12507 207
792 3300044673 Ga0453683_0006130 Ga0453683_0006130_1888_2511 207
793 3300044673 Ga0453683_0011802 Ga0453683_0011802_1302_1925 207
794 3300044673 Ga0453683_0032817 Ga0453683_0032817_2172_2795 207
795 3300044673 Ga0453683_0080866 Ga0453683_0080866_751_1374 207
796 3300044673 Ga0453683_0234905 Ga0453683_0234905_491_1114 207
797 3300044673 Ga0453683_0329663 Ga0453683_0329663_317_940 207
798 3300044712 Ga0453684_0046569 Ga0453684_0046569_3386_4009 207
799 3300044712 Ga0453684_0320630 Ga0453684_0320630_499_1122 207
800 3300044712 Ga0453684_0378649 Ga0453684_0378649_122_745 207
801 3300045051 Ga0451576_0033734 Ga0451576_0033734_1689_2312 207
802 3300045051 Ga0451576_0055389 Ga0451576_0055389_1530_2153 207
803 3300045051 Ga0451576_0108565 Ga0451576_0108565_1707_2330 207
804 3300046457 Ga0495590_0041523 Ga0495590_0041523_632_1318 207
805 3300046459 Ga0495629_0243094 Ga0495629_0243094_349_972 207
806 3300046462 Ga0495651_0394046 Ga0495651_0394046_34_732 207
807 3300046472 Ga0495580_0078824 Ga0495580_0078824_1306_1929 207
808 3300046472 Ga0495580_0141575 Ga0495580_0141575_170_793 207
809 3300046473 Ga0495582_0367625 Ga0495582_0367625_112_735 207
810 3300046477 Ga0495664_0173357 Ga0495664_0173357_62_685 207
811 3300046491 Ga0495584_0037238 Ga0495584_0037238_76_699 207
812 3300046491 Ga0495584_0042612 Ga0495584_0042612_1433_2119 207
813 3300046499 Ga0495594_0137711 Ga0495594_0137711_576_1199 207
814 3300046511 Ga0495608_0067086 Ga0495608_0067086_732_1430 207
815 3300046514 Ga0495618_0042290 Ga0495618_0042290_1278_1901 207
816 3300046516 Ga0495628_0242951 Ga0495628_0242951_692_1315 207
817 3300046517 Ga0495630_0098949 Ga0495630_0098949_776_1399 207
818 3300046517 Ga0495630_0565111 Ga0495630_0565111_112_735 207
819 3300046518 Ga0495631_0116266 Ga0495631_0116266_430_1116 207
820 3300046519 Ga0495632_0206032 Ga0495632_0206032_35_721 207
821 3300046525 Ga0495663_0206691 Ga0495663_0206691_12_635 207
822 3300046528 Ga0495642_0154502 Ga0495642_0154502_284_937 207
823 3300046531 Ga0495665_0157712 Ga0495665_0157712_131_754 207
824 3300046533 Ga0495640_0056854 Ga0495640_0056854_765_1388 207
825 3300046538 Ga0495609_0190288 Ga0495609_0190288_147_770 207
826 3300046543 Ga0495645_0067270 Ga0495645_0067270_373_996 207
827 3300046558 Ga0495633_0142795 Ga0495633_0142795_246_869 207
828 3300046642 Ga0495634_0040100 Ga0495634_0040100_425_1048 207
829 3300046663 Ga0495635_0630366 Ga0495635_0630366_30_653 207
830 3300046663 Ga0495635_0651942 Ga0495635_0651942_19_642 207
831 3300046664 Ga0495659_0053397 Ga0495659_0053397_193_816 207
832 3300046664 Ga0495659_0162846 Ga0495659_0162846_51_674 207
833 3300046678 Ga0495599_0089005 Ga0495599_0089005_731_1354 207
834 3300046680 Ga0495646_0339900 Ga0495646_0339900_15_638 207
835 3300046684 Ga0495669_0359874 Ga0495669_0359874_49_678 207
836 3300046689 Ga0495613_0202390 Ga0495613_0202390_239_862 207
837 3300046689 Ga0495613_0217992 Ga0495613_0217992_653_1276 207
838 3300046690 Ga0495624_0385143 Ga0495624_0385143_89_712 207
839 3300046690 Ga0495624_0482935 Ga0495624_0482935_92_727 207
840 3300046691 Ga0495670_0399061 Ga0495670_0399061_25_648 207
841 3300047315 Ga0495581_0082110 Ga0495581_0082110_46_669 207
842 3300047318 Ga0495636_0178267 Ga0495636_0178267_26_649 207
843 3300047318 Ga0495636_0250903 Ga0495636_0250903_79_732 207
844 3300047319 Ga0495674_0064432 Ga0495674_0064432_1967_2590 207
845 3300047319 Ga0495674_0085525 Ga0495674_0085525_220_843 207
846 3300047471 Ga0495684_0037983 Ga0495684_0037983_2190_2813 207
847 3300048903 Ga0496100_0007168 Ga0496100_0007168_2866_3489 207
848 3300048903 Ga0496100_0390539 Ga0496100_0390539_65_688 207
849 3300048904 Ga0496101_0224338 Ga0496101_0224338_364_987 207
850 3300048904 Ga0496101_0597398 Ga0496101_0597398_181_804 207
851 3300048905 Ga0496102_0141169 Ga0496102_0141169_123_785 207
852 3300048905 Ga0496102_0175044 Ga0496102_0175044_631_1254 207
853 3300048905 Ga0496102_0199132 Ga0496102_0199132_599_1222 207
854 3300048905 Ga0496102_0956093 Ga0496102_0956093_111_734 207
855 3300048907 Ga0496104_0000339 Ga0496104_0000339_1782_2405 207
856 3300048907 Ga0496104_0008489 Ga0496104_0008489_6790_7413 207
857 3300048907 Ga0496104_0034057 Ga0496104_0034057_3995_4618 207
858 3300048907 Ga0496104_0076052 Ga0496104_0076052_2462_3085 207
859 3300048908 Ga0496105_0002897 Ga0496105_0002897_1655_2278 207
860 3300048908 Ga0496105_0006320 Ga0496105_0006320_7311_7934 207
861 3300048908 Ga0496105_0111260 Ga0496105_0111260_1360_1983 207
862 3300048909 Ga0496106_0037970 Ga0496106_0037970_2719_3342 207
863 3300048909 Ga0496106_0385457 Ga0496106_0385457_31_654 207
864 3300048909 Ga0496106_0626156 Ga0496106_0626156_150_773 207
865 3300048910 Ga0496107_0032183 Ga0496107_0032183_1388_2011 207
866 3300048910 Ga0496107_0393475 Ga0496107_0393475_140_763 207
867 3300048911 Ga0496108_0033772 Ga0496108_0033772_3047_3670 207
868 3300048911 Ga0496108_0040429 Ga0496108_0040429_390_1013 207
869 3300048911 Ga0496108_0395786 Ga0496108_0395786_162_785 207
870 3300048911 Ga0496108_0880321 Ga0496108_0880321_116_739 207
871 3300048911 Ga0496108_0901547 Ga0496108_0901547_106_729 207
872 3300048912 Ga0496109_0000191 Ga0496109_0000191_4166_4789 207
873 3300048912 Ga0496109_0077982 Ga0496109_0077982_741_1367 207
874 3300048912 Ga0496109_0109696 Ga0496109_0109696_1369_1992 207
875 3300048913 Ga0496110_0014344 Ga0496110_0014344_630_1253 207
876 3300048913 Ga0496110_0063097 Ga0496110_0063097_1144_1767 207
877 3300048913 Ga0496110_0093278 Ga0496110_0093278_1594_2331 207
878 3300048913 Ga0496110_1062316 Ga0496110_1062316_12_638 207
879 3300048914 Ga0496111_0016400 Ga0496111_0016400_4003_4626 207
880 3300048914 Ga0496111_0089040 Ga0496111_0089040_1360_1983 207
881 3300048914 Ga0496111_0145166 Ga0496111_0145166_195_932 207
882 3300048915 Ga0496112_0081626 Ga0496112_0081626_1944_2567 207
883 3300048915 Ga0496112_0296383 Ga0496112_0296383_50_673 207
884 3300048915 Ga0496112_0547969 Ga0496112_0547969_431_1054 207
885 3300048916 Ga0496113_0071636 Ga0496113_0071636_1981_2607 207
886 3300048916 Ga0496113_0089240 Ga0496113_0089240_575_1198 207
887 3300048916 Ga0496113_0298504 Ga0496113_0298504_442_1065 207
888 3300048916 Ga0496113_0389564 Ga0496113_0389564_271_894 207
889 3300048916 Ga0496113_0470367 Ga0496113_0470367_250_876 207
890 3300048917 Ga0496114_0000527 Ga0496114_0000527_13116_13739 207
891 3300048917 Ga0496114_0058277 Ga0496114_0058277_874_1608 207
892 3300048917 Ga0496114_0349343 Ga0496114_0349343_466_1089 207
893 3300048918 Ga0496115_0020011 Ga0496115_0020011_3137_3871 207
894 3300048918 Ga0496115_0028961 Ga0496115_0028961_3171_3794 207
895 3300048918 Ga0496115_0096450 Ga0496115_0096450_1565_2188 207
896 3300048918 Ga0496115_0100313 Ga0496115_0100313_1544_2167 207
897 3300048918 Ga0496115_0138419 Ga0496115_0138419_224_847 207
898 3300048918 Ga0496115_0148030 Ga0496115_0148030_962_1588 207
899 3300048918 Ga0496115_0295940 Ga0496115_0295940_364_987 207
900 3300048920 Ga0496117_0010943 Ga0496117_0010943_6171_6902 207
901 3300048921 Ga0496118_0009623 Ga0496118_0009623_1980_2711 207
902 3300048922 Ga0496119_0072377 Ga0496119_0072377_195_818 207
903 3300048928 Ga0496125_0051918 Ga0496125_0051918_690_1313 207
904 3300048929 Ga0496126_0040027 Ga0496126_0040027_1241_1975 207
905 3300050507 nmdc:mga05p37_103593_c2 nmdc:mga05p37_103593_c2_2422_3045 207
906 3300050507 nmdc:mga05p37_10_c1 nmdc:mga05p37_10_c1_91232_91855 207
907 3300050507 nmdc:mga05p37_11608_c1 nmdc:mga05p37_11608_c1_3882_4505 207
908 3300050507 nmdc:mga05p37_116479_c1 nmdc:mga05p37_116479_c1_1814_2437 207
909 3300050507 nmdc:mga05p37_1238_c1 nmdc:mga05p37_1238_c1_596_1219 207
910 3300050507 nmdc:mga05p37_1315154_c1 nmdc:mga05p37_1315154_c1_103_726 207
911 3300050507 nmdc:mga05p37_13336_c1 nmdc:mga05p37_13336_c1_2563_3195 207
912 3300050507 nmdc:mga05p37_13888_c1 nmdc:mga05p37_13888_c1_7279_7902 207
913 3300050507 nmdc:mga05p37_155369_c1 nmdc:mga05p37_155369_c1_626_1249 207
914 3300050507 nmdc:mga05p37_169056_c1 nmdc:mga05p37_169056_c1_541_1164 207
915 3300050507 nmdc:mga05p37_208979_c1 nmdc:mga05p37_208979_c1_1316_1939 207
916 3300050507 nmdc:mga05p37_21714_c1 nmdc:mga05p37_21714_c1_5183_5806 207
917 3300050507 nmdc:mga05p37_2264_c1 nmdc:mga05p37_2264_c1_17182_17805 207
918 3300050507 nmdc:mga05p37_260198_c1 nmdc:mga05p37_260198_c1_1442_2065 207
919 3300050507 nmdc:mga05p37_284012_c1 nmdc:mga05p37_284012_c1_1178_1801 207
920 3300050507 nmdc:mga05p37_29334_c1 nmdc:mga05p37_29334_c1_3946_4569 207
921 3300050507 nmdc:mga05p37_2985_c1 nmdc:mga05p37_2985_c1_15329_15952 207
922 3300050507 nmdc:mga05p37_308166_c1 nmdc:mga05p37_308166_c1_1121_1807 207
923 3300050507 nmdc:mga05p37_352769_c1 nmdc:mga05p37_352769_c1_142_765 207
924 3300050507 nmdc:mga05p37_37533_c1 nmdc:mga05p37_37533_c1_2828_3451 207
925 3300050507 nmdc:mga05p37_38691_c1 nmdc:mga05p37_38691_c1_2888_3511 207
926 3300050507 nmdc:mga05p37_441644_c1 nmdc:mga05p37_441644_c1_408_1031 207
927 3300050507 nmdc:mga05p37_461039_c1 nmdc:mga05p37_461039_c1_737_1414 207
928 3300050507 nmdc:mga05p37_491_c1 nmdc:mga05p37_491_c1_36680_37303 207
929 3300050507 nmdc:mga05p37_511488_c1 nmdc:mga05p37_511488_c1_545_1222 207
930 3300050507 nmdc:mga05p37_554389_c1 nmdc:mga05p37_554389_c1_598_1233 207
931 3300050507 nmdc:mga05p37_58271_c1 nmdc:mga05p37_58271_c1_810_1433 207
932 3300050507 nmdc:mga05p37_708888_c1 nmdc:mga05p37_708888_c1_313_936 207
933 3300050507 nmdc:mga05p37_720571_c1 nmdc:mga05p37_720571_c1_190_813 207
934 3300050507 nmdc:mga05p37_876178_c1 nmdc:mga05p37_876178_c1_150_887 207
935 3300050508 nmdc:mga09592_11547_c1 nmdc:mga09592_11547_c1_777_1400 207
936 3300050508 nmdc:mga09592_14031_c1 nmdc:mga09592_14031_c1_2109_2732 207
937 3300050508 nmdc:mga09592_170190_c1 nmdc:mga09592_170190_c1_163_786 207
938 3300050508 nmdc:mga09592_172832_c1 nmdc:mga09592_172832_c1_1054_1677 207
939 3300050508 nmdc:mga09592_256747_c1 nmdc:mga09592_256747_c1_474_1151 207
940 3300050508 nmdc:mga09592_305656_c1 nmdc:mga09592_305656_c1_545_1222 207
941 3300050508 nmdc:mga09592_370636_c1 nmdc:mga09592_370636_c1_557_1180 207
942 3300050508 nmdc:mga09592_433519_c1 nmdc:mga09592_433519_c1_297_920 207
943 3300050508 nmdc:mga09592_507597_c1 nmdc:mga09592_507597_c1_301_924 207
944 3300050508 nmdc:mga09592_687080_c1 nmdc:mga09592_687080_c1_221_844 207
945 3300050508 nmdc:mga09592_75905_c1 nmdc:mga09592_75905_c1_1838_2461 207
946 3300050509 nmdc:mga0qj67_339787_c1 nmdc:mga0qj67_339787_c1_322_945 207
947 3300050509 nmdc:mga0qj67_35067_c1 nmdc:mga0qj67_35067_c1_209_832 207
948 3300050509 nmdc:mga0qj67_377543_c1 nmdc:mga0qj67_377543_c1_511_1134 207
949 3300050509 nmdc:mga0qj67_413768_c1 nmdc:mga0qj67_413768_c1_240_863 207
950 3300050509 nmdc:mga0qj67_487064_c1 nmdc:mga0qj67_487064_c1_316_939 207
951 3300050509 nmdc:mga0qj67_52444_c1 nmdc:mga0qj67_52444_c1_471_1094 207
952 3300050509 nmdc:mga0qj67_7248_c1 nmdc:mga0qj67_7248_c1_6791_7468 207
953 3300050510 nmdc:mga06r32_101683_c1 nmdc:mga06r32_101683_c1_44_667 207
954 3300050510 nmdc:mga06r32_176367_c1 nmdc:mga06r32_176367_c1_1143_1766 207
955 3300050510 nmdc:mga06r32_176801_c1 nmdc:mga06r32_176801_c1_442_1065 207
956 3300050510 nmdc:mga06r32_202958_c1 nmdc:mga06r32_202958_c1_212_835 207
957 3300050510 nmdc:mga06r32_21017_c1 nmdc:mga06r32_21017_c1_450_1127 207
958 3300050510 nmdc:mga06r32_283685_c1 nmdc:mga06r32_283685_c1_963_1586 207
959 3300050510 nmdc:mga06r32_312514_c1 nmdc:mga06r32_312514_c1_658_1281 207
960 3300050510 nmdc:mga06r32_45076_c1 nmdc:mga06r32_45076_c1_3486_4109 207
961 3300050510 nmdc:mga06r32_653011_c1 nmdc:mga06r32_653011_c1_136_789 207
962 3300050510 nmdc:mga06r32_6852_c1 nmdc:mga06r32_6852_c1_4510_5133 207
963 3300050511 nmdc:mga08y16_1318648_c1 nmdc:mga08y16_1318648_c1_34_657 207
964 3300050511 nmdc:mga08y16_200287_c1 nmdc:mga08y16_200287_c1_541_1164 207
965 3300050511 nmdc:mga08y16_463068_c1 nmdc:mga08y16_463068_c1_185_808 207
966 3300050511 nmdc:mga08y16_741248_c1 nmdc:mga08y16_741248_c1_168_791 207
967 3300050511 nmdc:mga08y16_78900_c1 nmdc:mga08y16_78900_c1_113_736 207
968 3300050511 nmdc:mga08y16_872464_c1 nmdc:mga08y16_872464_c1_223_846 207
969 3300050511 nmdc:mga08y16_89545_c1 nmdc:mga08y16_89545_c1_2405_3028 207
970 3300050511 nmdc:mga08y16_9772_c1 nmdc:mga08y16_9772_c1_4881_5558 207
971 3300050512 nmdc:mga0n895_10664_c1 nmdc:mga0n895_10664_c1_3769_4392 207
972 3300050512 nmdc:mga0n895_1123_c1 nmdc:mga0n895_1123_c1_8844_9467 207
973 3300050512 nmdc:mga0n895_127369_c1 nmdc:mga0n895_127369_c1_832_1455 207
974 3300050512 nmdc:mga0n895_129603_c1 nmdc:mga0n895_129603_c1_1462_2085 207
975 3300050512 nmdc:mga0n895_1338814_c1 nmdc:mga0n895_1338814_c1_47_670 207
976 3300050512 nmdc:mga0n895_172180_c1 nmdc:mga0n895_172180_c1_94_861 207
977 3300050512 nmdc:mga0n895_177204_c1 nmdc:mga0n895_177204_c1_308_931 207
978 3300050512 nmdc:mga0n895_22284_c1 nmdc:mga0n895_22284_c1_4554_5231 207
979 3300050512 nmdc:mga0n895_233540_c1 nmdc:mga0n895_233540_c1_687_1310 207
980 3300050512 nmdc:mga0n895_266001_c1 nmdc:mga0n895_266001_c1_563_1186 207
981 3300050512 nmdc:mga0n895_31868_c1 nmdc:mga0n895_31868_c1_1266_1889 207
982 3300050512 nmdc:mga0n895_332683_c1 nmdc:mga0n895_332683_c1_182_805 207
983 3300050512 nmdc:mga0n895_344847_c1 nmdc:mga0n895_344847_c1_101_754 207
984 3300050512 nmdc:mga0n895_368247_c1 nmdc:mga0n895_368247_c1_95_769 207
985 3300050512 nmdc:mga0n895_39905_c1 nmdc:mga0n895_39905_c1_2696_3325 207
986 3300050512 nmdc:mga0n895_403302_c1 nmdc:mga0n895_403302_c1_95_718 207
987 3300050512 nmdc:mga0n895_453875_c1 nmdc:mga0n895_453875_c1_271_894 207
988 3300050512 nmdc:mga0n895_482075_c1 nmdc:mga0n895_482075_c1_585_1208 207
989 3300050512 nmdc:mga0n895_486897_c1 nmdc:mga0n895_486897_c1_499_1137 207
990 3300050512 nmdc:mga0n895_623932_c1 nmdc:mga0n895_623932_c1_98_721 207
991 3300050512 nmdc:mga0n895_645233_c1 nmdc:mga0n895_645233_c1_269_1006 207
992 3300050512 nmdc:mga0n895_700_c1 nmdc:mga0n895_700_c1_10499_11122 207
993 3300050512 nmdc:mga0n895_716247_c1 nmdc:mga0n895_716247_c1_271_894 207
994 3300050512 nmdc:mga0n895_86186_c1 nmdc:mga0n895_86186_c1_1181_1804 207
995 3300050512 nmdc:mga0n895_97034_c1 nmdc:mga0n895_97034_c1_1477_2100 207
996 3300050513 nmdc:mga0rr50_124979_c1 nmdc:mga0rr50_124979_c1_571_1194 207
997 3300050513 nmdc:mga0rr50_1261_c1 nmdc:mga0rr50_1261_c1_9703_10326 207
998 3300050513 nmdc:mga0rr50_129763_c1 nmdc:mga0rr50_129763_c1_882_1535 207
999 3300050513 nmdc:mga0rr50_154421_c1 nmdc:mga0rr50_154421_c1_779_1453 207
1000 3300050513 nmdc:mga0rr50_162833_c1 nmdc:mga0rr50_162833_c1_15_638 207
1001 3300050513 nmdc:mga0rr50_189173_c1 nmdc:mga0rr50_189173_c1_251_874 207
1002 3300050513 nmdc:mga0rr50_198472_c1 nmdc:mga0rr50_198472_c1_779_1402 207
1003 3300050513 nmdc:mga0rr50_255069_c1 nmdc:mga0rr50_255069_c1_218_856 207
1004 3300050513 nmdc:mga0rr50_2634_c1 nmdc:mga0rr50_2634_c1_2233_2856 207
1005 3300050513 nmdc:mga0rr50_29527_c1 nmdc:mga0rr50_29527_c1_1186_1809 207
1006 3300050513 nmdc:mga0rr50_30672_c1 nmdc:mga0rr50_30672_c1_1492_2115 207
1007 3300050513 nmdc:mga0rr50_328189_c1 nmdc:mga0rr50_328189_c1_177_800 207
1008 3300050513 nmdc:mga0rr50_339854_c1 nmdc:mga0rr50_339854_c1_474_1097 207
1009 3300050513 nmdc:mga0rr50_404737_c1 nmdc:mga0rr50_404737_c1_297_920 207
1010 3300050513 nmdc:mga0rr50_418565_c1 nmdc:mga0rr50_418565_c1_75_698 207
1011 3300050513 nmdc:mga0rr50_420213_c1 nmdc:mga0rr50_420213_c1_132_755 207
1012 3300050513 nmdc:mga0rr50_4367_c1 nmdc:mga0rr50_4367_c1_196_819 207
1013 3300050513 nmdc:mga0rr50_573584_c1 nmdc:mga0rr50_573584_c1_50_673 207
1014 3300050513 nmdc:mga0rr50_589072_c1 nmdc:mga0rr50_589072_c1_13_696 207
1015 3300050513 nmdc:mga0rr50_68445_c1 nmdc:mga0rr50_68445_c1_1194_1961 207
1016 3300050513 nmdc:mga0rr50_753288_c1 nmdc:mga0rr50_753288_c1_131_808 207
1017 3300050513 nmdc:mga0rr50_9648_c1 nmdc:mga0rr50_9648_c1_4743_5372 207
1018 3300050514 nmdc:mga08x19_13343_c1 nmdc:mga08x19_13343_c1_3832_4455 207
1019 3300050514 nmdc:mga08x19_1479_c1 nmdc:mga08x19_1479_c1_1793_2416 207
1020 3300050514 nmdc:mga08x19_148088_c1 nmdc:mga08x19_148088_c1_142_765 207
1021 3300050514 nmdc:mga08x19_193062_c1 nmdc:mga08x19_193062_c1_608_1231 207
1022 3300050514 nmdc:mga08x19_204887_c1 nmdc:mga08x19_204887_c1_402_1031 207
1023 3300050514 nmdc:mga08x19_219599_c1 nmdc:mga08x19_219599_c1_351_989 207
1024 3300050514 nmdc:mga08x19_220521_c1 nmdc:mga08x19_220521_c1_615_1244 207
1025 3300050514 nmdc:mga08x19_225258_c1 nmdc:mga08x19_225258_c1_195_818 207
1026 3300050514 nmdc:mga08x19_232105_c1 nmdc:mga08x19_232105_c1_172_795 207
1027 3300050514 nmdc:mga08x19_256775_c1 nmdc:mga08x19_256775_c1_23_676 207
1028 3300050514 nmdc:mga08x19_272945_c1 nmdc:mga08x19_272945_c1_476_1099 207
1029 3300050514 nmdc:mga08x19_3476_c1 nmdc:mga08x19_3476_c1_2580_3203 207
1030 3300050514 nmdc:mga08x19_450771_c1 nmdc:mga08x19_450771_c1_40_726 207
1031 3300050514 nmdc:mga08x19_45717_c1 nmdc:mga08x19_45717_c1_263_892 207
1032 3300050514 nmdc:mga08x19_633567_c1 nmdc:mga08x19_633567_c1_93_716 207
1033 3300050514 nmdc:mga08x19_8_c1 nmdc:mga08x19_8_c1_424092_424715 207
1034 3300050515 nmdc:mga0a205_143966_c1 nmdc:mga0a205_143966_c1_20_673 207
1035 3300050515 nmdc:mga0a205_152988_c1 nmdc:mga0a205_152988_c1_999_1622 207
1036 3300050515 nmdc:mga0a205_173009_c1 nmdc:mga0a205_173009_c1_432_1055 207
1037 3300050515 nmdc:mga0a205_18021_c1 nmdc:mga0a205_18021_c1_273_896 207
1038 3300050515 nmdc:mga0a205_187531_c1 nmdc:mga0a205_187531_c1_903_1526 207
1039 3300050515 nmdc:mga0a205_19381_c1 nmdc:mga0a205_19381_c1_953_1576 207
1040 3300050515 nmdc:mga0a205_204353_c1 nmdc:mga0a205_204353_c1_419_1042 207
1041 3300050515 nmdc:mga0a205_222345_c1 nmdc:mga0a205_222345_c1_169_792 207
1042 3300050515 nmdc:mga0a205_241335_c1 nmdc:mga0a205_241335_c1_876_1499 207
1043 3300050515 nmdc:mga0a205_285366_c1 nmdc:mga0a205_285366_c1_833_1456 207
1044 3300050515 nmdc:mga0a205_3019_c1 nmdc:mga0a205_3019_c1_10519_11142 207
1045 3300050515 nmdc:mga0a205_302010_c1 nmdc:mga0a205_302010_c1_678_1304 207
1046 3300050515 nmdc:mga0a205_343167_c1 nmdc:mga0a205_343167_c1_632_1255 207
1047 3300050515 nmdc:mga0a205_3796_c2 nmdc:mga0a205_3796_c2_6648_7325 207
1048 3300050515 nmdc:mga0a205_42037_c1 nmdc:mga0a205_42037_c1_722_1345 207
1049 3300050515 nmdc:mga0a205_42924_c1 nmdc:mga0a205_42924_c1_3505_4128 207
1050 3300050515 nmdc:mga0a205_443829_c1 nmdc:mga0a205_443829_c1_134_757 207
1051 3300050515 nmdc:mga0a205_457504_c1 nmdc:mga0a205_457504_c1_427_1050 207
1052 3300050515 nmdc:mga0a205_4777_c1 nmdc:mga0a205_4777_c1_11123_11746 207
1053 3300050515 nmdc:mga0a205_488759_c1 nmdc:mga0a205_488759_c1_148_828 207
1054 3300050515 nmdc:mga0a205_54934_c1 nmdc:mga0a205_54934_c1_1422_2189 207
1055 3300050515 nmdc:mga0a205_598624_c1 nmdc:mga0a205_598624_c1_10_633 207
1056 3300050515 nmdc:mga0a205_659212_c1 nmdc:mga0a205_659212_c1_158_781 207
1057 3300050515 nmdc:mga0a205_6966_c1 nmdc:mga0a205_6966_c1_7893_8516 207
1058 3300050515 nmdc:mga0a205_76307_c1 nmdc:mga0a205_76307_c1_1383_2006 207
1059 3300053077 Ga0495601_0125076 Ga0495601_0125076_201_884 207
1060 3300053078 Ga0495612_0102120 Ga0495612_0102120_506_1204 207
1061 3300053084 Ga0495595_0107367 Ga0495595_0107367_510_1208 207
1062 3300053085 Ga0495619_0050521 Ga0495619_0050521_828_1526 207
1063 3300053125 Ga0500618_001429 Ga0500618_001429_279_1016 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

36

186

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.9311 9 193
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9058 8 205
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.8876 8 207
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.8841 8 207
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.8762 8 205
ID Description Score Start End Superfamily
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.931 10 193 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9056 9 193 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8875 10 198 3.40.50.850
af_Q54RC7_3_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8855 9 191 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8847 8 207 3.40.50.850
ID Description Score Start End GO Terms
AF-U3U4G6-F1-model_v4 Isochorismatase hydrolase 0.9755 7 133 GO:0016787
AF-B8L5H2-F1-model_v4 Isochorismatase hydrolase (EC 3.3.2.1) 0.9741 20 161 GO:0008908
AF-A0A377Z2N5-F1-model_v4 Isochorismatase family protein 0.9739 9 163
AF-A0A447J483-F1-model_v4 deleted 0.9738 7 174
AF-A0A1H6P1D7-F1-model_v4 deleted 0.9734 8 167

Feature Viewer

pLDDT pTM Quality
91.35 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map