F489336
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1063 | 316 | 1064 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_517578_c1|nmdc:mga0n895_517578_c1_288_962 |
| Length | 224 |
| Sequence | MGAAPFIATAAQTRQSQENEMFDQIRPYDPLTSENAALVLIDHQVGLMTGVRDYSTGELKHNVVALAKAAKALKLPIVATTTARDSMWGPTFPELVVALPGVQIIDRSSVNAFDDTRVAQATGRKKLIFAGISLEVCAAFPAITAVGKGYSAYVAVDASGTFSETKRQVGLLRMLQAGVIVSDYATLMVEILKDNARPEAGAVYGTIDMPWAKLVGQIAQAYGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 136 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 137 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 138 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 139 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 140 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 141 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 222 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 294 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 295 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.11 |
| Nodule | 0.38 |
| Rhizoplane | 5.93 |
| Rhizosphere | 85.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1001022 | 3300002737 | Bacteria | 17340 |
| 2 | JGI25150J39212_1000044 | 3300002774 | Bacteria | 83125 |
| 3 | JGI25150J39212_1000132 | 3300002774 | Bacteria | 41803 |
| 4 | JGI25159J45721_1016594 | 3300002987 | Bacteria | 1563 |
| 5 | JGI25151J46595_10021401 | 3300003187 | Bacteria | 2706 |
| 6 | JGI25165J46597_1000276 | 3300003214 | Bacteria | 66076 |
| 7 | JGI25153J46596_10000043 | 3300003215 | Bacteria | 156407 |
| 8 | JGI25153J46596_10000265 | 3300003215 | Bacteria | 41811 |
| 9 | rootH1_10042237 | 3300003316 | Bacteria | 2968 |
| 10 | rootH1_10016176 | 3300003316 | Bacteria | 26999 |
| 11 | rootH1_10016176 | 3300003323 | Bacteria | 2806 |
| 12 | rootH1_10077686 | 3300003323 | Bacteria | 3548 |
| 13 | JGI25160J50197_1032623 | 3300003354 | Bacteria | 1320 |
| 14 | JGI25407J50210_10054340 | 3300003373 | Bacteria | 1012 |
| 15 | JGI25404J52841_10028741 | 3300003659 | Bacteria | 1193 |
| 16 | Ga0055526_1008793 | 3300003771 | Bacteria | 4971 |
| 17 | Ga0055526_1043098 | 3300003771 | Bacteria | 1103 |
| 18 | Ga0055537_1000553 | 3300003773 | Bacteria | 21212 |
| 19 | Ga0055524_1000017 | 3300003775 | Bacteria | 235608 |
| 20 | Ga0055536_1000393 | 3300003781 | Bacteria | 31775 |
| 21 | Ga0055530_10009972 | 3300003791 | Bacteria | 3574 |
| 22 | Ga0055540_1041615 | 3300003792 | Bacteria | 988 |
| 23 | Ga0055531_10000805 | 3300003794 | Bacteria | 26002 |
| 24 | Ga0055531_10002275 | 3300003794 | Bacteria | 12993 |
| 25 | JGI25405J52794_10001047 | 3300003911 | Bacteria | 4401 |
| 26 | Ga0065165_1001283 | 3300005262 | Bacteria | 28362 |
| 27 | Ga0065165_1011885 | 3300005262 | Bacteria | 3585 |
| 28 | Ga0065704_10105882 | 3300005289 | Bacteria | 2098 |
| 29 | Ga0065712_10001241 | 3300005290 | Bacteria | 6376 |
| 30 | Ga0065712_10295978 | 3300005290 | Bacteria | 869 |
| 31 | Ga0065715_10095973 | 3300005293 | Bacteria | 3970 |
| 32 | Ga0065715_10150025 | 3300005293 | Bacteria | 1740 |
| 33 | Ga0065715_10300473 | 3300005293 | Bacteria | 1042 |
| 34 | Ga0065715_10344713 | 3300005293 | Bacteria | 961 |
| 35 | Ga0065707_10066515 | 3300005295 | Bacteria | 975 |
| 36 | Ga0065707_10084964 | 3300005295 | Bacteria | 6594 |
| 37 | Ga0070666_10040482 | 3300005335 | Bacteria | 3111 |
| 38 | Ga0070682_100003792 | 3300005337 | Bacteria | 8402 |
| 39 | Ga0070682_100080519 | 3300005337 | Unclassified | 2106 |
| 40 | Ga0070682_100598915 | 3300005337 | Bacteria | 870 |
| 41 | Ga0068868_100201975 | 3300005338 | Bacteria | 1657 |
| 42 | Ga0068868_101277302 | 3300005338 | Bacteria | 681 |
| 43 | Ga0070660_100023777 | 3300005339 | Unclassified | 4541 |
| 44 | Ga0070689_100018067 | 3300005340 | Bacteria | 5188 |
| 45 | Ga0070689_100027619 | 3300005340 | Bacteria | 4279 |
| 46 | Ga0070691_10009813 | 3300005341 | Bacteria | 4366 |
| 47 | Ga0070691_10017350 | 3300005341 | Unclassified | 3312 |
| 48 | Ga0070687_100017106 | 3300005343 | Bacteria | 3326 |
| 49 | Ga0070661_100288636 | 3300005344 | Bacteria | 1274 |
| 50 | Ga0070668_100019648 | 3300005347 | Bacteria | 5086 |
| 51 | Ga0070668_100414151 | 3300005347 | Bacteria | 1153 |
| 52 | Ga0070668_100514818 | 3300005347 | Bacteria | 1037 |
| 53 | Ga0070668_100836728 | 3300005347 | Bacteria | 819 |
| 54 | Ga0070669_100037023 | 3300005353 | Bacteria | 3538 |
| 55 | Ga0070669_100120918 | 3300005353 | Bacteria | 1998 |
| 56 | Ga0070669_100667130 | 3300005353 | Bacteria | 876 |
| 57 | Ga0070671_100078248 | 3300005355 | Bacteria | 2764 |
| 58 | Ga0070671_100492473 | 3300005355 | Unclassified | 1054 |
| 59 | Ga0070671_100807460 | 3300005355 | Bacteria | 817 |
| 60 | Ga0070674_100142987 | 3300005356 | Bacteria | 1798 |
| 61 | Ga0070688_100042784 | 3300005365 | Bacteria | 2788 |
| 62 | Ga0070688_100534970 | 3300005365 | Bacteria | 889 |
| 63 | Ga0070667_100140252 | 3300005367 | Bacteria | 2116 |
| 64 | Ga0070667_100141623 | 3300005367 | Bacteria | 2106 |
| 65 | Ga0070703_10064253 | 3300005406 | Bacteria | 1209 |
| 66 | Ga0070703_10151273 | 3300005406 | Bacteria | 872 |
| 67 | Ga0070703_10160910 | 3300005406 | Unclassified | 852 |
| 68 | Ga0070703_10196478 | 3300005406 | Bacteria | 789 |
| 69 | Ga0070709_10004844 | 3300005434 | Bacteria | 7276 |
| 70 | Ga0070714_100074415 | 3300005435 | Bacteria | 2944 |
| 71 | Ga0070714_100074880 | 3300005435 | Bacteria | 2936 |
| 72 | Ga0070714_100153402 | 3300005435 | Bacteria | 2078 |
| 73 | Ga0070714_100839701 | 3300005435 | Bacteria | 890 |
| 74 | Ga0070713_100027663 | 3300005436 | Bacteria | 4467 |
| 75 | Ga0070713_100060530 | 3300005436 | Bacteria | 3165 |
| 76 | Ga0070713_100080320 | 3300005436 | Bacteria | 2780 |
| 77 | Ga0070713_100081033 | 3300005436 | Bacteria | 2769 |
| 78 | Ga0070713_100176424 | 3300005436 | Bacteria | 1918 |
| 79 | Ga0070713_100334988 | 3300005436 | Bacteria | 1401 |
| 80 | Ga0070713_100446178 | 3300005436 | Bacteria | 1214 |
| 81 | Ga0070713_100581494 | 3300005436 | Bacteria | 1063 |
| 82 | Ga0070713_100754813 | 3300005436 | Bacteria | 931 |
| 83 | Ga0070713_101282739 | 3300005436 | Bacteria | 710 |
| 84 | Ga0070710_10012689 | 3300005437 | Bacteria | 4193 |
| 85 | Ga0070710_10051571 | 3300005437 | Bacteria | 2310 |
| 86 | Ga0070710_10066255 | 3300005437 | Bacteria | 2070 |
| 87 | Ga0070710_10075010 | 3300005437 | Bacteria | 1958 |
| 88 | Ga0070710_10075659 | 3300005437 | Bacteria | 1952 |
| 89 | Ga0070710_10236370 | 3300005437 | Bacteria | 1169 |
| 90 | Ga0070711_100001412 | 3300005439 | Bacteria | 13173 |
| 91 | Ga0070711_100042018 | 3300005439 | Bacteria | 3089 |
| 92 | Ga0070711_100229132 | 3300005439 | Bacteria | 1448 |
| 93 | Ga0070711_100246346 | 3300005439 | Bacteria | 1400 |
| 94 | Ga0070705_100079313 | 3300005440 | Bacteria | 2011 |
| 95 | Ga0070705_100523006 | 3300005440 | Bacteria | 904 |
| 96 | Ga0070705_100710452 | 3300005440 | Bacteria | 790 |
| 97 | Ga0070694_100017290 | 3300005444 | Bacteria | 4555 |
| 98 | Ga0070694_100382885 | 3300005444 | Bacteria | 1097 |
| 99 | Ga0070694_100463437 | 3300005444 | Bacteria | 1003 |
| 100 | Ga0070694_100508519 | 3300005444 | Bacteria | 959 |
| 101 | Ga0070708_100000327 | 3300005445 | Bacteria | 35749 |
| 102 | Ga0070708_100011819 | 3300005445 | Bacteria | 7104 |
| 103 | Ga0070708_100024936 | 3300005445 | Bacteria | 5110 |
| 104 | Ga0070708_100039861 | 3300005445 | Bacteria | 4112 |
| 105 | Ga0070708_100086373 | 3300005445 | Bacteria | 2849 |
| 106 | Ga0070708_100097597 | 3300005445 | Unclassified | 2686 |
| 107 | Ga0070708_100124707 | 3300005445 | Bacteria | 2379 |
| 108 | Ga0070708_100150992 | 3300005445 | Bacteria | 2160 |
| 109 | Ga0070708_100152133 | 3300005445 | Bacteria | 2152 |
| 110 | Ga0070708_100195530 | 3300005445 | Bacteria | 1892 |
| 111 | Ga0070708_100198356 | 3300005445 | Bacteria | 1878 |
| 112 | Ga0070708_100203302 | 3300005445 | Bacteria | 1855 |
| 113 | Ga0070708_100262275 | 3300005445 | Bacteria | 1624 |
| 114 | Ga0070708_100262598 | 3300005445 | Bacteria | 1623 |
| 115 | Ga0070708_100332498 | 3300005445 | Bacteria | 1431 |
| 116 | Ga0070708_100355751 | 3300005445 | Bacteria | 1380 |
| 117 | Ga0070708_100556719 | 3300005445 | Bacteria | 1082 |
| 118 | Ga0070663_100011764 | 3300005455 | Bacteria | 5508 |
| 119 | Ga0070663_100016703 | 3300005455 | Bacteria | 4775 |
| 120 | Ga0070678_100002534 | 3300005456 | Bacteria | 10017 |
| 121 | Ga0070662_100009553 | 3300005457 | Bacteria | 6348 |
| 122 | Ga0068867_100045742 | 3300005459 | Bacteria | 3211 |
| 123 | Ga0070685_10064247 | 3300005466 | Bacteria | 2157 |
| 124 | Ga0070706_100004540 | 3300005467 | Bacteria | 13358 |
| 125 | Ga0070706_100006358 | 3300005467 | Bacteria | 11157 |
| 126 | Ga0070706_100007422 | 3300005467 | Bacteria | 10282 |
| 127 | Ga0070706_100009362 | 3300005467 | Bacteria | 9120 |
| 128 | Ga0070706_100019204 | 3300005467 | Bacteria | 6306 |
| 129 | Ga0070706_100029868 | 3300005467 | Bacteria | 5020 |
| 130 | Ga0070706_100141986 | 3300005467 | Unclassified | 2241 |
| 131 | Ga0070706_100157119 | 3300005467 | Unclassified | 2123 |
| 132 | Ga0070706_100159878 | 3300005467 | Bacteria | 2103 |
| 133 | Ga0070706_100214579 | 3300005467 | Unclassified | 1796 |
| 134 | Ga0070706_100344381 | 3300005467 | Bacteria | 1390 |
| 135 | Ga0070706_100643487 | 3300005467 | Unclassified | 984 |
| 136 | Ga0070707_100009021 | 3300005468 | Bacteria | 9251 |
| 137 | Ga0070707_100009843 | 3300005468 | Bacteria | 8896 |
| 138 | Ga0070707_100018493 | 3300005468 | Bacteria | 6556 |
| 139 | Ga0070707_100030862 | 3300005468 | Bacteria | 5104 |
| 140 | Ga0070707_100033453 | 3300005468 | Bacteria | 4902 |
| 141 | Ga0070707_100065091 | 3300005468 | Bacteria | 3501 |
| 142 | Ga0070707_100126479 | 3300005468 | Bacteria | 2484 |
| 143 | Ga0070707_100139495 | 3300005468 | Bacteria | 2359 |
| 144 | Ga0070707_100258676 | 3300005468 | Bacteria | 1694 |
| 145 | Ga0070707_100261425 | 3300005468 | Bacteria | 1684 |
| 146 | Ga0070707_100373945 | 3300005468 | Bacteria | 1384 |
| 147 | Ga0070707_100444884 | 3300005468 | Bacteria | 1256 |
| 148 | Ga0070707_100487286 | 3300005468 | Bacteria | 1194 |
| 149 | Ga0070707_100621527 | 3300005468 | Bacteria | 1043 |
| 150 | Ga0070707_100675305 | 3300005468 | Bacteria | 996 |
| 151 | Ga0070707_100700568 | 3300005468 | Bacteria | 976 |
| 152 | Ga0070698_100008194 | 3300005471 | Bacteria | 11303 |
| 153 | Ga0070698_100014041 | 3300005471 | Bacteria | 8470 |
| 154 | Ga0070698_100029756 | 3300005471 | Bacteria | 5667 |
| 155 | Ga0070698_100034175 | 3300005471 | Bacteria | 5266 |
| 156 | Ga0070698_100054828 | 3300005471 | Bacteria | 4046 |
| 157 | Ga0070698_100061029 | 3300005471 | Bacteria | 3803 |
| 158 | Ga0070698_100064612 | 3300005471 | Bacteria | 3686 |
| 159 | Ga0070698_100087994 | 3300005471 | Bacteria | 3091 |
| 160 | Ga0070698_100089099 | 3300005471 | Bacteria | 3070 |
| 161 | Ga0070698_100109669 | 3300005471 | Unclassified | 2726 |
| 162 | Ga0070698_100114191 | 3300005471 | Bacteria | 2665 |
| 163 | Ga0070698_100214036 | 3300005471 | Bacteria | 1861 |
| 164 | Ga0070698_100303321 | 3300005471 | Bacteria | 1528 |
| 165 | Ga0070698_100334536 | 3300005471 | Bacteria | 1445 |
| 166 | Ga0070698_100454634 | 3300005471 | Bacteria | 1216 |
| 167 | Ga0070698_100557483 | 3300005471 | Bacteria | 1085 |
| 168 | Ga0070698_100868048 | 3300005471 | Bacteria | 847 |
| 169 | Ga0070698_100892199 | 3300005471 | Unclassified | 834 |
| 170 | Ga0070699_100004190 | 3300005518 | Bacteria | 12763 |
| 171 | Ga0070699_100017176 | 3300005518 | Bacteria | 6213 |
| 172 | Ga0070699_100054650 | 3300005518 | Bacteria | 3456 |
| 173 | Ga0070699_100077202 | 3300005518 | Bacteria | 2899 |
| 174 | Ga0070699_100078547 | 3300005518 | Bacteria | 2874 |
| 175 | Ga0070699_100137897 | 3300005518 | Bacteria | 2152 |
| 176 | Ga0070699_100210749 | 3300005518 | Bacteria | 1730 |
| 177 | Ga0070699_100274525 | 3300005518 | Bacteria | 1509 |
| 178 | Ga0070699_100347088 | 3300005518 | Bacteria | 1336 |
| 179 | Ga0070699_100358408 | 3300005518 | Bacteria | 1315 |
| 180 | Ga0070699_100398865 | 3300005518 | Bacteria | 1243 |
| 181 | Ga0070699_100401805 | 3300005518 | Bacteria | 1239 |
| 182 | Ga0070699_100453804 | 3300005518 | Bacteria | 1162 |
| 183 | Ga0070699_100505170 | 3300005518 | Bacteria | 1098 |
| 184 | Ga0070699_100545237 | 3300005518 | Bacteria | 1055 |
| 185 | Ga0070699_100948268 | 3300005518 | Bacteria | 788 |
| 186 | Ga0070697_100007293 | 3300005536 | Bacteria | 8600 |
| 187 | Ga0070697_100007757 | 3300005536 | Bacteria | 8357 |
| 188 | Ga0070697_100017733 | 3300005536 | Bacteria | 5608 |
| 189 | Ga0070697_100032620 | 3300005536 | Bacteria | 4192 |
| 190 | Ga0070697_100041917 | 3300005536 | Bacteria | 3705 |
| 191 | Ga0070697_100101570 | 3300005536 | Unclassified | 2389 |
| 192 | Ga0070697_100116022 | 3300005536 | Bacteria | 2236 |
| 193 | Ga0070697_100131380 | 3300005536 | Bacteria | 2100 |
| 194 | Ga0070697_100200865 | 3300005536 | Bacteria | 1695 |
| 195 | Ga0070697_100254396 | 3300005536 | Bacteria | 1502 |
| 196 | Ga0070697_100353426 | 3300005536 | Bacteria | 1269 |
| 197 | Ga0070697_100385229 | 3300005536 | Bacteria | 1215 |
| 198 | Ga0070697_100438865 | 3300005536 | Bacteria | 1136 |
| 199 | Ga0070697_100523208 | 3300005536 | Unclassified | 1038 |
| 200 | Ga0070697_100565601 | 3300005536 | Bacteria | 998 |
| 201 | Ga0070697_100986311 | 3300005536 | Bacteria | 749 |
| 202 | Ga0068853_100017172 | 3300005539 | Bacteria | 5971 |
| 203 | Ga0068853_100231603 | 3300005539 | Bacteria | 1690 |
| 204 | Ga0070672_100030559 | 3300005543 | Bacteria | 4048 |
| 205 | Ga0070686_100006693 | 3300005544 | Bacteria | 6415 |
| 206 | Ga0070695_100027617 | 3300005545 | Unclassified | 3517 |
| 207 | Ga0070695_100027867 | 3300005545 | Bacteria | 3502 |
| 208 | Ga0070695_100065982 | 3300005545 | Bacteria | 2358 |
| 209 | Ga0070695_100435303 | 3300005545 | Bacteria | 1001 |
| 210 | Ga0070695_100562165 | 3300005545 | Bacteria | 890 |
| 211 | Ga0070695_100844889 | 3300005545 | Bacteria | 736 |
| 212 | Ga0070696_100034202 | 3300005546 | Bacteria | 3495 |
| 213 | Ga0070696_100036799 | 3300005546 | Bacteria | 3375 |
| 214 | Ga0070696_100046895 | 3300005546 | Bacteria | 2998 |
| 215 | Ga0070696_100103608 | 3300005546 | Bacteria | 2042 |
| 216 | Ga0070696_100148354 | 3300005546 | Bacteria | 1719 |
| 217 | Ga0070696_100181210 | 3300005546 | Bacteria | 1563 |
| 218 | Ga0070696_100196543 | 3300005546 | Bacteria | 1504 |
| 219 | Ga0070696_100244947 | 3300005546 | Bacteria | 1353 |
| 220 | Ga0070696_100316303 | 3300005546 | Bacteria | 1200 |
| 221 | Ga0070696_100528193 | 3300005546 | Bacteria | 942 |
| 222 | Ga0070665_100005888 | 3300005548 | Bacteria | 12561 |
| 223 | Ga0070665_100099412 | 3300005548 | Bacteria | 2913 |
| 224 | Ga0070665_100488105 | 3300005548 | Bacteria | 1243 |
| 225 | Ga0070665_100766005 | 3300005548 | Unclassified | 978 |
| 226 | Ga0070704_100020569 | 3300005549 | Bacteria | 4258 |
| 227 | Ga0070704_100022009 | 3300005549 | Bacteria | 4143 |
| 228 | Ga0070704_100030427 | 3300005549 | Bacteria | 3617 |
| 229 | Ga0070704_100226560 | 3300005549 | Bacteria | 1522 |
| 230 | Ga0070704_100243905 | 3300005549 | Bacteria | 1472 |
| 231 | Ga0070704_100265153 | 3300005549 | Bacteria | 1417 |
| 232 | Ga0070704_100377307 | 3300005549 | Bacteria | 1204 |
| 233 | Ga0070704_100573656 | 3300005549 | Bacteria | 988 |
| 234 | Ga0070704_100596189 | 3300005549 | Bacteria | 971 |
| 235 | Ga0070664_100211057 | 3300005564 | Unclassified | 1735 |
| 236 | Ga0068857_100017155 | 3300005577 | Bacteria | 6341 |
| 237 | Ga0068854_100011429 | 3300005578 | Bacteria | 5781 |
| 238 | Ga0068854_100049570 | 3300005578 | Bacteria | 3000 |
| 239 | Ga0068854_100523771 | 3300005578 | Bacteria | 1002 |
| 240 | Ga0070702_100001810 | 3300005615 | Bacteria | 8892 |
| 241 | Ga0068852_100012556 | 3300005616 | Bacteria | 6434 |
| 242 | Ga0068859_100362090 | 3300005617 | Bacteria | 1545 |
| 243 | Ga0068864_100269485 | 3300005618 | Unclassified | 1586 |
| 244 | Ga0068866_10469634 | 3300005718 | Bacteria | 826 |
| 245 | Ga0068861_100034650 | 3300005719 | Bacteria | 3734 |
| 246 | Ga0068861_100119064 | 3300005719 | Bacteria | 2128 |
| 247 | Ga0068861_100271996 | 3300005719 | Bacteria | 1455 |
| 248 | Ga0068861_100475677 | 3300005719 | Bacteria | 1124 |
| 249 | Ga0068863_100012142 | 3300005841 | Bacteria | 8322 |
| 250 | Ga0068858_100228910 | 3300005842 | Bacteria | 1762 |
| 251 | Ga0068860_100016584 | 3300005843 | Bacteria | 7184 |
| 252 | Ga0068860_100892269 | 3300005843 | Bacteria | 905 |
| 253 | Ga0068862_100009669 | 3300005844 | Bacteria | 7969 |
| 254 | Ga0081455_10006446 | 3300005937 | Bacteria | 12576 |
| 255 | Ga0081455_10010595 | 3300005937 | Bacteria | 9330 |
| 256 | Ga0081455_10116873 | 3300005937 | Bacteria | 2109 |
| 257 | Ga0081538_10003905 | 3300005981 | Bacteria | 13909 |
| 258 | Ga0081538_10008589 | 3300005981 | Bacteria | 8643 |
| 259 | Ga0081538_10012492 | 3300005981 | Bacteria | 6804 |
| 260 | Ga0081538_10135447 | 3300005981 | Bacteria | 1148 |
| 261 | Ga0081540_1000494 | 3300005983 | Bacteria | 38779 |
| 262 | Ga0081540_1052217 | 3300005983 | Bacteria | 2015 |
| 263 | Ga0081539_10061200 | 3300005985 | Bacteria | 2063 |
| 264 | Ga0070717_10011227 | 3300006028 | Bacteria | 6793 |
| 265 | Ga0070717_10013507 | 3300006028 | Bacteria | 6260 |
| 266 | Ga0070717_10111075 | 3300006028 | Bacteria | 2338 |
| 267 | Ga0070717_10111664 | 3300006028 | Bacteria | 2332 |
| 268 | Ga0070717_10153964 | 3300006028 | Bacteria | 1990 |
| 269 | Ga0070717_10163817 | 3300006028 | Bacteria | 1930 |
| 270 | Ga0070717_10325851 | 3300006028 | Bacteria | 1369 |
| 271 | Ga0070717_10470178 | 3300006028 | Bacteria | 1135 |
| 272 | Ga0070717_10548576 | 3300006028 | Unclassified | 1047 |
| 273 | Ga0070717_10642939 | 3300006028 | Bacteria | 963 |
| 274 | Ga0070717_10906287 | 3300006028 | Bacteria | 803 |
| 275 | Ga0075365_10141022 | 3300006038 | Unclassified | 1673 |
| 276 | Ga0075368_10013725 | 3300006042 | Bacteria | 2979 |
| 277 | Ga0075363_100000487 | 3300006048 | Bacteria | 12588 |
| 278 | Ga0075364_10048714 | 3300006051 | Bacteria | 2762 |
| 279 | Ga0075364_10536748 | 3300006051 | Bacteria | 800 |
| 280 | Ga0070715_10019337 | 3300006163 | Unclassified | 2611 |
| 281 | Ga0070715_10019458 | 3300006163 | Bacteria | 2605 |
| 282 | Ga0070715_10094818 | 3300006163 | Bacteria | 1380 |
| 283 | Ga0070715_10307258 | 3300006163 | Bacteria | 851 |
| 284 | Ga0070716_100002178 | 3300006173 | Bacteria | 9012 |
| 285 | Ga0070716_100011404 | 3300006173 | Bacteria | 4473 |
| 286 | Ga0070716_100023382 | 3300006173 | Bacteria | 3277 |
| 287 | Ga0070716_100086870 | 3300006173 | Bacteria | 1883 |
| 288 | Ga0070716_100151142 | 3300006173 | Bacteria | 1494 |
| 289 | Ga0070716_100225498 | 3300006173 | Bacteria | 1262 |
| 290 | Ga0070716_100228945 | 3300006173 | Bacteria | 1253 |
| 291 | Ga0070716_100241319 | 3300006173 | Bacteria | 1225 |
| 292 | Ga0070716_100564528 | 3300006173 | Bacteria | 851 |
| 293 | Ga0070716_100610680 | 3300006173 | Bacteria | 822 |
| 294 | Ga0070712_100003950 | 3300006175 | Bacteria | 9122 |
| 295 | Ga0070712_100006417 | 3300006175 | Bacteria | 7296 |
| 296 | Ga0070712_100058515 | 3300006175 | Bacteria | 2711 |
| 297 | Ga0070712_100059493 | 3300006175 | Bacteria | 2691 |
| 298 | Ga0070712_100709512 | 3300006175 | Bacteria | 858 |
| 299 | Ga0070712_100820479 | 3300006175 | Bacteria | 799 |
| 300 | Ga0075367_10177329 | 3300006178 | Bacteria | 1328 |
| 301 | Ga0097621_100761348 | 3300006237 | Bacteria | 895 |
| 302 | Ga0075370_10011330 | 3300006353 | Bacteria | 4682 |
| 303 | Ga0068871_100228670 | 3300006358 | Bacteria | 1614 |
| 304 | Ga0068871_100273776 | 3300006358 | Bacteria | 1475 |
| 305 | Ga0075428_100026406 | 3300006844 | Bacteria | 6429 |
| 306 | Ga0075428_100027761 | 3300006844 | Bacteria | 6262 |
| 307 | Ga0075428_100044754 | 3300006844 | Bacteria | 4863 |
| 308 | Ga0075428_100068519 | 3300006844 | Bacteria | 3881 |
| 309 | Ga0075428_100097710 | 3300006844 | Bacteria | 3201 |
| 310 | Ga0075428_100099150 | 3300006844 | Bacteria | 3176 |
| 311 | Ga0075428_100122741 | 3300006844 | Bacteria | 2827 |
| 312 | Ga0075428_100156310 | 3300006844 | Bacteria | 2477 |
| 313 | Ga0075428_100162662 | 3300006844 | Bacteria | 2422 |
| 314 | Ga0075428_100192864 | 3300006844 | Unclassified | 2203 |
| 315 | Ga0075428_100219793 | 3300006844 | Bacteria | 2052 |
| 316 | Ga0075428_100226376 | 3300006844 | Bacteria | 2018 |
| 317 | Ga0075428_100279629 | 3300006844 | Bacteria | 1796 |
| 318 | Ga0075428_100353716 | 3300006844 | Bacteria | 1576 |
| 319 | Ga0075428_100355340 | 3300006844 | Bacteria | 1572 |
| 320 | Ga0075428_100402237 | 3300006844 | Bacteria | 1467 |
| 321 | Ga0075428_100573948 | 3300006844 | Bacteria | 1205 |
| 322 | Ga0075428_100778339 | 3300006844 | Unclassified | 1017 |
| 323 | Ga0075430_100020140 | 3300006846 | Bacteria | 5676 |
| 324 | Ga0075430_100054534 | 3300006846 | Bacteria | 3363 |
| 325 | Ga0075430_100059465 | 3300006846 | Bacteria | 3213 |
| 326 | Ga0075430_100278704 | 3300006846 | Unclassified | 1383 |
| 327 | Ga0075430_100362592 | 3300006846 | Bacteria | 1197 |
| 328 | Ga0075431_100022859 | 3300006847 | Bacteria | 6391 |
| 329 | Ga0075431_100065686 | 3300006847 | Bacteria | 3746 |
| 330 | Ga0075431_100287923 | 3300006847 | Bacteria | 1662 |
| 331 | Ga0075431_100319715 | 3300006847 | Bacteria | 1565 |
| 332 | Ga0075431_100360776 | 3300006847 | Bacteria | 1460 |
| 333 | Ga0075431_100557529 | 3300006847 | Bacteria | 1133 |
| 334 | Ga0075433_10001320 | 3300006852 | Bacteria | 18149 |
| 335 | Ga0075433_10002036 | 3300006852 | Bacteria | 15269 |
| 336 | Ga0075433_10003541 | 3300006852 | Bacteria | 12056 |
| 337 | Ga0075433_10006871 | 3300006852 | Bacteria | 9017 |
| 338 | Ga0075433_10010320 | 3300006852 | Bacteria | 7491 |
| 339 | Ga0075433_10011565 | 3300006852 | Bacteria | 7108 |
| 340 | Ga0075433_10034231 | 3300006852 | Bacteria | 4361 |
| 341 | Ga0075433_10053330 | 3300006852 | Bacteria | 3525 |
| 342 | Ga0075433_10076139 | 3300006852 | Bacteria | 2955 |
| 343 | Ga0075433_10127900 | 3300006852 | Bacteria | 2256 |
| 344 | Ga0075433_10148695 | 3300006852 | Unclassified | 2083 |
| 345 | Ga0075433_10152514 | 3300006852 | Bacteria | 2055 |
| 346 | Ga0075433_10194662 | 3300006852 | Bacteria | 1803 |
| 347 | Ga0075433_10231520 | 3300006852 | Bacteria | 1641 |
| 348 | Ga0075433_10261307 | 3300006852 | Bacteria | 1535 |
| 349 | Ga0075433_10288162 | 3300006852 | Bacteria | 1454 |
| 350 | Ga0075433_10459230 | 3300006852 | Bacteria | 1122 |
| 351 | Ga0075433_10459672 | 3300006852 | Bacteria | 1122 |
| 352 | Ga0075433_10496308 | 3300006852 | Bacteria | 1075 |
| 353 | Ga0075433_10681852 | 3300006852 | Bacteria | 900 |
| 354 | Ga0075433_10801193 | 3300006852 | Unclassified | 823 |
| 355 | Ga0075434_100005686 | 3300006871 | Bacteria | 11379 |
| 356 | Ga0075434_100007695 | 3300006871 | Bacteria | 9974 |
| 357 | Ga0075434_100019749 | 3300006871 | Bacteria | 6524 |
| 358 | Ga0075434_100034636 | 3300006871 | Bacteria | 4988 |
| 359 | Ga0075434_100046970 | 3300006871 | Bacteria | 4284 |
| 360 | Ga0075434_100057121 | 3300006871 | Bacteria | 3879 |
| 361 | Ga0075434_100114024 | 3300006871 | Bacteria | 2715 |
| 362 | Ga0075434_100145351 | 3300006871 | Bacteria | 2391 |
| 363 | Ga0075434_100161118 | 3300006871 | Bacteria | 2263 |
| 364 | Ga0075434_100210425 | 3300006871 | Unclassified | 1965 |
| 365 | Ga0075434_100212061 | 3300006871 | Bacteria | 1956 |
| 366 | Ga0075434_100248425 | 3300006871 | Bacteria | 1798 |
| 367 | Ga0075434_100254674 | 3300006871 | Bacteria | 1774 |
| 368 | Ga0075434_100278393 | 3300006871 | Unclassified | 1692 |
| 369 | Ga0075434_100306409 | 3300006871 | Bacteria | 1608 |
| 370 | Ga0075434_100354064 | 3300006871 | Bacteria | 1489 |
| 371 | Ga0075434_100429004 | 3300006871 | Bacteria | 1343 |
| 372 | Ga0075434_100495667 | 3300006871 | Bacteria | 1242 |
| 373 | Ga0075434_100649057 | 3300006871 | Bacteria | 1074 |
| 374 | Ga0075434_100707807 | 3300006871 | Bacteria | 1024 |
| 375 | Ga0075434_100724323 | 3300006871 | Bacteria | 1012 |
| 376 | Ga0075434_100747756 | 3300006871 | Unclassified | 995 |
| 377 | Ga0075434_100766494 | 3300006871 | Bacteria | 981 |
| 378 | Ga0075434_101076223 | 3300006871 | Bacteria | 817 |
| 379 | Ga0075429_100019033 | 3300006880 | Bacteria | 5948 |
| 380 | Ga0075429_100037493 | 3300006880 | Bacteria | 4220 |
| 381 | Ga0075429_100049459 | 3300006880 | Bacteria | 3656 |
| 382 | Ga0075429_100050141 | 3300006880 | Bacteria | 3632 |
| 383 | Ga0075429_100149788 | 3300006880 | Unclassified | 2043 |
| 384 | Ga0075429_100173732 | 3300006880 | Bacteria | 1887 |
| 385 | Ga0075429_100256636 | 3300006880 | Bacteria | 1531 |
| 386 | Ga0075429_100425021 | 3300006880 | Unclassified | 1164 |
| 387 | Ga0075429_100786033 | 3300006880 | Bacteria | 834 |
| 388 | Ga0068865_100183944 | 3300006881 | Bacteria | 1611 |
| 389 | Ga0075436_100003400 | 3300006914 | Bacteria | 10905 |
| 390 | Ga0075436_100033969 | 3300006914 | Unclassified | 3515 |
| 391 | Ga0075436_100065982 | 3300006914 | Bacteria | 2501 |
| 392 | Ga0075436_100067224 | 3300006914 | Bacteria | 2477 |
| 393 | Ga0075436_100198226 | 3300006914 | Bacteria | 1421 |
| 394 | Ga0075436_100235642 | 3300006914 | Bacteria | 1301 |
| 395 | Ga0075436_100296316 | 3300006914 | Bacteria | 1158 |
| 396 | Ga0075436_100665177 | 3300006914 | Bacteria | 770 |
| 397 | Ga0075436_100669369 | 3300006914 | Bacteria | 768 |
| 398 | Ga0075436_100856380 | 3300006914 | Bacteria | 679 |
| 399 | Ga0097620_100362080 | 3300006931 | Bacteria | 1545 |
| 400 | Ga0075435_100007201 | 3300007076 | Bacteria | 7913 |
| 401 | Ga0075435_100013765 | 3300007076 | Bacteria | 6029 |
| 402 | Ga0075435_100024448 | 3300007076 | Bacteria | 4689 |
| 403 | Ga0075435_100055694 | 3300007076 | Bacteria | 3194 |
| 404 | Ga0075435_100067152 | 3300007076 | Bacteria | 2919 |
| 405 | Ga0075435_100071188 | 3300007076 | Bacteria | 2839 |
| 406 | Ga0075435_100072577 | 3300007076 | Bacteria | 2812 |
| 407 | Ga0075435_100098896 | 3300007076 | Bacteria | 2415 |
| 408 | Ga0075435_100152434 | 3300007076 | Bacteria | 1944 |
| 409 | Ga0075435_100164266 | 3300007076 | Bacteria | 1872 |
| 410 | Ga0075435_100228569 | 3300007076 | Bacteria | 1580 |
| 411 | Ga0075435_100232000 | 3300007076 | Bacteria | 1568 |
| 412 | Ga0075435_100313066 | 3300007076 | Bacteria | 1343 |
| 413 | Ga0075435_100403072 | 3300007076 | Bacteria | 1176 |
| 414 | Ga0075435_100408508 | 3300007076 | Bacteria | 1168 |
| 415 | Ga0075435_100459042 | 3300007076 | Bacteria | 1099 |
| 416 | Ga0075435_100480993 | 3300007076 | Bacteria | 1072 |
| 417 | Ga0075435_100585129 | 3300007076 | Bacteria | 967 |
| 418 | Ga0075435_100601046 | 3300007076 | Bacteria | 954 |
| 419 | Ga0075435_100893735 | 3300007076 | Bacteria | 774 |
| 420 | Ga0099794_10001962 | 3300007265 | Bacteria | 7402 |
| 421 | Ga0099794_10002095 | 3300007265 | Bacteria | 7253 |
| 422 | Ga0099794_10020880 | 3300007265 | Bacteria | 2969 |
| 423 | Ga0099794_10193834 | 3300007265 | Bacteria | 1040 |
| 424 | Ga0099794_10229070 | 3300007265 | Bacteria | 956 |
| 425 | Ga0099795_10225537 | 3300007788 | Bacteria | 799 |
| 426 | Ga0105244_10005771 | 3300009036 | Bacteria | 8157 |
| 427 | Ga0105250_10030786 | 3300009092 | Bacteria | 2157 |
| 428 | Ga0105240_10663574 | 3300009093 | Bacteria | 1142 |
| 429 | Ga0111539_10048581 | 3300009094 | Bacteria | 5065 |
| 430 | Ga0111539_10085334 | 3300009094 | Bacteria | 3711 |
| 431 | Ga0111539_10168166 | 3300009094 | Bacteria | 2562 |
| 432 | Ga0111539_10203521 | 3300009094 | Bacteria | 2308 |
| 433 | Ga0111539_10243809 | 3300009094 | Bacteria | 2092 |
| 434 | Ga0111539_10390786 | 3300009094 | Bacteria | 1620 |
| 435 | Ga0111539_10459093 | 3300009094 | Bacteria | 1483 |
| 436 | Ga0111539_10486766 | 3300009094 | Bacteria | 1437 |
| 437 | Ga0111539_10781032 | 3300009094 | Unclassified | 1112 |
| 438 | Ga0111539_10793818 | 3300009094 | Bacteria | 1102 |
| 439 | Ga0105245_10013776 | 3300009098 | Bacteria | 7042 |
| 440 | Ga0105247_10038209 | 3300009101 | Bacteria | 2930 |
| 441 | Ga0114129_10002492 | 3300009147 | Bacteria | 25557 |
| 442 | Ga0114129_10004475 | 3300009147 | Bacteria | 19706 |
| 443 | Ga0114129_10004685 | 3300009147 | Bacteria | 19321 |
| 444 | Ga0114129_10007203 | 3300009147 | Bacteria | 15828 |
| 445 | Ga0114129_10017425 | 3300009147 | Bacteria | 10230 |
| 446 | Ga0114129_10017478 | 3300009147 | Bacteria | 10211 |
| 447 | Ga0114129_10019037 | 3300009147 | Bacteria | 9779 |
| 448 | Ga0114129_10021529 | 3300009147 | Bacteria | 9153 |
| 449 | Ga0114129_10041514 | 3300009147 | Bacteria | 6481 |
| 450 | Ga0114129_10060267 | 3300009147 | Bacteria | 5306 |
| 451 | Ga0114129_10090140 | 3300009147 | Bacteria | 4251 |
| 452 | Ga0114129_10118447 | 3300009147 | Bacteria | 3647 |
| 453 | Ga0114129_10184200 | 3300009147 | Bacteria | 2839 |
| 454 | Ga0114129_10185627 | 3300009147 | Bacteria | 2826 |
| 455 | Ga0114129_10296831 | 3300009147 | Bacteria | 2155 |
| 456 | Ga0114129_10359204 | 3300009147 | Bacteria | 1928 |
| 457 | Ga0114129_10378370 | 3300009147 | Unclassified | 1870 |
| 458 | Ga0114129_10455247 | 3300009147 | Bacteria | 1678 |
| 459 | Ga0114129_10472099 | 3300009147 | Bacteria | 1642 |
| 460 | Ga0114129_10483623 | 3300009147 | Bacteria | 1619 |
| 461 | Ga0114129_10619674 | 3300009147 | Bacteria | 1400 |
| 462 | Ga0114129_10653232 | 3300009147 | Bacteria | 1357 |
| 463 | Ga0114129_10675847 | 3300009147 | Bacteria | 1330 |
| 464 | Ga0114129_10727537 | 3300009147 | Bacteria | 1273 |
| 465 | Ga0114129_10812272 | 3300009147 | Bacteria | 1192 |
| 466 | Ga0114129_10902255 | 3300009147 | Bacteria | 1120 |
| 467 | Ga0114129_11076102 | 3300009147 | Bacteria | 1008 |
| 468 | Ga0114129_11078018 | 3300009147 | Bacteria | 1007 |
| 469 | Ga0114129_11638466 | 3300009147 | Bacteria | 787 |
| 470 | Ga0105243_10848832 | 3300009148 | Bacteria | 904 |
| 471 | Ga0105241_10040941 | 3300009174 | Bacteria | 3499 |
| 472 | Ga0105241_10048446 | 3300009174 | Bacteria | 3234 |
| 473 | Ga0105242_10297612 | 3300009176 | Unclassified | 1471 |
| 474 | Ga0105242_10593919 | 3300009176 | Bacteria | 1068 |
| 475 | Ga0105242_10607719 | 3300009176 | Bacteria | 1057 |
| 476 | Ga0105248_10011651 | 3300009177 | Bacteria | 9686 |
| 477 | Ga0105248_10752314 | 3300009177 | Bacteria | 1100 |
| 478 | Ga0105237_10000964 | 3300009545 | Bacteria | 38709 |
| 479 | Ga0105237_10966098 | 3300009545 | Bacteria | 859 |
| 480 | Ga0105238_10426422 | 3300009551 | Bacteria | 1321 |
| 481 | Ga0105249_10268839 | 3300009553 | Bacteria | 1698 |
| 482 | Ga0105249_10314419 | 3300009553 | Bacteria | 1576 |
| 483 | Ga0105249_10394120 | 3300009553 | Bacteria | 1413 |
| 484 | Ga0105249_11097431 | 3300009553 | Bacteria | 866 |
| 485 | Ga0099796_10017097 | 3300010159 | Bacteria | 2154 |
| 486 | Ga0099796_10085032 | 3300010159 | Bacteria | 1167 |
| 487 | Ga0105239_10000025 | 3300010375 | Bacteria | 254049 |
| 488 | Ga0105239_10090735 | 3300010375 | Bacteria | 3371 |
| 489 | Ga0105239_11317040 | 3300010375 | Bacteria | 833 |
| 490 | Ga0105239_11352899 | 3300010375 | Bacteria | 822 |
| 491 | Ga0105246_10214239 | 3300011119 | Unclassified | 1505 |
| 492 | Ga0157373_10077541 | 3300013100 | Bacteria | 2344 |
| 493 | Ga0157369_10108106 | 3300013105 | Bacteria | 2958 |
| 494 | Ga0157374_10241514 | 3300013296 | Bacteria | 1776 |
| 495 | Ga0157378_10021295 | 3300013297 | Bacteria | 5700 |
| 496 | Ga0157378_10491278 | 3300013297 | Bacteria | 1225 |
| 497 | Ga0157378_10873191 | 3300013297 | Bacteria | 929 |
| 498 | Ga0163162_10181078 | 3300013306 | Bacteria | 2233 |
| 499 | Ga0157372_10744394 | 3300013307 | Bacteria | 1140 |
| 500 | Ga0157375_10091370 | 3300013308 | Bacteria | 3106 |
| 501 | Ga0157375_10266665 | 3300013308 | Bacteria | 1874 |
| 502 | Ga0157375_10963889 | 3300013308 | Bacteria | 994 |
| 503 | Ga0163163_10017144 | 3300014325 | Bacteria | 6748 |
| 504 | Ga0163163_10986678 | 3300014325 | Bacteria | 906 |
| 505 | Ga0157380_10009890 | 3300014326 | Bacteria | 6847 |
| 506 | Ga0157380_10338927 | 3300014326 | Unclassified | 1402 |
| 507 | Ga0157379_10312860 | 3300014968 | Bacteria | 1433 |
| 508 | Ga0157379_10544289 | 3300014968 | Unclassified | 1080 |
| 509 | Ga0157376_10009199 | 3300014969 | Bacteria | 7167 |
| 510 | Ga0163161_11047058 | 3300017792 | Bacteria | 699 |
| 511 | Ga0214544_1000424 | 3300021320 | Bacteria | 75924 |
| 512 | Ga0214542_1000412 | 3300021321 | Bacteria | 75924 |
| 513 | Ga0214545_1000242 | 3300021324 | Bacteria | 75924 |
| 514 | Ga0214543_1000327 | 3300021327 | Bacteria | 75924 |
| 515 | Ga0224572_1002353 | 3300024225 | Bacteria | 3033 |
| 516 | Ga0228598_1002567 | 3300024227 | Bacteria | 3941 |
| 517 | Ga0228598_1016185 | 3300024227 | Bacteria | 1472 |
| 518 | Ga0209437_100023 | 3300025233 | Bacteria | 614195 |
| 519 | Ga0207425_1000037 | 3300025245 | Bacteria | 224645 |
| 520 | Ga0207425_1000047 | 3300025245 | Bacteria | 189158 |
| 521 | Ga0209129_1000378 | 3300025258 | Bacteria | 36183 |
| 522 | Ga0209129_1000480 | 3300025258 | Bacteria | 29248 |
| 523 | Ga0209233_1000062 | 3300025261 | Bacteria | 399685 |
| 524 | Ga0209565_1000062 | 3300025263 | Bacteria | 184007 |
| 525 | Ga0209565_1002595 | 3300025263 | Bacteria | 6408 |
| 526 | Ga0209565_1037884 | 3300025263 | Bacteria | 910 |
| 527 | Ga0209130_1000318 | 3300025284 | Bacteria | 56545 |
| 528 | Ga0209676_1000291 | 3300025292 | Bacteria | 102996 |
| 529 | Ga0209676_1001816 | 3300025292 | Bacteria | 17808 |
| 530 | Ga0209025_1000117 | 3300025294 | Bacteria | 215073 |
| 531 | Ga0209025_1000150 | 3300025294 | Bacteria | 172834 |
| 532 | Ga0209025_1045233 | 3300025294 | Bacteria | 1828 |
| 533 | Ga0209564_1002021 | 3300025295 | Bacteria | 17638 |
| 534 | Ga0209564_1013326 | 3300025295 | Bacteria | 3505 |
| 535 | Ga0209564_1020233 | 3300025295 | Bacteria | 2447 |
| 536 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 537 | Ga0209758_1000103 | 3300025297 | Bacteria | 223968 |
| 538 | Ga0209758_1001241 | 3300025297 | Bacteria | 31750 |
| 539 | Ga0209050_1000327 | 3300025298 | Bacteria | 95283 |
| 540 | Ga0209050_1002490 | 3300025298 | Bacteria | 15572 |
| 541 | Ga0209050_1003020 | 3300025298 | Bacteria | 13031 |
| 542 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 543 | Ga0207426_1000512 | 3300025302 | Bacteria | 56516 |
| 544 | Ga0207426_1001703 | 3300025302 | Bacteria | 16900 |
| 545 | Ga0207426_1030352 | 3300025302 | Bacteria | 1773 |
| 546 | Ga0209051_1017824 | 3300025303 | Bacteria | 3161 |
| 547 | Ga0209257_1000345 | 3300025304 | Bacteria | 96513 |
| 548 | Ga0209257_1001353 | 3300025304 | Bacteria | 29628 |
| 549 | Ga0207653_10055869 | 3300025885 | Bacteria | 1323 |
| 550 | Ga0207692_10042639 | 3300025898 | Bacteria | 2254 |
| 551 | Ga0207692_10072078 | 3300025898 | Bacteria | 1824 |
| 552 | Ga0207692_10651571 | 3300025898 | Bacteria | 680 |
| 553 | Ga0207642_10371252 | 3300025899 | Bacteria | 849 |
| 554 | Ga0207688_10008540 | 3300025901 | Bacteria | 5574 |
| 555 | Ga0207647_10008876 | 3300025904 | Bacteria | 7170 |
| 556 | Ga0207685_10007770 | 3300025905 | Bacteria | 3012 |
| 557 | Ga0207685_10030721 | 3300025905 | Bacteria | 1916 |
| 558 | Ga0207685_10037116 | 3300025905 | Bacteria | 1792 |
| 559 | Ga0207685_10063917 | 3300025905 | Bacteria | 1468 |
| 560 | Ga0207685_10161923 | 3300025905 | Bacteria | 1022 |
| 561 | Ga0207699_10076719 | 3300025906 | Bacteria | 2059 |
| 562 | Ga0207699_10087391 | 3300025906 | Bacteria | 1949 |
| 563 | Ga0207699_10090359 | 3300025906 | Bacteria | 1921 |
| 564 | Ga0207699_10592016 | 3300025906 | Bacteria | 807 |
| 565 | Ga0207645_10031716 | 3300025907 | Bacteria | 3398 |
| 566 | Ga0207645_10285027 | 3300025907 | Bacteria | 1097 |
| 567 | Ga0207684_10000181 | 3300025910 | Bacteria | 101122 |
| 568 | Ga0207684_10000507 | 3300025910 | Bacteria | 48732 |
| 569 | Ga0207684_10000684 | 3300025910 | Bacteria | 40135 |
| 570 | Ga0207684_10003189 | 3300025910 | Bacteria | 16104 |
| 571 | Ga0207684_10005711 | 3300025910 | Bacteria | 11427 |
| 572 | Ga0207684_10007743 | 3300025910 | Bacteria | 9619 |
| 573 | Ga0207684_10013300 | 3300025910 | Bacteria | 7119 |
| 574 | Ga0207684_10019354 | 3300025910 | Bacteria | 5825 |
| 575 | Ga0207684_10026415 | 3300025910 | Bacteria | 4949 |
| 576 | Ga0207684_10027978 | 3300025910 | Bacteria | 4802 |
| 577 | Ga0207684_10074280 | 3300025910 | Bacteria | 2888 |
| 578 | Ga0207684_10079262 | 3300025910 | Bacteria | 2794 |
| 579 | Ga0207684_10084698 | 3300025910 | Bacteria | 2700 |
| 580 | Ga0207684_10085947 | 3300025910 | Bacteria | 2679 |
| 581 | Ga0207684_10113533 | 3300025910 | Bacteria | 2319 |
| 582 | Ga0207684_10116903 | 3300025910 | Bacteria | 2285 |
| 583 | Ga0207684_10144603 | 3300025910 | Bacteria | 2045 |
| 584 | Ga0207684_10150699 | 3300025910 | Bacteria | 2001 |
| 585 | Ga0207684_10193612 | 3300025910 | Unclassified | 1754 |
| 586 | Ga0207684_10481299 | 3300025910 | Bacteria | 1065 |
| 587 | Ga0207684_10498204 | 3300025910 | Bacteria | 1044 |
| 588 | Ga0207684_10550516 | 3300025910 | Bacteria | 987 |
| 589 | Ga0207684_10626499 | 3300025910 | Bacteria | 917 |
| 590 | Ga0207654_10044067 | 3300025911 | Bacteria | 2532 |
| 591 | Ga0207695_10000347 | 3300025913 | Bacteria | 107013 |
| 592 | Ga0207671_10001460 | 3300025914 | Bacteria | 27305 |
| 593 | Ga0207693_10000898 | 3300025915 | Bacteria | 26695 |
| 594 | Ga0207693_10006516 | 3300025915 | Bacteria | 9662 |
| 595 | Ga0207693_10008253 | 3300025915 | Bacteria | 8527 |
| 596 | Ga0207693_10037532 | 3300025915 | Bacteria | 3819 |
| 597 | Ga0207693_10095563 | 3300025915 | Bacteria | 2330 |
| 598 | Ga0207693_10689661 | 3300025915 | Bacteria | 792 |
| 599 | Ga0207663_10001824 | 3300025916 | Bacteria | 10047 |
| 600 | Ga0207663_10017487 | 3300025916 | Bacteria | 3996 |
| 601 | Ga0207663_10027262 | 3300025916 | Bacteria | 3327 |
| 602 | Ga0207663_10105923 | 3300025916 | Unclassified | 1899 |
| 603 | Ga0207663_10145373 | 3300025916 | Bacteria | 1657 |
| 604 | Ga0207663_10267973 | 3300025916 | Bacteria | 1264 |
| 605 | Ga0207662_10040450 | 3300025918 | Bacteria | 2741 |
| 606 | Ga0207657_10009972 | 3300025919 | Bacteria | 9507 |
| 607 | Ga0207646_10000165 | 3300025922 | Bacteria | 89540 |
| 608 | Ga0207646_10000663 | 3300025922 | Bacteria | 44694 |
| 609 | Ga0207646_10006466 | 3300025922 | Bacteria | 12098 |
| 610 | Ga0207646_10006994 | 3300025922 | Bacteria | 11555 |
| 611 | Ga0207646_10008284 | 3300025922 | Bacteria | 10435 |
| 612 | Ga0207646_10011592 | 3300025922 | Bacteria | 8523 |
| 613 | Ga0207646_10015133 | 3300025922 | Bacteria | 7298 |
| 614 | Ga0207646_10021846 | 3300025922 | Bacteria | 5905 |
| 615 | Ga0207646_10029826 | 3300025922 | Bacteria | 4952 |
| 616 | Ga0207646_10030282 | 3300025922 | Bacteria | 4908 |
| 617 | Ga0207646_10059603 | 3300025922 | Bacteria | 3409 |
| 618 | Ga0207646_10084655 | 3300025922 | Bacteria | 2837 |
| 619 | Ga0207646_10205860 | 3300025922 | Bacteria | 1777 |
| 620 | Ga0207646_10497438 | 3300025922 | Bacteria | 1099 |
| 621 | Ga0207646_10527683 | 3300025922 | Bacteria | 1063 |
| 622 | Ga0207646_10666228 | 3300025922 | Bacteria | 932 |
| 623 | Ga0207646_10804948 | 3300025922 | Bacteria | 837 |
| 624 | Ga0207681_10026959 | 3300025923 | Bacteria | 3711 |
| 625 | Ga0207681_10059934 | 3300025923 | Bacteria | 2610 |
| 626 | Ga0207681_10419507 | 3300025923 | Unclassified | 1084 |
| 627 | Ga0207694_10331642 | 3300025924 | Bacteria | 1257 |
| 628 | Ga0207650_10083604 | 3300025925 | Bacteria | 2425 |
| 629 | Ga0207659_10288409 | 3300025926 | Bacteria | 1344 |
| 630 | Ga0207687_10142857 | 3300025927 | Bacteria | 1818 |
| 631 | Ga0207700_10036148 | 3300025928 | Bacteria | 3564 |
| 632 | Ga0207700_10084701 | 3300025928 | Bacteria | 2486 |
| 633 | Ga0207700_10151733 | 3300025928 | Bacteria | 1915 |
| 634 | Ga0207700_10186891 | 3300025928 | Bacteria | 1739 |
| 635 | Ga0207700_10224733 | 3300025928 | Bacteria | 1593 |
| 636 | Ga0207700_10775811 | 3300025928 | Bacteria | 857 |
| 637 | Ga0207664_10086255 | 3300025929 | Bacteria | 2564 |
| 638 | Ga0207664_10189227 | 3300025929 | Bacteria | 1771 |
| 639 | Ga0207664_10685140 | 3300025929 | Unclassified | 922 |
| 640 | Ga0207664_10903034 | 3300025929 | Bacteria | 793 |
| 641 | Ga0207644_10067356 | 3300025931 | Bacteria | 2609 |
| 642 | Ga0207644_10729361 | 3300025931 | Bacteria | 827 |
| 643 | Ga0207706_10028247 | 3300025933 | Bacteria | 5010 |
| 644 | Ga0207706_10406090 | 3300025933 | Bacteria | 1181 |
| 645 | Ga0207706_10430626 | 3300025933 | Unclassified | 1142 |
| 646 | Ga0207686_10361276 | 3300025934 | Bacteria | 1096 |
| 647 | Ga0207709_10134917 | 3300025935 | Bacteria | 1688 |
| 648 | Ga0207670_10019485 | 3300025936 | Bacteria | 4146 |
| 649 | Ga0207670_10099245 | 3300025936 | Bacteria | 2077 |
| 650 | Ga0207669_10130770 | 3300025937 | Bacteria | 1724 |
| 651 | Ga0207704_10184947 | 3300025938 | Bacteria | 1509 |
| 652 | Ga0207704_10879087 | 3300025938 | Bacteria | 753 |
| 653 | Ga0207665_10000887 | 3300025939 | Bacteria | 20188 |
| 654 | Ga0207665_10014732 | 3300025939 | Bacteria | 5143 |
| 655 | Ga0207665_10045875 | 3300025939 | Bacteria | 2927 |
| 656 | Ga0207665_10051130 | 3300025939 | Unclassified | 2781 |
| 657 | Ga0207665_10059603 | 3300025939 | Bacteria | 2584 |
| 658 | Ga0207665_10119703 | 3300025939 | Bacteria | 1859 |
| 659 | Ga0207665_10121938 | 3300025939 | Bacteria | 1842 |
| 660 | Ga0207665_10262680 | 3300025939 | Bacteria | 1279 |
| 661 | Ga0207665_10306822 | 3300025939 | Bacteria | 1188 |
| 662 | Ga0207665_10395603 | 3300025939 | Bacteria | 1051 |
| 663 | Ga0207691_10360324 | 3300025940 | Bacteria | 1243 |
| 664 | Ga0207711_10050722 | 3300025941 | Bacteria | 3552 |
| 665 | Ga0207711_10744232 | 3300025941 | Bacteria | 914 |
| 666 | Ga0207679_10357158 | 3300025945 | Bacteria | 1275 |
| 667 | Ga0207679_10665272 | 3300025945 | Bacteria | 943 |
| 668 | Ga0207667_10679476 | 3300025949 | Bacteria | 1033 |
| 669 | Ga0207712_10189122 | 3300025961 | Bacteria | 1624 |
| 670 | Ga0207712_10377086 | 3300025961 | Bacteria | 1186 |
| 671 | Ga0207668_10017069 | 3300025972 | Bacteria | 4541 |
| 672 | Ga0207668_10534655 | 3300025972 | Unclassified | 1013 |
| 673 | Ga0207668_10826589 | 3300025972 | Bacteria | 821 |
| 674 | Ga0207640_10031502 | 3300025981 | Bacteria | 3277 |
| 675 | Ga0207640_10137884 | 3300025981 | Bacteria | 1774 |
| 676 | Ga0207640_10270490 | 3300025981 | Bacteria | 1329 |
| 677 | Ga0207658_10232312 | 3300025986 | Bacteria | 1558 |
| 678 | Ga0207658_10300761 | 3300025986 | Bacteria | 1382 |
| 679 | Ga0207658_10446389 | 3300025986 | Bacteria | 1144 |
| 680 | Ga0207677_10266446 | 3300026023 | Bacteria | 1399 |
| 681 | Ga0207677_10492097 | 3300026023 | Bacteria | 1059 |
| 682 | Ga0207703_10176207 | 3300026035 | Bacteria | 1884 |
| 683 | Ga0207639_10357378 | 3300026041 | Bacteria | 1306 |
| 684 | Ga0207639_10719125 | 3300026041 | Bacteria | 927 |
| 685 | Ga0207678_10002089 | 3300026067 | Bacteria | 18095 |
| 686 | Ga0207678_10011677 | 3300026067 | Bacteria | 7713 |
| 687 | Ga0207708_10015629 | 3300026075 | Bacteria | 5693 |
| 688 | Ga0207708_10147078 | 3300026075 | Bacteria | 1852 |
| 689 | Ga0207641_10009040 | 3300026088 | Bacteria | 8232 |
| 690 | Ga0207648_10037907 | 3300026089 | Bacteria | 4243 |
| 691 | Ga0207648_10043366 | 3300026089 | Bacteria | 3949 |
| 692 | Ga0207648_10220721 | 3300026089 | Bacteria | 1685 |
| 693 | Ga0207676_11060287 | 3300026095 | Unclassified | 800 |
| 694 | Ga0207674_10018861 | 3300026116 | Bacteria | 7482 |
| 695 | Ga0207675_100072478 | 3300026118 | Bacteria | 3222 |
| 696 | Ga0207675_100203694 | 3300026118 | Bacteria | 1901 |
| 697 | Ga0207675_100469956 | 3300026118 | Bacteria | 1248 |
| 698 | Ga0207675_100577786 | 3300026118 | Bacteria | 1125 |
| 699 | Ga0207675_101038825 | 3300026118 | Bacteria | 838 |
| 700 | Ga0207683_10006916 | 3300026121 | Bacteria | 9711 |
| 701 | Ga0207683_11175321 | 3300026121 | Bacteria | 711 |
| 702 | Ga0207698_11125597 | 3300026142 | Bacteria | 798 |
| 703 | Ga0209588_1000024 | 3300027671 | Bacteria | 86158 |
| 704 | Ga0209588_1004440 | 3300027671 | Bacteria | 3954 |
| 705 | Ga0209813_10123432 | 3300027866 | Bacteria | 904 |
| 706 | Ga0207428_10016868 | 3300027907 | Bacteria | 6276 |
| 707 | Ga0207428_10065007 | 3300027907 | Bacteria | 2879 |
| 708 | Ga0265356_1000449 | 3300028017 | Bacteria | 7523 |
| 709 | Ga0268266_10002394 | 3300028379 | Bacteria | 20226 |
| 710 | Ga0268266_10031920 | 3300028379 | Bacteria | 4475 |
| 711 | Ga0268266_10569836 | 3300028379 | Unclassified | 1086 |
| 712 | Ga0268265_10086808 | 3300028380 | Bacteria | 2488 |
| 713 | Ga0268264_10040316 | 3300028381 | Bacteria | 3859 |
| 714 | Ga0268264_10111426 | 3300028381 | Bacteria | 2397 |
| 715 | Ga0268264_10193494 | 3300028381 | Unclassified | 1855 |
| 716 | Ga0268264_11025120 | 3300028381 | Bacteria | 832 |
| 717 | Ga0265762_1001022 | 3300030760 | Bacteria | 5025 |
| 718 | Ga0265762_1002005 | 3300030760 | Bacteria | 3707 |
| 719 | Ga0265763_1000002 | 3300030763 | Bacteria | 10269 |
| 720 | Ga0265763_1007364 | 3300030763 | Bacteria | 964 |
| 721 | Ga0265773_1002492 | 3300031018 | Bacteria | 1121 |
| 722 | Ga0265760_10001288 | 3300031090 | Bacteria | 7325 |
| 723 | Ga0265760_10109242 | 3300031090 | Bacteria | 880 |
| 724 | Ga0307510_10275516 | 3300033180 | Bacteria | 1156 |
| 725 | Ga0373950_0016769 | 3300034818 | Bacteria | 1256 |
| 726 | Ga0373926_0075173 | 3300035083 | Bacteria | 1245 |
| 727 | Ga0373926_0216179 | 3300035083 | Bacteria | 739 |
| 728 | Ga0373940_0125668 | 3300035088 | Bacteria | 799 |
| 729 | Ga0373951_0064816 | 3300035091 | Bacteria | 921 |
| 730 | Ga0373951_0122752 | 3300035091 | Bacteria | 708 |
| 731 | Ga0373931_0575102 | 3300035691 | Bacteria | 734 |
| 732 | Ga0373931_0609514 | 3300035691 | Bacteria | 714 |
| 733 | Ga0373927_0053694 | 3300035695 | Bacteria | 2607 |
| 734 | Ga0373927_0552959 | 3300035695 | Bacteria | 761 |
| 735 | Ga0373947_0186141 | 3300035725 | Bacteria | 1354 |
| 736 | Ga0373937_0041832 | 3300036401 | Bacteria | 4181 |
| 737 | Ga0372808_025127 | 3300036459 | Bacteria | 855 |
| 738 | Ga0395900_0112472 | 3300037418 | Bacteria | 2796 |
| 739 | Ga0400483_083970 | 3300039062 | Bacteria | 12648 |
| 740 | Ga0400483_108458 | 3300039062 | Bacteria | 2257 |
| 741 | Ga0451577_0153436 | 3300042876 | Bacteria | 2072 |
| 742 | Ga0453683_0000258 | 3300044673 | Bacteria | 69739 |
| 743 | Ga0453683_0006130 | 3300044673 | Bacteria | 8285 |
| 744 | Ga0453683_0011802 | 3300044673 | Bacteria | 5751 |
| 745 | Ga0453683_0032817 | 3300044673 | Bacteria | 3273 |
| 746 | Ga0453683_0080866 | 3300044673 | Bacteria | 2035 |
| 747 | Ga0453683_0150096 | 3300044673 | Bacteria | 1472 |
| 748 | Ga0453683_0234905 | 3300044673 | Bacteria | 1167 |
| 749 | Ga0453683_0329663 | 3300044673 | Bacteria | 979 |
| 750 | Ga0453684_0046569 | 3300044712 | Bacteria | 5766 |
| 751 | Ga0453684_0320630 | 3300044712 | Bacteria | 1755 |
| 752 | Ga0453684_0378649 | 3300044712 | Bacteria | 1590 |
| 753 | Ga0466968_0097739 | 3300044735 | Bacteria | 1308 |
| 754 | Ga0451576_0033734 | 3300045051 | Bacteria | 5439 |
| 755 | Ga0451576_0055389 | 3300045051 | Bacteria | 4149 |
| 756 | Ga0451576_0108565 | 3300045051 | Bacteria | 2887 |
| 757 | Ga0495590_0041523 | 3300046457 | Bacteria | 1604 |
| 758 | Ga0495629_0243094 | 3300046459 | Bacteria | 1239 |
| 759 | Ga0495651_0394046 | 3300046462 | Unclassified | 905 |
| 760 | Ga0495580_0078824 | 3300046472 | Bacteria | 2298 |
| 761 | Ga0495580_0141575 | 3300046472 | Bacteria | 1667 |
| 762 | Ga0495582_0367625 | 3300046473 | Bacteria | 828 |
| 763 | Ga0495605_0000749 | 3300046474 | Bacteria | 23822 |
| 764 | Ga0495605_0269777 | 3300046474 | Bacteria | 725 |
| 765 | Ga0495664_0173357 | 3300046477 | Bacteria | 1308 |
| 766 | Ga0495584_0037238 | 3300046491 | Bacteria | 2458 |
| 767 | Ga0495584_0042612 | 3300046491 | Bacteria | 2291 |
| 768 | Ga0495594_0137711 | 3300046499 | Bacteria | 1384 |
| 769 | Ga0495606_0009794 | 3300046507 | Bacteria | 8052 |
| 770 | Ga0495608_0067086 | 3300046511 | Bacteria | 2348 |
| 771 | Ga0495618_0042290 | 3300046514 | Bacteria | 2872 |
| 772 | Ga0495628_0242951 | 3300046516 | Bacteria | 1346 |
| 773 | Ga0495630_0098949 | 3300046517 | Bacteria | 2206 |
| 774 | Ga0495630_0565111 | 3300046517 | Bacteria | 872 |
| 775 | Ga0495631_0116266 | 3300046518 | Bacteria | 1150 |
| 776 | Ga0495632_0206032 | 3300046519 | Bacteria | 894 |
| 777 | Ga0495663_0206691 | 3300046525 | Bacteria | 687 |
| 778 | Ga0495642_0154502 | 3300046528 | Bacteria | 994 |
| 779 | Ga0495665_0157712 | 3300046531 | Bacteria | 1183 |
| 780 | Ga0495640_0056854 | 3300046533 | Bacteria | 2671 |
| 781 | Ga0495609_0190288 | 3300046538 | Bacteria | 861 |
| 782 | Ga0495645_0067270 | 3300046543 | Bacteria | 2587 |
| 783 | Ga0495633_0142795 | 3300046558 | Bacteria | 1107 |
| 784 | Ga0495634_0040100 | 3300046642 | Bacteria | 3187 |
| 785 | Ga0495635_0630366 | 3300046663 | Bacteria | 698 |
| 786 | Ga0495635_0651942 | 3300046663 | Unclassified | 685 |
| 787 | Ga0495659_0053397 | 3300046664 | Bacteria | 1477 |
| 788 | Ga0495659_0162846 | 3300046664 | Bacteria | 901 |
| 789 | Ga0495599_0089005 | 3300046678 | Bacteria | 1927 |
| 790 | Ga0495646_0339900 | 3300046680 | Bacteria | 788 |
| 791 | Ga0495669_0359874 | 3300046684 | Bacteria | 704 |
| 792 | Ga0495613_0202390 | 3300046689 | Bacteria | 1399 |
| 793 | Ga0495613_0217992 | 3300046689 | Bacteria | 1340 |
| 794 | Ga0495624_0385143 | 3300046690 | Bacteria | 842 |
| 795 | Ga0495624_0482935 | 3300046690 | Bacteria | 742 |
| 796 | Ga0495670_0399061 | 3300046691 | Bacteria | 743 |
| 797 | Ga0495660_0220296 | 3300046810 | Bacteria | 895 |
| 798 | Ga0495660_0282831 | 3300046810 | Bacteria | 758 |
| 799 | Ga0495581_0082110 | 3300047315 | Bacteria | 1867 |
| 800 | Ga0495636_0178267 | 3300047318 | Bacteria | 963 |
| 801 | Ga0495636_0250903 | 3300047318 | Bacteria | 818 |
| 802 | Ga0495674_0064432 | 3300047319 | Bacteria | 3186 |
| 803 | Ga0495674_0085525 | 3300047319 | Bacteria | 2701 |
| 804 | Ga0495672_0364999 | 3300047320 | Bacteria | 667 |
| 805 | Ga0495673_0067809 | 3300047469 | Bacteria | 1509 |
| 806 | Ga0495684_0037983 | 3300047471 | Bacteria | 3693 |
| 807 | Ga0496100_0007168 | 3300048903 | Bacteria | 6125 |
| 808 | Ga0496100_0390539 | 3300048903 | Bacteria | 1058 |
| 809 | Ga0496101_0224338 | 3300048904 | Bacteria | 1459 |
| 810 | Ga0496101_0597398 | 3300048904 | Bacteria | 873 |
| 811 | Ga0496102_0141169 | 3300048905 | Unclassified | 2259 |
| 812 | Ga0496102_0175044 | 3300048905 | Bacteria | 2020 |
| 813 | Ga0496102_0193307 | 3300048905 | Bacteria | 1918 |
| 814 | Ga0496102_0199132 | 3300048905 | Unclassified | 1888 |
| 815 | Ga0496102_0956093 | 3300048905 | Unclassified | 778 |
| 816 | Ga0496104_0000339 | 3300048907 | Bacteria | 41808 |
| 817 | Ga0496104_0008489 | 3300048907 | Bacteria | 9135 |
| 818 | Ga0496104_0034057 | 3300048907 | Bacteria | 4748 |
| 819 | Ga0496104_0050418 | 3300048907 | Bacteria | 3928 |
| 820 | Ga0496104_0076052 | 3300048907 | Bacteria | 3197 |
| 821 | Ga0496105_0002897 | 3300048908 | Bacteria | 12589 |
| 822 | Ga0496105_0006320 | 3300048908 | Bacteria | 9101 |
| 823 | Ga0496105_0111260 | 3300048908 | Bacteria | 2260 |
| 824 | Ga0496106_0037970 | 3300048909 | Bacteria | 3603 |
| 825 | Ga0496106_0385457 | 3300048909 | Bacteria | 1126 |
| 826 | Ga0496106_0626156 | 3300048909 | Unclassified | 861 |
| 827 | Ga0496107_0032183 | 3300048910 | Bacteria | 3747 |
| 828 | Ga0496107_0393475 | 3300048910 | Bacteria | 1031 |
| 829 | Ga0496107_0765576 | 3300048910 | Bacteria | 708 |
| 830 | Ga0496107_0817709 | 3300048910 | Bacteria | 682 |
| 831 | Ga0496108_0033772 | 3300048911 | Bacteria | 4249 |
| 832 | Ga0496108_0040429 | 3300048911 | Bacteria | 3887 |
| 833 | Ga0496108_0395786 | 3300048911 | Bacteria | 1207 |
| 834 | Ga0496108_0880321 | 3300048911 | Bacteria | 769 |
| 835 | Ga0496108_0901547 | 3300048911 | Bacteria | 759 |
| 836 | Ga0496109_0000191 | 3300048912 | Bacteria | 61025 |
| 837 | Ga0496109_0077982 | 3300048912 | Bacteria | 3049 |
| 838 | Ga0496109_0109696 | 3300048912 | Bacteria | 2565 |
| 839 | Ga0496110_0014344 | 3300048913 | Bacteria | 6575 |
| 840 | Ga0496110_0063097 | 3300048913 | Bacteria | 3273 |
| 841 | Ga0496110_0093278 | 3300048913 | Bacteria | 2695 |
| 842 | Ga0496110_1062316 | 3300048913 | Bacteria | 717 |
| 843 | Ga0496111_0016400 | 3300048914 | Bacteria | 5103 |
| 844 | Ga0496111_0089040 | 3300048914 | Bacteria | 2260 |
| 845 | Ga0496111_0145166 | 3300048914 | Bacteria | 1759 |
| 846 | Ga0496112_0081626 | 3300048915 | Bacteria | 3197 |
| 847 | Ga0496112_0296383 | 3300048915 | Unclassified | 1563 |
| 848 | Ga0496112_0547969 | 3300048915 | Bacteria | 1090 |
| 849 | Ga0496113_0071636 | 3300048916 | Bacteria | 2636 |
| 850 | Ga0496113_0089240 | 3300048916 | Bacteria | 2372 |
| 851 | Ga0496113_0193187 | 3300048916 | Bacteria | 1616 |
| 852 | Ga0496113_0298504 | 3300048916 | Bacteria | 1290 |
| 853 | Ga0496113_0389564 | 3300048916 | Bacteria | 1118 |
| 854 | Ga0496113_0470367 | 3300048916 | Bacteria | 1010 |
| 855 | Ga0496114_0000527 | 3300048917 | Bacteria | 28173 |
| 856 | Ga0496114_0058277 | 3300048917 | Bacteria | 3225 |
| 857 | Ga0496114_0349343 | 3300048917 | Bacteria | 1308 |
| 858 | Ga0496115_0020011 | 3300048918 | Bacteria | 5157 |
| 859 | Ga0496115_0028961 | 3300048918 | Unclassified | 4345 |
| 860 | Ga0496115_0080307 | 3300048918 | Bacteria | 2655 |
| 861 | Ga0496115_0096450 | 3300048918 | Bacteria | 2421 |
| 862 | Ga0496115_0100313 | 3300048918 | Bacteria | 2373 |
| 863 | Ga0496115_0132347 | 3300048918 | Bacteria | 2056 |
| 864 | Ga0496115_0138419 | 3300048918 | Bacteria | 2008 |
| 865 | Ga0496115_0148030 | 3300048918 | Bacteria | 1938 |
| 866 | Ga0496115_0260607 | 3300048918 | Bacteria | 1426 |
| 867 | Ga0496115_0295940 | 3300048918 | Bacteria | 1327 |
| 868 | Ga0496115_0500395 | 3300048918 | Bacteria | 977 |
| 869 | Ga0496115_0694642 | 3300048918 | Bacteria | 800 |
| 870 | Ga0496117_0010943 | 3300048920 | Bacteria | 8176 |
| 871 | Ga0496118_0009623 | 3300048921 | Bacteria | 9727 |
| 872 | Ga0496118_0082947 | 3300048921 | Bacteria | 2243 |
| 873 | Ga0496119_0072377 | 3300048922 | Bacteria | 2014 |
| 874 | Ga0496121_0000245 | 3300048924 | Bacteria | 116316 |
| 875 | Ga0496121_0011345 | 3300048924 | Bacteria | 9909 |
| 876 | Ga0496122_0000043 | 3300048925 | Bacteria | 280333 |
| 877 | Ga0496123_0000090 | 3300048926 | Bacteria | 179735 |
| 878 | Ga0496123_0114209 | 3300048926 | Bacteria | 1536 |
| 879 | Ga0496123_0160171 | 3300048926 | Bacteria | 1201 |
| 880 | Ga0496125_0051918 | 3300048928 | Bacteria | 3377 |
| 881 | Ga0496126_0005254 | 3300048929 | Bacteria | 14879 |
| 882 | Ga0496126_0040027 | 3300048929 | Bacteria | 4346 |
| 883 | Ga0496126_0137305 | 3300048929 | Bacteria | 2108 |
| 884 | Ga0496126_0439338 | 3300048929 | Bacteria | 1052 |
| 885 | nmdc:mga00v17_339830_c1 | 3300050491 | Bacteria | 976 |
| 886 | nmdc:mga0yw44_128213_c1 | 3300050492 | Unclassified | 1640 |
| 887 | nmdc:mga0k408_169626_c1 | 3300050493 | Bacteria | 1301 |
| 888 | nmdc:mga07m45_7474_c1 | 3300050496 | Bacteria | 5586 |
| 889 | nmdc:mga05p37_103593_c2 | 3300050507 | Bacteria | 3069 |
| 890 | nmdc:mga05p37_10_c1 | 3300050507 | Bacteria | 113461 |
| 891 | nmdc:mga05p37_11608_c1 | 3300050507 | Bacteria | 10498 |
| 892 | nmdc:mga05p37_116479_c1 | 3300050507 | Bacteria | 2559 |
| 893 | nmdc:mga05p37_1238_c1 | 3300050507 | Bacteria | 29628 |
| 894 | nmdc:mga05p37_1315154_c1 | 3300050507 | Bacteria | 736 |
| 895 | nmdc:mga05p37_13336_c1 | 3300050507 | Bacteria | 9846 |
| 896 | nmdc:mga05p37_13888_c1 | 3300050507 | Bacteria | 9652 |
| 897 | nmdc:mga05p37_155369_c1 | 3300050507 | Bacteria | 2796 |
| 898 | nmdc:mga05p37_169056_c1 | 3300050507 | Bacteria | 2667 |
| 899 | nmdc:mga05p37_208979_c1 | 3300050507 | Bacteria | 2360 |
| 900 | nmdc:mga05p37_21714_c1 | 3300050507 | Bacteria | 7776 |
| 901 | nmdc:mga05p37_2264_c1 | 3300050507 | Bacteria | 22435 |
| 902 | nmdc:mga05p37_260198_c1 | 3300050507 | Bacteria | 2077 |
| 903 | nmdc:mga05p37_284012_c1 | 3300050507 | Bacteria | 1973 |
| 904 | nmdc:mga05p37_29334_c1 | 3300050507 | Bacteria | 6714 |
| 905 | nmdc:mga05p37_2985_c1 | 3300050507 | Bacteria | 19650 |
| 906 | nmdc:mga05p37_308166_c1 | 3300050507 | Bacteria | 1878 |
| 907 | nmdc:mga05p37_352059_c1 | 3300050507 | Bacteria | 1734 |
| 908 | nmdc:mga05p37_352769_c1 | 3300050507 | Bacteria | 1732 |
| 909 | nmdc:mga05p37_37533_c1 | 3300050507 | Bacteria | 5941 |
| 910 | nmdc:mga05p37_38691_c1 | 3300050507 | Bacteria | 5853 |
| 911 | nmdc:mga05p37_441644_c1 | 3300050507 | Bacteria | 1509 |
| 912 | nmdc:mga05p37_461039_c1 | 3300050507 | Unclassified | 1469 |
| 913 | nmdc:mga05p37_491_c1 | 3300050507 | Bacteria | 43356 |
| 914 | nmdc:mga05p37_511488_c1 | 3300050507 | Bacteria | 1376 |
| 915 | nmdc:mga05p37_527792_c1 | 3300050507 | Bacteria | 912 |
| 916 | nmdc:mga05p37_554389_c1 | 3300050507 | Bacteria | 1307 |
| 917 | nmdc:mga05p37_58271_c1 | 3300050507 | Bacteria | 4757 |
| 918 | nmdc:mga05p37_708888_c1 | 3300050507 | Bacteria | 1116 |
| 919 | nmdc:mga05p37_720571_c1 | 3300050507 | Bacteria | 1105 |
| 920 | nmdc:mga05p37_79_c1 | 3300050507 | Bacteria | 85182 |
| 921 | nmdc:mga05p37_876178_c1 | 3300050507 | Bacteria | 971 |
| 922 | nmdc:mga05p37_991_c1 | 3300050507 | Bacteria | 32378 |
| 923 | nmdc:mga09592_11547_c1 | 3300050508 | Bacteria | 7185 |
| 924 | nmdc:mga09592_14031_c1 | 3300050508 | Bacteria | 6541 |
| 925 | nmdc:mga09592_170190_c1 | 3300050508 | Bacteria | 1884 |
| 926 | nmdc:mga09592_172832_c1 | 3300050508 | Bacteria | 1868 |
| 927 | nmdc:mga09592_256747_c1 | 3300050508 | Unclassified | 1515 |
| 928 | nmdc:mga09592_305656_c1 | 3300050508 | Bacteria | 1379 |
| 929 | nmdc:mga09592_370636_c1 | 3300050508 | Bacteria | 1238 |
| 930 | nmdc:mga09592_433519_c1 | 3300050508 | Bacteria | 1135 |
| 931 | nmdc:mga09592_507597_c1 | 3300050508 | Bacteria | 1038 |
| 932 | nmdc:mga09592_687080_c1 | 3300050508 | Unclassified | 872 |
| 933 | nmdc:mga09592_75905_c1 | 3300050508 | Bacteria | 2858 |
| 934 | nmdc:mga0qj67_339787_c1 | 3300050509 | Bacteria | 1214 |
| 935 | nmdc:mga0qj67_35067_c1 | 3300050509 | Bacteria | 3922 |
| 936 | nmdc:mga0qj67_377543_c1 | 3300050509 | Unclassified | 1145 |
| 937 | nmdc:mga0qj67_413768_c1 | 3300050509 | Bacteria | 1087 |
| 938 | nmdc:mga0qj67_487064_c1 | 3300050509 | Bacteria | 992 |
| 939 | nmdc:mga0qj67_52444_c1 | 3300050509 | Bacteria | 3228 |
| 940 | nmdc:mga0qj67_7248_c1 | 3300050509 | Bacteria | 8193 |
| 941 | nmdc:mga06r32_101683_c1 | 3300050510 | Bacteria | 2821 |
| 942 | nmdc:mga06r32_176367_c1 | 3300050510 | Bacteria | 2122 |
| 943 | nmdc:mga06r32_176801_c1 | 3300050510 | Bacteria | 2119 |
| 944 | nmdc:mga06r32_202958_c1 | 3300050510 | Bacteria | 1970 |
| 945 | nmdc:mga06r32_21017_c1 | 3300050510 | Bacteria | 6021 |
| 946 | nmdc:mga06r32_283685_c1 | 3300050510 | Bacteria | 1643 |
| 947 | nmdc:mga06r32_312514_c1 | 3300050510 | Bacteria | 1557 |
| 948 | nmdc:mga06r32_354590_c1 | 3300050510 | Bacteria | 1451 |
| 949 | nmdc:mga06r32_45076_c1 | 3300050510 | Bacteria | 4202 |
| 950 | nmdc:mga06r32_653011_c1 | 3300050510 | Bacteria | 1020 |
| 951 | nmdc:mga06r32_6852_c1 | 3300050510 | Bacteria | 10241 |
| 952 | nmdc:mga08y16_1318648_c1 | 3300050511 | Bacteria | 688 |
| 953 | nmdc:mga08y16_200287_c1 | 3300050511 | Bacteria | 2069 |
| 954 | nmdc:mga08y16_463068_c1 | 3300050511 | Unclassified | 1292 |
| 955 | nmdc:mga08y16_572158_c1 | 3300050511 | Bacteria | 1141 |
| 956 | nmdc:mga08y16_594252_c1 | 3300050511 | Bacteria | 1116 |
| 957 | nmdc:mga08y16_741248_c1 | 3300050511 | Unclassified | 979 |
| 958 | nmdc:mga08y16_78900_c1 | 3300050511 | Bacteria | 3432 |
| 959 | nmdc:mga08y16_872464_c1 | 3300050511 | Bacteria | 888 |
| 960 | nmdc:mga08y16_89545_c1 | 3300050511 | Bacteria | 3207 |
| 961 | nmdc:mga08y16_9772_c1 | 3300050511 | Bacteria | 10075 |
| 962 | nmdc:mga0n895_10664_c1 | 3300050512 | Bacteria | 8138 |
| 963 | nmdc:mga0n895_1123_c1 | 3300050512 | Bacteria | 19550 |
| 964 | nmdc:mga0n895_127369_c1 | 3300050512 | Bacteria | 2570 |
| 965 | nmdc:mga0n895_129603_c1 | 3300050512 | Bacteria | 2547 |
| 966 | nmdc:mga0n895_1338814_c1 | 3300050512 | Bacteria | 686 |
| 967 | nmdc:mga0n895_172180_c1 | 3300050512 | Bacteria | 2197 |
| 968 | nmdc:mga0n895_177204_c1 | 3300050512 | Bacteria | 2163 |
| 969 | nmdc:mga0n895_194258_c1 | 3300050512 | Bacteria | 2061 |
| 970 | nmdc:mga0n895_22284_c1 | 3300050512 | Bacteria | 5939 |
| 971 | nmdc:mga0n895_233540_c1 | 3300050512 | Bacteria | 1867 |
| 972 | nmdc:mga0n895_266001_c1 | 3300050512 | Bacteria | 1740 |
| 973 | nmdc:mga0n895_31868_c1 | 3300050512 | Bacteria | 5053 |
| 974 | nmdc:mga0n895_332683_c1 | 3300050512 | Bacteria | 1539 |
| 975 | nmdc:mga0n895_344847_c1 | 3300050512 | Bacteria | 1509 |
| 976 | nmdc:mga0n895_368247_c1 | 3300050512 | Bacteria | 1455 |
| 977 | nmdc:mga0n895_39905_c1 | 3300050512 | Bacteria | 4559 |
| 978 | nmdc:mga0n895_403302_c1 | 3300050512 | Bacteria | 1383 |
| 979 | nmdc:mga0n895_42084_c1 | 3300050512 | Bacteria | 4444 |
| 980 | nmdc:mga0n895_453875_c1 | 3300050512 | Unclassified | 1294 |
| 981 | nmdc:mga0n895_482075_c1 | 3300050512 | Bacteria | 1251 |
| 982 | nmdc:mga0n895_486897_c1 | 3300050512 | Bacteria | 1244 |
| 983 | nmdc:mga0n895_517578_c1 | 3300050512 | Bacteria | 1201 |
| 984 | nmdc:mga0n895_585369_c1 | 3300050512 | Bacteria | 1119 |
| 985 | nmdc:mga0n895_623932_c1 | 3300050512 | Bacteria | 1079 |
| 986 | nmdc:mga0n895_645233_c1 | 3300050512 | Bacteria | 1058 |
| 987 | nmdc:mga0n895_700_c1 | 3300050512 | Bacteria | 23549 |
| 988 | nmdc:mga0n895_716247_c1 | 3300050512 | Bacteria | 996 |
| 989 | nmdc:mga0n895_86186_c1 | 3300050512 | Bacteria | 3137 |
| 990 | nmdc:mga0n895_97034_c1 | 3300050512 | Unclassified | 2953 |
| 991 | nmdc:mga0rr50_124979_c1 | 3300050513 | Bacteria | 2053 |
| 992 | nmdc:mga0rr50_1261_c1 | 3300050513 | Bacteria | 13788 |
| 993 | nmdc:mga0rr50_129763_c1 | 3300050513 | Bacteria | 2017 |
| 994 | nmdc:mga0rr50_154421_c1 | 3300050513 | Bacteria | 1858 |
| 995 | nmdc:mga0rr50_162833_c1 | 3300050513 | Bacteria | 1812 |
| 996 | nmdc:mga0rr50_189173_c1 | 3300050513 | Bacteria | 1686 |
| 997 | nmdc:mga0rr50_198472_c1 | 3300050513 | Bacteria | 1648 |
| 998 | nmdc:mga0rr50_255069_c1 | 3300050513 | Bacteria | 1458 |
| 999 | nmdc:mga0rr50_2634_c1 | 3300050513 | Bacteria | 10164 |
| 1000 | nmdc:mga0rr50_29527_c1 | 3300050513 | Bacteria | 3869 |
| 1001 | nmdc:mga0rr50_30672_c1 | 3300050513 | Bacteria | 3810 |
| 1002 | nmdc:mga0rr50_328189_c1 | 3300050513 | Bacteria | 1284 |
| 1003 | nmdc:mga0rr50_339854_c1 | 3300050513 | Bacteria | 1261 |
| 1004 | nmdc:mga0rr50_404737_c1 | 3300050513 | Bacteria | 1153 |
| 1005 | nmdc:mga0rr50_411500_c1 | 3300050513 | Unclassified | 1143 |
| 1006 | nmdc:mga0rr50_418565_c1 | 3300050513 | Bacteria | 1133 |
| 1007 | nmdc:mga0rr50_420213_c1 | 3300050513 | Bacteria | 1131 |
| 1008 | nmdc:mga0rr50_4367_c1 | 3300050513 | Bacteria | 8304 |
| 1009 | nmdc:mga0rr50_5505_c1 | 3300050513 | Bacteria | 7562 |
| 1010 | nmdc:mga0rr50_573584_c1 | 3300050513 | Bacteria | 961 |
| 1011 | nmdc:mga0rr50_589072_c1 | 3300050513 | Bacteria | 948 |
| 1012 | nmdc:mga0rr50_68445_c1 | 3300050513 | Bacteria | 2360 |
| 1013 | nmdc:mga0rr50_753288_c1 | 3300050513 | Bacteria | 831 |
| 1014 | nmdc:mga0rr50_9648_c1 | 3300050513 | Bacteria | 6084 |
| 1015 | nmdc:mga08x19_13343_c1 | 3300050514 | Bacteria | 4965 |
| 1016 | nmdc:mga08x19_1479_c1 | 3300050514 | Bacteria | 14556 |
| 1017 | nmdc:mga08x19_148088_c1 | 3300050514 | Bacteria | 1588 |
| 1018 | nmdc:mga08x19_193062_c1 | 3300050514 | Bacteria | 1394 |
| 1019 | nmdc:mga08x19_204887_c1 | 3300050514 | Bacteria | 1353 |
| 1020 | nmdc:mga08x19_219599_c1 | 3300050514 | Bacteria | 1306 |
| 1021 | nmdc:mga08x19_220521_c1 | 3300050514 | Bacteria | 1303 |
| 1022 | nmdc:mga08x19_225258_c1 | 3300050514 | Bacteria | 1289 |
| 1023 | nmdc:mga08x19_232105_c1 | 3300050514 | Bacteria | 1270 |
| 1024 | nmdc:mga08x19_256775_c1 | 3300050514 | Bacteria | 1207 |
| 1025 | nmdc:mga08x19_272945_c1 | 3300050514 | Bacteria | 1170 |
| 1026 | nmdc:mga08x19_3476_c1 | 3300050514 | Bacteria | 9387 |
| 1027 | nmdc:mga08x19_450771_c1 | 3300050514 | Unclassified | 906 |
| 1028 | nmdc:mga08x19_45717_c1 | 3300050514 | Bacteria | 2798 |
| 1029 | nmdc:mga08x19_633567_c1 | 3300050514 | Bacteria | 758 |
| 1030 | nmdc:mga08x19_8_c1 | 3300050514 | Bacteria | 427794 |
| 1031 | nmdc:mga0a205_143966_c1 | 3300050515 | Bacteria | 2284 |
| 1032 | nmdc:mga0a205_152988_c1 | 3300050515 | Bacteria | 2206 |
| 1033 | nmdc:mga0a205_173009_c1 | 3300050515 | Bacteria | 2055 |
| 1034 | nmdc:mga0a205_18021_c1 | 3300050515 | Bacteria | 6631 |
| 1035 | nmdc:mga0a205_187531_c1 | 3300050515 | Bacteria | 1961 |
| 1036 | nmdc:mga0a205_19381_c1 | 3300050515 | Bacteria | 6412 |
| 1037 | nmdc:mga0a205_204353_c1 | 3300050515 | Bacteria | 1865 |
| 1038 | nmdc:mga0a205_222345_c1 | 3300050515 | Bacteria | 1773 |
| 1039 | nmdc:mga0a205_241335_c1 | 3300050515 | Bacteria | 1688 |
| 1040 | nmdc:mga0a205_285366_c1 | 3300050515 | Bacteria | 1526 |
| 1041 | nmdc:mga0a205_3019_c1 | 3300050515 | Bacteria | 14915 |
| 1042 | nmdc:mga0a205_302010_c1 | 3300050515 | Bacteria | 1474 |
| 1043 | nmdc:mga0a205_343167_c1 | 3300050515 | Bacteria | 1362 |
| 1044 | nmdc:mga0a205_3796_c2 | 3300050515 | Bacteria | 12079 |
| 1045 | nmdc:mga0a205_42037_c1 | 3300050515 | Bacteria | 4404 |
| 1046 | nmdc:mga0a205_42924_c1 | 3300050515 | Bacteria | 4359 |
| 1047 | nmdc:mga0a205_443829_c1 | 3300050515 | Bacteria | 1158 |
| 1048 | nmdc:mga0a205_457504_c1 | 3300050515 | Unclassified | 1136 |
| 1049 | nmdc:mga0a205_4777_c1 | 3300050515 | Bacteria | 12170 |
| 1050 | nmdc:mga0a205_488759_c1 | 3300050515 | Bacteria | 1088 |
| 1051 | nmdc:mga0a205_54934_c1 | 3300050515 | Bacteria | 3846 |
| 1052 | nmdc:mga0a205_598624_c1 | 3300050515 | Bacteria | 956 |
| 1053 | nmdc:mga0a205_659212_c1 | 3300050515 | Bacteria | 898 |
| 1054 | nmdc:mga0a205_6966_c1 | 3300050515 | Bacteria | 10226 |
| 1055 | nmdc:mga0a205_704444_c1 | 3300050515 | Bacteria | 859 |
| 1056 | nmdc:mga0a205_758506_c1 | 3300050515 | Bacteria | 819 |
| 1057 | nmdc:mga0a205_76307_c1 | 3300050515 | Bacteria | 3239 |
| 1058 | nmdc:mga0a205_88431_c1 | 3300050515 | Bacteria | 2994 |
| 1059 | nmdc:mga0sz30_310680_c1 | 3300050516 | Unclassified | 703 |
| 1060 | Ga0495601_0125076 | 3300053077 | Bacteria | 1672 |
| 1061 | Ga0495612_0102120 | 3300053078 | Unclassified | 1222 |
| 1062 | Ga0495595_0107367 | 3300053084 | Bacteria | 1351 |
| 1063 | Ga0495619_0050521 | 3300053085 | Bacteria | 2745 |
| 1064 | Ga0500618_001429 | 3300053125 | Bacteria | 10652 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100011819 | Ga0070708_1000118192 | 191 |
| 2 | 3300009176 | Ga0105242_10593919 | Ga0105242_105939192 | 197 |
| 3 | 3300003323 | rootH1_10077686 | rootH1_100776863 | 201 |
| 4 | 3300005467 | Ga0070706_100214579 | Ga0070706_1002145792 | 201 |
| 5 | 3300005468 | Ga0070707_100675305 | Ga0070707_1006753052 | 201 |
| 6 | 3300031090 | Ga0265760_10109242 | Ga0265760_101092421 | 202 |
| 7 | 3300003354 | JGI25160J50197_1032623 | JGI25160J50197_10326232 | 203 |
| 8 | 3300003775 | Ga0055524_1000017 | Ga0055524_1000017156 | 203 |
| 9 | 3300005262 | Ga0065165_1001283 | Ga0065165_10012839 | 203 |
| 10 | 3300025263 | Ga0209565_1002595 | Ga0209565_10025956 | 203 |
| 11 | 3300025295 | Ga0209564_1020233 | Ga0209564_10202334 | 203 |
| 12 | 3300025297 | Ga0209758_1001241 | Ga0209758_100124126 | 203 |
| 13 | 3300025299 | Ga0209256_1000018 | Ga0209256_1000018322 | 203 |
| 14 | 3300025302 | Ga0207426_1001703 | Ga0207426_10017038 | 203 |
| 15 | 3300050511 | nmdc:mga08y16_572158_c1 | nmdc:mga08y16_572158_c1_473_1084 | 203 |
| 16 | 3300003771 | Ga0055526_1008793 | Ga0055526_10087934 | 204 |
| 17 | 3300009147 | Ga0114129_10727537 | Ga0114129_107275372 | 204 |
| 18 | 3300025295 | Ga0209564_1002021 | Ga0209564_10020214 | 204 |
| 19 | 3300044673 | Ga0453683_0150096 | Ga0453683_0150096_42_656 | 204 |
| 20 | 3300050507 | nmdc:mga05p37_527792_c1 | nmdc:mga05p37_527792_c1_62_676 | 204 |
| 21 | 3300050512 | nmdc:mga0n895_517578_c1 | nmdc:mga0n895_517578_c1_288_962 | 204 |
| 22 | 3300002774 | JGI25150J39212_1000044 | JGI25150J39212_100004447 | 205 |
| 23 | 3300002774 | JGI25150J39212_1000132 | JGI25150J39212_100013216 | 205 |
| 24 | 3300002987 | JGI25159J45721_1016594 | JGI25159J45721_10165941 | 205 |
| 25 | 3300003187 | JGI25151J46595_10021401 | JGI25151J46595_100214013 | 205 |
| 26 | 3300003215 | JGI25153J46596_10000043 | JGI25153J46596_1000004324 | 205 |
| 27 | 3300003215 | JGI25153J46596_10000265 | JGI25153J46596_1000026516 | 205 |
| 28 | 3300003316 | rootH1_10042237 | rootH1_100422373 | 205 |
| 29 | 3300003323 | rootH1_10016176 | rootH1_100161762 | 205 |
| 30 | 3300003659 | JGI25404J52841_10028741 | JGI25404J52841_100287411 | 205 |
| 31 | 3300003771 | Ga0055526_1043098 | Ga0055526_10430981 | 205 |
| 32 | 3300003773 | Ga0055537_1000553 | Ga0055537_100055311 | 205 |
| 33 | 3300003781 | Ga0055536_1000393 | Ga0055536_10003933 | 205 |
| 34 | 3300003791 | Ga0055530_10009972 | Ga0055530_100099723 | 205 |
| 35 | 3300003792 | Ga0055540_1041615 | Ga0055540_10416152 | 205 |
| 36 | 3300003794 | Ga0055531_10000805 | Ga0055531_1000080522 | 205 |
| 37 | 3300003794 | Ga0055531_10002275 | Ga0055531_1000227511 | 205 |
| 38 | 3300005262 | Ga0065165_1011885 | Ga0065165_10118851 | 205 |
| 39 | 3300005337 | Ga0070682_100080519 | Ga0070682_1000805192 | 205 |
| 40 | 3300005337 | Ga0070682_100598915 | Ga0070682_1005989151 | 205 |
| 41 | 3300005344 | Ga0070661_100288636 | Ga0070661_1002886362 | 205 |
| 42 | 3300005347 | Ga0070668_100836728 | Ga0070668_1008367281 | 205 |
| 43 | 3300005436 | Ga0070713_100027663 | Ga0070713_1000276635 | 205 |
| 44 | 3300005437 | Ga0070710_10012689 | Ga0070710_100126892 | 205 |
| 45 | 3300005439 | Ga0070711_100042018 | Ga0070711_1000420184 | 205 |
| 46 | 3300005455 | Ga0070663_100011764 | Ga0070663_1000117643 | 205 |
| 47 | 3300005539 | Ga0068853_100231603 | Ga0068853_1002316032 | 205 |
| 48 | 3300005548 | Ga0070665_100005888 | Ga0070665_1000058883 | 205 |
| 49 | 3300005564 | Ga0070664_100211057 | Ga0070664_1002110572 | 205 |
| 50 | 3300005578 | Ga0068854_100049570 | Ga0068854_1000495701 | 205 |
| 51 | 3300005578 | Ga0068854_100523771 | Ga0068854_1005237712 | 205 |
| 52 | 3300005719 | Ga0068861_100271996 | Ga0068861_1002719962 | 205 |
| 53 | 3300005983 | Ga0081540_1000494 | Ga0081540_100049424 | 205 |
| 54 | 3300005983 | Ga0081540_1052217 | Ga0081540_10522172 | 205 |
| 55 | 3300006038 | Ga0075365_10141022 | Ga0075365_101410222 | 205 |
| 56 | 3300006042 | Ga0075368_10013725 | Ga0075368_100137253 | 205 |
| 57 | 3300006048 | Ga0075363_100000487 | Ga0075363_1000004878 | 205 |
| 58 | 3300006051 | Ga0075364_10048714 | Ga0075364_100487142 | 205 |
| 59 | 3300006051 | Ga0075364_10536748 | Ga0075364_105367481 | 205 |
| 60 | 3300006175 | Ga0070712_100003950 | Ga0070712_1000039503 | 205 |
| 61 | 3300006175 | Ga0070712_100709512 | Ga0070712_1007095121 | 205 |
| 62 | 3300006178 | Ga0075367_10177329 | Ga0075367_101773292 | 205 |
| 63 | 3300006353 | Ga0075370_10011330 | Ga0075370_100113301 | 205 |
| 64 | 3300006358 | Ga0068871_100273776 | Ga0068871_1002737762 | 205 |
| 65 | 3300009036 | Ga0105244_10005771 | Ga0105244_100057715 | 205 |
| 66 | 3300009093 | Ga0105240_10663574 | Ga0105240_106635741 | 205 |
| 67 | 3300009545 | Ga0105237_10000964 | Ga0105237_1000096430 | 205 |
| 68 | 3300009551 | Ga0105238_10426422 | Ga0105238_104264222 | 205 |
| 69 | 3300010375 | Ga0105239_10000025 | Ga0105239_10000025110 | 205 |
| 70 | 3300021320 | Ga0214544_1000424 | Ga0214544_100042475 | 205 |
| 71 | 3300021321 | Ga0214542_1000412 | Ga0214542_100041275 | 205 |
| 72 | 3300021324 | Ga0214545_1000242 | Ga0214545_100024275 | 205 |
| 73 | 3300021327 | Ga0214543_1000327 | Ga0214543_100032712 | 205 |
| 74 | 3300025245 | Ga0207425_1000037 | Ga0207425_1000037169 | 205 |
| 75 | 3300025245 | Ga0207425_1000047 | Ga0207425_1000047126 | 205 |
| 76 | 3300025258 | Ga0209129_1000378 | Ga0209129_100037822 | 205 |
| 77 | 3300025258 | Ga0209129_1000480 | Ga0209129_10004807 | 205 |
| 78 | 3300025263 | Ga0209565_1000062 | Ga0209565_100006287 | 205 |
| 79 | 3300025263 | Ga0209565_1037884 | Ga0209565_10378841 | 205 |
| 80 | 3300025284 | Ga0209130_1000318 | Ga0209130_100031837 | 205 |
| 81 | 3300025292 | Ga0209676_1000291 | Ga0209676_100029112 | 205 |
| 82 | 3300025292 | Ga0209676_1001816 | Ga0209676_10018163 | 205 |
| 83 | 3300025294 | Ga0209025_1000117 | Ga0209025_10001173 | 205 |
| 84 | 3300025294 | Ga0209025_1000150 | Ga0209025_100015024 | 205 |
| 85 | 3300025294 | Ga0209025_1045233 | Ga0209025_10452332 | 205 |
| 86 | 3300025295 | Ga0209564_1013326 | Ga0209564_10133261 | 205 |
| 87 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009854 | 205 |
| 88 | 3300025297 | Ga0209758_1000103 | Ga0209758_1000103169 | 205 |
| 89 | 3300025298 | Ga0209050_1000327 | Ga0209050_1000327107 | 205 |
| 90 | 3300025298 | Ga0209050_1002490 | Ga0209050_100249012 | 205 |
| 91 | 3300025298 | Ga0209050_1003020 | Ga0209050_10030203 | 205 |
| 92 | 3300025302 | Ga0207426_1000512 | Ga0207426_100051237 | 205 |
| 93 | 3300025302 | Ga0207426_1030352 | Ga0207426_10303523 | 205 |
| 94 | 3300025303 | Ga0209051_1017824 | Ga0209051_10178243 | 205 |
| 95 | 3300025304 | Ga0209257_1000345 | Ga0209257_10003458 | 205 |
| 96 | 3300025304 | Ga0209257_1001353 | Ga0209257_10013536 | 205 |
| 97 | 3300025898 | Ga0207692_10651571 | Ga0207692_106515711 | 205 |
| 98 | 3300025913 | Ga0207695_10000347 | Ga0207695_1000034711 | 205 |
| 99 | 3300025914 | Ga0207671_10001460 | Ga0207671_1000146011 | 205 |
| 100 | 3300025915 | Ga0207693_10008253 | Ga0207693_100082531 | 205 |
| 101 | 3300025915 | Ga0207693_10689661 | Ga0207693_106896612 | 205 |
| 102 | 3300025916 | Ga0207663_10145373 | Ga0207663_101453732 | 205 |
| 103 | 3300025924 | Ga0207694_10331642 | Ga0207694_103316421 | 205 |
| 104 | 3300025928 | Ga0207700_10084701 | Ga0207700_100847013 | 205 |
| 105 | 3300025931 | Ga0207644_10729361 | Ga0207644_107293611 | 205 |
| 106 | 3300025945 | Ga0207679_10665272 | Ga0207679_106652721 | 205 |
| 107 | 3300025972 | Ga0207668_10826589 | Ga0207668_108265891 | 205 |
| 108 | 3300025981 | Ga0207640_10031502 | Ga0207640_100315021 | 205 |
| 109 | 3300026041 | Ga0207639_10719125 | Ga0207639_107191251 | 205 |
| 110 | 3300026067 | Ga0207678_10002089 | Ga0207678_1000208915 | 205 |
| 111 | 3300026142 | Ga0207698_11125597 | Ga0207698_111255971 | 205 |
| 112 | 3300027866 | Ga0209813_10123432 | Ga0209813_101234322 | 205 |
| 113 | 3300028379 | Ga0268266_10002394 | Ga0268266_1000239417 | 205 |
| 114 | 3300037418 | Ga0395900_0112472 | Ga0395900_0112472_215_832 | 205 |
| 115 | 3300039062 | Ga0400483_083970 | Ga0400483_083970_4339_4956 | 205 |
| 116 | 3300044735 | Ga0466968_0097739 | Ga0466968_0097739_296_958 | 205 |
| 117 | 3300046474 | Ga0495605_0000749 | Ga0495605_0000749_4427_5044 | 205 |
| 118 | 3300046507 | Ga0495606_0009794 | Ga0495606_0009794_5448_6065 | 205 |
| 119 | 3300046810 | Ga0495660_0220296 | Ga0495660_0220296_140_757 | 205 |
| 120 | 3300046810 | Ga0495660_0282831 | Ga0495660_0282831_41_658 | 205 |
| 121 | 3300047320 | Ga0495672_0364999 | Ga0495672_0364999_39_656 | 205 |
| 122 | 3300047469 | Ga0495673_0067809 | Ga0495673_0067809_572_1189 | 205 |
| 123 | 3300048905 | Ga0496102_0193307 | Ga0496102_0193307_710_1327 | 205 |
| 124 | 3300048907 | Ga0496104_0050418 | Ga0496104_0050418_1657_2274 | 205 |
| 125 | 3300048910 | Ga0496107_0765576 | Ga0496107_0765576_47_664 | 205 |
| 126 | 3300048916 | Ga0496113_0193187 | Ga0496113_0193187_194_811 | 205 |
| 127 | 3300048918 | Ga0496115_0080307 | Ga0496115_0080307_1536_2153 | 205 |
| 128 | 3300048918 | Ga0496115_0500395 | Ga0496115_0500395_210_839 | 205 |
| 129 | 3300048921 | Ga0496118_0082947 | Ga0496118_0082947_809_1426 | 205 |
| 130 | 3300048924 | Ga0496121_0000245 | Ga0496121_0000245_28731_29360 | 205 |
| 131 | 3300048924 | Ga0496121_0011345 | Ga0496121_0011345_5668_6285 | 205 |
| 132 | 3300048925 | Ga0496122_0000043 | Ga0496122_0000043_162883_163500 | 205 |
| 133 | 3300048926 | Ga0496123_0000090 | Ga0496123_0000090_116827_117444 | 205 |
| 134 | 3300048926 | Ga0496123_0114209 | Ga0496123_0114209_898_1515 | 205 |
| 135 | 3300048926 | Ga0496123_0160171 | Ga0496123_0160171_564_1181 | 205 |
| 136 | 3300048929 | Ga0496126_0005254 | Ga0496126_0005254_11619_12248 | 205 |
| 137 | 3300048929 | Ga0496126_0137305 | Ga0496126_0137305_1000_1617 | 205 |
| 138 | 3300048929 | Ga0496126_0439338 | Ga0496126_0439338_31_648 | 205 |
| 139 | 3300050491 | nmdc:mga00v17_339830_c1 | nmdc:mga00v17_339830_c1_302_919 | 205 |
| 140 | 3300050492 | nmdc:mga0yw44_128213_c1 | nmdc:mga0yw44_128213_c1_368_985 | 205 |
| 141 | 3300050493 | nmdc:mga0k408_169626_c1 | nmdc:mga0k408_169626_c1_243_860 | 205 |
| 142 | 3300050496 | nmdc:mga07m45_7474_c1 | nmdc:mga07m45_7474_c1_1578_2195 | 205 |
| 143 | 3300050512 | nmdc:mga0n895_42084_c1 | nmdc:mga0n895_42084_c1_1765_2496 | 205 |
| 144 | 3300050512 | nmdc:mga0n895_585369_c1 | nmdc:mga0n895_585369_c1_364_987 | 205 |
| 145 | 3300050515 | nmdc:mga0a205_704444_c1 | nmdc:mga0a205_704444_c1_55_672 | 205 |
| 146 | 3300050515 | nmdc:mga0a205_758506_c1 | nmdc:mga0a205_758506_c1_58_675 | 205 |
| 147 | 3300050516 | nmdc:mga0sz30_310680_c1 | nmdc:mga0sz30_310680_c1_71_688 | 205 |
| 148 | 3300006844 | Ga0075428_100219793 | Ga0075428_1002197933 | 206 |
| 149 | 3300006844 | Ga0075428_100573948 | Ga0075428_1005739481 | 206 |
| 150 | 3300006847 | Ga0075431_100557529 | Ga0075431_1005575292 | 206 |
| 151 | 3300006852 | Ga0075433_10127900 | Ga0075433_101279002 | 206 |
| 152 | 3300006852 | Ga0075433_10801193 | Ga0075433_108011931 | 206 |
| 153 | 3300006871 | Ga0075434_100161118 | Ga0075434_1001611184 | 206 |
| 154 | 3300007076 | Ga0075435_100098896 | Ga0075435_1000988964 | 206 |
| 155 | 3300007076 | Ga0075435_100459042 | Ga0075435_1004590422 | 206 |
| 156 | 3300009147 | Ga0114129_10004475 | Ga0114129_100044753 | 206 |
| 157 | 3300009147 | Ga0114129_10004685 | Ga0114129_100046859 | 206 |
| 158 | 3300009147 | Ga0114129_10483623 | Ga0114129_104836233 | 206 |
| 159 | 3300028381 | Ga0268264_11025120 | Ga0268264_110251201 | 206 |
| 160 | 3300046474 | Ga0495605_0269777 | Ga0495605_0269777_21_641 | 206 |
| 161 | 3300048910 | Ga0496107_0817709 | Ga0496107_0817709_37_657 | 206 |
| 162 | 3300048918 | Ga0496115_0132347 | Ga0496115_0132347_1419_2039 | 206 |
| 163 | 3300048918 | Ga0496115_0260607 | Ga0496115_0260607_184_804 | 206 |
| 164 | 3300048918 | Ga0496115_0694642 | Ga0496115_0694642_46_666 | 206 |
| 165 | 3300050507 | nmdc:mga05p37_352059_c1 | nmdc:mga05p37_352059_c1_261_881 | 206 |
| 166 | 3300050507 | nmdc:mga05p37_79_c1 | nmdc:mga05p37_79_c1_62156_62776 | 206 |
| 167 | 3300050507 | nmdc:mga05p37_991_c1 | nmdc:mga05p37_991_c1_9913_10533 | 206 |
| 168 | 3300050510 | nmdc:mga06r32_354590_c1 | nmdc:mga06r32_354590_c1_221_841 | 206 |
| 169 | 3300050511 | nmdc:mga08y16_594252_c1 | nmdc:mga08y16_594252_c1_123_743 | 206 |
| 170 | 3300050512 | nmdc:mga0n895_194258_c1 | nmdc:mga0n895_194258_c1_1421_2041 | 206 |
| 171 | 3300050513 | nmdc:mga0rr50_411500_c1 | nmdc:mga0rr50_411500_c1_471_1091 | 206 |
| 172 | 3300050513 | nmdc:mga0rr50_5505_c1 | nmdc:mga0rr50_5505_c1_998_1618 | 206 |
| 173 | 3300050515 | nmdc:mga0a205_88431_c1 | nmdc:mga0a205_88431_c1_1122_1742 | 206 |
| 174 | 3300002737 | JGI25162J39368_1001022 | JGI25162J39368_100102218 | 207 |
| 175 | 3300003214 | JGI25165J46597_1000276 | JGI25165J46597_100027654 | 207 |
| 176 | 3300003373 | JGI25407J50210_10054340 | JGI25407J50210_100543402 | 207 |
| 177 | 3300003911 | JGI25405J52794_10001047 | JGI25405J52794_100010472 | 207 |
| 178 | 3300005289 | Ga0065704_10105882 | Ga0065704_101058822 | 207 |
| 179 | 3300005290 | Ga0065712_10001241 | Ga0065712_100012417 | 207 |
| 180 | 3300005290 | Ga0065712_10295978 | Ga0065712_102959781 | 207 |
| 181 | 3300005293 | Ga0065715_10095973 | Ga0065715_100959733 | 207 |
| 182 | 3300005293 | Ga0065715_10150025 | Ga0065715_101500252 | 207 |
| 183 | 3300005293 | Ga0065715_10300473 | Ga0065715_103004732 | 207 |
| 184 | 3300005293 | Ga0065715_10344713 | Ga0065715_103447131 | 207 |
| 185 | 3300005295 | Ga0065707_10066515 | Ga0065707_100665151 | 207 |
| 186 | 3300005295 | Ga0065707_10084964 | Ga0065707_100849647 | 207 |
| 187 | 3300005335 | Ga0070666_10040482 | Ga0070666_100404823 | 207 |
| 188 | 3300005337 | Ga0070682_100003792 | Ga0070682_1000037923 | 207 |
| 189 | 3300005338 | Ga0068868_100201975 | Ga0068868_1002019753 | 207 |
| 190 | 3300005338 | Ga0068868_101277302 | Ga0068868_1012773021 | 207 |
| 191 | 3300005339 | Ga0070660_100023777 | Ga0070660_1000237776 | 207 |
| 192 | 3300005340 | Ga0070689_100018067 | Ga0070689_1000180673 | 207 |
| 193 | 3300005340 | Ga0070689_100027619 | Ga0070689_1000276197 | 207 |
| 194 | 3300005341 | Ga0070691_10009813 | Ga0070691_100098134 | 207 |
| 195 | 3300005341 | Ga0070691_10017350 | Ga0070691_100173502 | 207 |
| 196 | 3300005343 | Ga0070687_100017106 | Ga0070687_1000171064 | 207 |
| 197 | 3300005347 | Ga0070668_100019648 | Ga0070668_1000196484 | 207 |
| 198 | 3300005347 | Ga0070668_100414151 | Ga0070668_1004141512 | 207 |
| 199 | 3300005347 | Ga0070668_100514818 | Ga0070668_1005148181 | 207 |
| 200 | 3300005353 | Ga0070669_100037023 | Ga0070669_1000370232 | 207 |
| 201 | 3300005353 | Ga0070669_100120918 | Ga0070669_1001209182 | 207 |
| 202 | 3300005353 | Ga0070669_100667130 | Ga0070669_1006671301 | 207 |
| 203 | 3300005355 | Ga0070671_100078248 | Ga0070671_1000782482 | 207 |
| 204 | 3300005355 | Ga0070671_100492473 | Ga0070671_1004924731 | 207 |
| 205 | 3300005355 | Ga0070671_100807460 | Ga0070671_1008074602 | 207 |
| 206 | 3300005356 | Ga0070674_100142987 | Ga0070674_1001429872 | 207 |
| 207 | 3300005365 | Ga0070688_100042784 | Ga0070688_1000427842 | 207 |
| 208 | 3300005365 | Ga0070688_100534970 | Ga0070688_1005349701 | 207 |
| 209 | 3300005367 | Ga0070667_100140252 | Ga0070667_1001402524 | 207 |
| 210 | 3300005367 | Ga0070667_100141623 | Ga0070667_1001416232 | 207 |
| 211 | 3300005406 | Ga0070703_10064253 | Ga0070703_100642531 | 207 |
| 212 | 3300005406 | Ga0070703_10151273 | Ga0070703_101512731 | 207 |
| 213 | 3300005406 | Ga0070703_10160910 | Ga0070703_101609101 | 207 |
| 214 | 3300005406 | Ga0070703_10196478 | Ga0070703_101964781 | 207 |
| 215 | 3300005434 | Ga0070709_10004844 | Ga0070709_100048444 | 207 |
| 216 | 3300005435 | Ga0070714_100074415 | Ga0070714_1000744151 | 207 |
| 217 | 3300005435 | Ga0070714_100074880 | Ga0070714_1000748803 | 207 |
| 218 | 3300005435 | Ga0070714_100153402 | Ga0070714_1001534023 | 207 |
| 219 | 3300005435 | Ga0070714_100839701 | Ga0070714_1008397011 | 207 |
| 220 | 3300005436 | Ga0070713_100060530 | Ga0070713_1000605303 | 207 |
| 221 | 3300005436 | Ga0070713_100080320 | Ga0070713_1000803203 | 207 |
| 222 | 3300005436 | Ga0070713_100081033 | Ga0070713_1000810335 | 207 |
| 223 | 3300005436 | Ga0070713_100176424 | Ga0070713_1001764243 | 207 |
| 224 | 3300005436 | Ga0070713_100334988 | Ga0070713_1003349882 | 207 |
| 225 | 3300005436 | Ga0070713_100446178 | Ga0070713_1004461781 | 207 |
| 226 | 3300005436 | Ga0070713_100581494 | Ga0070713_1005814941 | 207 |
| 227 | 3300005436 | Ga0070713_100754813 | Ga0070713_1007548131 | 207 |
| 228 | 3300005436 | Ga0070713_101282739 | Ga0070713_1012827391 | 207 |
| 229 | 3300005437 | Ga0070710_10051571 | Ga0070710_100515713 | 207 |
| 230 | 3300005437 | Ga0070710_10066255 | Ga0070710_100662551 | 207 |
| 231 | 3300005437 | Ga0070710_10075010 | Ga0070710_100750102 | 207 |
| 232 | 3300005437 | Ga0070710_10075659 | Ga0070710_100756592 | 207 |
| 233 | 3300005437 | Ga0070710_10236370 | Ga0070710_102363701 | 207 |
| 234 | 3300005439 | Ga0070711_100001412 | Ga0070711_10000141216 | 207 |
| 235 | 3300005439 | Ga0070711_100229132 | Ga0070711_1002291321 | 207 |
| 236 | 3300005439 | Ga0070711_100246346 | Ga0070711_1002463461 | 207 |
| 237 | 3300005440 | Ga0070705_100079313 | Ga0070705_1000793131 | 207 |
| 238 | 3300005440 | Ga0070705_100523006 | Ga0070705_1005230061 | 207 |
| 239 | 3300005440 | Ga0070705_100710452 | Ga0070705_1007104521 | 207 |
| 240 | 3300005444 | Ga0070694_100017290 | Ga0070694_1000172903 | 207 |
| 241 | 3300005444 | Ga0070694_100382885 | Ga0070694_1003828851 | 207 |
| 242 | 3300005444 | Ga0070694_100463437 | Ga0070694_1004634371 | 207 |
| 243 | 3300005444 | Ga0070694_100508519 | Ga0070694_1005085192 | 207 |
| 244 | 3300005445 | Ga0070708_100000327 | Ga0070708_10000032726 | 207 |
| 245 | 3300005445 | Ga0070708_100024936 | Ga0070708_1000249367 | 207 |
| 246 | 3300005445 | Ga0070708_100039861 | Ga0070708_1000398612 | 207 |
| 247 | 3300005445 | Ga0070708_100086373 | Ga0070708_1000863733 | 207 |
| 248 | 3300005445 | Ga0070708_100097597 | Ga0070708_1000975973 | 207 |
| 249 | 3300005445 | Ga0070708_100124707 | Ga0070708_1001247072 | 207 |
| 250 | 3300005445 | Ga0070708_100150992 | Ga0070708_1001509922 | 207 |
| 251 | 3300005445 | Ga0070708_100152133 | Ga0070708_1001521332 | 207 |
| 252 | 3300005445 | Ga0070708_100195530 | Ga0070708_1001955303 | 207 |
| 253 | 3300005445 | Ga0070708_100198356 | Ga0070708_1001983562 | 207 |
| 254 | 3300005445 | Ga0070708_100203302 | Ga0070708_1002033022 | 207 |
| 255 | 3300005445 | Ga0070708_100262275 | Ga0070708_1002622752 | 207 |
| 256 | 3300005445 | Ga0070708_100262598 | Ga0070708_1002625981 | 207 |
| 257 | 3300005445 | Ga0070708_100332498 | Ga0070708_1003324982 | 207 |
| 258 | 3300005445 | Ga0070708_100355751 | Ga0070708_1003557512 | 207 |
| 259 | 3300005445 | Ga0070708_100556719 | Ga0070708_1005567191 | 207 |
| 260 | 3300005455 | Ga0070663_100016703 | Ga0070663_1000167032 | 207 |
| 261 | 3300005456 | Ga0070678_100002534 | Ga0070678_1000025344 | 207 |
| 262 | 3300005457 | Ga0070662_100009553 | Ga0070662_1000095534 | 207 |
| 263 | 3300005459 | Ga0068867_100045742 | Ga0068867_1000457421 | 207 |
| 264 | 3300005466 | Ga0070685_10064247 | Ga0070685_100642472 | 207 |
| 265 | 3300005467 | Ga0070706_100004540 | Ga0070706_10000454014 | 207 |
| 266 | 3300005467 | Ga0070706_100006358 | Ga0070706_1000063583 | 207 |
| 267 | 3300005467 | Ga0070706_100007422 | Ga0070706_1000074227 | 207 |
| 268 | 3300005467 | Ga0070706_100009362 | Ga0070706_1000093628 | 207 |
| 269 | 3300005467 | Ga0070706_100019204 | Ga0070706_1000192043 | 207 |
| 270 | 3300005467 | Ga0070706_100029868 | Ga0070706_1000298685 | 207 |
| 271 | 3300005467 | Ga0070706_100141986 | Ga0070706_1001419862 | 207 |
| 272 | 3300005467 | Ga0070706_100157119 | Ga0070706_1001571193 | 207 |
| 273 | 3300005467 | Ga0070706_100159878 | Ga0070706_1001598783 | 207 |
| 274 | 3300005467 | Ga0070706_100344381 | Ga0070706_1003443811 | 207 |
| 275 | 3300005467 | Ga0070706_100643487 | Ga0070706_1006434872 | 207 |
| 276 | 3300005468 | Ga0070707_100009021 | Ga0070707_1000090216 | 207 |
| 277 | 3300005468 | Ga0070707_100009843 | Ga0070707_1000098436 | 207 |
| 278 | 3300005468 | Ga0070707_100018493 | Ga0070707_1000184933 | 207 |
| 279 | 3300005468 | Ga0070707_100030862 | Ga0070707_1000308623 | 207 |
| 280 | 3300005468 | Ga0070707_100033453 | Ga0070707_1000334533 | 207 |
| 281 | 3300005468 | Ga0070707_100065091 | Ga0070707_1000650913 | 207 |
| 282 | 3300005468 | Ga0070707_100126479 | Ga0070707_1001264792 | 207 |
| 283 | 3300005468 | Ga0070707_100139495 | Ga0070707_1001394951 | 207 |
| 284 | 3300005468 | Ga0070707_100258676 | Ga0070707_1002586762 | 207 |
| 285 | 3300005468 | Ga0070707_100261425 | Ga0070707_1002614252 | 207 |
| 286 | 3300005468 | Ga0070707_100373945 | Ga0070707_1003739451 | 207 |
| 287 | 3300005468 | Ga0070707_100444884 | Ga0070707_1004448842 | 207 |
| 288 | 3300005468 | Ga0070707_100487286 | Ga0070707_1004872862 | 207 |
| 289 | 3300005468 | Ga0070707_100621527 | Ga0070707_1006215272 | 207 |
| 290 | 3300005468 | Ga0070707_100700568 | Ga0070707_1007005682 | 207 |
| 291 | 3300005471 | Ga0070698_100008194 | Ga0070698_1000081948 | 207 |
| 292 | 3300005471 | Ga0070698_100014041 | Ga0070698_1000140415 | 207 |
| 293 | 3300005471 | Ga0070698_100029756 | Ga0070698_1000297563 | 207 |
| 294 | 3300005471 | Ga0070698_100034175 | Ga0070698_1000341754 | 207 |
| 295 | 3300005471 | Ga0070698_100054828 | Ga0070698_1000548282 | 207 |
| 296 | 3300005471 | Ga0070698_100061029 | Ga0070698_1000610294 | 207 |
| 297 | 3300005471 | Ga0070698_100064612 | Ga0070698_1000646122 | 207 |
| 298 | 3300005471 | Ga0070698_100087994 | Ga0070698_1000879944 | 207 |
| 299 | 3300005471 | Ga0070698_100089099 | Ga0070698_1000890996 | 207 |
| 300 | 3300005471 | Ga0070698_100109669 | Ga0070698_1001096692 | 207 |
| 301 | 3300005471 | Ga0070698_100114191 | Ga0070698_1001141913 | 207 |
| 302 | 3300005471 | Ga0070698_100214036 | Ga0070698_1002140362 | 207 |
| 303 | 3300005471 | Ga0070698_100303321 | Ga0070698_1003033212 | 207 |
| 304 | 3300005471 | Ga0070698_100334536 | Ga0070698_1003345361 | 207 |
| 305 | 3300005471 | Ga0070698_100454634 | Ga0070698_1004546341 | 207 |
| 306 | 3300005471 | Ga0070698_100557483 | Ga0070698_1005574832 | 207 |
| 307 | 3300005471 | Ga0070698_100868048 | Ga0070698_1008680481 | 207 |
| 308 | 3300005471 | Ga0070698_100892199 | Ga0070698_1008921991 | 207 |
| 309 | 3300005518 | Ga0070699_100004190 | Ga0070699_1000041902 | 207 |
| 310 | 3300005518 | Ga0070699_100017176 | Ga0070699_1000171762 | 207 |
| 311 | 3300005518 | Ga0070699_100054650 | Ga0070699_1000546504 | 207 |
| 312 | 3300005518 | Ga0070699_100077202 | Ga0070699_1000772024 | 207 |
| 313 | 3300005518 | Ga0070699_100078547 | Ga0070699_1000785472 | 207 |
| 314 | 3300005518 | Ga0070699_100137897 | Ga0070699_1001378973 | 207 |
| 315 | 3300005518 | Ga0070699_100210749 | Ga0070699_1002107492 | 207 |
| 316 | 3300005518 | Ga0070699_100274525 | Ga0070699_1002745251 | 207 |
| 317 | 3300005518 | Ga0070699_100347088 | Ga0070699_1003470882 | 207 |
| 318 | 3300005518 | Ga0070699_100358408 | Ga0070699_1003584082 | 207 |
| 319 | 3300005518 | Ga0070699_100398865 | Ga0070699_1003988651 | 207 |
| 320 | 3300005518 | Ga0070699_100401805 | Ga0070699_1004018051 | 207 |
| 321 | 3300005518 | Ga0070699_100453804 | Ga0070699_1004538042 | 207 |
| 322 | 3300005518 | Ga0070699_100505170 | Ga0070699_1005051701 | 207 |
| 323 | 3300005518 | Ga0070699_100545237 | Ga0070699_1005452372 | 207 |
| 324 | 3300005518 | Ga0070699_100948268 | Ga0070699_1009482681 | 207 |
| 325 | 3300005536 | Ga0070697_100007293 | Ga0070697_1000072938 | 207 |
| 326 | 3300005536 | Ga0070697_100007757 | Ga0070697_1000077573 | 207 |
| 327 | 3300005536 | Ga0070697_100017733 | Ga0070697_1000177334 | 207 |
| 328 | 3300005536 | Ga0070697_100032620 | Ga0070697_1000326204 | 207 |
| 329 | 3300005536 | Ga0070697_100041917 | Ga0070697_1000419172 | 207 |
| 330 | 3300005536 | Ga0070697_100101570 | Ga0070697_1001015703 | 207 |
| 331 | 3300005536 | Ga0070697_100116022 | Ga0070697_1001160222 | 207 |
| 332 | 3300005536 | Ga0070697_100131380 | Ga0070697_1001313801 | 207 |
| 333 | 3300005536 | Ga0070697_100200865 | Ga0070697_1002008651 | 207 |
| 334 | 3300005536 | Ga0070697_100254396 | Ga0070697_1002543962 | 207 |
| 335 | 3300005536 | Ga0070697_100353426 | Ga0070697_1003534262 | 207 |
| 336 | 3300005536 | Ga0070697_100385229 | Ga0070697_1003852291 | 207 |
| 337 | 3300005536 | Ga0070697_100438865 | Ga0070697_1004388652 | 207 |
| 338 | 3300005536 | Ga0070697_100523208 | Ga0070697_1005232081 | 207 |
| 339 | 3300005536 | Ga0070697_100565601 | Ga0070697_1005656011 | 207 |
| 340 | 3300005536 | Ga0070697_100986311 | Ga0070697_1009863111 | 207 |
| 341 | 3300005539 | Ga0068853_100017172 | Ga0068853_1000171721 | 207 |
| 342 | 3300005543 | Ga0070672_100030559 | Ga0070672_1000305598 | 207 |
| 343 | 3300005544 | Ga0070686_100006693 | Ga0070686_1000066936 | 207 |
| 344 | 3300005545 | Ga0070695_100027617 | Ga0070695_1000276174 | 207 |
| 345 | 3300005545 | Ga0070695_100027867 | Ga0070695_1000278675 | 207 |
| 346 | 3300005545 | Ga0070695_100065982 | Ga0070695_1000659822 | 207 |
| 347 | 3300005545 | Ga0070695_100435303 | Ga0070695_1004353031 | 207 |
| 348 | 3300005545 | Ga0070695_100562165 | Ga0070695_1005621652 | 207 |
| 349 | 3300005545 | Ga0070695_100844889 | Ga0070695_1008448891 | 207 |
| 350 | 3300005546 | Ga0070696_100034202 | Ga0070696_1000342022 | 207 |
| 351 | 3300005546 | Ga0070696_100036799 | Ga0070696_1000367996 | 207 |
| 352 | 3300005546 | Ga0070696_100046895 | Ga0070696_1000468951 | 207 |
| 353 | 3300005546 | Ga0070696_100103608 | Ga0070696_1001036083 | 207 |
| 354 | 3300005546 | Ga0070696_100148354 | Ga0070696_1001483542 | 207 |
| 355 | 3300005546 | Ga0070696_100181210 | Ga0070696_1001812103 | 207 |
| 356 | 3300005546 | Ga0070696_100196543 | Ga0070696_1001965432 | 207 |
| 357 | 3300005546 | Ga0070696_100244947 | Ga0070696_1002449471 | 207 |
| 358 | 3300005546 | Ga0070696_100316303 | Ga0070696_1003163032 | 207 |
| 359 | 3300005546 | Ga0070696_100528193 | Ga0070696_1005281932 | 207 |
| 360 | 3300005548 | Ga0070665_100099412 | Ga0070665_1000994123 | 207 |
| 361 | 3300005548 | Ga0070665_100488105 | Ga0070665_1004881052 | 207 |
| 362 | 3300005548 | Ga0070665_100766005 | Ga0070665_1007660051 | 207 |
| 363 | 3300005549 | Ga0070704_100020569 | Ga0070704_1000205692 | 207 |
| 364 | 3300005549 | Ga0070704_100022009 | Ga0070704_1000220096 | 207 |
| 365 | 3300005549 | Ga0070704_100030427 | Ga0070704_1000304271 | 207 |
| 366 | 3300005549 | Ga0070704_100226560 | Ga0070704_1002265602 | 207 |
| 367 | 3300005549 | Ga0070704_100243905 | Ga0070704_1002439052 | 207 |
| 368 | 3300005549 | Ga0070704_100265153 | Ga0070704_1002651533 | 207 |
| 369 | 3300005549 | Ga0070704_100377307 | Ga0070704_1003773072 | 207 |
| 370 | 3300005549 | Ga0070704_100573656 | Ga0070704_1005736562 | 207 |
| 371 | 3300005549 | Ga0070704_100596189 | Ga0070704_1005961892 | 207 |
| 372 | 3300005577 | Ga0068857_100017155 | Ga0068857_1000171554 | 207 |
| 373 | 3300005578 | Ga0068854_100011429 | Ga0068854_10001142910 | 207 |
| 374 | 3300005615 | Ga0070702_100001810 | Ga0070702_10000181010 | 207 |
| 375 | 3300005616 | Ga0068852_100012556 | Ga0068852_1000125566 | 207 |
| 376 | 3300005617 | Ga0068859_100362090 | Ga0068859_1003620903 | 207 |
| 377 | 3300005618 | Ga0068864_100269485 | Ga0068864_1002694851 | 207 |
| 378 | 3300005718 | Ga0068866_10469634 | Ga0068866_104696341 | 207 |
| 379 | 3300005719 | Ga0068861_100034650 | Ga0068861_1000346505 | 207 |
| 380 | 3300005719 | Ga0068861_100119064 | Ga0068861_1001190642 | 207 |
| 381 | 3300005719 | Ga0068861_100475677 | Ga0068861_1004756771 | 207 |
| 382 | 3300005841 | Ga0068863_100012142 | Ga0068863_1000121423 | 207 |
| 383 | 3300005842 | Ga0068858_100228910 | Ga0068858_1002289102 | 207 |
| 384 | 3300005843 | Ga0068860_100016584 | Ga0068860_1000165846 | 207 |
| 385 | 3300005843 | Ga0068860_100892269 | Ga0068860_1008922692 | 207 |
| 386 | 3300005844 | Ga0068862_100009669 | Ga0068862_1000096696 | 207 |
| 387 | 3300005937 | Ga0081455_10006446 | Ga0081455_100064464 | 207 |
| 388 | 3300005937 | Ga0081455_10010595 | Ga0081455_100105958 | 207 |
| 389 | 3300005937 | Ga0081455_10116873 | Ga0081455_101168732 | 207 |
| 390 | 3300005981 | Ga0081538_10003905 | Ga0081538_100039056 | 207 |
| 391 | 3300005981 | Ga0081538_10008589 | Ga0081538_100085897 | 207 |
| 392 | 3300005981 | Ga0081538_10012492 | Ga0081538_100124922 | 207 |
| 393 | 3300005981 | Ga0081538_10135447 | Ga0081538_101354472 | 207 |
| 394 | 3300005985 | Ga0081539_10061200 | Ga0081539_100612003 | 207 |
| 395 | 3300006028 | Ga0070717_10011227 | Ga0070717_100112272 | 207 |
| 396 | 3300006028 | Ga0070717_10013507 | Ga0070717_100135075 | 207 |
| 397 | 3300006028 | Ga0070717_10111075 | Ga0070717_101110752 | 207 |
| 398 | 3300006028 | Ga0070717_10111664 | Ga0070717_101116644 | 207 |
| 399 | 3300006028 | Ga0070717_10153964 | Ga0070717_101539642 | 207 |
| 400 | 3300006028 | Ga0070717_10163817 | Ga0070717_101638171 | 207 |
| 401 | 3300006028 | Ga0070717_10325851 | Ga0070717_103258512 | 207 |
| 402 | 3300006028 | Ga0070717_10470178 | Ga0070717_104701782 | 207 |
| 403 | 3300006028 | Ga0070717_10548576 | Ga0070717_105485761 | 207 |
| 404 | 3300006028 | Ga0070717_10642939 | Ga0070717_106429391 | 207 |
| 405 | 3300006028 | Ga0070717_10906287 | Ga0070717_109062871 | 207 |
| 406 | 3300006163 | Ga0070715_10019337 | Ga0070715_100193374 | 207 |
| 407 | 3300006163 | Ga0070715_10019458 | Ga0070715_100194582 | 207 |
| 408 | 3300006163 | Ga0070715_10094818 | Ga0070715_100948183 | 207 |
| 409 | 3300006163 | Ga0070715_10307258 | Ga0070715_103072581 | 207 |
| 410 | 3300006173 | Ga0070716_100002178 | Ga0070716_1000021786 | 207 |
| 411 | 3300006173 | Ga0070716_100011404 | Ga0070716_1000114043 | 207 |
| 412 | 3300006173 | Ga0070716_100023382 | Ga0070716_1000233826 | 207 |
| 413 | 3300006173 | Ga0070716_100086870 | Ga0070716_1000868702 | 207 |
| 414 | 3300006173 | Ga0070716_100151142 | Ga0070716_1001511421 | 207 |
| 415 | 3300006173 | Ga0070716_100225498 | Ga0070716_1002254982 | 207 |
| 416 | 3300006173 | Ga0070716_100228945 | Ga0070716_1002289452 | 207 |
| 417 | 3300006173 | Ga0070716_100241319 | Ga0070716_1002413192 | 207 |
| 418 | 3300006173 | Ga0070716_100564528 | Ga0070716_1005645281 | 207 |
| 419 | 3300006173 | Ga0070716_100610680 | Ga0070716_1006106801 | 207 |
| 420 | 3300006175 | Ga0070712_100006417 | Ga0070712_1000064178 | 207 |
| 421 | 3300006175 | Ga0070712_100058515 | Ga0070712_1000585152 | 207 |
| 422 | 3300006175 | Ga0070712_100059493 | Ga0070712_1000594933 | 207 |
| 423 | 3300006175 | Ga0070712_100820479 | Ga0070712_1008204791 | 207 |
| 424 | 3300006237 | Ga0097621_100761348 | Ga0097621_1007613481 | 207 |
| 425 | 3300006358 | Ga0068871_100228670 | Ga0068871_1002286702 | 207 |
| 426 | 3300006844 | Ga0075428_100026406 | Ga0075428_1000264066 | 207 |
| 427 | 3300006844 | Ga0075428_100027761 | Ga0075428_1000277615 | 207 |
| 428 | 3300006844 | Ga0075428_100044754 | Ga0075428_1000447547 | 207 |
| 429 | 3300006844 | Ga0075428_100068519 | Ga0075428_1000685193 | 207 |
| 430 | 3300006844 | Ga0075428_100097710 | Ga0075428_1000977105 | 207 |
| 431 | 3300006844 | Ga0075428_100099150 | Ga0075428_1000991504 | 207 |
| 432 | 3300006844 | Ga0075428_100122741 | Ga0075428_1001227413 | 207 |
| 433 | 3300006844 | Ga0075428_100156310 | Ga0075428_1001563104 | 207 |
| 434 | 3300006844 | Ga0075428_100162662 | Ga0075428_1001626623 | 207 |
| 435 | 3300006844 | Ga0075428_100192864 | Ga0075428_1001928643 | 207 |
| 436 | 3300006844 | Ga0075428_100226376 | Ga0075428_1002263763 | 207 |
| 437 | 3300006844 | Ga0075428_100279629 | Ga0075428_1002796292 | 207 |
| 438 | 3300006844 | Ga0075428_100353716 | Ga0075428_1003537162 | 207 |
| 439 | 3300006844 | Ga0075428_100355340 | Ga0075428_1003553402 | 207 |
| 440 | 3300006844 | Ga0075428_100402237 | Ga0075428_1004022372 | 207 |
| 441 | 3300006844 | Ga0075428_100778339 | Ga0075428_1007783391 | 207 |
| 442 | 3300006846 | Ga0075430_100020140 | Ga0075430_1000201402 | 207 |
| 443 | 3300006846 | Ga0075430_100054534 | Ga0075430_1000545343 | 207 |
| 444 | 3300006846 | Ga0075430_100059465 | Ga0075430_1000594654 | 207 |
| 445 | 3300006846 | Ga0075430_100278704 | Ga0075430_1002787043 | 207 |
| 446 | 3300006846 | Ga0075430_100362592 | Ga0075430_1003625922 | 207 |
| 447 | 3300006847 | Ga0075431_100022859 | Ga0075431_1000228597 | 207 |
| 448 | 3300006847 | Ga0075431_100065686 | Ga0075431_1000656861 | 207 |
| 449 | 3300006847 | Ga0075431_100287923 | Ga0075431_1002879231 | 207 |
| 450 | 3300006847 | Ga0075431_100319715 | Ga0075431_1003197152 | 207 |
| 451 | 3300006847 | Ga0075431_100360776 | Ga0075431_1003607762 | 207 |
| 452 | 3300006852 | Ga0075433_10001320 | Ga0075433_1000132017 | 207 |
| 453 | 3300006852 | Ga0075433_10002036 | Ga0075433_1000203612 | 207 |
| 454 | 3300006852 | Ga0075433_10003541 | Ga0075433_100035418 | 207 |
| 455 | 3300006852 | Ga0075433_10006871 | Ga0075433_100068713 | 207 |
| 456 | 3300006852 | Ga0075433_10010320 | Ga0075433_100103202 | 207 |
| 457 | 3300006852 | Ga0075433_10011565 | Ga0075433_100115654 | 207 |
| 458 | 3300006852 | Ga0075433_10034231 | Ga0075433_100342314 | 207 |
| 459 | 3300006852 | Ga0075433_10053330 | Ga0075433_100533301 | 207 |
| 460 | 3300006852 | Ga0075433_10076139 | Ga0075433_100761393 | 207 |
| 461 | 3300006852 | Ga0075433_10148695 | Ga0075433_101486952 | 207 |
| 462 | 3300006852 | Ga0075433_10152514 | Ga0075433_101525142 | 207 |
| 463 | 3300006852 | Ga0075433_10194662 | Ga0075433_101946622 | 207 |
| 464 | 3300006852 | Ga0075433_10231520 | Ga0075433_102315203 | 207 |
| 465 | 3300006852 | Ga0075433_10261307 | Ga0075433_102613072 | 207 |
| 466 | 3300006852 | Ga0075433_10288162 | Ga0075433_102881623 | 207 |
| 467 | 3300006852 | Ga0075433_10459230 | Ga0075433_104592302 | 207 |
| 468 | 3300006852 | Ga0075433_10459672 | Ga0075433_104596721 | 207 |
| 469 | 3300006852 | Ga0075433_10496308 | Ga0075433_104963082 | 207 |
| 470 | 3300006852 | Ga0075433_10681852 | Ga0075433_106818521 | 207 |
| 471 | 3300006871 | Ga0075434_100005686 | Ga0075434_1000056867 | 207 |
| 472 | 3300006871 | Ga0075434_100007695 | Ga0075434_10000769510 | 207 |
| 473 | 3300006871 | Ga0075434_100019749 | Ga0075434_1000197495 | 207 |
| 474 | 3300006871 | Ga0075434_100034636 | Ga0075434_1000346363 | 207 |
| 475 | 3300006871 | Ga0075434_100046970 | Ga0075434_1000469705 | 207 |
| 476 | 3300006871 | Ga0075434_100057121 | Ga0075434_1000571212 | 207 |
| 477 | 3300006871 | Ga0075434_100114024 | Ga0075434_1001140243 | 207 |
| 478 | 3300006871 | Ga0075434_100145351 | Ga0075434_1001453512 | 207 |
| 479 | 3300006871 | Ga0075434_100210425 | Ga0075434_1002104251 | 207 |
| 480 | 3300006871 | Ga0075434_100212061 | Ga0075434_1002120612 | 207 |
| 481 | 3300006871 | Ga0075434_100248425 | Ga0075434_1002484252 | 207 |
| 482 | 3300006871 | Ga0075434_100254674 | Ga0075434_1002546742 | 207 |
| 483 | 3300006871 | Ga0075434_100278393 | Ga0075434_1002783932 | 207 |
| 484 | 3300006871 | Ga0075434_100306409 | Ga0075434_1003064092 | 207 |
| 485 | 3300006871 | Ga0075434_100354064 | Ga0075434_1003540642 | 207 |
| 486 | 3300006871 | Ga0075434_100429004 | Ga0075434_1004290042 | 207 |
| 487 | 3300006871 | Ga0075434_100495667 | Ga0075434_1004956672 | 207 |
| 488 | 3300006871 | Ga0075434_100649057 | Ga0075434_1006490572 | 207 |
| 489 | 3300006871 | Ga0075434_100707807 | Ga0075434_1007078072 | 207 |
| 490 | 3300006871 | Ga0075434_100724323 | Ga0075434_1007243232 | 207 |
| 491 | 3300006871 | Ga0075434_100747756 | Ga0075434_1007477562 | 207 |
| 492 | 3300006871 | Ga0075434_100766494 | Ga0075434_1007664942 | 207 |
| 493 | 3300006871 | Ga0075434_101076223 | Ga0075434_1010762231 | 207 |
| 494 | 3300006880 | Ga0075429_100019033 | Ga0075429_1000190332 | 207 |
| 495 | 3300006880 | Ga0075429_100037493 | Ga0075429_1000374933 | 207 |
| 496 | 3300006880 | Ga0075429_100049459 | Ga0075429_1000494593 | 207 |
| 497 | 3300006880 | Ga0075429_100050141 | Ga0075429_1000501415 | 207 |
| 498 | 3300006880 | Ga0075429_100149788 | Ga0075429_1001497881 | 207 |
| 499 | 3300006880 | Ga0075429_100173732 | Ga0075429_1001737321 | 207 |
| 500 | 3300006880 | Ga0075429_100256636 | Ga0075429_1002566363 | 207 |
| 501 | 3300006880 | Ga0075429_100425021 | Ga0075429_1004250212 | 207 |
| 502 | 3300006880 | Ga0075429_100786033 | Ga0075429_1007860332 | 207 |
| 503 | 3300006881 | Ga0068865_100183944 | Ga0068865_1001839442 | 207 |
| 504 | 3300006914 | Ga0075436_100003400 | Ga0075436_1000034006 | 207 |
| 505 | 3300006914 | Ga0075436_100033969 | Ga0075436_1000339692 | 207 |
| 506 | 3300006914 | Ga0075436_100065982 | Ga0075436_1000659822 | 207 |
| 507 | 3300006914 | Ga0075436_100067224 | Ga0075436_1000672242 | 207 |
| 508 | 3300006914 | Ga0075436_100198226 | Ga0075436_1001982263 | 207 |
| 509 | 3300006914 | Ga0075436_100235642 | Ga0075436_1002356422 | 207 |
| 510 | 3300006914 | Ga0075436_100296316 | Ga0075436_1002963162 | 207 |
| 511 | 3300006914 | Ga0075436_100665177 | Ga0075436_1006651771 | 207 |
| 512 | 3300006914 | Ga0075436_100669369 | Ga0075436_1006693691 | 207 |
| 513 | 3300006914 | Ga0075436_100856380 | Ga0075436_1008563801 | 207 |
| 514 | 3300006931 | Ga0097620_100362080 | Ga0097620_1003620803 | 207 |
| 515 | 3300007076 | Ga0075435_100007201 | Ga0075435_1000072016 | 207 |
| 516 | 3300007076 | Ga0075435_100013765 | Ga0075435_1000137656 | 207 |
| 517 | 3300007076 | Ga0075435_100024448 | Ga0075435_1000244486 | 207 |
| 518 | 3300007076 | Ga0075435_100055694 | Ga0075435_1000556943 | 207 |
| 519 | 3300007076 | Ga0075435_100067152 | Ga0075435_1000671522 | 207 |
| 520 | 3300007076 | Ga0075435_100071188 | Ga0075435_1000711882 | 207 |
| 521 | 3300007076 | Ga0075435_100072577 | Ga0075435_1000725773 | 207 |
| 522 | 3300007076 | Ga0075435_100152434 | Ga0075435_1001524342 | 207 |
| 523 | 3300007076 | Ga0075435_100164266 | Ga0075435_1001642662 | 207 |
| 524 | 3300007076 | Ga0075435_100228569 | Ga0075435_1002285691 | 207 |
| 525 | 3300007076 | Ga0075435_100232000 | Ga0075435_1002320002 | 207 |
| 526 | 3300007076 | Ga0075435_100313066 | Ga0075435_1003130662 | 207 |
| 527 | 3300007076 | Ga0075435_100403072 | Ga0075435_1004030722 | 207 |
| 528 | 3300007076 | Ga0075435_100408508 | Ga0075435_1004085082 | 207 |
| 529 | 3300007076 | Ga0075435_100480993 | Ga0075435_1004809931 | 207 |
| 530 | 3300007076 | Ga0075435_100585129 | Ga0075435_1005851291 | 207 |
| 531 | 3300007076 | Ga0075435_100601046 | Ga0075435_1006010461 | 207 |
| 532 | 3300007076 | Ga0075435_100893735 | Ga0075435_1008937351 | 207 |
| 533 | 3300007265 | Ga0099794_10001962 | Ga0099794_100019626 | 207 |
| 534 | 3300007265 | Ga0099794_10002095 | Ga0099794_100020954 | 207 |
| 535 | 3300007265 | Ga0099794_10020880 | Ga0099794_100208803 | 207 |
| 536 | 3300007265 | Ga0099794_10193834 | Ga0099794_101938341 | 207 |
| 537 | 3300007265 | Ga0099794_10229070 | Ga0099794_102290701 | 207 |
| 538 | 3300007788 | Ga0099795_10225537 | Ga0099795_102255371 | 207 |
| 539 | 3300009092 | Ga0105250_10030786 | Ga0105250_100307863 | 207 |
| 540 | 3300009094 | Ga0111539_10048581 | Ga0111539_100485811 | 207 |
| 541 | 3300009094 | Ga0111539_10085334 | Ga0111539_100853342 | 207 |
| 542 | 3300009094 | Ga0111539_10168166 | Ga0111539_101681663 | 207 |
| 543 | 3300009094 | Ga0111539_10203521 | Ga0111539_102035211 | 207 |
| 544 | 3300009094 | Ga0111539_10243809 | Ga0111539_102438092 | 207 |
| 545 | 3300009094 | Ga0111539_10390786 | Ga0111539_103907862 | 207 |
| 546 | 3300009094 | Ga0111539_10459093 | Ga0111539_104590931 | 207 |
| 547 | 3300009094 | Ga0111539_10486766 | Ga0111539_104867662 | 207 |
| 548 | 3300009094 | Ga0111539_10781032 | Ga0111539_107810321 | 207 |
| 549 | 3300009094 | Ga0111539_10793818 | Ga0111539_107938181 | 207 |
| 550 | 3300009098 | Ga0105245_10013776 | Ga0105245_100137768 | 207 |
| 551 | 3300009101 | Ga0105247_10038209 | Ga0105247_100382093 | 207 |
| 552 | 3300009147 | Ga0114129_10002492 | Ga0114129_1000249221 | 207 |
| 553 | 3300009147 | Ga0114129_10007203 | Ga0114129_100072035 | 207 |
| 554 | 3300009147 | Ga0114129_10017425 | Ga0114129_100174252 | 207 |
| 555 | 3300009147 | Ga0114129_10017478 | Ga0114129_100174783 | 207 |
| 556 | 3300009147 | Ga0114129_10019037 | Ga0114129_100190374 | 207 |
| 557 | 3300009147 | Ga0114129_10021529 | Ga0114129_100215292 | 207 |
| 558 | 3300009147 | Ga0114129_10041514 | Ga0114129_100415145 | 207 |
| 559 | 3300009147 | Ga0114129_10060267 | Ga0114129_100602672 | 207 |
| 560 | 3300009147 | Ga0114129_10090140 | Ga0114129_100901402 | 207 |
| 561 | 3300009147 | Ga0114129_10118447 | Ga0114129_101184474 | 207 |
| 562 | 3300009147 | Ga0114129_10184200 | Ga0114129_101842002 | 207 |
| 563 | 3300009147 | Ga0114129_10185627 | Ga0114129_101856273 | 207 |
| 564 | 3300009147 | Ga0114129_10296831 | Ga0114129_102968312 | 207 |
| 565 | 3300009147 | Ga0114129_10359204 | Ga0114129_103592042 | 207 |
| 566 | 3300009147 | Ga0114129_10378370 | Ga0114129_103783702 | 207 |
| 567 | 3300009147 | Ga0114129_10455247 | Ga0114129_104552471 | 207 |
| 568 | 3300009147 | Ga0114129_10472099 | Ga0114129_104720993 | 207 |
| 569 | 3300009147 | Ga0114129_10619674 | Ga0114129_106196742 | 207 |
| 570 | 3300009147 | Ga0114129_10653232 | Ga0114129_106532322 | 207 |
| 571 | 3300009147 | Ga0114129_10675847 | Ga0114129_106758472 | 207 |
| 572 | 3300009147 | Ga0114129_10812272 | Ga0114129_108122722 | 207 |
| 573 | 3300009147 | Ga0114129_10902255 | Ga0114129_109022551 | 207 |
| 574 | 3300009147 | Ga0114129_11076102 | Ga0114129_110761021 | 207 |
| 575 | 3300009147 | Ga0114129_11078018 | Ga0114129_110780181 | 207 |
| 576 | 3300009147 | Ga0114129_11638466 | Ga0114129_116384661 | 207 |
| 577 | 3300009148 | Ga0105243_10848832 | Ga0105243_108488321 | 207 |
| 578 | 3300009174 | Ga0105241_10040941 | Ga0105241_100409414 | 207 |
| 579 | 3300009174 | Ga0105241_10048446 | Ga0105241_100484462 | 207 |
| 580 | 3300009176 | Ga0105242_10297612 | Ga0105242_102976122 | 207 |
| 581 | 3300009176 | Ga0105242_10607719 | Ga0105242_106077192 | 207 |
| 582 | 3300009177 | Ga0105248_10011651 | Ga0105248_100116514 | 207 |
| 583 | 3300009177 | Ga0105248_10752314 | Ga0105248_107523142 | 207 |
| 584 | 3300009545 | Ga0105237_10966098 | Ga0105237_109660982 | 207 |
| 585 | 3300009553 | Ga0105249_10268839 | Ga0105249_102688392 | 207 |
| 586 | 3300009553 | Ga0105249_10314419 | Ga0105249_103144192 | 207 |
| 587 | 3300009553 | Ga0105249_10394120 | Ga0105249_103941202 | 207 |
| 588 | 3300009553 | Ga0105249_11097431 | Ga0105249_110974311 | 207 |
| 589 | 3300010159 | Ga0099796_10017097 | Ga0099796_100170972 | 207 |
| 590 | 3300010159 | Ga0099796_10085032 | Ga0099796_100850322 | 207 |
| 591 | 3300010375 | Ga0105239_10090735 | Ga0105239_100907351 | 207 |
| 592 | 3300010375 | Ga0105239_11317040 | Ga0105239_113170402 | 207 |
| 593 | 3300010375 | Ga0105239_11352899 | Ga0105239_113528991 | 207 |
| 594 | 3300011119 | Ga0105246_10214239 | Ga0105246_102142392 | 207 |
| 595 | 3300013100 | Ga0157373_10077541 | Ga0157373_100775412 | 207 |
| 596 | 3300013105 | Ga0157369_10108106 | Ga0157369_101081063 | 207 |
| 597 | 3300013296 | Ga0157374_10241514 | Ga0157374_102415142 | 207 |
| 598 | 3300013297 | Ga0157378_10021295 | Ga0157378_100212957 | 207 |
| 599 | 3300013297 | Ga0157378_10491278 | Ga0157378_104912781 | 207 |
| 600 | 3300013297 | Ga0157378_10873191 | Ga0157378_108731912 | 207 |
| 601 | 3300013306 | Ga0163162_10181078 | Ga0163162_101810782 | 207 |
| 602 | 3300013307 | Ga0157372_10744394 | Ga0157372_107443942 | 207 |
| 603 | 3300013308 | Ga0157375_10091370 | Ga0157375_100913704 | 207 |
| 604 | 3300013308 | Ga0157375_10266665 | Ga0157375_102666651 | 207 |
| 605 | 3300013308 | Ga0157375_10963889 | Ga0157375_109638892 | 207 |
| 606 | 3300014325 | Ga0163163_10017144 | Ga0163163_100171443 | 207 |
| 607 | 3300014325 | Ga0163163_10986678 | Ga0163163_109866782 | 207 |
| 608 | 3300014326 | Ga0157380_10009890 | Ga0157380_100098906 | 207 |
| 609 | 3300014326 | Ga0157380_10338927 | Ga0157380_103389272 | 207 |
| 610 | 3300014968 | Ga0157379_10312860 | Ga0157379_103128602 | 207 |
| 611 | 3300014968 | Ga0157379_10544289 | Ga0157379_105442891 | 207 |
| 612 | 3300014969 | Ga0157376_10009199 | Ga0157376_100091996 | 207 |
| 613 | 3300017792 | Ga0163161_11047058 | Ga0163161_110470581 | 207 |
| 614 | 3300024225 | Ga0224572_1002353 | Ga0224572_10023532 | 207 |
| 615 | 3300024227 | Ga0228598_1002567 | Ga0228598_10025675 | 207 |
| 616 | 3300024227 | Ga0228598_1016185 | Ga0228598_10161851 | 207 |
| 617 | 3300025233 | Ga0209437_100023 | Ga0209437_100023423 | 207 |
| 618 | 3300025261 | Ga0209233_1000062 | Ga0209233_100006252 | 207 |
| 619 | 3300025885 | Ga0207653_10055869 | Ga0207653_100558692 | 207 |
| 620 | 3300025898 | Ga0207692_10042639 | Ga0207692_100426392 | 207 |
| 621 | 3300025898 | Ga0207692_10072078 | Ga0207692_100720782 | 207 |
| 622 | 3300025899 | Ga0207642_10371252 | Ga0207642_103712521 | 207 |
| 623 | 3300025901 | Ga0207688_10008540 | Ga0207688_100085409 | 207 |
| 624 | 3300025904 | Ga0207647_10008876 | Ga0207647_100088764 | 207 |
| 625 | 3300025905 | Ga0207685_10007770 | Ga0207685_100077701 | 207 |
| 626 | 3300025905 | Ga0207685_10030721 | Ga0207685_100307213 | 207 |
| 627 | 3300025905 | Ga0207685_10037116 | Ga0207685_100371162 | 207 |
| 628 | 3300025905 | Ga0207685_10063917 | Ga0207685_100639172 | 207 |
| 629 | 3300025905 | Ga0207685_10161923 | Ga0207685_101619231 | 207 |
| 630 | 3300025906 | Ga0207699_10076719 | Ga0207699_100767192 | 207 |
| 631 | 3300025906 | Ga0207699_10087391 | Ga0207699_100873912 | 207 |
| 632 | 3300025906 | Ga0207699_10090359 | Ga0207699_100903592 | 207 |
| 633 | 3300025906 | Ga0207699_10592016 | Ga0207699_105920161 | 207 |
| 634 | 3300025907 | Ga0207645_10031716 | Ga0207645_100317165 | 207 |
| 635 | 3300025907 | Ga0207645_10285027 | Ga0207645_102850272 | 207 |
| 636 | 3300025910 | Ga0207684_10000181 | Ga0207684_1000018191 | 207 |
| 637 | 3300025910 | Ga0207684_10000507 | Ga0207684_1000050755 | 207 |
| 638 | 3300025910 | Ga0207684_10000684 | Ga0207684_1000068440 | 207 |
| 639 | 3300025910 | Ga0207684_10003189 | Ga0207684_1000318912 | 207 |
| 640 | 3300025910 | Ga0207684_10005711 | Ga0207684_100057116 | 207 |
| 641 | 3300025910 | Ga0207684_10007743 | Ga0207684_100077438 | 207 |
| 642 | 3300025910 | Ga0207684_10013300 | Ga0207684_100133006 | 207 |
| 643 | 3300025910 | Ga0207684_10019354 | Ga0207684_100193542 | 207 |
| 644 | 3300025910 | Ga0207684_10026415 | Ga0207684_100264153 | 207 |
| 645 | 3300025910 | Ga0207684_10027978 | Ga0207684_100279785 | 207 |
| 646 | 3300025910 | Ga0207684_10074280 | Ga0207684_100742801 | 207 |
| 647 | 3300025910 | Ga0207684_10079262 | Ga0207684_100792624 | 207 |
| 648 | 3300025910 | Ga0207684_10084698 | Ga0207684_100846983 | 207 |
| 649 | 3300025910 | Ga0207684_10085947 | Ga0207684_100859474 | 207 |
| 650 | 3300025910 | Ga0207684_10113533 | Ga0207684_101135332 | 207 |
| 651 | 3300025910 | Ga0207684_10116903 | Ga0207684_101169033 | 207 |
| 652 | 3300025910 | Ga0207684_10144603 | Ga0207684_101446032 | 207 |
| 653 | 3300025910 | Ga0207684_10150699 | Ga0207684_101506993 | 207 |
| 654 | 3300025910 | Ga0207684_10193612 | Ga0207684_101936121 | 207 |
| 655 | 3300025910 | Ga0207684_10481299 | Ga0207684_104812991 | 207 |
| 656 | 3300025910 | Ga0207684_10498204 | Ga0207684_104982042 | 207 |
| 657 | 3300025910 | Ga0207684_10550516 | Ga0207684_105505163 | 207 |
| 658 | 3300025910 | Ga0207684_10626499 | Ga0207684_106264992 | 207 |
| 659 | 3300025911 | Ga0207654_10044067 | Ga0207654_100440673 | 207 |
| 660 | 3300025915 | Ga0207693_10000898 | Ga0207693_1000089827 | 207 |
| 661 | 3300025915 | Ga0207693_10006516 | Ga0207693_1000651615 | 207 |
| 662 | 3300025915 | Ga0207693_10037532 | Ga0207693_100375325 | 207 |
| 663 | 3300025915 | Ga0207693_10095563 | Ga0207693_100955632 | 207 |
| 664 | 3300025916 | Ga0207663_10001824 | Ga0207663_100018246 | 207 |
| 665 | 3300025916 | Ga0207663_10017487 | Ga0207663_100174874 | 207 |
| 666 | 3300025916 | Ga0207663_10027262 | Ga0207663_100272623 | 207 |
| 667 | 3300025916 | Ga0207663_10105923 | Ga0207663_101059232 | 207 |
| 668 | 3300025916 | Ga0207663_10267973 | Ga0207663_102679732 | 207 |
| 669 | 3300025918 | Ga0207662_10040450 | Ga0207662_100404503 | 207 |
| 670 | 3300025919 | Ga0207657_10009972 | Ga0207657_100099726 | 207 |
| 671 | 3300025922 | Ga0207646_10000165 | Ga0207646_1000016530 | 207 |
| 672 | 3300025922 | Ga0207646_10000663 | Ga0207646_100006636 | 207 |
| 673 | 3300025922 | Ga0207646_10006466 | Ga0207646_100064662 | 207 |
| 674 | 3300025922 | Ga0207646_10006994 | Ga0207646_100069948 | 207 |
| 675 | 3300025922 | Ga0207646_10008284 | Ga0207646_1000828410 | 207 |
| 676 | 3300025922 | Ga0207646_10011592 | Ga0207646_100115923 | 207 |
| 677 | 3300025922 | Ga0207646_10015133 | Ga0207646_100151336 | 207 |
| 678 | 3300025922 | Ga0207646_10021846 | Ga0207646_100218466 | 207 |
| 679 | 3300025922 | Ga0207646_10029826 | Ga0207646_100298266 | 207 |
| 680 | 3300025922 | Ga0207646_10030282 | Ga0207646_100302828 | 207 |
| 681 | 3300025922 | Ga0207646_10059603 | Ga0207646_100596032 | 207 |
| 682 | 3300025922 | Ga0207646_10084655 | Ga0207646_100846552 | 207 |
| 683 | 3300025922 | Ga0207646_10205860 | Ga0207646_102058602 | 207 |
| 684 | 3300025922 | Ga0207646_10497438 | Ga0207646_104974382 | 207 |
| 685 | 3300025922 | Ga0207646_10527683 | Ga0207646_105276832 | 207 |
| 686 | 3300025922 | Ga0207646_10666228 | Ga0207646_106662281 | 207 |
| 687 | 3300025922 | Ga0207646_10804948 | Ga0207646_108049482 | 207 |
| 688 | 3300025923 | Ga0207681_10026959 | Ga0207681_100269592 | 207 |
| 689 | 3300025923 | Ga0207681_10059934 | Ga0207681_100599342 | 207 |
| 690 | 3300025923 | Ga0207681_10419507 | Ga0207681_104195071 | 207 |
| 691 | 3300025925 | Ga0207650_10083604 | Ga0207650_100836042 | 207 |
| 692 | 3300025926 | Ga0207659_10288409 | Ga0207659_102884092 | 207 |
| 693 | 3300025927 | Ga0207687_10142857 | Ga0207687_101428572 | 207 |
| 694 | 3300025928 | Ga0207700_10036148 | Ga0207700_100361482 | 207 |
| 695 | 3300025928 | Ga0207700_10151733 | Ga0207700_101517332 | 207 |
| 696 | 3300025928 | Ga0207700_10186891 | Ga0207700_101868912 | 207 |
| 697 | 3300025928 | Ga0207700_10224733 | Ga0207700_102247332 | 207 |
| 698 | 3300025928 | Ga0207700_10775811 | Ga0207700_107758111 | 207 |
| 699 | 3300025929 | Ga0207664_10086255 | Ga0207664_100862553 | 207 |
| 700 | 3300025929 | Ga0207664_10189227 | Ga0207664_101892272 | 207 |
| 701 | 3300025929 | Ga0207664_10685140 | Ga0207664_106851401 | 207 |
| 702 | 3300025929 | Ga0207664_10903034 | Ga0207664_109030341 | 207 |
| 703 | 3300025931 | Ga0207644_10067356 | Ga0207644_100673563 | 207 |
| 704 | 3300025933 | Ga0207706_10028247 | Ga0207706_100282475 | 207 |
| 705 | 3300025933 | Ga0207706_10406090 | Ga0207706_104060901 | 207 |
| 706 | 3300025933 | Ga0207706_10430626 | Ga0207706_104306262 | 207 |
| 707 | 3300025934 | Ga0207686_10361276 | Ga0207686_103612761 | 207 |
| 708 | 3300025935 | Ga0207709_10134917 | Ga0207709_101349172 | 207 |
| 709 | 3300025936 | Ga0207670_10019485 | Ga0207670_100194852 | 207 |
| 710 | 3300025936 | Ga0207670_10099245 | Ga0207670_100992452 | 207 |
| 711 | 3300025937 | Ga0207669_10130770 | Ga0207669_101307703 | 207 |
| 712 | 3300025938 | Ga0207704_10184947 | Ga0207704_101849472 | 207 |
| 713 | 3300025938 | Ga0207704_10879087 | Ga0207704_108790871 | 207 |
| 714 | 3300025939 | Ga0207665_10000887 | Ga0207665_1000088720 | 207 |
| 715 | 3300025939 | Ga0207665_10014732 | Ga0207665_100147324 | 207 |
| 716 | 3300025939 | Ga0207665_10045875 | Ga0207665_100458753 | 207 |
| 717 | 3300025939 | Ga0207665_10051130 | Ga0207665_100511303 | 207 |
| 718 | 3300025939 | Ga0207665_10059603 | Ga0207665_100596032 | 207 |
| 719 | 3300025939 | Ga0207665_10119703 | Ga0207665_101197032 | 207 |
| 720 | 3300025939 | Ga0207665_10121938 | Ga0207665_101219382 | 207 |
| 721 | 3300025939 | Ga0207665_10262680 | Ga0207665_102626802 | 207 |
| 722 | 3300025939 | Ga0207665_10306822 | Ga0207665_103068222 | 207 |
| 723 | 3300025939 | Ga0207665_10395603 | Ga0207665_103956031 | 207 |
| 724 | 3300025940 | Ga0207691_10360324 | Ga0207691_103603241 | 207 |
| 725 | 3300025941 | Ga0207711_10050722 | Ga0207711_100507223 | 207 |
| 726 | 3300025941 | Ga0207711_10744232 | Ga0207711_107442321 | 207 |
| 727 | 3300025945 | Ga0207679_10357158 | Ga0207679_103571581 | 207 |
| 728 | 3300025949 | Ga0207667_10679476 | Ga0207667_106794761 | 207 |
| 729 | 3300025961 | Ga0207712_10189122 | Ga0207712_101891222 | 207 |
| 730 | 3300025961 | Ga0207712_10377086 | Ga0207712_103770861 | 207 |
| 731 | 3300025972 | Ga0207668_10017069 | Ga0207668_100170694 | 207 |
| 732 | 3300025972 | Ga0207668_10534655 | Ga0207668_105346552 | 207 |
| 733 | 3300025981 | Ga0207640_10137884 | Ga0207640_101378842 | 207 |
| 734 | 3300025981 | Ga0207640_10270490 | Ga0207640_102704902 | 207 |
| 735 | 3300025986 | Ga0207658_10232312 | Ga0207658_102323121 | 207 |
| 736 | 3300025986 | Ga0207658_10300761 | Ga0207658_103007612 | 207 |
| 737 | 3300025986 | Ga0207658_10446389 | Ga0207658_104463892 | 207 |
| 738 | 3300026023 | Ga0207677_10266446 | Ga0207677_102664462 | 207 |
| 739 | 3300026023 | Ga0207677_10492097 | Ga0207677_104920971 | 207 |
| 740 | 3300026035 | Ga0207703_10176207 | Ga0207703_101762072 | 207 |
| 741 | 3300026041 | Ga0207639_10357378 | Ga0207639_103573782 | 207 |
| 742 | 3300026067 | Ga0207678_10011677 | Ga0207678_100116772 | 207 |
| 743 | 3300026075 | Ga0207708_10015629 | Ga0207708_100156296 | 207 |
| 744 | 3300026075 | Ga0207708_10147078 | Ga0207708_101470782 | 207 |
| 745 | 3300026088 | Ga0207641_10009040 | Ga0207641_100090403 | 207 |
| 746 | 3300026089 | Ga0207648_10037907 | Ga0207648_100379073 | 207 |
| 747 | 3300026089 | Ga0207648_10043366 | Ga0207648_100433663 | 207 |
| 748 | 3300026089 | Ga0207648_10220721 | Ga0207648_102207211 | 207 |
| 749 | 3300026095 | Ga0207676_11060287 | Ga0207676_110602871 | 207 |
| 750 | 3300026116 | Ga0207674_10018861 | Ga0207674_100188617 | 207 |
| 751 | 3300026118 | Ga0207675_100072478 | Ga0207675_1000724785 | 207 |
| 752 | 3300026118 | Ga0207675_100203694 | Ga0207675_1002036941 | 207 |
| 753 | 3300026118 | Ga0207675_100469956 | Ga0207675_1004699562 | 207 |
| 754 | 3300026118 | Ga0207675_100577786 | Ga0207675_1005777861 | 207 |
| 755 | 3300026118 | Ga0207675_101038825 | Ga0207675_1010388251 | 207 |
| 756 | 3300026121 | Ga0207683_10006916 | Ga0207683_100069169 | 207 |
| 757 | 3300026121 | Ga0207683_11175321 | Ga0207683_111753211 | 207 |
| 758 | 3300027671 | Ga0209588_1000024 | Ga0209588_100002474 | 207 |
| 759 | 3300027671 | Ga0209588_1004440 | Ga0209588_10044404 | 207 |
| 760 | 3300027907 | Ga0207428_10016868 | Ga0207428_100168687 | 207 |
| 761 | 3300027907 | Ga0207428_10065007 | Ga0207428_100650071 | 207 |
| 762 | 3300028017 | Ga0265356_1000449 | Ga0265356_10004494 | 207 |
| 763 | 3300028379 | Ga0268266_10031920 | Ga0268266_100319203 | 207 |
| 764 | 3300028379 | Ga0268266_10569836 | Ga0268266_105698362 | 207 |
| 765 | 3300028380 | Ga0268265_10086808 | Ga0268265_100868082 | 207 |
| 766 | 3300028381 | Ga0268264_10040316 | Ga0268264_100403162 | 207 |
| 767 | 3300028381 | Ga0268264_10111426 | Ga0268264_101114262 | 207 |
| 768 | 3300028381 | Ga0268264_10193494 | Ga0268264_101934942 | 207 |
| 769 | 3300030760 | Ga0265762_1001022 | Ga0265762_10010224 | 207 |
| 770 | 3300030760 | Ga0265762_1002005 | Ga0265762_10020054 | 207 |
| 771 | 3300030763 | Ga0265763_1000002 | Ga0265763_10000022 | 207 |
| 772 | 3300030763 | Ga0265763_1007364 | Ga0265763_10073641 | 207 |
| 773 | 3300031018 | Ga0265773_1002492 | Ga0265773_10024922 | 207 |
| 774 | 3300031090 | Ga0265760_10001288 | Ga0265760_100012886 | 207 |
| 775 | 3300033180 | Ga0307510_10275516 | Ga0307510_102755162 | 207 |
| 776 | 3300034818 | Ga0373950_0016769 | Ga0373950_0016769_131_754 | 207 |
| 777 | 3300035083 | Ga0373926_0075173 | Ga0373926_0075173_409_1056 | 207 |
| 778 | 3300035083 | Ga0373926_0216179 | Ga0373926_0216179_30_653 | 207 |
| 779 | 3300035088 | Ga0373940_0125668 | Ga0373940_0125668_92_718 | 207 |
| 780 | 3300035091 | Ga0373951_0064816 | Ga0373951_0064816_157_780 | 207 |
| 781 | 3300035091 | Ga0373951_0122752 | Ga0373951_0122752_13_636 | 207 |
| 782 | 3300035691 | Ga0373931_0575102 | Ga0373931_0575102_20_694 | 207 |
| 783 | 3300035691 | Ga0373931_0609514 | Ga0373931_0609514_31_654 | 207 |
| 784 | 3300035695 | Ga0373927_0053694 | Ga0373927_0053694_1524_2147 | 207 |
| 785 | 3300035695 | Ga0373927_0552959 | Ga0373927_0552959_105_728 | 207 |
| 786 | 3300035725 | Ga0373947_0186141 | Ga0373947_0186141_365_988 | 207 |
| 787 | 3300036401 | Ga0373937_0041832 | Ga0373937_0041832_1329_2027 | 207 |
| 788 | 3300036459 | Ga0372808_025127 | Ga0372808_025127_38_772 | 207 |
| 789 | 3300039062 | Ga0400483_108458 | Ga0400483_108458_285_923 | 207 |
| 790 | 3300042876 | Ga0451577_0153436 | Ga0451577_0153436_874_1497 | 207 |
| 791 | 3300044673 | Ga0453683_0000258 | Ga0453683_0000258_11884_12507 | 207 |
| 792 | 3300044673 | Ga0453683_0006130 | Ga0453683_0006130_1888_2511 | 207 |
| 793 | 3300044673 | Ga0453683_0011802 | Ga0453683_0011802_1302_1925 | 207 |
| 794 | 3300044673 | Ga0453683_0032817 | Ga0453683_0032817_2172_2795 | 207 |
| 795 | 3300044673 | Ga0453683_0080866 | Ga0453683_0080866_751_1374 | 207 |
| 796 | 3300044673 | Ga0453683_0234905 | Ga0453683_0234905_491_1114 | 207 |
| 797 | 3300044673 | Ga0453683_0329663 | Ga0453683_0329663_317_940 | 207 |
| 798 | 3300044712 | Ga0453684_0046569 | Ga0453684_0046569_3386_4009 | 207 |
| 799 | 3300044712 | Ga0453684_0320630 | Ga0453684_0320630_499_1122 | 207 |
| 800 | 3300044712 | Ga0453684_0378649 | Ga0453684_0378649_122_745 | 207 |
| 801 | 3300045051 | Ga0451576_0033734 | Ga0451576_0033734_1689_2312 | 207 |
| 802 | 3300045051 | Ga0451576_0055389 | Ga0451576_0055389_1530_2153 | 207 |
| 803 | 3300045051 | Ga0451576_0108565 | Ga0451576_0108565_1707_2330 | 207 |
| 804 | 3300046457 | Ga0495590_0041523 | Ga0495590_0041523_632_1318 | 207 |
| 805 | 3300046459 | Ga0495629_0243094 | Ga0495629_0243094_349_972 | 207 |
| 806 | 3300046462 | Ga0495651_0394046 | Ga0495651_0394046_34_732 | 207 |
| 807 | 3300046472 | Ga0495580_0078824 | Ga0495580_0078824_1306_1929 | 207 |
| 808 | 3300046472 | Ga0495580_0141575 | Ga0495580_0141575_170_793 | 207 |
| 809 | 3300046473 | Ga0495582_0367625 | Ga0495582_0367625_112_735 | 207 |
| 810 | 3300046477 | Ga0495664_0173357 | Ga0495664_0173357_62_685 | 207 |
| 811 | 3300046491 | Ga0495584_0037238 | Ga0495584_0037238_76_699 | 207 |
| 812 | 3300046491 | Ga0495584_0042612 | Ga0495584_0042612_1433_2119 | 207 |
| 813 | 3300046499 | Ga0495594_0137711 | Ga0495594_0137711_576_1199 | 207 |
| 814 | 3300046511 | Ga0495608_0067086 | Ga0495608_0067086_732_1430 | 207 |
| 815 | 3300046514 | Ga0495618_0042290 | Ga0495618_0042290_1278_1901 | 207 |
| 816 | 3300046516 | Ga0495628_0242951 | Ga0495628_0242951_692_1315 | 207 |
| 817 | 3300046517 | Ga0495630_0098949 | Ga0495630_0098949_776_1399 | 207 |
| 818 | 3300046517 | Ga0495630_0565111 | Ga0495630_0565111_112_735 | 207 |
| 819 | 3300046518 | Ga0495631_0116266 | Ga0495631_0116266_430_1116 | 207 |
| 820 | 3300046519 | Ga0495632_0206032 | Ga0495632_0206032_35_721 | 207 |
| 821 | 3300046525 | Ga0495663_0206691 | Ga0495663_0206691_12_635 | 207 |
| 822 | 3300046528 | Ga0495642_0154502 | Ga0495642_0154502_284_937 | 207 |
| 823 | 3300046531 | Ga0495665_0157712 | Ga0495665_0157712_131_754 | 207 |
| 824 | 3300046533 | Ga0495640_0056854 | Ga0495640_0056854_765_1388 | 207 |
| 825 | 3300046538 | Ga0495609_0190288 | Ga0495609_0190288_147_770 | 207 |
| 826 | 3300046543 | Ga0495645_0067270 | Ga0495645_0067270_373_996 | 207 |
| 827 | 3300046558 | Ga0495633_0142795 | Ga0495633_0142795_246_869 | 207 |
| 828 | 3300046642 | Ga0495634_0040100 | Ga0495634_0040100_425_1048 | 207 |
| 829 | 3300046663 | Ga0495635_0630366 | Ga0495635_0630366_30_653 | 207 |
| 830 | 3300046663 | Ga0495635_0651942 | Ga0495635_0651942_19_642 | 207 |
| 831 | 3300046664 | Ga0495659_0053397 | Ga0495659_0053397_193_816 | 207 |
| 832 | 3300046664 | Ga0495659_0162846 | Ga0495659_0162846_51_674 | 207 |
| 833 | 3300046678 | Ga0495599_0089005 | Ga0495599_0089005_731_1354 | 207 |
| 834 | 3300046680 | Ga0495646_0339900 | Ga0495646_0339900_15_638 | 207 |
| 835 | 3300046684 | Ga0495669_0359874 | Ga0495669_0359874_49_678 | 207 |
| 836 | 3300046689 | Ga0495613_0202390 | Ga0495613_0202390_239_862 | 207 |
| 837 | 3300046689 | Ga0495613_0217992 | Ga0495613_0217992_653_1276 | 207 |
| 838 | 3300046690 | Ga0495624_0385143 | Ga0495624_0385143_89_712 | 207 |
| 839 | 3300046690 | Ga0495624_0482935 | Ga0495624_0482935_92_727 | 207 |
| 840 | 3300046691 | Ga0495670_0399061 | Ga0495670_0399061_25_648 | 207 |
| 841 | 3300047315 | Ga0495581_0082110 | Ga0495581_0082110_46_669 | 207 |
| 842 | 3300047318 | Ga0495636_0178267 | Ga0495636_0178267_26_649 | 207 |
| 843 | 3300047318 | Ga0495636_0250903 | Ga0495636_0250903_79_732 | 207 |
| 844 | 3300047319 | Ga0495674_0064432 | Ga0495674_0064432_1967_2590 | 207 |
| 845 | 3300047319 | Ga0495674_0085525 | Ga0495674_0085525_220_843 | 207 |
| 846 | 3300047471 | Ga0495684_0037983 | Ga0495684_0037983_2190_2813 | 207 |
| 847 | 3300048903 | Ga0496100_0007168 | Ga0496100_0007168_2866_3489 | 207 |
| 848 | 3300048903 | Ga0496100_0390539 | Ga0496100_0390539_65_688 | 207 |
| 849 | 3300048904 | Ga0496101_0224338 | Ga0496101_0224338_364_987 | 207 |
| 850 | 3300048904 | Ga0496101_0597398 | Ga0496101_0597398_181_804 | 207 |
| 851 | 3300048905 | Ga0496102_0141169 | Ga0496102_0141169_123_785 | 207 |
| 852 | 3300048905 | Ga0496102_0175044 | Ga0496102_0175044_631_1254 | 207 |
| 853 | 3300048905 | Ga0496102_0199132 | Ga0496102_0199132_599_1222 | 207 |
| 854 | 3300048905 | Ga0496102_0956093 | Ga0496102_0956093_111_734 | 207 |
| 855 | 3300048907 | Ga0496104_0000339 | Ga0496104_0000339_1782_2405 | 207 |
| 856 | 3300048907 | Ga0496104_0008489 | Ga0496104_0008489_6790_7413 | 207 |
| 857 | 3300048907 | Ga0496104_0034057 | Ga0496104_0034057_3995_4618 | 207 |
| 858 | 3300048907 | Ga0496104_0076052 | Ga0496104_0076052_2462_3085 | 207 |
| 859 | 3300048908 | Ga0496105_0002897 | Ga0496105_0002897_1655_2278 | 207 |
| 860 | 3300048908 | Ga0496105_0006320 | Ga0496105_0006320_7311_7934 | 207 |
| 861 | 3300048908 | Ga0496105_0111260 | Ga0496105_0111260_1360_1983 | 207 |
| 862 | 3300048909 | Ga0496106_0037970 | Ga0496106_0037970_2719_3342 | 207 |
| 863 | 3300048909 | Ga0496106_0385457 | Ga0496106_0385457_31_654 | 207 |
| 864 | 3300048909 | Ga0496106_0626156 | Ga0496106_0626156_150_773 | 207 |
| 865 | 3300048910 | Ga0496107_0032183 | Ga0496107_0032183_1388_2011 | 207 |
| 866 | 3300048910 | Ga0496107_0393475 | Ga0496107_0393475_140_763 | 207 |
| 867 | 3300048911 | Ga0496108_0033772 | Ga0496108_0033772_3047_3670 | 207 |
| 868 | 3300048911 | Ga0496108_0040429 | Ga0496108_0040429_390_1013 | 207 |
| 869 | 3300048911 | Ga0496108_0395786 | Ga0496108_0395786_162_785 | 207 |
| 870 | 3300048911 | Ga0496108_0880321 | Ga0496108_0880321_116_739 | 207 |
| 871 | 3300048911 | Ga0496108_0901547 | Ga0496108_0901547_106_729 | 207 |
| 872 | 3300048912 | Ga0496109_0000191 | Ga0496109_0000191_4166_4789 | 207 |
| 873 | 3300048912 | Ga0496109_0077982 | Ga0496109_0077982_741_1367 | 207 |
| 874 | 3300048912 | Ga0496109_0109696 | Ga0496109_0109696_1369_1992 | 207 |
| 875 | 3300048913 | Ga0496110_0014344 | Ga0496110_0014344_630_1253 | 207 |
| 876 | 3300048913 | Ga0496110_0063097 | Ga0496110_0063097_1144_1767 | 207 |
| 877 | 3300048913 | Ga0496110_0093278 | Ga0496110_0093278_1594_2331 | 207 |
| 878 | 3300048913 | Ga0496110_1062316 | Ga0496110_1062316_12_638 | 207 |
| 879 | 3300048914 | Ga0496111_0016400 | Ga0496111_0016400_4003_4626 | 207 |
| 880 | 3300048914 | Ga0496111_0089040 | Ga0496111_0089040_1360_1983 | 207 |
| 881 | 3300048914 | Ga0496111_0145166 | Ga0496111_0145166_195_932 | 207 |
| 882 | 3300048915 | Ga0496112_0081626 | Ga0496112_0081626_1944_2567 | 207 |
| 883 | 3300048915 | Ga0496112_0296383 | Ga0496112_0296383_50_673 | 207 |
| 884 | 3300048915 | Ga0496112_0547969 | Ga0496112_0547969_431_1054 | 207 |
| 885 | 3300048916 | Ga0496113_0071636 | Ga0496113_0071636_1981_2607 | 207 |
| 886 | 3300048916 | Ga0496113_0089240 | Ga0496113_0089240_575_1198 | 207 |
| 887 | 3300048916 | Ga0496113_0298504 | Ga0496113_0298504_442_1065 | 207 |
| 888 | 3300048916 | Ga0496113_0389564 | Ga0496113_0389564_271_894 | 207 |
| 889 | 3300048916 | Ga0496113_0470367 | Ga0496113_0470367_250_876 | 207 |
| 890 | 3300048917 | Ga0496114_0000527 | Ga0496114_0000527_13116_13739 | 207 |
| 891 | 3300048917 | Ga0496114_0058277 | Ga0496114_0058277_874_1608 | 207 |
| 892 | 3300048917 | Ga0496114_0349343 | Ga0496114_0349343_466_1089 | 207 |
| 893 | 3300048918 | Ga0496115_0020011 | Ga0496115_0020011_3137_3871 | 207 |
| 894 | 3300048918 | Ga0496115_0028961 | Ga0496115_0028961_3171_3794 | 207 |
| 895 | 3300048918 | Ga0496115_0096450 | Ga0496115_0096450_1565_2188 | 207 |
| 896 | 3300048918 | Ga0496115_0100313 | Ga0496115_0100313_1544_2167 | 207 |
| 897 | 3300048918 | Ga0496115_0138419 | Ga0496115_0138419_224_847 | 207 |
| 898 | 3300048918 | Ga0496115_0148030 | Ga0496115_0148030_962_1588 | 207 |
| 899 | 3300048918 | Ga0496115_0295940 | Ga0496115_0295940_364_987 | 207 |
| 900 | 3300048920 | Ga0496117_0010943 | Ga0496117_0010943_6171_6902 | 207 |
| 901 | 3300048921 | Ga0496118_0009623 | Ga0496118_0009623_1980_2711 | 207 |
| 902 | 3300048922 | Ga0496119_0072377 | Ga0496119_0072377_195_818 | 207 |
| 903 | 3300048928 | Ga0496125_0051918 | Ga0496125_0051918_690_1313 | 207 |
| 904 | 3300048929 | Ga0496126_0040027 | Ga0496126_0040027_1241_1975 | 207 |
| 905 | 3300050507 | nmdc:mga05p37_103593_c2 | nmdc:mga05p37_103593_c2_2422_3045 | 207 |
| 906 | 3300050507 | nmdc:mga05p37_10_c1 | nmdc:mga05p37_10_c1_91232_91855 | 207 |
| 907 | 3300050507 | nmdc:mga05p37_11608_c1 | nmdc:mga05p37_11608_c1_3882_4505 | 207 |
| 908 | 3300050507 | nmdc:mga05p37_116479_c1 | nmdc:mga05p37_116479_c1_1814_2437 | 207 |
| 909 | 3300050507 | nmdc:mga05p37_1238_c1 | nmdc:mga05p37_1238_c1_596_1219 | 207 |
| 910 | 3300050507 | nmdc:mga05p37_1315154_c1 | nmdc:mga05p37_1315154_c1_103_726 | 207 |
| 911 | 3300050507 | nmdc:mga05p37_13336_c1 | nmdc:mga05p37_13336_c1_2563_3195 | 207 |
| 912 | 3300050507 | nmdc:mga05p37_13888_c1 | nmdc:mga05p37_13888_c1_7279_7902 | 207 |
| 913 | 3300050507 | nmdc:mga05p37_155369_c1 | nmdc:mga05p37_155369_c1_626_1249 | 207 |
| 914 | 3300050507 | nmdc:mga05p37_169056_c1 | nmdc:mga05p37_169056_c1_541_1164 | 207 |
| 915 | 3300050507 | nmdc:mga05p37_208979_c1 | nmdc:mga05p37_208979_c1_1316_1939 | 207 |
| 916 | 3300050507 | nmdc:mga05p37_21714_c1 | nmdc:mga05p37_21714_c1_5183_5806 | 207 |
| 917 | 3300050507 | nmdc:mga05p37_2264_c1 | nmdc:mga05p37_2264_c1_17182_17805 | 207 |
| 918 | 3300050507 | nmdc:mga05p37_260198_c1 | nmdc:mga05p37_260198_c1_1442_2065 | 207 |
| 919 | 3300050507 | nmdc:mga05p37_284012_c1 | nmdc:mga05p37_284012_c1_1178_1801 | 207 |
| 920 | 3300050507 | nmdc:mga05p37_29334_c1 | nmdc:mga05p37_29334_c1_3946_4569 | 207 |
| 921 | 3300050507 | nmdc:mga05p37_2985_c1 | nmdc:mga05p37_2985_c1_15329_15952 | 207 |
| 922 | 3300050507 | nmdc:mga05p37_308166_c1 | nmdc:mga05p37_308166_c1_1121_1807 | 207 |
| 923 | 3300050507 | nmdc:mga05p37_352769_c1 | nmdc:mga05p37_352769_c1_142_765 | 207 |
| 924 | 3300050507 | nmdc:mga05p37_37533_c1 | nmdc:mga05p37_37533_c1_2828_3451 | 207 |
| 925 | 3300050507 | nmdc:mga05p37_38691_c1 | nmdc:mga05p37_38691_c1_2888_3511 | 207 |
| 926 | 3300050507 | nmdc:mga05p37_441644_c1 | nmdc:mga05p37_441644_c1_408_1031 | 207 |
| 927 | 3300050507 | nmdc:mga05p37_461039_c1 | nmdc:mga05p37_461039_c1_737_1414 | 207 |
| 928 | 3300050507 | nmdc:mga05p37_491_c1 | nmdc:mga05p37_491_c1_36680_37303 | 207 |
| 929 | 3300050507 | nmdc:mga05p37_511488_c1 | nmdc:mga05p37_511488_c1_545_1222 | 207 |
| 930 | 3300050507 | nmdc:mga05p37_554389_c1 | nmdc:mga05p37_554389_c1_598_1233 | 207 |
| 931 | 3300050507 | nmdc:mga05p37_58271_c1 | nmdc:mga05p37_58271_c1_810_1433 | 207 |
| 932 | 3300050507 | nmdc:mga05p37_708888_c1 | nmdc:mga05p37_708888_c1_313_936 | 207 |
| 933 | 3300050507 | nmdc:mga05p37_720571_c1 | nmdc:mga05p37_720571_c1_190_813 | 207 |
| 934 | 3300050507 | nmdc:mga05p37_876178_c1 | nmdc:mga05p37_876178_c1_150_887 | 207 |
| 935 | 3300050508 | nmdc:mga09592_11547_c1 | nmdc:mga09592_11547_c1_777_1400 | 207 |
| 936 | 3300050508 | nmdc:mga09592_14031_c1 | nmdc:mga09592_14031_c1_2109_2732 | 207 |
| 937 | 3300050508 | nmdc:mga09592_170190_c1 | nmdc:mga09592_170190_c1_163_786 | 207 |
| 938 | 3300050508 | nmdc:mga09592_172832_c1 | nmdc:mga09592_172832_c1_1054_1677 | 207 |
| 939 | 3300050508 | nmdc:mga09592_256747_c1 | nmdc:mga09592_256747_c1_474_1151 | 207 |
| 940 | 3300050508 | nmdc:mga09592_305656_c1 | nmdc:mga09592_305656_c1_545_1222 | 207 |
| 941 | 3300050508 | nmdc:mga09592_370636_c1 | nmdc:mga09592_370636_c1_557_1180 | 207 |
| 942 | 3300050508 | nmdc:mga09592_433519_c1 | nmdc:mga09592_433519_c1_297_920 | 207 |
| 943 | 3300050508 | nmdc:mga09592_507597_c1 | nmdc:mga09592_507597_c1_301_924 | 207 |
| 944 | 3300050508 | nmdc:mga09592_687080_c1 | nmdc:mga09592_687080_c1_221_844 | 207 |
| 945 | 3300050508 | nmdc:mga09592_75905_c1 | nmdc:mga09592_75905_c1_1838_2461 | 207 |
| 946 | 3300050509 | nmdc:mga0qj67_339787_c1 | nmdc:mga0qj67_339787_c1_322_945 | 207 |
| 947 | 3300050509 | nmdc:mga0qj67_35067_c1 | nmdc:mga0qj67_35067_c1_209_832 | 207 |
| 948 | 3300050509 | nmdc:mga0qj67_377543_c1 | nmdc:mga0qj67_377543_c1_511_1134 | 207 |
| 949 | 3300050509 | nmdc:mga0qj67_413768_c1 | nmdc:mga0qj67_413768_c1_240_863 | 207 |
| 950 | 3300050509 | nmdc:mga0qj67_487064_c1 | nmdc:mga0qj67_487064_c1_316_939 | 207 |
| 951 | 3300050509 | nmdc:mga0qj67_52444_c1 | nmdc:mga0qj67_52444_c1_471_1094 | 207 |
| 952 | 3300050509 | nmdc:mga0qj67_7248_c1 | nmdc:mga0qj67_7248_c1_6791_7468 | 207 |
| 953 | 3300050510 | nmdc:mga06r32_101683_c1 | nmdc:mga06r32_101683_c1_44_667 | 207 |
| 954 | 3300050510 | nmdc:mga06r32_176367_c1 | nmdc:mga06r32_176367_c1_1143_1766 | 207 |
| 955 | 3300050510 | nmdc:mga06r32_176801_c1 | nmdc:mga06r32_176801_c1_442_1065 | 207 |
| 956 | 3300050510 | nmdc:mga06r32_202958_c1 | nmdc:mga06r32_202958_c1_212_835 | 207 |
| 957 | 3300050510 | nmdc:mga06r32_21017_c1 | nmdc:mga06r32_21017_c1_450_1127 | 207 |
| 958 | 3300050510 | nmdc:mga06r32_283685_c1 | nmdc:mga06r32_283685_c1_963_1586 | 207 |
| 959 | 3300050510 | nmdc:mga06r32_312514_c1 | nmdc:mga06r32_312514_c1_658_1281 | 207 |
| 960 | 3300050510 | nmdc:mga06r32_45076_c1 | nmdc:mga06r32_45076_c1_3486_4109 | 207 |
| 961 | 3300050510 | nmdc:mga06r32_653011_c1 | nmdc:mga06r32_653011_c1_136_789 | 207 |
| 962 | 3300050510 | nmdc:mga06r32_6852_c1 | nmdc:mga06r32_6852_c1_4510_5133 | 207 |
| 963 | 3300050511 | nmdc:mga08y16_1318648_c1 | nmdc:mga08y16_1318648_c1_34_657 | 207 |
| 964 | 3300050511 | nmdc:mga08y16_200287_c1 | nmdc:mga08y16_200287_c1_541_1164 | 207 |
| 965 | 3300050511 | nmdc:mga08y16_463068_c1 | nmdc:mga08y16_463068_c1_185_808 | 207 |
| 966 | 3300050511 | nmdc:mga08y16_741248_c1 | nmdc:mga08y16_741248_c1_168_791 | 207 |
| 967 | 3300050511 | nmdc:mga08y16_78900_c1 | nmdc:mga08y16_78900_c1_113_736 | 207 |
| 968 | 3300050511 | nmdc:mga08y16_872464_c1 | nmdc:mga08y16_872464_c1_223_846 | 207 |
| 969 | 3300050511 | nmdc:mga08y16_89545_c1 | nmdc:mga08y16_89545_c1_2405_3028 | 207 |
| 970 | 3300050511 | nmdc:mga08y16_9772_c1 | nmdc:mga08y16_9772_c1_4881_5558 | 207 |
| 971 | 3300050512 | nmdc:mga0n895_10664_c1 | nmdc:mga0n895_10664_c1_3769_4392 | 207 |
| 972 | 3300050512 | nmdc:mga0n895_1123_c1 | nmdc:mga0n895_1123_c1_8844_9467 | 207 |
| 973 | 3300050512 | nmdc:mga0n895_127369_c1 | nmdc:mga0n895_127369_c1_832_1455 | 207 |
| 974 | 3300050512 | nmdc:mga0n895_129603_c1 | nmdc:mga0n895_129603_c1_1462_2085 | 207 |
| 975 | 3300050512 | nmdc:mga0n895_1338814_c1 | nmdc:mga0n895_1338814_c1_47_670 | 207 |
| 976 | 3300050512 | nmdc:mga0n895_172180_c1 | nmdc:mga0n895_172180_c1_94_861 | 207 |
| 977 | 3300050512 | nmdc:mga0n895_177204_c1 | nmdc:mga0n895_177204_c1_308_931 | 207 |
| 978 | 3300050512 | nmdc:mga0n895_22284_c1 | nmdc:mga0n895_22284_c1_4554_5231 | 207 |
| 979 | 3300050512 | nmdc:mga0n895_233540_c1 | nmdc:mga0n895_233540_c1_687_1310 | 207 |
| 980 | 3300050512 | nmdc:mga0n895_266001_c1 | nmdc:mga0n895_266001_c1_563_1186 | 207 |
| 981 | 3300050512 | nmdc:mga0n895_31868_c1 | nmdc:mga0n895_31868_c1_1266_1889 | 207 |
| 982 | 3300050512 | nmdc:mga0n895_332683_c1 | nmdc:mga0n895_332683_c1_182_805 | 207 |
| 983 | 3300050512 | nmdc:mga0n895_344847_c1 | nmdc:mga0n895_344847_c1_101_754 | 207 |
| 984 | 3300050512 | nmdc:mga0n895_368247_c1 | nmdc:mga0n895_368247_c1_95_769 | 207 |
| 985 | 3300050512 | nmdc:mga0n895_39905_c1 | nmdc:mga0n895_39905_c1_2696_3325 | 207 |
| 986 | 3300050512 | nmdc:mga0n895_403302_c1 | nmdc:mga0n895_403302_c1_95_718 | 207 |
| 987 | 3300050512 | nmdc:mga0n895_453875_c1 | nmdc:mga0n895_453875_c1_271_894 | 207 |
| 988 | 3300050512 | nmdc:mga0n895_482075_c1 | nmdc:mga0n895_482075_c1_585_1208 | 207 |
| 989 | 3300050512 | nmdc:mga0n895_486897_c1 | nmdc:mga0n895_486897_c1_499_1137 | 207 |
| 990 | 3300050512 | nmdc:mga0n895_623932_c1 | nmdc:mga0n895_623932_c1_98_721 | 207 |
| 991 | 3300050512 | nmdc:mga0n895_645233_c1 | nmdc:mga0n895_645233_c1_269_1006 | 207 |
| 992 | 3300050512 | nmdc:mga0n895_700_c1 | nmdc:mga0n895_700_c1_10499_11122 | 207 |
| 993 | 3300050512 | nmdc:mga0n895_716247_c1 | nmdc:mga0n895_716247_c1_271_894 | 207 |
| 994 | 3300050512 | nmdc:mga0n895_86186_c1 | nmdc:mga0n895_86186_c1_1181_1804 | 207 |
| 995 | 3300050512 | nmdc:mga0n895_97034_c1 | nmdc:mga0n895_97034_c1_1477_2100 | 207 |
| 996 | 3300050513 | nmdc:mga0rr50_124979_c1 | nmdc:mga0rr50_124979_c1_571_1194 | 207 |
| 997 | 3300050513 | nmdc:mga0rr50_1261_c1 | nmdc:mga0rr50_1261_c1_9703_10326 | 207 |
| 998 | 3300050513 | nmdc:mga0rr50_129763_c1 | nmdc:mga0rr50_129763_c1_882_1535 | 207 |
| 999 | 3300050513 | nmdc:mga0rr50_154421_c1 | nmdc:mga0rr50_154421_c1_779_1453 | 207 |
| 1000 | 3300050513 | nmdc:mga0rr50_162833_c1 | nmdc:mga0rr50_162833_c1_15_638 | 207 |
| 1001 | 3300050513 | nmdc:mga0rr50_189173_c1 | nmdc:mga0rr50_189173_c1_251_874 | 207 |
| 1002 | 3300050513 | nmdc:mga0rr50_198472_c1 | nmdc:mga0rr50_198472_c1_779_1402 | 207 |
| 1003 | 3300050513 | nmdc:mga0rr50_255069_c1 | nmdc:mga0rr50_255069_c1_218_856 | 207 |
| 1004 | 3300050513 | nmdc:mga0rr50_2634_c1 | nmdc:mga0rr50_2634_c1_2233_2856 | 207 |
| 1005 | 3300050513 | nmdc:mga0rr50_29527_c1 | nmdc:mga0rr50_29527_c1_1186_1809 | 207 |
| 1006 | 3300050513 | nmdc:mga0rr50_30672_c1 | nmdc:mga0rr50_30672_c1_1492_2115 | 207 |
| 1007 | 3300050513 | nmdc:mga0rr50_328189_c1 | nmdc:mga0rr50_328189_c1_177_800 | 207 |
| 1008 | 3300050513 | nmdc:mga0rr50_339854_c1 | nmdc:mga0rr50_339854_c1_474_1097 | 207 |
| 1009 | 3300050513 | nmdc:mga0rr50_404737_c1 | nmdc:mga0rr50_404737_c1_297_920 | 207 |
| 1010 | 3300050513 | nmdc:mga0rr50_418565_c1 | nmdc:mga0rr50_418565_c1_75_698 | 207 |
| 1011 | 3300050513 | nmdc:mga0rr50_420213_c1 | nmdc:mga0rr50_420213_c1_132_755 | 207 |
| 1012 | 3300050513 | nmdc:mga0rr50_4367_c1 | nmdc:mga0rr50_4367_c1_196_819 | 207 |
| 1013 | 3300050513 | nmdc:mga0rr50_573584_c1 | nmdc:mga0rr50_573584_c1_50_673 | 207 |
| 1014 | 3300050513 | nmdc:mga0rr50_589072_c1 | nmdc:mga0rr50_589072_c1_13_696 | 207 |
| 1015 | 3300050513 | nmdc:mga0rr50_68445_c1 | nmdc:mga0rr50_68445_c1_1194_1961 | 207 |
| 1016 | 3300050513 | nmdc:mga0rr50_753288_c1 | nmdc:mga0rr50_753288_c1_131_808 | 207 |
| 1017 | 3300050513 | nmdc:mga0rr50_9648_c1 | nmdc:mga0rr50_9648_c1_4743_5372 | 207 |
| 1018 | 3300050514 | nmdc:mga08x19_13343_c1 | nmdc:mga08x19_13343_c1_3832_4455 | 207 |
| 1019 | 3300050514 | nmdc:mga08x19_1479_c1 | nmdc:mga08x19_1479_c1_1793_2416 | 207 |
| 1020 | 3300050514 | nmdc:mga08x19_148088_c1 | nmdc:mga08x19_148088_c1_142_765 | 207 |
| 1021 | 3300050514 | nmdc:mga08x19_193062_c1 | nmdc:mga08x19_193062_c1_608_1231 | 207 |
| 1022 | 3300050514 | nmdc:mga08x19_204887_c1 | nmdc:mga08x19_204887_c1_402_1031 | 207 |
| 1023 | 3300050514 | nmdc:mga08x19_219599_c1 | nmdc:mga08x19_219599_c1_351_989 | 207 |
| 1024 | 3300050514 | nmdc:mga08x19_220521_c1 | nmdc:mga08x19_220521_c1_615_1244 | 207 |
| 1025 | 3300050514 | nmdc:mga08x19_225258_c1 | nmdc:mga08x19_225258_c1_195_818 | 207 |
| 1026 | 3300050514 | nmdc:mga08x19_232105_c1 | nmdc:mga08x19_232105_c1_172_795 | 207 |
| 1027 | 3300050514 | nmdc:mga08x19_256775_c1 | nmdc:mga08x19_256775_c1_23_676 | 207 |
| 1028 | 3300050514 | nmdc:mga08x19_272945_c1 | nmdc:mga08x19_272945_c1_476_1099 | 207 |
| 1029 | 3300050514 | nmdc:mga08x19_3476_c1 | nmdc:mga08x19_3476_c1_2580_3203 | 207 |
| 1030 | 3300050514 | nmdc:mga08x19_450771_c1 | nmdc:mga08x19_450771_c1_40_726 | 207 |
| 1031 | 3300050514 | nmdc:mga08x19_45717_c1 | nmdc:mga08x19_45717_c1_263_892 | 207 |
| 1032 | 3300050514 | nmdc:mga08x19_633567_c1 | nmdc:mga08x19_633567_c1_93_716 | 207 |
| 1033 | 3300050514 | nmdc:mga08x19_8_c1 | nmdc:mga08x19_8_c1_424092_424715 | 207 |
| 1034 | 3300050515 | nmdc:mga0a205_143966_c1 | nmdc:mga0a205_143966_c1_20_673 | 207 |
| 1035 | 3300050515 | nmdc:mga0a205_152988_c1 | nmdc:mga0a205_152988_c1_999_1622 | 207 |
| 1036 | 3300050515 | nmdc:mga0a205_173009_c1 | nmdc:mga0a205_173009_c1_432_1055 | 207 |
| 1037 | 3300050515 | nmdc:mga0a205_18021_c1 | nmdc:mga0a205_18021_c1_273_896 | 207 |
| 1038 | 3300050515 | nmdc:mga0a205_187531_c1 | nmdc:mga0a205_187531_c1_903_1526 | 207 |
| 1039 | 3300050515 | nmdc:mga0a205_19381_c1 | nmdc:mga0a205_19381_c1_953_1576 | 207 |
| 1040 | 3300050515 | nmdc:mga0a205_204353_c1 | nmdc:mga0a205_204353_c1_419_1042 | 207 |
| 1041 | 3300050515 | nmdc:mga0a205_222345_c1 | nmdc:mga0a205_222345_c1_169_792 | 207 |
| 1042 | 3300050515 | nmdc:mga0a205_241335_c1 | nmdc:mga0a205_241335_c1_876_1499 | 207 |
| 1043 | 3300050515 | nmdc:mga0a205_285366_c1 | nmdc:mga0a205_285366_c1_833_1456 | 207 |
| 1044 | 3300050515 | nmdc:mga0a205_3019_c1 | nmdc:mga0a205_3019_c1_10519_11142 | 207 |
| 1045 | 3300050515 | nmdc:mga0a205_302010_c1 | nmdc:mga0a205_302010_c1_678_1304 | 207 |
| 1046 | 3300050515 | nmdc:mga0a205_343167_c1 | nmdc:mga0a205_343167_c1_632_1255 | 207 |
| 1047 | 3300050515 | nmdc:mga0a205_3796_c2 | nmdc:mga0a205_3796_c2_6648_7325 | 207 |
| 1048 | 3300050515 | nmdc:mga0a205_42037_c1 | nmdc:mga0a205_42037_c1_722_1345 | 207 |
| 1049 | 3300050515 | nmdc:mga0a205_42924_c1 | nmdc:mga0a205_42924_c1_3505_4128 | 207 |
| 1050 | 3300050515 | nmdc:mga0a205_443829_c1 | nmdc:mga0a205_443829_c1_134_757 | 207 |
| 1051 | 3300050515 | nmdc:mga0a205_457504_c1 | nmdc:mga0a205_457504_c1_427_1050 | 207 |
| 1052 | 3300050515 | nmdc:mga0a205_4777_c1 | nmdc:mga0a205_4777_c1_11123_11746 | 207 |
| 1053 | 3300050515 | nmdc:mga0a205_488759_c1 | nmdc:mga0a205_488759_c1_148_828 | 207 |
| 1054 | 3300050515 | nmdc:mga0a205_54934_c1 | nmdc:mga0a205_54934_c1_1422_2189 | 207 |
| 1055 | 3300050515 | nmdc:mga0a205_598624_c1 | nmdc:mga0a205_598624_c1_10_633 | 207 |
| 1056 | 3300050515 | nmdc:mga0a205_659212_c1 | nmdc:mga0a205_659212_c1_158_781 | 207 |
| 1057 | 3300050515 | nmdc:mga0a205_6966_c1 | nmdc:mga0a205_6966_c1_7893_8516 | 207 |
| 1058 | 3300050515 | nmdc:mga0a205_76307_c1 | nmdc:mga0a205_76307_c1_1383_2006 | 207 |
| 1059 | 3300053077 | Ga0495601_0125076 | Ga0495601_0125076_201_884 | 207 |
| 1060 | 3300053078 | Ga0495612_0102120 | Ga0495612_0102120_506_1204 | 207 |
| 1061 | 3300053084 | Ga0495595_0107367 | Ga0495595_0107367_510_1208 | 207 |
| 1062 | 3300053085 | Ga0495619_0050521 | Ga0495619_0050521_828_1526 | 207 |
| 1063 | 3300053125 | Ga0500618_001429 | Ga0500618_001429_279_1016 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2b34-assembly1.cif.gz_A | structure of mar1 ribonuclease from caenorhabditis elegans | 0.9311 | 9 | 193 |
| 1yac-assembly1.cif.gz_A | the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity | 0.9058 | 8 | 205 |
| 4wh0-assembly1.cif.gz_A | ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine | 0.8876 | 8 | 207 |
| 4wgf-assembly1.cif.gz_C | ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide | 0.8841 | 8 | 207 |
| 1yac-assembly1.cif.gz_A | the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity | 0.8762 | 8 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0JME6_2_195_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.931 | 10 | 193 | 3.40.50.850 |
| af_Q9W127_4_199_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9056 | 9 | 193 | 3.40.50.850 |
| af_Q54NZ8_2_198_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8875 | 10 | 198 | 3.40.50.850 |
| af_Q54RC7_3_195_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8855 | 9 | 191 | 3.40.50.850 |
| 4wh0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8847 | 8 | 207 | 3.40.50.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U3U4G6-F1-model_v4 | Isochorismatase hydrolase | 0.9755 | 7 | 133 |
GO:0016787
|
| AF-B8L5H2-F1-model_v4 | Isochorismatase hydrolase (EC 3.3.2.1) | 0.9741 | 20 | 161 |
GO:0008908
|
| AF-A0A377Z2N5-F1-model_v4 | Isochorismatase family protein | 0.9739 | 9 | 163 |
|
| AF-A0A447J483-F1-model_v4 | deleted | 0.9738 | 7 | 174 |
|
| AF-A0A1H6P1D7-F1-model_v4 | deleted | 0.9734 | 8 | 167 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar